BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26433_g1_i1 len=1043 path=[1055:0-1042]

Length=1043
                                                                      Score     E

ref|XP_004242916.1|  PREDICTED: cornifin-A-like                       78.2    3e-14   
ref|XP_009801539.1|  PREDICTED: cornifin alpha-like                   73.2    2e-12   
ref|XP_009600499.1|  PREDICTED: cornifin alpha-like                   72.4    8e-12   
ref|XP_009777124.1|  PREDICTED: periaxin-like                         70.1    2e-11   
ref|XP_006351735.1|  PREDICTED: periaxin-like                         67.4    4e-10   
ref|XP_011091999.1|  PREDICTED: periaxin-like                         67.0    2e-09   
ref|XP_009801938.1|  PREDICTED: proteoglycan 4-like                   63.2    3e-08   
ref|XP_011023049.1|  PREDICTED: periaxin-like                         62.0    3e-08   
ref|XP_009599880.1|  PREDICTED: vegetative cell wall protein gp1-...  63.5    4e-08   
ref|XP_009600494.1|  PREDICTED: cornifin-A-like                       60.8    6e-08   
ref|XP_009757596.1|  PREDICTED: vegetative cell wall protein gp1-...  63.5    6e-08   
ref|XP_006367895.1|  PREDICTED: periaxin-like                         60.5    7e-08   
ref|XP_009600495.1|  PREDICTED: proteoglycan 4-like                   60.5    8e-08   
ref|XP_009600496.1|  PREDICTED: periaxin-like                         59.7    1e-07   
ref|XP_009599879.1|  PREDICTED: proteoglycan 4-like                   62.0    2e-07   
ref|XP_011079452.1|  PREDICTED: proteoglycan 4-like                   60.8    2e-07   
ref|XP_009600498.1|  PREDICTED: cornifin-A-like                       58.9    3e-07   
ref|XP_002310490.2|  hypothetical protein POPTR_0007s03360g           58.9    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_009626200.1|  PREDICTED: proteoglycan 4-like                   58.5    4e-07   
ref|XP_009757599.1|  PREDICTED: vegetative cell wall protein gp1-...  58.5    1e-06   
gb|EYU35329.1|  hypothetical protein MIMGU_mgv1a013074mg              57.8    2e-06   
ref|XP_009600016.1|  PREDICTED: periaxin-like                         57.8    3e-06   
ref|XP_011084043.1|  PREDICTED: periaxin-like                         56.6    3e-06   
ref|XP_004240134.1|  PREDICTED: periaxin-like                         55.5    4e-06   
ref|XP_009770035.1|  PREDICTED: vegetative cell wall protein gp1-...  54.7    6e-06   
emb|CAA99755.1|  unknown                                              54.3    2e-05   Solanum lycopersicum
ref|XP_004240704.2|  PREDICTED: periaxin                              53.1    4e-05   
ref|NP_196514.1|  hydroxyproline-rich glycoprotein family protein     52.0    7e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042858.1|  Uncharacterized protein TCM_007386               50.8    1e-04   
ref|XP_010319390.1|  PREDICTED: periaxin-like                         50.8    2e-04   
ref|WP_015670448.1|  fimbrial isopeptide formation D2 domain-cont...  53.9    2e-04   
ref|WP_001178126.1|  adhesin                                          53.9    2e-04   
gb|AIE32336.1|  collagen adhesion protein                             53.9    2e-04   
ref|WP_033693066.1|  adhesin                                          53.5    2e-04   
ref|WP_003306478.1|  adhesin                                          53.5    2e-04   
ref|WP_001178106.1|  collagen adhesion protein                        53.5    2e-04   
gb|EEK90606.1|  Collagen adhesion protein                             53.5    2e-04   Bacillus cereus m1550
ref|WP_015406459.1|  hypothetical protein                             53.5    3e-04   
ref|WP_033698282.1|  adhesin                                          53.1    3e-04   
ref|XP_007160955.1|  hypothetical protein PHAVU_001G031400g           52.4    3e-04   
ref|XP_006351737.1|  PREDICTED: periaxin-like isoform X2              52.8    3e-04   
gb|AHX17294.1|  adhesin                                               53.1    3e-04   
ref|WP_024927888.1|  adhesin                                          53.1    3e-04   
ref|WP_001178122.1|  collagen adhesion protein                        53.1    3e-04   
ref|WP_001178110.1|  adhesin                                          53.1    3e-04   
ref|XP_006351736.1|  PREDICTED: periaxin-like isoform X1              52.4    4e-04   
ref|WP_001178121.1|  adhesin                                          52.8    4e-04   
gb|EEL66342.1|  Collagen adhesion protein                             52.8    4e-04   Bacillus cereus F65185
ref|WP_025966977.1|  adhesin                                          52.8    4e-04   
ref|WP_016077985.1|  fimbrial isopeptide formation D2 domain-cont...  52.4    5e-04   
ref|XP_009131114.1|  PREDICTED: periaxin-like                         51.2    5e-04   
ref|WP_038415558.1|  adhesin                                          52.0    6e-04   
ref|XP_008237138.1|  PREDICTED: pollen-specific leucine-rich repe...  49.3    7e-04   
gb|AJA18563.1|  adhesin                                               52.0    7e-04   
ref|XP_009801937.1|  PREDICTED: vegetative cell wall protein gp1-...  50.4    0.001   



>ref|XP_004242916.1| PREDICTED: cornifin-A-like [Solanum lycopersicum]
Length=122

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 77/124 (62%), Gaps = 12/124 (10%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNH-VLEVPE  563
            MAH++NP + FL+F VT   T+  +++++AR  LE T LP+LP PE+P +P    L  PE
Sbjct  1    MAHYYNPSFFFLLF-VTSFLTSDYVIRSDARHLLEIT-LPKLPKPELPHLPEIPTLPKPE  58

Query  564  FPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP---------VPQL  716
            FP   KP+LPT+P+ ELP  PKPE PT  +P +P  P+ E P + KP         +PQ+
Sbjct  59   FPEIPKPELPTLPKPELPKIPKPEFPTLPKPELPALPKLEIPVIPKPELPIFPKLDIPQV  118

Query  717  PGNP  728
            P  P
Sbjct  119  PKKP  122



>ref|XP_009801539.1| PREDICTED: cornifin alpha-like [Nicotiana sylvestris]
Length=116

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNH-VLEVPE  563
            MA+  N  + FLV LV LS T+   +Q EAR  LE T LPELP PE+P +P    LE PE
Sbjct  1    MAYRHNQSF-FLVLLVALSLTSCNTIQAEARHLLEVT-LPELPKPELPEIPTLPKLEFPE  58

Query  564  FPMPEKPQLPTVPEHELPAFPKPEGPT--------TRRPVMPFRPRPEFPALQKPV  707
             P   KP+LPT+P+ ELP FPKPE PT          +   P  P+PE P L KP 
Sbjct  59   IP---KPELPTLPQPELPEFPKPELPTLPMPELPPMPKLEFPTIPKPELPTLSKPA  111



>ref|XP_009600499.1| PREDICTED: cornifin alpha-like, partial [Nicotiana tomentosiformis]
Length=154

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 70/119 (59%), Gaps = 12/119 (10%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVL----E  554
            MA+  N  + F V LVTLS T+S ++Q EAR  LE T +PE+P PE+P +P        E
Sbjct  1    MAYRHNQSFFF-VLLVTLSLTSSYVIQAEARHLLEVT-MPEIPKPELPHLPEIPTLPKPE  58

Query  555  VPEFPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP-VPQ  713
             PE P PE     KPQ P +P+ ELP FPKPE P   +  +P  P  EFP L KP +PQ
Sbjct  59   FPEIPKPELPTLPKPQFPEIPKPELPTFPKPELPALPKLELPAIPNLEFPTLPKPEIPQ  117



>ref|XP_009777124.1| PREDICTED: periaxin-like [Nicotiana sylvestris]
Length=114

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNH-VLEVPE  563
            MA+H N  Y  L+ +VTLS T+S ++Q EAR  LE T LPELP PE+P +P    L  PE
Sbjct  1    MAYHHNS-YFILLLVVTLSLTSSYIIQAEARHLLEVT-LPELPKPELPHLPEIPTLLKPE  58

Query  564  FPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQK-PVPQLPGNP  728
            FP   KP+LPT+P+ ELP FPKPE PT  +  +P  P+PE P L K  +PQ+P NP
Sbjct  59   FPEIPKPELPTLPKLELPEFPKPELPTMPKLEIPSIPKPELPTLPKLEIPQVPHNP  114



>ref|XP_006351735.1| PREDICTED: periaxin-like [Solanum tuberosum]
Length=147

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNH-VLEVPE  563
            MA H++   L L+  + +      +    AR  LET  +PE+P PE+P+VP     E+P 
Sbjct  1    MAQHYHISSLLLLAFLNIFFIHGNISSATARHLLETP-VPEIPKPELPKVPALPKFEIPT  59

Query  564  FPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQK  701
             P PE     KP++P VP+ ELP FPKPE PT  +P +P  P+PE PA+ K
Sbjct  60   VPKPELPTIPKPEIPAVPKPELPTFPKPELPTLSKPKIPIMPKPEIPAMPK  110



>ref|XP_011091999.1| PREDICTED: periaxin-like [Sesamum indicum]
Length=254

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +3

Query  423  VFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVP  602
              L+TLS+ +    Q EAR  LE+  LPE+P PEIP      L  PE P   KP+LPT+P
Sbjct  96   TVLITLSSISGSTYQAEARHLLESA-LPEIPKPEIPLPQIPALPKPELPALPKPELPTLP  154

Query  603  EHELPAFPKPEGPTTRRPVMPFRPRPEFPALQK  701
            + ELP  PKPE P   +P +P  P+PE P L+K
Sbjct  155  KPELPTLPKPELPVVPKPELPTLPKPELPKLEK  187



>ref|XP_009801938.1| PREDICTED: proteoglycan 4-like [Nicotiana sylvestris]
Length=212

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 66/118 (56%), Gaps = 8/118 (7%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNH-VLEVPE  563
            MA H +   L  +  +TL     I     ARR LET  LPE+P PE P VP     E+P 
Sbjct  1    MAQHCHLSNLLPLAFLTLFMYGHITSGVSARRLLETP-LPEIPKPEFPEVPVLPKFEIPT  59

Query  564  FPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP-VPQLP  719
             P P+     KP++P +P+ E+P  PKPE PT  +  +P  P+PEFP +QKP +P +P
Sbjct  60   VPKPDFPTIPKPEIPAIPKPEIPTIPKPEIPTVPKLEIPAVPKPEFPTIQKPEIPAIP  117


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 8/79 (10%)
 Frame = +3

Query  501  LPELPIPEIPRVPNHVLEVPEFPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMP  665
            +P +P PEIP VP   LE+P  P PE     KP++P +P+ E+P  PKPE PT  +P +P
Sbjct  81   IPTIPKPEIPTVPK--LEIPAVPKPEFPTIQKPEIPAIPKPEIPTIPKPEVPTVPKPEIP  138

Query  666  FRPRPEFPALQKP-VPQLP  719
              P+ + P +QKP +P +P
Sbjct  139  AVPKSKLPTIQKPGIPAIP  157



>ref|XP_011023049.1| PREDICTED: periaxin-like [Populus euphratica]
Length=137

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 74/125 (59%), Gaps = 14/125 (11%)
 Frame = +3

Query  387  MAHHFNPPYLF-LVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVL-EVP  560
            MA+H  P ++  L+ ++++S   S  +  EAR+ LE T LPELP PE P +P   L ++P
Sbjct  1    MANHIFPLFISPLIVIMSMSLIISQTILVEARQLLEVT-LPELPKPEFPELPKPELPKLP  59

Query  561  EFPMPEK-----PQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP-VPQLPG  722
            EFPMPE      P+LP +P+ E P  PKPE P      +P  P+PE P  + P +P+LP 
Sbjct  60   EFPMPELPKFEIPKLPELPKPEFPELPKPELPK-----LPEFPKPELPKFEIPKLPELPS  114

Query  723  NP*FP  737
             P FP
Sbjct  115  FPHFP  119



>ref|XP_009599880.1| PREDICTED: vegetative cell wall protein gp1-like [Nicotiana tomentosiformis]
Length=263

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVL-EVPE  563
            MAHH+    L L+  V L      +    ARR LET   PE+P PE P+VP     E+P 
Sbjct  1    MAHHYQLSSLLLLLFVNLCFMNGHITCATARRLLETPH-PEIPKPEFPKVPTLPKPEIPN  59

Query  564  FPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP  704
             P PE     KP++P VP+ E+P  PKPE P   +P +P+ P+PE P L KP
Sbjct  60   MPKPELPTIPKPEIPAVPKPEIPIMPKPEVPIVPKPELPYIPKPELPTLPKP  111



>ref|XP_009600494.1| PREDICTED: cornifin-A-like [Nicotiana tomentosiformis]
Length=122

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 60/103 (58%), Gaps = 19/103 (18%)
 Frame = +3

Query  462  VQTEARRFLETTTLPELPIPEIPRVPNHVLEVPEFPMPE-------------KPQLPTVP  602
            +Q EAR  LETT  PELP PE+P +P    E+P FP PE             KPQLP +P
Sbjct  25   IQAEARHLLETT-FPELPKPELPHLP----EIPAFPKPEFPQIPKPELPTLTKPQLPELP  79

Query  603  EHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP-VPQLPGNP  728
            + +LP  PKPE PT  +  +P  P+PE P L KP +PQ+P  P
Sbjct  80   KPDLPTLPKPELPTMPKLEIPAIPKPELPTLPKPEIPQVPKKP  122



>ref|XP_009757596.1| PREDICTED: vegetative cell wall protein gp1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009757597.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Nicotiana 
sylvestris]
Length=332

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 65/112 (58%), Gaps = 7/112 (6%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN-HVLEVPE  563
            MAHH+    L L+  + L      ++   ARR LET  LPE+P PE+P+VP     E+P 
Sbjct  1    MAHHYQLSSLLLLAFLNLCFMHGPIIGATARRLLETP-LPEIPKPELPKVPTLPKPEIPT  59

Query  564  FPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP  704
             P PE     KP++PTVP+ ELP  PKPE P   +P MP  P+PE P + KP
Sbjct  60   VPKPEIPAIPKPEIPTVPKPELPTIPKPEIPAVPKPEMPAVPKPEIPIMPKP  111



>ref|XP_006367895.1| PREDICTED: periaxin-like [Solanum tuberosum]
Length=122

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 11/103 (11%)
 Frame = +3

Query  450  TSIMVQTEARRFLETTTLPELPIPEIPRVPNH----VLEVPEFPMPEKPQLPT-----VP  602
            +S ++Q EAR  LE T +PELP PE+P +P       LE PE P PE P LP      +P
Sbjct  21   SSYVIQAEARNLLEVT-IPELPKPELPHLPEIPTLPKLEFPEIPKPELPTLPKLEFPEIP  79

Query  603  EHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP-VPQLPGNP  728
            + E P FPK E PT  +  +P  P+PE P L KP +PQ+P  P
Sbjct  80   KLEFPPFPKAELPTLPKLEIPVIPKPELPTLSKPEIPQVPKKP  122



>ref|XP_009600495.1| PREDICTED: proteoglycan 4-like [Nicotiana tomentosiformis]
Length=122

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 73/127 (57%), Gaps = 18/127 (14%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVL----E  554
            MA+H NP +  L+  +    ++ I +Q EAR  LE T +PELP PE+PR+P        E
Sbjct  1    MAYHHNPSFFLLLLAILSLTSSYI-IQAEARHLLEVT-IPELPKPELPRLPEIPTLPKPE  58

Query  555  VPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP---------V  707
             PE P   K +LPTVP+ +LP FPKPE PT  +P +P  P+ E P++ KP         +
Sbjct  59   FPEIP---KSELPTVPKPKLPEFPKPELPTMPKPELPMLPKLEIPSIPKPELPTLLKPEI  115

Query  708  PQLPGNP  728
            PQ+P  P
Sbjct  116  PQVPKKP  122



>ref|XP_009600496.1| PREDICTED: periaxin-like [Nicotiana tomentosiformis]
Length=122

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (60%), Gaps = 11/99 (11%)
 Frame = +3

Query  462  VQTEARRFLETTTLPELPIPEIPRVPNHVL----EVPEFPMPE-----KPQLPTVPEHEL  614
            +Q EAR  LE T LPELP PE+P +P        + PE P PE     KP+LP +P+ EL
Sbjct  25   IQAEARHLLEVT-LPELPKPELPHLPEISAFPKPQFPEIPKPELPTLPKPELPEIPKLEL  83

Query  615  PAFPKPEGPTTRRPVMPFRPRPEFPALQKP-VPQLPGNP  728
            P  PKPE PT  +  +P  P+PE P L KP +PQ+P  P
Sbjct  84   PTMPKPELPTMPKLEIPAIPKPELPTLPKPEIPQVPHKP  122



>ref|XP_009599879.1| PREDICTED: proteoglycan 4-like [Nicotiana tomentosiformis]
Length=315

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 5/106 (5%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN-HVLEVPE  563
            MA H +  YL  +  +TL     I     ARR L+T+ LPE+P P  P VP     E+P 
Sbjct  1    MAQHCHLSYLLPLAFLTLFMYGHITSGVSARRLLDTS-LPEIPKPGFPEVPVLPKFEIPT  59

Query  564  FPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQK  701
             P   KP LPT+P+ E+PA PKPE PT  +P +P  P+PE P + K
Sbjct  60   VP---KPDLPTIPKPEIPAIPKPEIPTIPKPEVPTVPKPEIPVVPK  102



>ref|XP_011079452.1| PREDICTED: proteoglycan 4-like [Sesamum indicum]
Length=235

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 17/113 (15%)
 Frame = +3

Query  417  FLVFLVTLSATTSIMVQTEARRFLETTT-LPELPIPEIPRVPNHVLEVPEFPMPE-----  578
            F + L+TLS+      Q +AR  LE +  LP+LP P+IP +P    E+P  P PE     
Sbjct  13   FFLLLITLSS-----FQAQARHLLEASAALPDLPKPQIPALPKP--ELPTLPKPELPTLP  65

Query  579  KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKPVPQLPGNP*FP  737
            KP+LPT+P+ ELP  PKPE PT  +P +P  P+PE P L K  P+LP  P  P
Sbjct  66   KPELPTLPKPELPTLPKPELPT--KPELPTLPKPEMPTLPK--PELPTKPELP  114


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 10/81 (12%)
 Frame = +3

Query  501  LPELPIPEIPRVPNHVL------EVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVM  662
            +PELP PEIP +P  V+      E+PE P   KP+LPT+P+ E+P  PKPE PT  +P +
Sbjct  151  IPELPKPEIPELPKPVISELPKPEIPELP---KPELPTLPKPEIPELPKPELPTLPKPEI  207

Query  663  PFRPRPEFPALQKP-VPQLPG  722
            P  P+PE P L KP +P LP 
Sbjct  208  PELPKPELPTLPKPELPTLPK  228



>ref|XP_009600498.1| PREDICTED: cornifin-A-like [Nicotiana tomentosiformis]
Length=130

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 56/89 (63%), Gaps = 3/89 (3%)
 Frame = +3

Query  462  VQTEARRFLETTTLPELPIPEIPRVPNH-VLEVPEFPMPEKPQLPTVPEHELPAFPKPEG  638
            +Q EAR  LE T LPELP PE+P +P    L  PEFP   KP LPT+P+ E P  PKPE 
Sbjct  25   IQAEARHLLEVT-LPELPKPELPHLPEIPALPKPEFPEIPKPVLPTLPKPEFPEIPKPEL  83

Query  639  PTTRRPVMPFRPRPEFPALQKP-VPQLPG  722
            PT  +P +P  P+ E PA+ KP +P LP 
Sbjct  84   PTMPKPELPTMPKLEIPAIPKPELPTLPK  112



>ref|XP_002310490.2| hypothetical protein POPTR_0007s03360g, partial [Populus trichocarpa]
 gb|EEE90940.2| hypothetical protein POPTR_0007s03360g, partial [Populus trichocarpa]
Length=135

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 73/124 (59%), Gaps = 15/124 (12%)
 Frame = +3

Query  387  MAHHFNPPYLF-LVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVL-EVP  560
            MA+H  P ++  L+ ++++S   S  +  EAR+ LE T LPELP PE P +P   L ++P
Sbjct  1    MANHIFPLFISPLIVIMSMSLIISQTILVEARQLLEVT-LPELPKPEFPELPKPELPKLP  59

Query  561  EFPMPEKPQ-----LPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKPVPQLPGN  725
            EFP+PE P+     LP +P+ E P  PKPE P      +P  P+PE P  +  +P+LP  
Sbjct  60   EFPIPELPKFEIPKLPELPKPEFPELPKPEFPK-----LPEFPKPELPKFE--IPKLPEL  112

Query  726  P*FP  737
            P FP
Sbjct  113  PPFP  116



>ref|XP_009626200.1| PREDICTED: proteoglycan 4-like [Nicotiana tomentosiformis]
Length=133

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 72/121 (60%), Gaps = 17/121 (14%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN--------  542
            MA+  N  + FLV LVTLS T S ++Q EAR  LE T +PE+P PE+P +P         
Sbjct  1    MAYRHNQSF-FLVLLVTLSLTNSYVIQAEARHLLEVT-MPEIPKPELPHLPEIPTLPKPE  58

Query  543  --HVLEVPEFPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQK  701
              H+ E+P  P PE     KP+LPT+P+ ELP FPKPE PT   P +P  P+ E P + K
Sbjct  59   LPHLPEIPTLPKPEFPEIPKPELPTLPQPELPEFPKPELPTLPMPELPPIPKLELPTIPK  118

Query  702  P  704
            P
Sbjct  119  P  119



>ref|XP_009757599.1| PREDICTED: vegetative cell wall protein gp1-like [Nicotiana sylvestris]
Length=233

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN-HVLEVPE  563
            MAHH+    L L+  + L      +    ARR LET  LPE+P  E P+VP    LE+P 
Sbjct  1    MAHHYQLSSLLLLAFLNLCFIHGPITGATARRLLETP-LPEIPKLEFPKVPTLPKLEIPT  59

Query  564  FPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP  704
             P PE     KP++P VP+ E+P  PKPE PT  +P +P  P+PE P L KP
Sbjct  60   VPKPELPTIPKPEIPAVPKPEIPIMPKPEVPTVPKPELPSIPKPELPTLPKP  111



>gb|EYU35329.1| hypothetical protein MIMGU_mgv1a013074mg [Erythranthe guttata]
Length=231

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = +3

Query  501  LPELPIPEIPRVPNH-VLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPR  677
            LP LP PE+P++P    L  PE P   KP+LP++P+ ELPAFPKPE PT  +P +P  P+
Sbjct  137  LPTLPKPEVPKLPKLPALPKPELPAFPKPELPSLPKPELPAFPKPEIPTLPKPELPAIPK  196

Query  678  PEFPALQKP-VPQLPGNP*FP  737
            PE PA  KP VP+LP  P FP
Sbjct  197  PELPAFPKPEVPKLPELPKFP  217



>ref|XP_009600016.1| PREDICTED: periaxin-like [Nicotiana tomentosiformis]
Length=249

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN-HVLEVPE  563
            MA+H+    L L+  + L      +    ARR LET  LPE+P PE P+VP    LE+P 
Sbjct  1    MAYHYQLSSLLLLAFLNLCFIHGPITGATARRLLETP-LPEIPKPEFPKVPTLPKLEIPT  59

Query  564  FPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP  704
             P PE     KP++P V + E+P  PKPE PT  +P +P  P+PE P L KP
Sbjct  60   VPKPELPTIPKPEIPAVSKPEIPIMPKPEVPTLSKPELPSIPKPELPTLPKP  111



>ref|XP_011084043.1| PREDICTED: periaxin-like, partial [Sesamum indicum]
Length=162

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query  462  VQTEARRFLETTTLPELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGP  641
             Q EAR  LE+  LPE+P PEIP      L  PE P   KP+LPT+P+ ELP  PKPE P
Sbjct  17   YQAEARHLLESA-LPEIPKPEIPLPQIPALPKPELPALPKPELPTLPKPELPTLPKPELP  75

Query  642  TTRRPVMPFRPRPEFPALQK  701
               +P +P  P+PE P L+K
Sbjct  76   ALPKPELPTLPKPELPKLEK  95



>ref|XP_004240134.1| PREDICTED: periaxin-like [Solanum lycopersicum]
Length=116

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 10/94 (11%)
 Frame = +3

Query  450  TSIMVQTEARRFLETTTLPELPIPEIPRVPNH----VLEVPEFPMPE-----KPQLPTVP  602
            +S ++Q EAR FLE T +PELP PE+P +P       LE PE P PE     KP+ P +P
Sbjct  21   SSYVIQVEARNFLEVT-IPELPKPELPHLPEIPTLPKLEFPEIPKPELPTLPKPEFPEIP  79

Query  603  EHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP  704
            + E P+F K E PT  +  +P  P+ E P L KP
Sbjct  80   KPEFPSFSKVELPTLPKLEIPVIPKLELPTLSKP  113



>ref|XP_009770035.1| PREDICTED: vegetative cell wall protein gp1-like [Nicotiana sylvestris]
Length=105

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 17/101 (17%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVLEVPEF  566
            MAHH     L+L+FLV L++ +S+ VQ EARR L+   LP+LPI  +P+        PE 
Sbjct  1    MAHH----SLYLLFLVALASISSLAVQAEARRLLDAP-LPDLPI-GLPK--------PEL  46

Query  567  PMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFP  689
            P   +P LPT+P   +P  P P+ P    P +P  P+P+ P
Sbjct  47   PALPQPGLPTLPTLPMPKLPLPQLPM---PQLPTLPKPDLP  84



>emb|CAA99755.1| unknown [Solanum lycopersicum]
Length=162

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (60%), Gaps = 16/97 (16%)
 Frame = +3

Query  366  QHQSAPRMAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPI----PEIPR  533
            + QSA  MAH      L+L+FLV LS+  S ++Q EAR  L+  TLP+LPI    PE+P 
Sbjct  27   KKQSAITMAHQ----SLYLLFLVVLSSIRSHVIQVEARHLLD-ATLPDLPIGLPKPELPT  81

Query  534  VPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPT  644
            +P     +P  P+P+ P LPT+P   LP  P+P  PT
Sbjct  82   LP-----MPNLPLPQ-PGLPTLPMSNLP-LPQPGLPT  111



>ref|XP_004240704.2| PREDICTED: periaxin [Solanum lycopersicum]
Length=178

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 57/95 (60%), Gaps = 16/95 (17%)
 Frame = +3

Query  372  QSAPRMAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPI----PEIPRVP  539
            QSA  MAH      L+L+FLV LS+  S ++Q EAR  L+  TLP+LPI    PE+P +P
Sbjct  45   QSAITMAHQ----SLYLLFLVVLSSIRSHVIQVEARHLLD-ATLPDLPIGLPKPELPTLP  99

Query  540  NHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPT  644
                 +P  P+P+ P LPT+P   LP  P+P  PT
Sbjct  100  -----MPNLPLPQ-PGLPTLPMPNLP-LPQPGLPT  127



>ref|NP_196514.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 emb|CAB89378.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AED91406.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
Length=130

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 67/130 (52%), Gaps = 18/130 (14%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLE-----TTTLPELPIPEIPRVPN---  542
            +   F+   L    ++ L A  S+ V   ARR LE       T PELP PE+P++P    
Sbjct  3    LKKSFSASLLSPFLIICLIALLSVPVSVGARRLLEEPKPEIPTFPELPKPEMPKLPEFPK  62

Query  543  -HVLEVPEFPMPEKPQLPTVPEHELPAFPK----PEGPTTRRPVMPFRPRPE---FPALQ  698
              + ++PE P PE P+LP + + ELP FP+    PE P    P +P  P+PE    PA  
Sbjct  63   LELPKLPEIPKPEMPKLPEIQKPELPTFPELPKMPEFPKFDFPKLPELPKPEETKVPAFT  122

Query  699  KPVPQLPGNP  728
              +P+ PG+P
Sbjct  123  --MPKFPGSP  130



>ref|XP_007042858.1| Uncharacterized protein TCM_007386, partial [Theobroma cacao]
 gb|EOX98689.1| Uncharacterized protein TCM_007386, partial [Theobroma cacao]
Length=105

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 15/111 (14%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTT--LPELPIPEIPRVPNHVL---  551
            MA +  P ++    L+TLS  +S  +   ARRFLET+    PELP PE+P +P       
Sbjct  1    MACYRFPFFILPFLLITLSLRSSNTILVGARRFLETSVPEKPELPKPELPEIPPFPKVEL  60

Query  552  ---EVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPAL  695
               E+P+FP PE P++P +P+ ELP        T   P +P  P+PE P +
Sbjct  61   PKPELPDFPKPEIPKVPELPKPELPK-------TPELPKVPELPKPELPKV  104



>ref|XP_010319390.1| PREDICTED: periaxin-like [Solanum lycopersicum]
Length=123

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 67/122 (55%), Gaps = 18/122 (15%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELP------IPEIPRVPNHV  548
            MA+ +NP   FL+  VTL  T+  ++Q +AR  LE T L ELP      +PEIP +P   
Sbjct  1    MAYCYNPSSFFLLLFVTLFLTSDYVIQADARHLLEIT-LAELPKPESSHLPEIPTLPKSE  59

Query  549  L------EVPEFPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPAL  695
                   E+P  P PE     KP+LPT+P+ ELPA PK E P   +P +P  P+ E P +
Sbjct  60   FPVIPKPELPTLPKPELPKIPKPELPTLPKPELPALPKLEIPVIPKPELPTLPKLEIPQV  119

Query  696  QK  701
             K
Sbjct  120  PK  121



>ref|WP_015670448.1| fimbrial isopeptide formation D2 domain-containing protein [Bacillus 
cereus]
 gb|EOQ66611.1| fimbrial isopeptide formation D2 domain-containing protein [Bacillus 
cereus TIAC219]
Length=2179

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 39/81 (48%), Gaps = 9/81 (11%)
 Frame = +3

Query  501   LPELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMP  665
             +PE P PE P  P+   E P  P PEKP     + P  P+ E P  P PE P T  P  P
Sbjct  2061  VPETPDPEKPGTPDP--EKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPDPEKP  2118

Query  666   FRPRPEFPALQKPVPQLPGNP  728
               P PE P    P P+ PG P
Sbjct  2119  GTPNPEKPG--TPGPEKPGTP  2137



>ref|WP_001178126.1| adhesin [Bacillus cereus]
 ref|YP_002444526.1| collagen adhesion protein [Bacillus cereus G9842]
 gb|ACK96336.1| collagen adhesion protein [Bacillus cereus G9842]
Length=2179

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 39/81 (48%), Gaps = 9/81 (11%)
 Frame = +3

Query  501   LPELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMP  665
             +PE P PE P  P+   E P  P PEKP     + P  P+ E P  P PE P T  P  P
Sbjct  2061  VPETPDPEKPGTPDP--EKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPDPEKP  2118

Query  666   FRPRPEFPALQKPVPQLPGNP  728
               P PE P    P P+ PG P
Sbjct  2119  GTPNPEKPG--TPGPEKPGTP  2137



>gb|AIE32336.1| collagen adhesion protein [Bacillus thuringiensis serovar kurstaki 
str. HD-1]
Length=2203

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEK-----PQLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             PE P PE P  PN   E P  P PEK     P+ P  P  E P  P PE P T  P  P 
Sbjct  2062  PETPDPEKPGTPNP--EKPGTPNPEKPGTPNPEKPGTPNPEKPGTPDPEKPGTPDPEKPG  2119

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  2120  TPNPEKPG--TPDPEKPGTP  2137


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEK-----PQLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             P  P PE P  PN   E P  P PEK     P+ P  P+ E P  P PE P T  P  P 
Sbjct  2078  PGTPNPEKPGTPNP--EKPGTPNPEKPGTPDPEKPGTPDPEKPGTPNPEKPGTPDPEKPG  2135

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  2136  TPNPEKPG--TPNPEKPGTP  2153


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             P  P PE P  PN   E P  P PEKP     + P  P+ E P  P PE P T  P  P 
Sbjct  2070  PGTPNPEKPGTPNP--EKPGTPNPEKPGTPNPEKPGTPDPEKPGTPDPEKPGTPNPEKPG  2127

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  2128  TPDPEKPG--TPNPEKPGTP  2145



>ref|WP_033693066.1| adhesin [Bacillus cereus]
 gb|KFL74131.1| fimbrial isopeptide formation D2 domain protein [Bacillus cereus 
ATCC 10876]
Length=2001

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 35/75 (47%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P+ E P  P PE P T  P  P  P PE
Sbjct  1876  PETPDPEKPGTPD-----PEKPGTPDPEKPGTPDPEKPGTPNPEKPGTPNPEKPGTPNPE  1930

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1931  KPG--TPNPEKPGTP  1943



>ref|WP_003306478.1| adhesin [Bacillus thuringiensis]
 gb|EEM97589.1| Collagen adhesion protein [Bacillus thuringiensis IBL 200]
Length=2053

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 35/75 (47%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P+ E P  P PE P T  P  P  P PE
Sbjct  1944  PEKPDPEKPGTPD-----PEKPGTPDPEKPGTPDPEKPGTPNPEKPGTPNPEKPGTPNPE  1998

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1999  KPG--TPNPEKPGTP  2011



>ref|WP_001178106.1| collagen adhesion protein [Bacillus cereus]
Length=1985

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 35/75 (47%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P+ E P  P PE P T  P  P  P PE
Sbjct  1876  PETPDPEKPGTPD-----PEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPE  1930

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1931  KPG--TPDPEKPGTP  1943



>gb|EEK90606.1| Collagen adhesion protein [Bacillus cereus m1550]
Length=1960

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 35/75 (47%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P+ E P  P PE P T  P  P  P PE
Sbjct  1851  PETPDPEKPGTPD-----PEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPE  1905

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1906  KPG--TPDPEKPGTP  1918



>ref|WP_015406459.1| hypothetical protein [Bacillus thuringiensis]
 ref|YP_007477487.1| hypothetical protein H175_ch1026 [Bacillus thuringiensis serovar 
thuringiensis str. IS5056]
 gb|AGF99738.1| hypothetical protein H175_ch1026 [Bacillus thuringiensis serovar 
thuringiensis str. IS5056]
Length=2187

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 38/80 (48%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             PE P PE P  P+   E P  P PEKP     + P  P+ E P  P PE P T  P  P 
Sbjct  2062  PETPDPEKPGTPDP--EKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPDPEKPG  2119

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  2120  TPNPEKPG--TPDPEKPGTP  2137


 Score = 51.6 bits (122),  Expect = 0.001, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 33/75 (44%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             P  P PE P  PN     PE P    P+ P  P  E P  P PE P T  P  P  P PE
Sbjct  2078  PGTPDPEKPGTPN-----PEKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPDPE  2132

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  2133  KPG--TPNPEKPGTP  2145



>ref|WP_033698282.1| adhesin [Bacillus thuringiensis]
 gb|EXY08164.1| adhesin [Bacillus thuringiensis]
Length=1985

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 34/75 (45%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P  E P  P PE P T  P  P  P PE
Sbjct  1876  PETPDPEKPGTPD-----PEKPGTPDPEKPGTPNPEKPGTPNPEKPGTPNPEKPGTPNPE  1930

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1931  KPG--TPDPEKPGTP  1943



>ref|XP_007160955.1| hypothetical protein PHAVU_001G031400g [Phaseolus vulgaris]
 gb|ESW32949.1| hypothetical protein PHAVU_001G031400g [Phaseolus vulgaris]
Length=295

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 67/124 (54%), Gaps = 20/124 (16%)
 Frame = +3

Query  423  VFLVTLSATTSIMVQTEARRFLETT----TLPELPIPEIPRVPN-----HVLEVPEFPMP  575
            VFLV LSA++  MV   AR  LE+T     +P+LP PE+P++P       + +VPE P P
Sbjct  14   VFLVLLSASSHTMVLG-ARDLLESTLSKPEVPQLPKPELPKIPELLPKPELSKVPELPKP  72

Query  576  E--------KPQLPTVPEHELPAFPK-PEGPTTRRPVMPFRPRPEFPAL-QKPVPQLPGN  725
            E        KP+LP V E   P  PK PE P    P +P  P+PE P + + P P+LP  
Sbjct  73   ELSKVPELPKPELPKVSELPKPELPKVPELPKPELPKVPELPKPELPKVPELPKPELPKV  132

Query  726  P*FP  737
            P  P
Sbjct  133  PELP  136



>ref|XP_006351737.1| PREDICTED: periaxin-like isoform X2 [Solanum tuberosum]
Length=446

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (54%), Gaps = 18/123 (15%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN-HVLEVPE  563
            MA H++   L L+  + +      +    AR  LET  +PE+P PE+P+VP    LE+P 
Sbjct  1    MAQHYHISSLLLLTFLNIFFIHGNISGATARHLLETP-VPEIPKPELPKVPALPKLEIPT  59

Query  564  FPMPE-------------KPQLPTVPEH---ELPAFPKPEGPTTRRPVMPFRPRPEFPAL  695
             P P+             KPQLPT+P+    E+P  PKPE PT  +P +P  P+ EFP L
Sbjct  60   VPKPQLPTIPKPQLPTLPKPQLPTLPKPKMPEIPTMPKPELPTMPKPEIPSMPKLEFPPL  119

Query  696  QKP  704
            +KP
Sbjct  120  KKP  122



>gb|AHX17294.1| adhesin [Bacillus bombysepticus str. Wang]
Length=1993

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             PE P PE P  P+   E P  P PEKP     + P  P  E P  P PE P T  P  P 
Sbjct  1876  PETPDPEKPGTPDP--EKPGTPDPEKPGTPDPEKPGTPNPEKPGIPNPEKPGTPNPEKPG  1933

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  1934  TPDPEKPG--TPDPEKPGTP  1951



>ref|WP_024927888.1| adhesin [Bacillus thuringiensis]
Length=2171

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 34/75 (45%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P  E P  P PE P T  P  P  P PE
Sbjct  2062  PETPDPEKPGTPD-----PEKPGTPDPEKPGTPNPEKPGTPDPEXPGTPNPEKPGTPDPE  2116

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  2117  KPG--TPNPEKPGTP  2129



>ref|WP_001178122.1| collagen adhesion protein [Bacillus cereus]
Length=1892

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 34/75 (45%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P  E P  P PE P T  P  P  P PE
Sbjct  1783  PETPDPEKPGTPD-----PEKPGTPDPEKPGTPNPEKPGTPNPEKPGTPNPEKPGTPNPE  1837

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1838  KPG--TPDPEKPGTP  1850



>ref|WP_001178110.1| adhesin [Bacillus cereus]
 gb|EJR71914.1| LPXTG-domain-containing protein cell wall anchor domain [Bacillus 
cereus VD154]
Length=2179

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 38/80 (48%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             PE P PE P  P+   E P  P PEKP     + P  P+ E P  P PE P T  P  P 
Sbjct  2062  PEKPDPEKPGTPDP--EKPGTPNPEKPGTPDPEKPGTPDPEKPGTPDPEKPGTPDPEKPG  2119

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  2120  TPNPEKPG--TPDPEKPGTP  2137



>ref|XP_006351736.1| PREDICTED: periaxin-like isoform X1 [Solanum tuberosum]
Length=470

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (54%), Gaps = 18/123 (15%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN-HVLEVPE  563
            MA H++   L L+  + +      +    AR  LET  +PE+P PE+P+VP    LE+P 
Sbjct  1    MAQHYHISSLLLLTFLNIFFIHGNISGATARHLLETP-VPEIPKPELPKVPALPKLEIPT  59

Query  564  FPMPE-------------KPQLPTVPEH---ELPAFPKPEGPTTRRPVMPFRPRPEFPAL  695
             P P+             KPQLPT+P+    E+P  PKPE PT  +P +P  P+ EFP L
Sbjct  60   VPKPQLPTIPKPQLPTLPKPQLPTLPKPKMPEIPTMPKPELPTMPKPEIPSMPKLEFPPL  119

Query  696  QKP  704
            +KP
Sbjct  120  KKP  122



>ref|WP_001178121.1| adhesin [Bacillus sp. 7_6_55CFAA_CT2]
 gb|EHL71110.1| LPXTG-domain-containing protein cell wall anchor domain [Bacillus 
sp. 7_6_55CFAA_CT2]
Length=1892

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 34/75 (45%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P  E P  P PE P T  P  P  P PE
Sbjct  1783  PETPDPEKPGTPD-----PEKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPNPE  1837

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1838  KPG--TPDPEKPGTP  1850



>gb|EEL66342.1| Collagen adhesion protein [Bacillus cereus F65185]
Length=1867

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 34/75 (45%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P  E P  P PE P T  P  P  P PE
Sbjct  1758  PETPDPEKPGTPD-----PEKPGTPDPEKPGTPNPEKPGTPNPEKPGTPNPEKPGTPNPE  1812

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1813  KPG--TPDPEKPGTP  1825



>ref|WP_025966977.1| adhesin [Bacillus cereus]
Length=1900

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             PE P PE P  P+   E P  P PEKP     + P  P  E P  P PE P T  P  P 
Sbjct  1783  PETPDPEKPGTPDP--EKPGTPDPEKPGTPDPEKPGTPNPEKPGTPNPEKPGTPNPEKPG  1840

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  1841  TPNPEKPG--TPDPEKPGTP  1858



>ref|WP_016077985.1| fimbrial isopeptide formation D2 domain-containing protein [Bacillus 
cereus]
 gb|EOO06840.1| fimbrial isopeptide formation D2 domain-containing protein [Bacillus 
cereus str. Schrouff]
Length=2211

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 39/81 (48%), Gaps = 9/81 (11%)
 Frame = +3

Query  501   LPELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMP  665
             +PE P PE P  P+   E P  P PEKP     + P  P+ E P  P PE P T  P  P
Sbjct  2061  VPETPDPEKPGTPDP--EKPGTPDPEKPGTPNPEKPGTPDPEKPGTPNPEKPGTPDPEKP  2118

Query  666   FRPRPEFPALQKPVPQLPGNP  728
               P PE P    P P+ PG P
Sbjct  2119  GTPNPEKPG--TPDPEKPGTP  2137



>ref|XP_009131114.1| PREDICTED: periaxin-like [Brassica rapa]
Length=274

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 60/117 (51%), Gaps = 21/117 (18%)
 Frame = +3

Query  390  AHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETT------TLPELPIPEIPR--VPN-  542
            A   + P L +  +  L+ T S+     ARR +E         LPELP PE+P+  VP  
Sbjct  10   ALLLSSPILIICLVALLAGTVSVG----ARRLVEEAPKPEIPKLPELPHPELPKFEVPKL  65

Query  543  ------HVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPAL  695
                   + ++PEFP PE P++P VP+ ELP F  PE P    P MP  P+PE P L
Sbjct  66   PELPKPEMPKLPEFPKPELPKMPEVPKPELPKF--PEIPKPELPKMPEVPKPEMPKL  120



>ref|WP_038415558.1| adhesin [Bacillus thuringiensis]
 gb|KEH51047.1| hypothetical protein BG09_0237 [Bacillus thuringiensis serovar 
kurstaki str. HD-1]
 gb|AIM33459.1| collagen adhesion protein [Bacillus thuringiensis serovar kurstaki 
str. YBT-1520]
Length=2017

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKP-----QLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             PE P PE P  P+   E P  P PEKP     + P  P  E P  P PE P T  P  P 
Sbjct  1876  PETPDPEKPGTPDP--EKPGTPDPEKPGTPNPEKPGTPNPEKPGTPNPEKPGTPNPEKPG  1933

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  1934  TPNPEKPG--TPNPEKPGTP  1951


 Score = 51.6 bits (122),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 36/80 (45%), Gaps = 9/80 (11%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEK-----PQLPTVPEHELPAFPKPEGPTTRRPVMPF  668
             P  P PE P  PN   E P  P PEK     P+ P  P  E P  P PE P T  P  P 
Sbjct  1892  PGTPDPEKPGTPNP--EKPGTPNPEKPGTPNPEKPGTPNPEKPGTPNPEKPGTPNPEKPG  1949

Query  669   RPRPEFPALQKPVPQLPGNP  728
              P PE P    P P+ PG P
Sbjct  1950  TPNPEKPG--TPNPEKPGTP  1967



>ref|XP_008237138.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Prunus mume]
Length=150

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLV-TLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPNHVLEVPE  563
            MA H  P ++F + LV TLS+ +S  +   AR  LET + P++P    P +P        
Sbjct  1    MAFHGLPAFVFPLLLVFTLSSMSSKTMVAGARILLETNSFPQVPQLPKPELPPLPTFP--  58

Query  564  FPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKP  704
                 KPQLP +P+ ELP  PKPE P   +P +P  P+PE P L KP
Sbjct  59   --TLPKPQLPQLPKPELPQLPKPELPQLPKPELPQLPKPELPTLPKP  103



>gb|AJA18563.1| adhesin [Bacillus thuringiensis serovar galleriae]
Length=2025

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 35/75 (47%), Gaps = 7/75 (9%)
 Frame = +3

Query  504   PELPIPEIPRVPNHVLEVPEFPMPEKPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPE  683
             PE P PE P  P+     PE P    P+ P  P+ E P  P PE P T  P  P  P PE
Sbjct  1876  PETPDPEKPGTPD-----PEKPGTPDPEKPGTPDPEKPGTPDPEKPGTPDPEKPGTPNPE  1930

Query  684   FPALQKPVPQLPGNP  728
              P    P P+ PG P
Sbjct  1931  KPG--TPNPEKPGTP  1943



>ref|XP_009801937.1| PREDICTED: vegetative cell wall protein gp1-like [Nicotiana sylvestris]
Length=297

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 10/120 (8%)
 Frame = +3

Query  387  MAHHFNPPYLFLVFLVTLSATTSIMVQTEARRFLETTTLPELPIPEIPRVPN-HVLEVPE  563
            MA H++   L L+  + L      +    ARR LET  +PE+P P+ P+VP     E+P 
Sbjct  1    MAQHYHLSSLLLLAFLNLCFMNGHITCATARRLLETP-VPEIPKPDFPKVPTLPKPEIPT  59

Query  564  FPMPE-----KPQLPTVPEHELPAFPKPEGPTTRRPVMPFRPRPEFPALQKPVPQLPGNP  728
             P PE     KP++P +P+ E+PA PKPE P   +P +P  P+PE P    P P+LP  P
Sbjct  60   VPKPELPTLPKPEIPVIPKPEVPAVPKPEMPAIPKPELPTFPKPEIPV---PKPKLPAMP  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2432257590704