BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2642_g1_i1 len=562 path=[1:0-96 98:97-151 153:152-561]

Length=562
                                                                      Score     E

ref|XP_010269906.1|  PREDICTED: UMP-CMP kinase 3-like                 96.7    4e-21   
ref|XP_010274609.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      95.9    9e-21   
ref|XP_010274607.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      95.9    2e-20   
ref|XP_004229700.1|  PREDICTED: UMP-CMP kinase 3                      93.2    8e-20   
ref|XP_009604492.1|  PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAM...  92.8    1e-19   
ref|XP_009604491.1|  PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAM...  92.4    2e-19   
ref|XP_006354631.1|  PREDICTED: UMP-CMP kinase-like                   91.7    3e-19   
ref|XP_010941205.1|  PREDICTED: probable UMP/CMP kinase 4             90.9    5e-19   
ref|XP_008799350.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      90.9    5e-19   
ref|XP_002263322.1|  PREDICTED: UMP-CMP kinase 3                      90.9    5e-19   Vitis vinifera
ref|XP_009392786.1|  PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAM...  90.9    6e-19   
emb|CDP09366.1|  unnamed protein product                              91.3    9e-19   
ref|XP_011085218.1|  PREDICTED: UMP-CMP kinase 3-like                 90.1    1e-18   
ref|XP_009396195.1|  PREDICTED: probable UMP/CMP kinase 4             90.1    1e-18   
ref|XP_009396120.1|  PREDICTED: probable UMP/CMP kinase 4             89.7    1e-18   
gb|ADE75743.1|  unknown                                               89.7    2e-18   
gb|EYU40312.1|  hypothetical protein MIMGU_mgv1a013671mg              89.4    2e-18   
ref|XP_008788701.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      89.4    2e-18   
ref|XP_008788698.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      89.4    3e-18   
ref|XP_011093471.1|  PREDICTED: UMP-CMP kinase 3-like                 87.8    7e-18   
gb|EPS71902.1|  hypothetical protein M569_02858                       87.8    7e-18   
ref|XP_006838089.1|  hypothetical protein AMTR_s00106p00022430        87.8    1e-17   
ref|XP_010917203.1|  PREDICTED: probable UMP/CMP kinase 3             87.4    1e-17   
ref|XP_006648001.1|  PREDICTED: UMP-CMP kinase-like                   87.0    1e-17   
ref|XP_010934875.1|  PREDICTED: probable UMP/CMP kinase 4 isoform X3  86.3    2e-17   
ref|XP_010934874.1|  PREDICTED: probable UMP/CMP kinase 4 isoform X2  86.7    2e-17   
gb|AAF23372.1|AF187063_1  UMP/CMP kinase b                            86.7    2e-17   Oryza sativa [red rice]
ref|XP_006657980.1|  PREDICTED: UMP-CMP kinase-like                   86.7    2e-17   
ref|XP_002444829.1|  hypothetical protein SORBIDRAFT_07g028830        86.3    2e-17   Sorghum bicolor [broomcorn]
ref|NP_001060327.1|  Os07g0624700                                     86.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010934872.1|  PREDICTED: probable UMP/CMP kinase 3 isoform X1  87.0    2e-17   
ref|XP_004973766.1|  PREDICTED: UMP-CMP kinase-like isoform X2        86.3    2e-17   
gb|EEE67620.1|  hypothetical protein OsJ_25184                        86.3    3e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04763.1|  hypothetical protein OsI_26926                        86.3    4e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_004973765.1|  PREDICTED: UMP-CMP kinase-like isoform X1        85.9    4e-17   
ref|XP_004133959.1|  PREDICTED: UMP/CMP kinase-like                   85.5    4e-17   
ref|XP_003562640.1|  PREDICTED: probable UMP/CMP kinase 3             85.1    6e-17   
ref|XP_004954107.1|  PREDICTED: UMP-CMP kinase-like isoform X2        85.1    6e-17   
ref|XP_011031636.1|  PREDICTED: UMP-CMP kinase 3                      85.1    7e-17   
ref|XP_008438259.1|  PREDICTED: UMP-CMP kinase 3                      85.1    7e-17   
ref|XP_009420432.1|  PREDICTED: probable UMP/CMP kinase 3             84.7    7e-17   
dbj|BAJ89068.1|  predicted protein                                    85.1    8e-17   
ref|NP_001048295.1|  Os02g0778400                                     84.7    9e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87742.1|  hypothetical protein OsI_09157                        84.7    9e-17   Oryza sativa Indica Group [Indian rice]
gb|EYU42311.1|  hypothetical protein MIMGU_mgv1a013593mg              84.7    1e-16   
gb|EMT26904.1|  Uridylate kinase                                      84.7    1e-16   
ref|XP_010097751.1|  UMP/CMP kinase                                   84.7    1e-16   
ref|XP_004954106.1|  PREDICTED: UMP-CMP kinase-like isoform X1        84.7    1e-16   
ref|XP_009151138.1|  PREDICTED: UMP-CMP kinase 3 isoform X2           84.3    1e-16   
ref|XP_010551751.1|  PREDICTED: UMP-CMP kinase 3-like                 84.3    1e-16   
emb|CDY61106.1|  BnaA06g39400D                                        84.3    1e-16   
gb|KHG08636.1|  Adenylate kinase                                      84.3    1e-16   
emb|CDX80561.1|  BnaC07g28830D                                        84.7    1e-16   
ref|XP_010524820.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      84.0    2e-16   
ref|XP_010524822.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      84.0    2e-16   
ref|XP_009151137.1|  PREDICTED: UMP-CMP kinase 3 isoform X1           84.0    2e-16   
ref|XP_002452912.1|  hypothetical protein SORBIDRAFT_04g034900        84.0    2e-16   Sorghum bicolor [broomcorn]
ref|XP_008786655.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      83.6    2e-16   
ref|NP_001140373.1|  hypothetical protein                             82.8    2e-16   Zea mays [maize]
ref|NP_001132382.1|  uncharacterized protein LOC100193828             84.0    2e-16   Zea mays [maize]
gb|ACF81200.1|  unknown                                               84.0    2e-16   Zea mays [maize]
ref|XP_002526510.1|  uridylate kinase plant, putative                 83.6    2e-16   Ricinus communis
ref|XP_008786654.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      83.6    2e-16   
gb|EMS55098.1|  Uridylate kinase                                      83.2    2e-16   
dbj|BAG97799.1|  unnamed protein product                              82.0    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003626830.1|  Uridylate kinase                                 83.2    3e-16   
ref|NP_001148719.1|  LOC100282335                                     83.2    3e-16   Zea mays [maize]
ref|XP_006402614.1|  hypothetical protein EUTSA_v10006205mg           83.6    3e-16   
ref|XP_009129925.1|  PREDICTED: UMP-CMP kinase 3-like                 83.2    3e-16   
ref|XP_006464365.1|  PREDICTED: UMP-CMP kinase-like isoform X2        83.2    3e-16   
gb|ABK96210.1|  unknown                                               82.8    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006375091.1|  uridylate kinase family protein                  82.8    4e-16   
ref|XP_006402611.1|  hypothetical protein EUTSA_v10006205mg           83.2    4e-16   
ref|XP_006394881.1|  hypothetical protein EUTSA_v10004904mg           83.2    4e-16   
ref|XP_010421507.1|  PREDICTED: UMP-CMP kinase 3 isoform X2           82.8    4e-16   
ref|XP_010493904.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      82.8    4e-16   
emb|CDX87049.1|  BnaC09g03640D                                        82.8    4e-16   
gb|ABK95106.1|  unknown                                               81.3    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010454994.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      82.8    4e-16   
ref|XP_006394880.1|  hypothetical protein EUTSA_v10004904mg           82.8    4e-16   
ref|XP_010421506.1|  PREDICTED: UMP-CMP kinase 3 isoform X1           82.8    4e-16   
ref|XP_010493903.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      82.8    5e-16   
gb|KDO85396.1|  hypothetical protein CISIN_1g028031mg                 82.4    5e-16   
emb|CDX71833.1|  BnaC08g30410D                                        81.6    5e-16   
ref|XP_011017308.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      82.4    5e-16   
ref|XP_006837137.1|  hypothetical protein AMTR_s00110p00138960        83.2    5e-16   
ref|XP_006288651.1|  hypothetical protein CARUB_v10001957mg           82.4    5e-16   
ref|XP_006445496.1|  hypothetical protein CICLE_v10024291mg           82.8    5e-16   
ref|XP_010454993.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      82.8    5e-16   
gb|KDO85397.1|  hypothetical protein CISIN_1g028031mg                 82.0    5e-16   
gb|AFK40059.1|  unknown                                               82.4    5e-16   
gb|KDP28915.1|  hypothetical protein JCGZ_14686                       82.4    6e-16   
dbj|BAK07182.1|  predicted protein                                    82.8    6e-16   
emb|CDM82068.1|  unnamed protein product                              82.8    6e-16   
ref|XP_010693171.1|  PREDICTED: UMP-CMP kinase 3                      82.4    6e-16   
gb|EPS71050.1|  hypothetical protein M569_03715                       82.4    6e-16   
ref|XP_006288650.1|  hypothetical protein CARUB_v10001957mg           82.4    6e-16   
ref|XP_011017307.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      82.0    7e-16   
ref|NP_001236958.1|  uncharacterized protein LOC100500111             82.0    7e-16   
ref|XP_004964311.1|  PREDICTED: UMP-CMP kinase-like                   82.4    7e-16   
gb|KCW76810.1|  hypothetical protein EUGRSUZ_D011661                  82.4    8e-16   
ref|XP_002302480.1|  uridylate kinase family protein                  82.0    8e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007008734.1|  P-loop containing nucleoside triphosphate hy...  81.6    1e-15   
emb|CDY19768.1|  BnaA09g04210D                                        81.6    1e-15   
ref|XP_007218406.1|  hypothetical protein PRUPE_ppa011471mg           81.6    1e-15   
ref|XP_008232290.1|  PREDICTED: UMP-CMP kinase 3-like                 81.6    1e-15   
gb|KCW62614.1|  hypothetical protein EUGRSUZ_G00116                   80.9    1e-15   
gb|EEC80195.1|  hypothetical protein OsI_22075                        82.0    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_007008736.1|  P-loop containing nucleoside triphosphate hy...  81.3    2e-15   
ref|XP_010052741.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      80.9    2e-15   
ref|XP_010067956.1|  PREDICTED: UMP-CMP kinase 3-like                 81.3    2e-15   
emb|CDY41189.1|  BnaA09g38260D                                        80.5    2e-15   
ref|XP_009116695.1|  PREDICTED: probable UMP-CMP kinase 1             80.5    3e-15   
ref|NP_850868.1|  UMP-CMP kinase                                      80.5    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008647819.1|  PREDICTED: UMP/CMP kinase1 isoform X2            80.5    3e-15   
ref|XP_008647821.1|  PREDICTED: UMP/CMP kinase1 isoform X4            80.5    3e-15   
ref|XP_005346102.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  80.1    3e-15   
gb|KHN05394.1|  UMP/CMP kinase                                        80.1    4e-15   
ref|NP_850867.1|  UMP-CMP kinase                                      80.1    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148127.1|  UMP/CMP kinase1                                  80.1    5e-15   Zea mays [maize]
ref|NP_001237387.1|  uncharacterized protein LOC100306603             80.1    5e-15   
ref|XP_009339868.1|  PREDICTED: UMP-CMP kinase 3-like isoform X3      79.7    5e-15   
ref|XP_008647818.1|  PREDICTED: UMP/CMP kinase1 isoform X1            80.1    5e-15   
gb|AFW75238.1|  uridylate kinase                                      79.7    5e-15   
ref|XP_003557252.1|  PREDICTED: probable UMP/CMP kinase 1 isoform X2  80.1    5e-15   
ref|XP_007134358.1|  hypothetical protein PHAVU_010G040800g           79.7    5e-15   
ref|XP_010228121.1|  PREDICTED: probable UMP/CMP kinase 1 isoform X1  80.1    6e-15   
ref|XP_009339867.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      79.3    7e-15   
ref|XP_009339866.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      79.3    7e-15   
ref|XP_008347075.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      79.3    7e-15   
emb|CAB75933.1|  URIDYLATE KINASE-like protein                        79.3    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512324.1|  PREDICTED: probable UMP-CMP kinase 1             79.3    8e-15   
ref|NP_567093.1|  uridylate kinase-like protein                       79.3    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510144.1|  PREDICTED: UMP/CMP kinase-like isoform X2        79.3    8e-15   
ref|XP_008355598.1|  PREDICTED: UMP-CMP kinase 3-like                 79.3    8e-15   
ref|XP_009334520.1|  PREDICTED: UMP-CMP kinase 3-like                 79.0    8e-15   
ref|XP_002436352.1|  hypothetical protein SORBIDRAFT_10g000910        78.2    8e-15   Sorghum bicolor [broomcorn]
ref|XP_010413597.1|  PREDICTED: probable UMP-CMP kinase 1             79.0    8e-15   
ref|XP_007010022.1|  P-loop containing nucleoside triphosphate hy...  79.0    9e-15   
ref|XP_009337255.1|  PREDICTED: UMP-CMP kinase 3-like isoform X6      79.3    9e-15   
gb|KHG26621.1|  Adenylate kinase                                      79.0    1e-14   
ref|XP_002878321.1|  hypothetical protein ARALYDRAFT_486486           79.0    1e-14   
ref|XP_009337254.1|  PREDICTED: UMP-CMP kinase 3-like isoform X5      79.0    1e-14   
gb|KGN46282.1|  hypothetical protein Csa_6G079760                     79.0    1e-14   
ref|XP_010546799.1|  PREDICTED: UMP-CMP kinase 3 isoform X1           78.6    1e-14   
ref|XP_001766287.1|  predicted protein                                79.0    1e-14   
ref|XP_008347073.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      79.0    1e-14   
ref|XP_004510143.1|  PREDICTED: UMP/CMP kinase-like isoform X1        78.6    2e-14   
ref|XP_004423550.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  78.2    2e-14   
emb|CDY05528.1|  BnaA02g31630D                                        78.6    2e-14   
ref|XP_009337253.1|  PREDICTED: UMP-CMP kinase 3-like isoform X4      78.6    2e-14   
ref|XP_009337252.1|  PREDICTED: UMP-CMP kinase 3-like isoform X3      78.6    2e-14   
emb|CDY65143.1|  BnaC02g48410D                                        78.2    2e-14   
ref|XP_009337251.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      78.6    2e-14   
ref|XP_009337250.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      78.6    2e-14   
ref|XP_006635126.1|  PREDICTED: UMP-CMP kinase-like                   78.2    2e-14   
ref|XP_008460060.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      78.2    2e-14   
ref|XP_004145023.1|  PREDICTED: UMP/CMP kinase-like isoform 1         78.2    2e-14   
ref|XP_006655698.1|  PREDICTED: UMP-CMP kinase-like isoform X1        78.2    2e-14   
ref|XP_004145024.1|  PREDICTED: UMP/CMP kinase-like isoform 2         77.8    3e-14   
gb|AAD41679.1|AF086603_1  adenylate kinase                            77.0    3e-14   Ceratopteris richardii
ref|XP_005346103.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  77.4    3e-14   
ref|XP_005087597.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  77.4    3e-14   
gb|EMS48079.1|  Uridylate kinase                                      77.4    3e-14   
ref|XP_002986589.1|  hypothetical protein SELMODRAFT_235054           77.4    4e-14   
ref|XP_002965261.1|  hypothetical protein SELMODRAFT_270489           77.4    4e-14   
gb|EMT05129.1|  Uridylate kinase                                      78.6    4e-14   
ref|XP_008460054.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      77.4    4e-14   
ref|XP_010062064.1|  PREDICTED: UMP-CMP kinase isoform X3             77.0    4e-14   
ref|XP_010062046.1|  PREDICTED: UMP-CMP kinase isoform X1             77.4    4e-14   
ref|XP_010062055.1|  PREDICTED: UMP-CMP kinase isoform X2             77.4    4e-14   
gb|KCW90820.1|  hypothetical protein EUGRSUZ_A02880                   77.4    4e-14   
ref|XP_010025667.1|  PREDICTED: probable UMP/CMP kinase 4             75.5    4e-14   
ref|XP_007528918.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  77.0    4e-14   
ref|XP_009111704.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      77.0    5e-14   
ref|XP_010982602.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  77.0    5e-14   
ref|XP_009111702.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      77.0    5e-14   
ref|XP_010065264.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      76.6    5e-14   
ref|XP_005087598.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  76.6    5e-14   
ref|XP_010949465.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  76.3    5e-14   
ref|XP_004307819.1|  PREDICTED: adenylate kinase-like                 77.0    5e-14   
ref|XP_006181932.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  77.0    5e-14   
ref|XP_006205542.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  77.0    5e-14   
ref|XP_006154122.1|  PREDICTED: adenylate kinase isoenzyme 1          77.0    5e-14   
ref|XP_786761.3|  PREDICTED: UMP-CMP kinase-like isoform 3            77.0    6e-14   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006744205.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  76.6    6e-14   
ref|XP_004593598.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  76.6    6e-14   
ref|NP_001056578.1|  Os06g0109600                                     77.0    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008509573.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  76.6    7e-14   
ref|XP_010469223.1|  PREDICTED: probable UMP-CMP kinase 1 isoform X2  76.3    8e-14   
sp|P12115.2|KAD1_CYPCA  RecName: Full=Adenylate kinase isoenzyme ...  76.3    8e-14   Cyprinus carpio [carp]
ref|XP_010469222.1|  PREDICTED: probable UMP-CMP kinase 1 isoform X1  76.3    9e-14   
ref|XP_006983551.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    9e-14   
dbj|BAA97655.1|  adenylate kinase isozyme 1                           75.9    1e-13   Rattus norvegicus [brown rat]
emb|CDP05314.1|  unnamed protein product                              76.3    1e-13   
ref|XP_010611968.1|  PREDICTED: adenylate kinase isoenzyme 1          75.9    1e-13   
gb|KEP52442.1|  UMP-CMP kinase                                        76.3    1e-13   
ref|NP_001124519.1|  adenylate kinase isoenzyme 1                     76.3    1e-13   Canis lupus familiaris [dogs]
gb|KDN43280.1|  hypothetical protein RSAG8_06247                      74.3    1e-13   
ref|XP_001775972.1|  predicted protein                                76.3    1e-13   
ref|XP_004677358.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
ref|XP_004302283.1|  PREDICTED: UMP/CMP kinase-like isoform 1         75.9    1e-13   
ref|XP_005982698.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
ref|XP_004453108.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
ref|XP_005881506.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
ref|XP_006074533.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
ref|XP_002915223.1|  PREDICTED: adenylate kinase isoenzyme 1-like     75.9    1e-13   
gb|EUC59506.1|  adenylate kinase                                      75.5    1e-13   
ref|XP_006102144.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_002872215.1|  uridylate kinase                                 75.9    1e-13   
ref|NP_077325.2|  adenylate kinase isoenzyme 1                        75.5    1e-13   Rattus norvegicus [brown rat]
ref|XP_006768594.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|NP_001013600.1|  adenylate kinase isoenzyme 1                     75.5    1e-13   Bos taurus [bovine]
ref|XP_006074532.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  76.3    1e-13   
ref|XP_004453109.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_008249249.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
gb|EFB25034.1|  hypothetical protein PANDA_003186                     75.9    1e-13   Ailuropoda melanoleuca
ref|XP_003785379.1|  PREDICTED: adenylate kinase isoenzyme 1          75.5    1e-13   
ref|XP_008150818.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_006768592.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_008696948.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|NP_001185719.1|  adenylate kinase isoenzyme 1 isoform 2           75.5    1e-13   
ref|XP_003480663.2|  PREDICTED: adenylate kinase isoenzyme 1 isof...  76.3    1e-13   
ref|XP_005908510.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_003995955.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_010982603.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_007094507.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_006205543.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_008150817.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
ref|XP_009243149.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_003940642.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_001094708.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   Macaca mulatta [rhesus macaque]
ref|XP_004677357.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    1e-13   
gb|EPY83275.1|  adenylate kinase isoenzyme 1                          75.5    1e-13   
ref|XP_005625076.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_004593599.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|NP_001155354.1|  adenylate kinase isoenzyme 1                     75.5    1e-13   Ovis aries [domestic sheep]
ref|XP_006918058.1|  PREDICTED: adenylate kinase isoenzyme 1          75.5    1e-13   
ref|XP_006181933.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
gb|EDL93222.1|  adenylate kinase 1, isoform CRA_a                     75.5    1e-13   
ref|XP_007656868.1|  PREDICTED: adenylate kinase isoenzyme 1-like     73.2    1e-13   
ref|XP_004757304.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_008569083.1|  PREDICTED: adenylate kinase isoenzyme 1          75.5    1e-13   
ref|XP_005881504.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    1e-13   
ref|XP_005881505.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_006102142.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_004641596.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_007101851.1|  PREDICTED: adenylate kinase isoenzyme 1          75.5    2e-13   
ref|XP_006102143.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_008509579.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_004423551.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
gb|EDL93224.1|  adenylate kinase 1, isoform CRA_c                     75.5    2e-13   
ref|XP_004392607.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_005614850.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate ki...  75.5    2e-13   
ref|XP_006744206.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.1    2e-13   
ref|XP_003264231.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_003911960.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
gb|ADO28241.1|  adenylate kinase isoenzyme 1                          75.1    2e-13   
ref|XP_005908509.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
gb|ELK07223.1|  Adenylate kinase isoenzyme 1                          75.5    2e-13   
ref|XP_008696947.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_005382461.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_003940643.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_004641595.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_005582203.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.9    2e-13   
ref|XP_007094506.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|NP_067490.1|  adenylate kinase isoenzyme 1 isoform 1              75.1    2e-13   Mus musculus [mouse]
ref|XP_003995957.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
ref|XP_002800218.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.5    2e-13   
gb|KFO19475.1|  Adenylate kinase isoenzyme 1                          75.9    2e-13   
ref|XP_003714573.1|  uridylate kinase                                 76.3    2e-13   
ref|XP_004392606.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.1    2e-13   
gb|AAY18912.1|  adenylate kinase 1                                    75.1    2e-13   
ref|XP_008004318.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.1    2e-13   
ref|XP_003747121.1|  PREDICTED: adenylate kinase isoenzyme 1-like     75.1    2e-13   
ref|XP_005802427.1|  PREDICTED: UMP-CMP kinase-like                   75.1    2e-13   
ref|XP_005321061.1|  PREDICTED: adenylate kinase isoenzyme 1          74.7    3e-13   
ref|XP_002131814.3|  PREDICTED: UMP-CMP kinase-like isoform X2        74.7    3e-13   Ciona intestinalis [sea vase]
ref|XP_002800219.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.1    3e-13   
ref|NP_001291113.1|  cytidine monophosphate (UMP-CMP) kinase 1, c...  74.7    3e-13   
ref|XP_008431540.1|  PREDICTED: UMP-CMP kinase                        74.7    3e-13   
ref|XP_007528919.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.7    3e-13   
ref|XP_010052740.1|  PREDICTED: UMP-CMP kinase 3-like isoform X1      74.7    3e-13   
ref|XP_003122225.3|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.7    3e-13   
pdb|3ADK|A  Chain A, Refined Structure Of Porcine Cytosolic Adeny...  74.7    3e-13   
gb|KGN57281.1|  hypothetical protein Csa_3G176280                     75.1    3e-13   
ref|XP_008004316.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  75.1    3e-13   
ref|XP_004361417.1|  UMP-CMP kinase                                   74.7    3e-13   
ref|XP_007471805.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.7    3e-13   
ref|XP_001848791.1|  cytidylate kinase                                74.3    3e-13   
ref|XP_004269227.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.3    3e-13   
ref|XP_008237519.1|  PREDICTED: UMP-CMP kinase isoform X2             74.7    3e-13   
ref|XP_007568831.1|  PREDICTED: UMP-CMP kinase                        74.7    3e-13   
ref|XP_009858567.1|  PREDICTED: UMP-CMP kinase-like isoform X1        74.7    3e-13   
ref|XP_004148161.1|  PREDICTED: adenylate kinase-like                 75.1    3e-13   
ref|XP_004269226.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.7    3e-13   
ref|XP_009001564.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate ki...  74.3    3e-13   
ref|XP_004613545.1|  PREDICTED: adenylate kinase isoenzyme 1          74.3    3e-13   
gb|ELU15408.1|  hypothetical protein CAPTEDRAFT_176353                77.0    4e-13   
ref|XP_004313993.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.3    4e-13   
gb|AAX36883.1|  adenylate kinase 1                                    74.3    4e-13   
gb|AAX42747.1|  adenylate kinase 1                                    74.3    4e-13   
ref|NP_000467.1|  adenylate kinase isoenzyme 1                        74.3    4e-13   
ref|XP_004895850.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.3    4e-13   
ref|XP_005382462.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.3    4e-13   
gb|KDN49004.1|  hypothetical protein RSAG8_02357                      74.7    4e-13   
gb|AAV38367.1|  adenylate kinase 1                                    74.3    4e-13   
dbj|BAD97221.1|  adenylate kinase 1 variant                           73.9    4e-13   
ref|XP_009050469.1|  hypothetical protein LOTGIDRAFT_113888           73.9    4e-13   
gb|EFA78190.1|  UMP-CMP kinase                                        73.9    4e-13   
ref|XP_007942489.1|  PREDICTED: adenylate kinase isoenzyme 1          73.9    4e-13   
ref|XP_004048698.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  74.3    4e-13   
ref|XP_004895851.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.9    4e-13   
sp|P00569.1|KAD1_RABIT  RecName: Full=Adenylate kinase isoenzyme ...  73.9    4e-13   
ref|XP_007434505.1|  PREDICTED: adenylate kinase isoenzyme 5 isof...  73.9    4e-13   
ref|XP_002723024.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.9    4e-13   
ref|XP_004639211.1|  PREDICTED: UMP-CMP kinase isoform X1             74.3    4e-13   
gb|EAW87706.1|  adenylate kinase 1, isoform CRA_a                     74.3    4e-13   
ref|XP_007977028.1|  PREDICTED: UMP-CMP kinase                        74.3    5e-13   
ref|XP_007645920.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.9    5e-13   
ref|XP_004375758.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.9    5e-13   
gb|KDR81358.1|  hypothetical protein GALMADRAFT_239211                74.3    5e-13   
ref|XP_001183089.2|  PREDICTED: adenylate kinase-like                 73.6    5e-13   
emb|CDQ56298.1|  unnamed protein product                              73.9    5e-13   
ref|XP_006834864.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.9    5e-13   
ref|XP_007645919.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.9    5e-13   
ref|XP_004375757.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.9    6e-13   
ref|XP_008823417.1|  PREDICTED: adenylate kinase isoenzyme 1          73.6    6e-13   
gb|KHG09861.1|  Adenylate kinase                                      74.3    6e-13   
ref|XP_010585910.1|  PREDICTED: adenylate kinase isoenzyme 1          73.6    6e-13   
ref|XP_007194691.1|  PREDICTED: adenylate kinase isoenzyme 1          73.6    6e-13   
ref|XP_006892588.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.6    6e-13   
ref|XP_008237517.1|  PREDICTED: UMP-CMP kinase isoform X1             73.9    7e-13   
ref|XP_003470798.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.6    7e-13   
ref|XP_006834863.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.6    7e-13   
ref|XP_003287285.1|  hypothetical protein DICPUDRAFT_151373           73.6    7e-13   
ref|XP_006029786.1|  PREDICTED: adenylate kinase isoenzyme 5 isof...  73.6    7e-13   
gb|ENN77885.1|  hypothetical protein YQE_05563                        73.2    7e-13   
ref|XP_005789037.1|  hypothetical protein EMIHUDRAFT_429140           74.3    8e-13   
ref|XP_006269504.1|  PREDICTED: adenylate kinase isoenzyme 1          73.2    8e-13   
gb|AFN08757.1|  UMP-CMP kinase                                        73.6    8e-13   
ref|XP_005139630.1|  PREDICTED: adenylate kinase isoenzyme 1-like     71.6    8e-13   
ref|XP_009374506.1|  PREDICTED: UMP-CMP kinase isoform X1             73.6    8e-13   
gb|AEE62632.1|  unknown                                               73.6    8e-13   
ref|XP_003729267.1|  PREDICTED: UMP-CMP kinase-like isoform 2         73.6    8e-13   
gb|KCW76808.1|  hypothetical protein EUGRSUZ_D01165                   73.6    8e-13   
ref|NP_001003993.1|  adenylate kinase isoenzyme 1                     73.2    8e-13   
ref|XP_006892587.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.6    8e-13   
sp|O24464.1|KCY_PRUAR  RecName: Full=UMP-CMP kinase; AltName: Ful...  73.6    9e-13   
ref|XP_008343704.1|  PREDICTED: UMP-CMP kinase                        73.6    9e-13   
ref|XP_003035078.1|  hypothetical protein SCHCODRAFT_74381            74.3    9e-13   
gb|KFU97665.1|  Adenylate kinase isoenzyme 1                          71.6    1e-12   
dbj|BAG56775.1|  unnamed protein product                              72.8    1e-12   
ref|XP_004713347.1|  PREDICTED: adenylate kinase isoenzyme 1          73.2    1e-12   
ref|XP_007852282.1|  uridylate kinase                                 73.6    1e-12   
ref|XP_008439101.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   
sp|Q7ZWE9.2|KCY_DANRE  RecName: Full=UMP-CMP kinase; AltName: Ful...  73.2    1e-12   
ref|XP_002805512.1|  PREDICTED: UMP-CMP kinase-like isoform 2         72.8    1e-12   
ref|XP_010259049.1|  PREDICTED: UMP-CMP kinase-like isoform X4        73.2    1e-12   
ref|XP_005168739.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  73.2    1e-12   
gb|KEZ44379.1|  UMP/CMP kinase                                        74.3    1e-12   
gb|ACO11479.1|  UMP-CMP kinase                                        72.8    1e-12   
ref|XP_010259048.1|  PREDICTED: UMP-CMP kinase-like isoform X3        73.2    1e-12   
ref|XP_003437843.1|  PREDICTED: UMP-CMP kinase-like                   73.2    1e-12   
ref|XP_009370486.1|  PREDICTED: UMP-CMP kinase-like isoform X2        72.8    1e-12   
ref|XP_003729266.1|  PREDICTED: UMP-CMP kinase-like isoform 1         73.2    1e-12   
ref|XP_010735747.1|  PREDICTED: adenylate kinase isoenzyme 1          72.8    1e-12   
ref|XP_006029785.1|  PREDICTED: adenylate kinase isoenzyme 5 isof...  73.2    1e-12   
ref|NP_057392.1|  UMP-CMP kinase isoform a                            73.2    1e-12   
gb|ACO11273.1|  UMP-CMP kinase                                        72.8    1e-12   
emb|CCA70217.1|  probable URA6-uridine-monophosphate kinase           73.2    1e-12   
gb|ACM41863.1|  adenylate kinase 1-2                                  72.8    1e-12   
gb|KGQ12309.1|  Uridylate kinase                                      73.9    1e-12   
ref|XP_008594292.1|  UMP-CMP kinase                                   73.9    1e-12   
ref|XP_009034575.1|  hypothetical protein AURANDRAFT_22358            72.8    1e-12   
sp|O59845.1|KCY_LENED  RecName: Full=UMP-CMP kinase; AltName: Ful...  73.2    1e-12   
ref|XP_007200405.1|  hypothetical protein PRUPE_ppa010904mg           73.2    1e-12   
ref|XP_003965210.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.4    1e-12   
emb|CAG12406.1|  unnamed protein product                              72.8    1e-12   
ref|XP_010143484.1|  PREDICTED: adenylate kinase isoenzyme 1          71.2    1e-12   
gb|EKC37610.1|  Adenylate kinase isoenzyme 1                          72.8    1e-12   
ref|XP_005810110.1|  PREDICTED: adenylate kinase isoenzyme 1-like     72.8    1e-12   
ref|XP_003455014.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.8    1e-12   
ref|XP_008277428.1|  PREDICTED: adenylate kinase isoenzyme 1          72.8    1e-12   
ref|XP_008422613.1|  PREDICTED: adenylate kinase isoenzyme 1          72.4    1e-12   
ref|XP_006274096.1|  PREDICTED: UMP-CMP kinase                        72.4    1e-12   
ref|XP_003455015.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.8    1e-12   
gb|KFB53321.1|  AGAP003968-PA-like protein                            72.4    1e-12   
sp|Q29561.1|KCY_PIG  RecName: Full=UMP-CMP kinase; AltName: Full=...  72.4    1e-12   
ref|XP_004089843.1|  PREDICTED: UMP-CMP kinase                        72.0    1e-12   
ref|XP_002192284.2|  PREDICTED: UMP-CMP kinase                        72.4    1e-12   
ref|XP_011039197.1|  PREDICTED: UMP-CMP kinase 3-like                 72.8    1e-12   
ref|XP_009882940.1|  PREDICTED: UMP-CMP kinase                        72.4    2e-12   
ref|XP_003965209.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.4    2e-12   
ref|XP_005178088.1|  PREDICTED: UMP-CMP kinase-like                   72.8    2e-12   
ref|XP_004549631.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.4    2e-12   
ref|XP_006789051.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.4    2e-12   
gb|KFO85736.1|  Adenylate kinase isoenzyme 1                          71.2    2e-12   
ref|XP_010433662.1|  PREDICTED: probable UMP-CMP kinase 2             72.8    2e-12   
ref|XP_010302221.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
gb|AAH49446.1|  Cytidylate kinase                                     72.8    2e-12   
ref|XP_005293510.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.4    2e-12   
ref|XP_006119055.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.4    2e-12   
ref|XP_010259047.1|  PREDICTED: UMP-CMP kinase-like isoform X2        72.8    2e-12   
ref|NP_998274.2|  UMP-CMP kinase                                      72.8    2e-12   
ref|XP_010186318.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_006358592.1|  PREDICTED: UMP-CMP kinase-like isoform X1        72.4    2e-12   
ref|XP_005482293.1|  PREDICTED: UMP-CMP kinase                        72.4    2e-12   
ref|XP_004549630.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.4    2e-12   
ref|XP_005511719.1|  PREDICTED: UMP-CMP kinase                        72.4    2e-12   
ref|NP_001026735.1|  UMP-CMP kinase                                   72.4    2e-12   
ref|XP_010259046.1|  PREDICTED: UMP-CMP kinase-like isoform X1        72.8    2e-12   
ref|XP_010071156.1|  PREDICTED: adenylate kinase isoenzyme 1-like     70.9    2e-12   
ref|XP_007239674.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.4    2e-12   
pdb|1Z83|A  Chain A, Crystal Structure Of Human Ak1a In Complex W...  72.4    2e-12   
ref|XP_008640485.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.4    2e-12   
ref|XP_002112173.1|  hypothetical protein TRIADDRAFT_24660            72.4    2e-12   
ref|NP_001180547.1|  UMP-CMP kinase                                   72.4    2e-12   
ref|XP_010672010.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_006789050.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.4    2e-12   
ref|XP_009998856.1|  PREDICTED: adenylate kinase isoenzyme 1          72.4    2e-12   
gb|AAQ02450.1|  adenylate kinase 1                                    72.4    2e-12   
gb|AAH01116.1|  Adenylate kinase 1                                    72.0    2e-12   
ref|XP_003320608.1|  cytidylate kinase                                72.4    2e-12   
gb|EDK39503.2|  hypothetical protein PGUG_03601                       72.8    2e-12   
ref|XP_003757362.1|  PREDICTED: adenylate kinase isoenzyme 1          72.4    2e-12   
ref|XP_001484220.1|  hypothetical protein PGUG_03601                  72.8    2e-12   
ref|XP_008489641.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_005293508.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.4    2e-12   
ref|XP_005293509.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.4    2e-12   
ref|XP_005564009.1|  PREDICTED: UMP-CMP kinase-like isoform X1        72.4    2e-12   
gb|KDP31410.1|  hypothetical protein JCGZ_11786                       72.4    2e-12   
gb|AIC53979.1|  AK1                                                   72.0    2e-12   
gb|EPS67840.1|  adenylate kinase                                      72.4    2e-12   
ref|XP_008935388.1|  PREDICTED: adenylate kinase isoenzyme 1          71.6    2e-12   
ref|XP_009632756.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_009370485.1|  PREDICTED: UMP-CMP kinase-like isoform X1        72.4    2e-12   
ref|XP_001163827.1|  PREDICTED: UMP-CMP kinase                        72.4    2e-12   
ref|XP_006119054.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.4    2e-12   
gb|AAX43269.1|  UMP-CMP kinase                                        72.4    2e-12   
ref|XP_003816227.1|  PREDICTED: UMP-CMP kinase                        72.4    2e-12   
ref|XP_009905797.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_007475116.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.0    2e-12   
gb|AAH14961.1|  Cytidine monophosphate (UMP-CMP) kinase 1, cytosolic  72.4    2e-12   
ref|NP_001006817.1|  adenylate kinase isoenzyme 1                     72.0    2e-12   
ref|NP_001187771.1|  adenylate kinase                                 72.0    2e-12   
gb|KDQ12267.1|  hypothetical protein BOTBODRAFT_176515                72.4    2e-12   
ref|XP_003128059.3|  PREDICTED: UMP-CMP kinase isoform X1             72.4    2e-12   
ref|XP_001092713.1|  PREDICTED: UMP-CMP kinase-like isoform 1         72.4    2e-12   
ref|XP_010014788.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
gb|ERE71219.1|  endoglin                                              75.9    2e-12   
ref|NP_001039509.1|  UMP-CMP kinase                                   72.4    2e-12   
ref|XP_006051721.1|  PREDICTED: UMP-CMP kinase isoform X1             72.4    2e-12   
gb|ELW62013.1|  Adenylate kinase isoenzyme 1                          72.4    2e-12   
gb|ERE71220.1|  endoglin                                              75.9    2e-12   
ref|XP_009567730.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_005527264.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_009983654.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_005421380.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.0    2e-12   
ref|XP_010788477.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
gb|ENH87509.1|  uridylate kinase                                      73.2    2e-12   
ref|XP_005490616.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.0    2e-12   
ref|XP_004074791.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.0    2e-12   
ref|XP_005284948.1|  PREDICTED: UMP-CMP kinase                        72.4    2e-12   
gb|ERE71221.1|  endoglin                                              75.5    2e-12   
gb|ACO09564.1|  Adenylate kinase                                      72.0    2e-12   
ref|XP_005055531.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.0    2e-12   
ref|XP_010841862.1|  PREDICTED: UMP-CMP kinase-like                   71.6    2e-12   
ref|XP_010876296.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
emb|CCF42554.1|  adenylate kinase isoenzyme 1                         71.6    2e-12   
ref|XP_006119053.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.0    2e-12   
ref|XP_011076328.1|  PREDICTED: UMP-CMP kinase isoform X2             72.0    2e-12   
ref|XP_006119052.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.0    2e-12   
ref|XP_010832730.1|  PREDICTED: UMP-CMP kinase isoform X1             72.0    2e-12   
ref|XP_008640486.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  72.0    2e-12   
emb|CAA23069.1|  UMP/CMP kinase like protein                          72.0    2e-12   
gb|EMS24212.1|  UMP-CMP kinase                                        72.0    2e-12   
ref|XP_009886385.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    2e-12   
ref|XP_002053486.1|  GJ23317                                          72.0    3e-12   
ref|XP_004074790.1|  PREDICTED: adenylate kinase isoenzyme 1-like...  72.0    3e-12   
ref|XP_003259059.1|  PREDICTED: UMP-CMP kinase isoform 1              72.0    3e-12   
ref|XP_007057347.1|  PREDICTED: adenylate kinase isoenzyme 5 isof...  72.0    3e-12   
ref|XP_004001997.1|  PREDICTED: UMP-CMP kinase                        72.0    3e-12   
ref|XP_004518054.1|  PREDICTED: UMP-CMP kinase-like                   72.4    3e-12   
ref|XP_009477786.1|  PREDICTED: adenylate kinase isoenzyme 1          71.6    3e-12   
ref|XP_005231347.1|  PREDICTED: adenylate kinase isoenzyme 1          71.6    3e-12   
ref|XP_011076325.1|  PREDICTED: UMP-CMP kinase isoform X1             72.0    3e-12   
ref|XP_010355182.1|  PREDICTED: UMP-CMP kinase                        72.0    3e-12   
ref|NP_001134467.1|  Adenylate kinase                                 71.6    3e-12   
ref|XP_010206090.1|  PREDICTED: adenylate kinase isoenzyme 1          71.6    3e-12   
ref|XP_009285259.1|  PREDICTED: adenylate kinase isoenzyme 1          72.0    3e-12   
ref|XP_003767216.1|  PREDICTED: UMP-CMP kinase                        72.0    3e-12   
ref|XP_010673482.1|  PREDICTED: UMP-CMP kinase 3-like isoform X2      72.0    3e-12   
dbj|GAC75780.1|  uridylate kinase                                     73.6    3e-12   
ref|XP_004869361.1|  PREDICTED: UMP-CMP kinase isoform X1             72.0    3e-12   
ref|XP_002320896.2|  hypothetical protein POPTR_0014s10050g           72.0    3e-12   
ref|NP_001133179.1|  adenylate kinase 1-2                             71.6    3e-12   
gb|ETS64547.1|  hypothetical protein PaG_01012                        73.6    3e-12   
ref|XP_008332321.1|  PREDICTED: UMP-CMP kinase                        72.0    3e-12   
ref|XP_007475115.1|  PREDICTED: adenylate kinase isoenzyme 1 isof...  71.6    3e-12   



>ref|XP_010269906.1| PREDICTED: UMP-CMP kinase 3-like [Nelumbo nucifera]
Length=208

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            S+ K  NGSL   KKVKVVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  7    SVNKEANGSLSDEKKVKVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  61



>ref|XP_010274609.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Nelumbo nucifera]
Length=211

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             ++ K  NG+L   KKVKVVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  5    VAVDKEANGNLLDEKKVKVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_010274607.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010274608.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Nelumbo nucifera]
Length=259

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             ++ K  NG+L   KKVKVVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  5    VAVDKEANGNLLDEKKVKVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_004229700.1| PREDICTED: UMP-CMP kinase 3 [Solanum lycopersicum]
Length=209

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  SLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SLP NKKV V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  14   SLPTNKKVTVIFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_009604492.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172} 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009604493.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172} 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009760215.1| PREDICTED: UMP-CMP kinase 3 [Nicotiana sylvestris]
Length=209

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            GSLP NKKV V+FVLGGPGSGKGTQCA IVE+FGYTHLSAGDLLRAEI
Sbjct  13   GSLPTNKKVSVIFVLGGPGSGKGTQCANIVENFGYTHLSAGDLLRAEI  60



>ref|XP_009604491.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172} 
isoform X1 [Nicotiana tomentosiformis]
Length=232

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            GSLP NKKV V+FVLGGPGSGKGTQCA IVE+FGYTHLSAGDLLRAEI
Sbjct  36   GSLPTNKKVSVIFVLGGPGSGKGTQCANIVENFGYTHLSAGDLLRAEI  83



>ref|XP_006354631.1| PREDICTED: UMP-CMP kinase-like [Solanum tuberosum]
Length=209

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  SLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SLP NKKV V+FVLGGPGSGKGTQC  IVEHFGYTHLSAGDLLRAEI
Sbjct  14   SLPTNKKVTVIFVLGGPGSGKGTQCTNIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_010941205.1| PREDICTED: probable UMP/CMP kinase 4 [Elaeis guineensis]
 ref|XP_010941207.1| PREDICTED: probable UMP/CMP kinase 4 [Elaeis guineensis]
 ref|XP_010941208.1| PREDICTED: probable UMP/CMP kinase 4 [Elaeis guineensis]
 ref|XP_010941209.1| PREDICTED: probable UMP/CMP kinase 4 [Elaeis guineensis]
Length=205

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K V+GS P  KK+ VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  6    KDVDGSFPGEKKITVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAEI  57



>ref|XP_008799350.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799351.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Phoenix dactylifera]
Length=205

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K V+GS P  KK+ VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  6    KDVDGSFPGEKKITVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAEI  57



>ref|XP_002263322.1| PREDICTED: UMP-CMP kinase 3 [Vitis vinifera]
 ref|XP_003633878.1| PREDICTED: UMP-CMP kinase 3 [Vitis vinifera]
 emb|CBI38106.3| unnamed protein product [Vitis vinifera]
Length=210

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            S+ K  N +L   KKVKVVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAEI
Sbjct  7    SVIKETNENLLAEKKVKVVFVLGGPGSGKGTQCANIVKHFGYTHLSAGDLLRAEI  61



>ref|XP_009392786.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009392787.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009392788.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009392789.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009392790.1| PREDICTED: UMP-CMP kinase 3 {ECO:0000255|HAMAP-Rule:MF_03172}-like 
[Musa acuminata subsp. malaccensis]
Length=205

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG  P  KK+ VVFVLGGPGSGKGTQCAKIVE+FG+THLSAGDLLRAEI
Sbjct  6    KDVNGGFPGYKKITVVFVLGGPGSGKGTQCAKIVENFGFTHLSAGDLLRAEI  57



>emb|CDP09366.1| unnamed protein product [Coffea canephora]
Length=286

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGSL  +KKV VVFVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  77   KDANGSLLTDKKVTVVFVLGGPGSGKGTQCANIVEHYGYTHLSAGDLLRAEI  128



>ref|XP_011085218.1| PREDICTED: UMP-CMP kinase 3-like [Sesamum indicum]
 ref|XP_011085224.1| PREDICTED: UMP-CMP kinase 3-like [Sesamum indicum]
Length=210

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS   NKKV VVFVLGGPGSGKGTQC+ IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KVANGSAHTNKKVTVVFVLGGPGSGKGTQCSNIVEHFGYTHLSAGDLLRAEI  61



>ref|XP_009396195.1| PREDICTED: probable UMP/CMP kinase 4 [Musa acuminata subsp. malaccensis]
Length=205

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNGS   +KK+ VVFVLGGPGSGKGTQCAKIVE+FG+THLSAGDLLRAEI
Sbjct  6    KDVNGSFSGDKKIIVVFVLGGPGSGKGTQCAKIVENFGFTHLSAGDLLRAEI  57



>ref|XP_009396120.1| PREDICTED: probable UMP/CMP kinase 4 [Musa acuminata subsp. malaccensis]
 ref|XP_009396121.1| PREDICTED: probable UMP/CMP kinase 4 [Musa acuminata subsp. malaccensis]
 ref|XP_009396122.1| PREDICTED: probable UMP/CMP kinase 4 [Musa acuminata subsp. malaccensis]
 ref|XP_009396124.1| PREDICTED: probable UMP/CMP kinase 4 [Musa acuminata subsp. malaccensis]
Length=208

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNGS P + K+ VVFVLGGPGSGKGTQC +IVE+FG+THLSAGDLLRAEI
Sbjct  9    KDVNGSFPGDNKIIVVFVLGGPGSGKGTQCTRIVENFGFTHLSAGDLLRAEI  60



>gb|ADE75743.1| unknown [Picea sitchensis]
Length=223

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            ++K  NG +P  KK+ V+FVLGGPGSGKGTQC KIVE+FG+THLSAGDLLRAEI
Sbjct  14   LEKKDNGVMPEEKKLHVIFVLGGPGSGKGTQCEKIVENFGFTHLSAGDLLRAEI  67



>gb|EYU40312.1| hypothetical protein MIMGU_mgv1a013671mg [Erythranthe guttata]
Length=213

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G+  +   ++Q G NG    NKKV VVFVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLR
Sbjct  2    GTVVDAPKTVQVG-NGDAHTNKKVTVVFVLGGPGSGKGTQCANIVEHYGYTHLSAGDLLR  60

Query  9    AEI  1
            AEI
Sbjct  61   AEI  63



>ref|XP_008788701.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Phoenix dactylifera]
Length=208

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K ++ S P +KK+ VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  9    KDIDWSFPGDKKITVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAEI  60



>ref|XP_008788698.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Phoenix dactylifera]
 ref|XP_008788699.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Phoenix dactylifera]
 ref|XP_008788700.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Phoenix dactylifera]
Length=253

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K ++ S P +KK+ VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  9    KDIDWSFPGDKKITVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAEI  60



>ref|XP_011093471.1| PREDICTED: UMP-CMP kinase 3-like [Sesamum indicum]
 ref|XP_011093472.1| PREDICTED: UMP-CMP kinase 3-like [Sesamum indicum]
Length=210

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            K  NGS   NKKVKVVFVLGGPGSGKGTQCA IV+HFGY+HLSAGDLLRAE
Sbjct  10   KEANGSSHINKKVKVVFVLGGPGSGKGTQCANIVKHFGYSHLSAGDLLRAE  60



>gb|EPS71902.1| hypothetical protein M569_02858 [Genlisea aurea]
Length=207

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  HNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +NKK  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI
Sbjct  19   NNKKFIVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  62



>ref|XP_006838089.1| hypothetical protein AMTR_s00106p00022430 [Amborella trichopoda]
 gb|ERN00658.1| hypothetical protein AMTR_s00106p00022430 [Amborella trichopoda]
Length=259

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            NGS    KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  44   NGSQLDEKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  92



>ref|XP_010917203.1| PREDICTED: probable UMP/CMP kinase 3 [Elaeis guineensis]
 ref|XP_010917205.1| PREDICTED: probable UMP/CMP kinase 3 [Elaeis guineensis]
Length=214

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -2

Query  174  GCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
               +  K V+ +L  +KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  9    ATTNTSKDVSQNLLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  66



>ref|XP_006648001.1| PREDICTED: UMP-CMP kinase-like [Oryza brachyantha]
Length=214

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            Q+ V  ++  +KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  14   QEEVTDNMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  66



>ref|XP_010934875.1| PREDICTED: probable UMP/CMP kinase 4 isoform X3 [Elaeis guineensis]
Length=184

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  + S P +KK+ VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  9    KDNDWSFPGDKKITVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAEI  60



>ref|XP_010934874.1| PREDICTED: probable UMP/CMP kinase 4 isoform X2 [Elaeis guineensis]
Length=208

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  + S P +KK+ VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  9    KDNDWSFPGDKKITVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAEI  60



>gb|AAF23372.1|AF187063_1 UMP/CMP kinase b [Oryza sativa Japonica Group]
Length=210

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            + +GV  ++  +KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  10   VVEGVAENMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  63



>ref|XP_006657980.1| PREDICTED: UMP-CMP kinase-like [Oryza brachyantha]
Length=212

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +++GV  ++   KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  12   VEEGVAENMLGGKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  65



>ref|XP_002444829.1| hypothetical protein SORBIDRAFT_07g028830 [Sorghum bicolor]
 gb|EES14324.1| hypothetical protein SORBIDRAFT_07g028830 [Sorghum bicolor]
Length=212

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G++ +   ++ + V  ++   KKV VVFVLGGPGSGKGTQC  IVEHFG+THLSAGDLLR
Sbjct  2    GTAVDASAAVAEEVTENMLGGKKVTVVFVLGGPGSGKGTQCTNIVEHFGFTHLSAGDLLR  61

Query  9    AEI  1
            AEI
Sbjct  62   AEI  64



>ref|NP_001060327.1| Os07g0624700 [Oryza sativa Japonica Group]
 sp|Q7XI40.1|KCY3_ORYSJ RecName: Full=Probable UMP/CMP kinase 3; AltName: Full=UMP/CMP 
kinase a; AltName: Full=UMP/CMP kinase b [Oryza sativa Japonica 
Group]
 gb|AAF23371.1|AF187062_1 UMP/CMP kinase a [Oryza sativa Japonica Group]
 dbj|BAC79912.1| UMP/CMP kinase a [Oryza sativa Japonica Group]
 dbj|BAF22241.1| Os07g0624700 [Oryza sativa Japonica Group]
Length=210

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            + +GV  ++  +KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  10   VVEGVAENMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  63



>ref|XP_010934872.1| PREDICTED: probable UMP/CMP kinase 3 isoform X1 [Elaeis guineensis]
 ref|XP_010934873.1| PREDICTED: probable UMP/CMP kinase 3 isoform X1 [Elaeis guineensis]
Length=256

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  + S P +KK+ VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  9    KDNDWSFPGDKKITVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAEI  60



>ref|XP_004973766.1| PREDICTED: UMP-CMP kinase-like isoform X2 [Setaria italica]
 ref|XP_004973767.1| PREDICTED: UMP-CMP kinase-like isoform X3 [Setaria italica]
Length=211

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G+S +    + + V  ++   KKV VVFVLGGPGSGKGTQC  IVEHFG+THLSAGDLLR
Sbjct  2    GTSVDAPAVVAEEVTDNMLGGKKVTVVFVLGGPGSGKGTQCTNIVEHFGFTHLSAGDLLR  61

Query  9    AEI  1
            AEI
Sbjct  62   AEI  64



>gb|EEE67620.1| hypothetical protein OsJ_25184 [Oryza sativa Japonica Group]
Length=222

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            + +GV  ++  +KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  10   VVEGVAENMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  63



>gb|EAZ04763.1| hypothetical protein OsI_26926 [Oryza sativa Indica Group]
Length=261

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  162  IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            + +GV  ++  +KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  10   VVEGVAENMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  63



>ref|XP_004973765.1| PREDICTED: UMP-CMP kinase-like isoform X1 [Setaria italica]
Length=220

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G+S +    + + V  ++   KKV VVFVLGGPGSGKGTQC  IVEHFG+THLSAGDLLR
Sbjct  2    GTSVDAPAVVAEEVTDNMLGGKKVTVVFVLGGPGSGKGTQCTNIVEHFGFTHLSAGDLLR  61

Query  9    AEI  1
            AEI
Sbjct  62   AEI  64



>ref|XP_004133959.1| PREDICTED: UMP/CMP kinase-like [Cucumis sativus]
 ref|XP_004164808.1| PREDICTED: UMP/CMP kinase-like [Cucumis sativus]
 gb|KGN56668.1| hypothetical protein Csa_3G127790 [Cucumis sativus]
Length=209

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGSL   KK  VVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAEI
Sbjct  11   KETNGSLAE-KKPTVVFVLGGPGSGKGTQCANIVQHFGYTHLSAGDLLRAEI  61



>ref|XP_003562640.1| PREDICTED: probable UMP/CMP kinase 3 [Brachypodium distachyon]
Length=213

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            NKKV VVFVLGGPGSGKGTQC+ IVEHFG+THLSAGDLLRAEI
Sbjct  24   NKKVTVVFVLGGPGSGKGTQCSNIVEHFGFTHLSAGDLLRAEI  66



>ref|XP_004954107.1| PREDICTED: UMP-CMP kinase-like isoform X2 [Setaria italica]
Length=212

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G+  +    + + V  ++   KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLR
Sbjct  2    GTVVDAPAVVAEEVTENMLGGKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLR  61

Query  9    AEI  1
            AEI
Sbjct  62   AEI  64



>ref|XP_011031636.1| PREDICTED: UMP-CMP kinase 3 [Populus euphratica]
Length=199

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             KK  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI
Sbjct  8    EKKPTVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  50



>ref|XP_008438259.1| PREDICTED: UMP-CMP kinase 3 [Cucumis melo]
Length=209

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGSL   KK  VVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAEI
Sbjct  11   KETNGSLAE-KKPTVVFVLGGPGSGKGTQCANIVKHFGYTHLSAGDLLRAEI  61



>ref|XP_009420432.1| PREDICTED: probable UMP/CMP kinase 3 [Musa acuminata subsp. malaccensis]
Length=204

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K +    P +KK+ VVFVLGGPGSGKGTQCAKIV+HF +THLSAGDLLRAEI
Sbjct  6    KDIVDGFPGDKKIIVVFVLGGPGSGKGTQCAKIVQHFNFTHLSAGDLLRAEI  57



>dbj|BAJ89068.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  24   DKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  66



>ref|NP_001048295.1| Os02g0778400 [Oryza sativa Japonica Group]
 sp|Q6K7H2.1|KCY4_ORYSJ RecName: Full=Probable UMP/CMP kinase 4 [Oryza sativa Japonica 
Group]
 dbj|BAD19510.1| putative UMP/CMP kinase a [Oryza sativa Japonica Group]
 dbj|BAF10209.1| Os02g0778400 [Oryza sativa Japonica Group]
Length=214

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            Q+ V  ++  +KKV VVFVLGGPGSGKGTQCA IVEHFG+ HLSAGDLLRAEI
Sbjct  14   QEEVTDNMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFIHLSAGDLLRAEI  66



>gb|EAY87742.1| hypothetical protein OsI_09157 [Oryza sativa Indica Group]
Length=222

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            Q+ V  ++  +KKV VVFVLGGPGSGKGTQCA IVEHFG+ HLSAGDLLRAEI
Sbjct  14   QEEVTDNMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFIHLSAGDLLRAEI  66



>gb|EYU42311.1| hypothetical protein MIMGU_mgv1a013593mg [Erythranthe guttata]
Length=216

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            NKKV VVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAE
Sbjct  19   NKKVTVVFVLGGPGSGKGTQCANIVKHFGYTHLSAGDLLRAE  60



>gb|EMT26904.1| Uridylate kinase [Aegilops tauschii]
Length=227

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +GS P  KK+ VVFV+GGPGSGKGTQCAKIV HFG+THLSAGDLLR E+
Sbjct  5    SGSFPSGKKITVVFVIGGPGSGKGTQCAKIVSHFGFTHLSAGDLLREEV  53



>ref|XP_010097751.1| UMP/CMP kinase [Morus notabilis]
 gb|EXB70706.1| UMP/CMP kinase [Morus notabilis]
Length=234

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            S ++  NGSL   KK  VVFVLGGPG GKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  7    SAKQDANGSLAE-KKPTVVFVLGGPGCGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_004954106.1| PREDICTED: UMP-CMP kinase-like isoform X1 [Setaria italica]
Length=232

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G+  +    + + V  ++   KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLR
Sbjct  2    GTVVDAPAVVAEEVTENMLGGKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLR  61

Query  9    AEI  1
            AEI
Sbjct  62   AEI  64



>ref|XP_009151138.1| PREDICTED: UMP-CMP kinase 3 isoform X2 [Brassica rapa]
 ref|XP_009151139.1| PREDICTED: UMP-CMP kinase 3 isoform X2 [Brassica rapa]
Length=209

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KGVNG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  10   KGVNGA-ASAKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  60



>ref|XP_010551751.1| PREDICTED: UMP-CMP kinase 3-like [Tarenaya hassleriana]
 ref|XP_010551752.1| PREDICTED: UMP-CMP kinase 3-like [Tarenaya hassleriana]
 ref|XP_010551753.1| PREDICTED: UMP-CMP kinase 3-like [Tarenaya hassleriana]
Length=210

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS    KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEANGSATE-KKPSVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>emb|CDY61106.1| BnaA06g39400D [Brassica napus]
Length=233

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KGVNG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  10   KGVNGTA-SAKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  60



>gb|KHG08636.1| Adenylate kinase [Gossypium arboreum]
Length=208

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = -2

Query  174  GCCSI-QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            G  S+  K +N SL   KK +VVFVLGGPGSGKGTQCA IVEHF YTHLSAGDLLRAEI
Sbjct  2    GTVSVANKDINVSLAE-KKPRVVFVLGGPGSGKGTQCANIVEHFHYTHLSAGDLLRAEI  59



>emb|CDX80561.1| BnaC07g28830D [Brassica napus]
Length=245

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KGVNG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  10   KGVNGT-ASAKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  60



>ref|XP_010524820.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Tarenaya hassleriana]
Length=217

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS    KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEANGS-ALEKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_010524822.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Tarenaya hassleriana]
Length=209

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS    KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEANGS-ALEKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_009151137.1| PREDICTED: UMP-CMP kinase 3 isoform X1 [Brassica rapa]
Length=215

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KGVNG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  10   KGVNGA-ASAKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  60



>ref|XP_002452912.1| hypothetical protein SORBIDRAFT_04g034900 [Sorghum bicolor]
 gb|EES05888.1| hypothetical protein SORBIDRAFT_04g034900 [Sorghum bicolor]
Length=213

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  24   KKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  65



>ref|XP_008786655.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Phoenix dactylifera]
 ref|XP_008777567.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Phoenix dactylifera]
Length=183

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +K+V VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  24   DKQVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  66



>ref|NP_001140373.1| hypothetical protein [Zea mays]
 gb|ACF83693.1| unknown [Zea mays]
 gb|AFW73744.1| hypothetical protein ZEAMMB73_107575 [Zea mays]
Length=154

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G+  +    + + V  ++   KKV  VFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLR
Sbjct  2    GTVVDAPAVVAEEVTENMLGGKKVTAVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLR  61

Query  9    AEI  1
            AEI
Sbjct  62   AEI  64



>ref|NP_001132382.1| uncharacterized protein LOC100193828 [Zea mays]
 gb|ACG33587.1| UMP-CMP kinase family protein [Zea mays]
 gb|AFW64272.1| UMP-CMP kinase family protein isoform 1 [Zea mays]
 gb|AFW64273.1| UMP-CMP kinase family protein isoform 2 [Zea mays]
 gb|AFW64274.1| UMP-CMP kinase family protein isoform 3 [Zea mays]
 gb|AFW64275.1| UMP-CMP kinase family protein isoform 4 [Zea mays]
Length=212

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  23   KKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  64



>gb|ACF81200.1| unknown [Zea mays]
Length=212

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KKV VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  23   KKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  64



>ref|XP_002526510.1| uridylate kinase plant, putative [Ricinus communis]
 gb|EEF35901.1| uridylate kinase plant, putative [Ricinus communis]
Length=210

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +K  NG +   KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   RKEENGDVVE-KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  61



>ref|XP_008786654.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Phoenix dactylifera]
 ref|XP_008777566.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Phoenix dactylifera]
Length=210

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +K+V VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  24   DKQVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  66



>gb|EMS55098.1| Uridylate kinase [Triticum urartu]
Length=198

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +KKV VVFVLGGPGSGKGTQC+ IVEHFG+THLSAGDLLRAEI
Sbjct  24   DKKVTVVFVLGGPGSGKGTQCSNIVEHFGFTHLSAGDLLRAEI  66



>dbj|BAG97799.1| unnamed protein product [Oryza sativa Japonica Group]
Length=147

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            Q+ +N ++   KKVK++FVLGGPGSGKGTQC+ IVEHFG+ HLSAG+LLRAEI
Sbjct  26   QQDINENMLGGKKVKIIFVLGGPGSGKGTQCSNIVEHFGFIHLSAGELLRAEI  78



>ref|XP_003626830.1| Uridylate kinase [Medicago truncatula]
 gb|ACJ85934.1| unknown [Medicago truncatula]
 gb|AET01306.1| UMP-CMP kinase family protein [Medicago truncatula]
 gb|AFK41665.1| unknown [Medicago truncatula]
Length=208

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS+  NK   VVFVLGGPGSGKGTQCA +VEHFG+THLSAGDLLRAEI
Sbjct  10   KDTNGSV-LNKNPTVVFVLGGPGSGKGTQCANVVEHFGFTHLSAGDLLRAEI  60



>ref|NP_001148719.1| LOC100282335 [Zea mays]
 gb|ACF83239.1| unknown [Zea mays]
 gb|ACG32648.1| uridylate kinase [Zea mays]
 gb|AFW73743.1| Uridylate kinase [Zea mays]
Length=212

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  GSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            G+  +    + + V  ++   KKV  VFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLR
Sbjct  2    GTVVDAPAVVAEEVTENMLGGKKVTAVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLR  61

Query  9    AEI  1
            AEI
Sbjct  62   AEI  64



>ref|XP_006402614.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
 gb|ESQ44067.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
Length=246

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 57/95 (60%), Gaps = 8/95 (8%)
 Frame = -2

Query  285  MATFRDSVKKVSGNHIEFRPIQSQAGGGLHSKGSSFNGCCSIQKGVNGSLPHNKKVKVVF  106
            M T  D+  KVS     F P+ +     L    S F     +Q   +   P  +K  VVF
Sbjct  1    METLVDAPIKVS-----FSPV-NPISLSLQPIKSGFLPISWLQD--DHESPRWQKSTVVF  52

Query  105  VLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VLGGPGSGKGTQCA +VEHFGYTHLSAGDLLRAEI
Sbjct  53   VLGGPGSGKGTQCANVVEHFGYTHLSAGDLLRAEI  87



>ref|XP_009129925.1| PREDICTED: UMP-CMP kinase 3-like [Brassica rapa]
 ref|XP_009129926.1| PREDICTED: UMP-CMP kinase 3-like [Brassica rapa]
Length=209

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    KK  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEVNGT-SSAKKPNVIFVLGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_006464365.1| PREDICTED: UMP-CMP kinase-like isoform X2 [Citrus sinensis]
 gb|KDO85391.1| hypothetical protein CISIN_1g028031mg [Citrus sinensis]
Length=209

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  19   KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>gb|ABK96210.1| unknown [Populus trichocarpa]
Length=199

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  8    EKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  50



>ref|XP_006375091.1| uridylate kinase family protein [Populus trichocarpa]
 gb|ERP52888.1| uridylate kinase family protein [Populus trichocarpa]
Length=199

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  8    EKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  50



>ref|XP_006402611.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
 ref|XP_006402612.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
 ref|XP_006402613.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
 gb|ESQ44064.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
 gb|ESQ44065.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
 gb|ESQ44066.1| hypothetical protein EUTSA_v10006205mg [Eutrema salsugineum]
Length=219

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  +K  VVFVLGGPGSGKGTQCA +VEHFGYTHLSAGDLLRAEI
Sbjct  16   PRWQKSTVVFVLGGPGSGKGTQCANVVEHFGYTHLSAGDLLRAEI  60



>ref|XP_006394881.1| hypothetical protein EUTSA_v10004904mg [Eutrema salsugineum]
 ref|XP_006394882.1| hypothetical protein EUTSA_v10004904mg [Eutrema salsugineum]
 gb|ESQ32167.1| hypothetical protein EUTSA_v10004904mg [Eutrema salsugineum]
 gb|ESQ32168.1| hypothetical protein EUTSA_v10004904mg [Eutrema salsugineum]
Length=209

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    KK  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEVNGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_010421507.1| PREDICTED: UMP-CMP kinase 3 isoform X2 [Camelina sativa]
Length=205

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI  G NG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  3    SIVDGANGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  56



>ref|XP_010493904.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Camelina sativa]
Length=205

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI  G NG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  3    SIVDGANGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  56



>emb|CDX87049.1| BnaC09g03640D [Brassica napus]
Length=209

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    K+  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEVNGT-ASEKRPAVIFVLGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  60



>gb|ABK95106.1| unknown [Populus trichocarpa]
Length=120

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  V+FVLGGPGSGKGTQCA +VEHFGYTHLSAGDLLRAEI
Sbjct  9    KKPAVIFVLGGPGSGKGTQCANVVEHFGYTHLSAGDLLRAEI  50



>ref|XP_010454994.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Camelina sativa]
 ref|XP_010454997.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Camelina sativa]
Length=205

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI  G NG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  3    SIVNGANGT-ATGKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  56



>ref|XP_006394880.1| hypothetical protein EUTSA_v10004904mg [Eutrema salsugineum]
 gb|ESQ32166.1| hypothetical protein EUTSA_v10004904mg [Eutrema salsugineum]
Length=215

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    KK  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEVNGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_010421506.1| PREDICTED: UMP-CMP kinase 3 isoform X1 [Camelina sativa]
Length=211

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI  G NG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  3    SIVDGANGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  56



>ref|XP_010493903.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Camelina sativa]
Length=211

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI  G NG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  3    SIVDGANGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  56



>gb|KDO85396.1| hypothetical protein CISIN_1g028031mg [Citrus sinensis]
Length=196

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  19   KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>emb|CDX71833.1| BnaC08g30410D [Brassica napus]
Length=144

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQCA IV+HF YTHLSAGDLLRAEI
Sbjct  17   PRWKKPTVVFVLGGPGSGKGTQCANIVQHFSYTHLSAGDLLRAEI  61



>ref|XP_011017308.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Populus euphratica]
Length=199

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  9    KKPAVIFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  50



>ref|XP_006837137.1| hypothetical protein AMTR_s00110p00138960 [Amborella trichopoda]
 gb|ERM99990.1| hypothetical protein AMTR_s00110p00138960 [Amborella trichopoda]
Length=260

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            NGS    KKV VV VLGGPGSGKGTQCA IVEHFG+THLSAGDLLRA+I
Sbjct  46   NGSQISEKKVTVVLVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAKI  94



>ref|XP_006288651.1| hypothetical protein CARUB_v10001957mg [Capsella rubella]
 gb|EOA21549.1| hypothetical protein CARUB_v10001957mg [Capsella rubella]
Length=205

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI    NG+    KK  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  3    SIVDAANGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  56



>ref|XP_006445496.1| hypothetical protein CICLE_v10024291mg [Citrus clementina]
 ref|XP_006464364.1| PREDICTED: UMP-CMP kinase-like isoform X1 [Citrus sinensis]
 gb|ESR58736.1| hypothetical protein CICLE_v10024291mg [Citrus clementina]
 gb|KDO85392.1| hypothetical protein CISIN_1g028031mg [Citrus sinensis]
 gb|KDO85393.1| hypothetical protein CISIN_1g028031mg [Citrus sinensis]
 gb|KDO85394.1| hypothetical protein CISIN_1g028031mg [Citrus sinensis]
 gb|KDO85395.1| hypothetical protein CISIN_1g028031mg [Citrus sinensis]
Length=215

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  19   KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>ref|XP_010454993.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Camelina sativa]
 ref|XP_010454995.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Camelina sativa]
 ref|XP_010454996.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Camelina sativa]
Length=211

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI  G NG+    KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  3    SIVNGANGT-ATGKKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  56



>gb|KDO85397.1| hypothetical protein CISIN_1g028031mg [Citrus sinensis]
Length=182

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  VVFVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  19   KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  60



>gb|AFK40059.1| unknown [Lotus japonicus]
Length=211

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            NGS+  NK + VVFVLGGPGSGKGTQC+ IV+HFGYTHLSAGDLLRAEI
Sbjct  16   NGSI-LNKNLTVVFVLGGPGSGKGTQCSNIVKHFGYTHLSAGDLLRAEI  63



>gb|KDP28915.1| hypothetical protein JCGZ_14686 [Jatropha curcas]
Length=209

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NG++   KK  VVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAEI
Sbjct  10   KEQNGNVTE-KKPTVVFVLGGPGSGKGTQCANIVQHFGYTHLSAGDLLRAEI  60



>dbj|BAK07182.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -2

Query  171  CCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
               + K   GS P  KK+ VVFV+GGPGSGKGTQCAKIV  FG+THLSAGDLLR E+
Sbjct  4    VVEVHKDWIGSFPSGKKITVVFVIGGPGSGKGTQCAKIVSQFGFTHLSAGDLLREEV  60



>emb|CDM82068.1| unnamed protein product [Triticum aestivum]
Length=241

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -2

Query  171  CCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
               + K   GS P  KK+ VVFV+GGPGSGKGTQCAKIV  FG+THLSAGDLLR E+
Sbjct  4    VVQVHKDWVGSFPSGKKITVVFVIGGPGSGKGTQCAKIVSQFGFTHLSAGDLLREEV  60



>ref|XP_010693171.1| PREDICTED: UMP-CMP kinase 3 [Beta vulgaris subsp. vulgaris]
Length=205

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  HNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
              KK+ V+FVLGGPGSGKGTQCA IVE+FGYTHLSAGDLLRAEI
Sbjct  14   EKKKITVIFVLGGPGSGKGTQCANIVENFGYTHLSAGDLLRAEI  57



>gb|EPS71050.1| hypothetical protein M569_03715, partial [Genlisea aurea]
Length=209

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  26   KKFTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  67



>ref|XP_006288650.1| hypothetical protein CARUB_v10001957mg [Capsella rubella]
 gb|EOA21548.1| hypothetical protein CARUB_v10001957mg [Capsella rubella]
Length=211

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            SI    NG+    KK  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  3    SIVDAANGT-ASGKKPTVIFVLGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  56



>ref|XP_011017307.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Populus euphratica]
Length=205

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             KK  V+FVLGGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  8    EKKPAVIFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI  50



>ref|NP_001236958.1| uncharacterized protein LOC100500111 [Glycine max]
 gb|ACU14987.1| unknown [Glycine max]
Length=207

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGSL   K   VVFVLGGPGSGKGTQCA IVE+FGYTHLSAGDLLRAEI
Sbjct  9    KDANGSLLE-KNPTVVFVLGGPGSGKGTQCANIVENFGYTHLSAGDLLRAEI  59



>ref|XP_004964311.1| PREDICTED: UMP-CMP kinase-like [Setaria italica]
Length=236

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            GS P  KK+ VVFV+GGPGSGKGTQC+KIV+HFG+THLSAGDLLR E
Sbjct  10   GSFPPGKKITVVFVIGGPGSGKGTQCSKIVKHFGFTHLSAGDLLREE  56



>gb|KCW76810.1| hypothetical protein EUGRSUZ_D011661, partial [Eucalyptus grandis]
Length=233

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -2

Query  183  SFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            S+     +Q    GSL   KK  VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAE
Sbjct  28   SWEVLLMLQLRQEGSLTE-KKPTVVFVLGGPGSGKGTQCADIVQHFGFTHLSAGDLLRAE  86

Query  3    I  1
            I
Sbjct  87   I  87



>ref|XP_002302480.1| uridylate kinase family protein [Populus trichocarpa]
 gb|ABK95915.1| unknown [Populus trichocarpa]
 gb|EEE81753.1| uridylate kinase family protein [Populus trichocarpa]
Length=199

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  V+FVLGGPGSGKGTQCA +VEHFGYTHLSAGDLLRAEI
Sbjct  9    KKPAVIFVLGGPGSGKGTQCANVVEHFGYTHLSAGDLLRAEI  50



>ref|XP_007008734.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007008735.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY17544.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY17545.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=208

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VN SL   K + VVFVLGGPGSGKGTQCA IV+HF YTHLSAGDLLRAEI
Sbjct  9    KDVNVSLTDEKPI-VVFVLGGPGSGKGTQCANIVQHFLYTHLSAGDLLRAEI  59



>emb|CDY19768.1| BnaA09g04210D [Brassica napus]
Length=209

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    K+  V+FVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAEI
Sbjct  10   KEVNGT-ASEKRPAVIFVLGGPGSGKGTQCAYIVDHFGYTHLSAGDLLRAEI  60



>ref|XP_007218406.1| hypothetical protein PRUPE_ppa011471mg [Prunus persica]
 gb|EMJ19605.1| hypothetical protein PRUPE_ppa011471mg [Prunus persica]
Length=209

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             + +K  NGSL  +    VVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAEI
Sbjct  7    AAAKKEANGSL-ADLNPTVVFVLGGPGSGKGTQCANIVQHFGYTHLSAGDLLRAEI  61



>ref|XP_008232290.1| PREDICTED: UMP-CMP kinase 3-like [Prunus mume]
Length=209

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             + +K  NGSL  +    VVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAEI
Sbjct  7    AAAKKEANGSL-ADLNPTVVFVLGGPGSGKGTQCANIVQHFGYTHLSAGDLLRAEI  61



>gb|KCW62614.1| hypothetical protein EUGRSUZ_G00116 [Eucalyptus grandis]
Length=191

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            GSL   KK  VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  10   GSLTE-KKPTVVFVLGGPGSGKGTQCANIVQHFGFTHLSAGDLLRAEI  56



>gb|EEC80195.1| hypothetical protein OsI_22075 [Oryza sativa Indica Group]
 gb|EEE65277.1| hypothetical protein OsJ_20500 [Oryza sativa Japonica Group]
Length=318

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            Q+ +N ++   KKVK++FVLGGPGSGKGTQC+ IVEHFG+ HLSAG+LLRAEI
Sbjct  26   QQDINENMLGGKKVKIIFVLGGPGSGKGTQCSNIVEHFGFIHLSAGELLRAEI  78



>ref|XP_007008736.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3 [Theobroma cacao]
 gb|EOY17546.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3 [Theobroma cacao]
Length=216

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VN SL   K + VVFVLGGPGSGKGTQCA IV+HF YTHLSAGDLLRAEI
Sbjct  9    KDVNVSLTDEKPI-VVFVLGGPGSGKGTQCANIVQHFLYTHLSAGDLLRAEI  59



>ref|XP_010052741.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Eucalyptus grandis]
Length=207

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            GSL   KK  VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  12   GSLTE-KKPTVVFVLGGPGSGKGTQCADIVQHFGFTHLSAGDLLRAEI  58



>ref|XP_010067956.1| PREDICTED: UMP-CMP kinase 3-like [Eucalyptus grandis]
Length=220

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            GSL   KK  VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  12   GSLTE-KKPTVVFVLGGPGSGKGTQCANIVQHFGFTHLSAGDLLRAEI  58



>emb|CDY41189.1| BnaA09g38260D [Brassica napus]
Length=205

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  +VFVLGGPGSGKGTQCA +V+HF YTHLSAGDLLRAEI
Sbjct  17   PRWKKSTIVFVLGGPGSGKGTQCANVVQHFSYTHLSAGDLLRAEI  61



>ref|XP_009116695.1| PREDICTED: probable UMP-CMP kinase 1 [Brassica rapa]
Length=205

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  +VFVLGGPGSGKGTQCA +V+HF YTHLSAGDLLRAEI
Sbjct  17   PRWKKPTIVFVLGGPGSGKGTQCANVVQHFSYTHLSAGDLLRAEI  61



>ref|NP_850868.1| UMP-CMP kinase [Arabidopsis thaliana]
 ref|NP_001031942.1| UMP-CMP kinase [Arabidopsis thaliana]
 sp|O04905.1|KCY3_ARATH RecName: Full=UMP-CMP kinase 3; AltName: Full=Deoxycytidylate 
kinase; Short=CK; Short=dCMP kinase; AltName: Full=Uridine 
monophosphate/cytidine monophosphate kinase; Short=UMP/CMP kinase; 
Short=UMP/CMPK [Arabidopsis thaliana]
 gb|AAB71135.1| UMP/CMP kinase [Arabidopsis thaliana]
 gb|AED93559.1| Uridylate kinase [Arabidopsis thaliana]
 gb|AED93560.1| Uridylate kinase [Arabidopsis thaliana]
Length=202

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  12   KKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  53



>ref|XP_008647819.1| PREDICTED: UMP/CMP kinase1 isoform X2 [Zea mays]
Length=220

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            G+ P  KK+ VVFV+GGPGSGKGTQC+KIV HFG+THLSAGDLLR ++
Sbjct  6    GAFPPGKKITVVFVIGGPGSGKGTQCSKIVRHFGFTHLSAGDLLRQQV  53



>ref|XP_008647821.1| PREDICTED: UMP/CMP kinase1 isoform X4 [Zea mays]
Length=216

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            G+ P  KK+ VVFV+GGPGSGKGTQC+KIV HFG+THLSAGDLLR ++
Sbjct  5    GAFPPGKKITVVFVIGGPGSGKGTQCSKIVRHFGFTHLSAGDLLRQQV  52



>ref|XP_005346102.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Microtus 
ochrogaster]
Length=210

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSI----QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
            GCCS     ++G   +    KK K++FV+GGPGSGKGTQC KIVE +GYTHLS GDLLRA
Sbjct  2    GCCSSSEPQEEGDRKAREKLKKAKIIFVVGGPGSGKGTQCEKIVEKYGYTHLSTGDLLRA  61

Query  6    EI  1
            E+
Sbjct  62   EV  63



>gb|KHN05394.1| UMP/CMP kinase [Glycine soja]
Length=207

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGSL   K   VVFVLGGPGSGKGTQCA IV++FGYTHLSAGDLLRAEI
Sbjct  9    KDANGSLLE-KNPTVVFVLGGPGSGKGTQCANIVKNFGYTHLSAGDLLRAEI  59



>ref|NP_850867.1| UMP-CMP kinase [Arabidopsis thaliana]
 gb|ABK59674.1| At5g26667 [Arabidopsis thaliana]
 gb|AED93558.1| Uridylate kinase [Arabidopsis thaliana]
Length=208

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  V+FVLGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEI
Sbjct  12   KKPTVIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEI  53



>ref|NP_001148127.1| UMP/CMP kinase1 [Zea mays]
 gb|ACG29827.1| uridylate kinase [Zea mays]
Length=221

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            G+ P  KK+ VVFV+GGPGSGKGTQC+KIV HFG+THLSAGDLLR ++
Sbjct  5    GAFPPGKKITVVFVIGGPGSGKGTQCSKIVRHFGFTHLSAGDLLRQQV  52



>ref|NP_001237387.1| uncharacterized protein LOC100306603 [Glycine max]
 gb|ACU14865.1| unknown [Glycine max]
Length=237

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGSL   K   VVFVLGGPGSGKGTQCA IV++FGYTHLSAGDLLRAEI
Sbjct  9    KDANGSLLE-KNPSVVFVLGGPGSGKGTQCANIVQNFGYTHLSAGDLLRAEI  59



>ref|XP_009339868.1| PREDICTED: UMP-CMP kinase 3-like isoform X3 [Pyrus x bretschneideri]
Length=212

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  177  NGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +G    Q+  +GSL  +    VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  7    DGKKEAQQEAHGSLA-DLNPTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  64



>ref|XP_008647818.1| PREDICTED: UMP/CMP kinase1 isoform X1 [Zea mays]
Length=223

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            G+ P  KK+ VVFV+GGPGSGKGTQC+KIV HFG+THLSAGDLLR ++
Sbjct  6    GAFPPGKKITVVFVIGGPGSGKGTQCSKIVRHFGFTHLSAGDLLRQQV  53



>gb|AFW75238.1| uridylate kinase [Zea mays]
Length=222

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            G+ P  KK+ VVFV+GGPGSGKGTQC+KIV HFG+THLSAGDLLR ++
Sbjct  5    GAFPPGKKITVVFVIGGPGSGKGTQCSKIVRHFGFTHLSAGDLLRQQV  52



>ref|XP_003557252.1| PREDICTED: probable UMP/CMP kinase 1 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010228123.1| PREDICTED: probable UMP/CMP kinase 1 isoform X2 [Brachypodium 
distachyon]
Length=237

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K   GS P  KK+ VVFV+GGPGSGKGTQCAKIV  FG+THLSAG+LLR E+
Sbjct  6    KDYVGSFPPGKKITVVFVIGGPGSGKGTQCAKIVNQFGFTHLSAGELLREEV  57



>ref|XP_007134358.1| hypothetical protein PHAVU_010G040800g [Phaseolus vulgaris]
 gb|ESW06352.1| hypothetical protein PHAVU_010G040800g [Phaseolus vulgaris]
Length=207

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -2

Query  165  SIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            S +K  NG L   K   VVFVLGGPGSGKGTQCA IVE+FG+THLSAGDLLRAEI
Sbjct  6    SAKKDANGGLLE-KNPTVVFVLGGPGSGKGTQCANIVENFGFTHLSAGDLLRAEI  59



>ref|XP_010228121.1| PREDICTED: probable UMP/CMP kinase 1 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010228122.1| PREDICTED: probable UMP/CMP kinase 1 isoform X1 [Brachypodium 
distachyon]
Length=238

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            GS P  KK+ VVFV+GGPGSGKGTQCAKIV  FG+THLSAG+LLR E+
Sbjct  11   GSFPPGKKITVVFVIGGPGSGKGTQCAKIVNQFGFTHLSAGELLREEV  58



>ref|XP_009339867.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Pyrus x bretschneideri]
Length=220

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            Q+  +GSL  +    VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  21   QQEAHGSLA-DLNPTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  72



>ref|XP_009339866.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Pyrus x bretschneideri]
Length=224

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  39   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  76



>ref|XP_008347075.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Malus domestica]
Length=212

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  27   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  64



>emb|CAB75933.1| URIDYLATE KINASE-like protein [Arabidopsis thaliana]
Length=210

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQCA +V+HF YTH SAGDLLRAEI
Sbjct  22   PRWKKSTVVFVLGGPGSGKGTQCANVVKHFSYTHFSAGDLLRAEI  66



>ref|XP_010512324.1| PREDICTED: probable UMP-CMP kinase 1 [Camelina sativa]
Length=204

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQCA +V+HF YTH SAGDLLRAEI
Sbjct  16   PRWKKSTVVFVLGGPGSGKGTQCANVVKHFSYTHFSAGDLLRAEI  60



>ref|NP_567093.1| uridylate kinase-like protein [Arabidopsis thaliana]
 ref|NP_850726.1| uridylate kinase-like protein [Arabidopsis thaliana]
 sp|Q8VY84.1|KCY1_ARATH RecName: Full=Probable UMP-CMP kinase 1; AltName: Full=Deoxycytidylate 
kinase; Short=CK; Short=dCMP kinase; AltName: Full=Uridine 
monophosphate/cytidine monophosphate kinase; Short=UMP/CMP 
kinase; Short=UMP/CMPK [Arabidopsis thaliana]
 gb|AAL62350.1| uridylate kinase-like protein [Arabidopsis thaliana]
 gb|AAM48046.1| uridylate kinase-like protein [Arabidopsis thaliana]
 gb|AEE80020.1| uridylate kinase-like protein [Arabidopsis thaliana]
 gb|AEE80021.1| uridylate kinase-like protein [Arabidopsis thaliana]
Length=204

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQCA +V+HF YTH SAGDLLRAEI
Sbjct  16   PRWKKSTVVFVLGGPGSGKGTQCANVVKHFSYTHFSAGDLLRAEI  60



>ref|XP_004510144.1| PREDICTED: UMP/CMP kinase-like isoform X2 [Cicer arietinum]
Length=208

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS   N    VVFVLGGPGSGKGTQCA +V++FGYTHLSAGDLLRAEI
Sbjct  10   KDTNGSF-LNTNPTVVFVLGGPGSGKGTQCANVVQNFGYTHLSAGDLLRAEI  60



>ref|XP_008355598.1| PREDICTED: UMP-CMP kinase 3-like, partial [Malus domestica]
Length=225

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +K  NGSL  +    VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  9    KKEANGSLA-DLNPTVVFVLGGPGSGKGTQCANIVQHFGFTHLSAGDLLRAEI  60



>ref|XP_009334520.1| PREDICTED: UMP-CMP kinase 3-like [Pyrus x bretschneideri]
 ref|XP_009334521.1| PREDICTED: UMP-CMP kinase 3-like [Pyrus x bretschneideri]
 ref|XP_009334543.1| PREDICTED: UMP-CMP kinase 3-like [Pyrus x bretschneideri]
 ref|XP_009334545.1| PREDICTED: UMP-CMP kinase 3-like [Pyrus x bretschneideri]
Length=208

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -2

Query  159  QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +K  NGSL  +    VVFVLGGPGSGKGTQCA IV HFG+THLSAGDLLRAEI
Sbjct  9    KKEANGSLA-DLNPTVVFVLGGPGSGKGTQCANIVRHFGFTHLSAGDLLRAEI  60



>ref|XP_002436352.1| hypothetical protein SORBIDRAFT_10g000910 [Sorghum bicolor]
 gb|EER87719.1| hypothetical protein SORBIDRAFT_10g000910 [Sorghum bicolor]
Length=155

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  144  GSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            GS P  KK+ VVFVLGGPGSGKGTQC+ IV+ FG+THLSAGDLLR E
Sbjct  10   GSFPPGKKITVVFVLGGPGSGKGTQCSNIVKQFGFTHLSAGDLLREE  56



>ref|XP_010413597.1| PREDICTED: probable UMP-CMP kinase 1 [Camelina sativa]
Length=202

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQCA +V+HF YTH SAGDLLRAEI
Sbjct  16   PRWKKSTVVFVLGGPGSGKGTQCANVVKHFSYTHFSAGDLLRAEI  60



>ref|XP_007010022.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY18832.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=209

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            K V   L   K + VVFVLGGPGSGKGTQCA IV+HFGYTHLSAGDLLRAE
Sbjct  9    KDVTVRLAERKPI-VVFVLGGPGSGKGTQCANIVQHFGYTHLSAGDLLRAE  58



>ref|XP_009337255.1| PREDICTED: UMP-CMP kinase 3-like isoform X6 [Pyrus x bretschneideri]
 ref|XP_009337256.1| PREDICTED: UMP-CMP kinase 3-like isoform X6 [Pyrus x bretschneideri]
Length=228

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  43   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  80



>gb|KHG26621.1| Adenylate kinase [Gossypium arboreum]
Length=222

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  117  KVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            KVVFVLGGPGSGKGTQC KIV+HFGYTHLSAGDLLRAE
Sbjct  21   KVVFVLGGPGSGKGTQCEKIVQHFGYTHLSAGDLLRAE  58



>ref|XP_002878321.1| hypothetical protein ARALYDRAFT_486486 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54580.1| hypothetical protein ARALYDRAFT_486486 [Arabidopsis lyrata subsp. 
lyrata]
Length=202

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQCA +V+HF YTH SAGDLLRAEI
Sbjct  16   PRWKKSTVVFVLGGPGSGKGTQCANLVKHFSYTHFSAGDLLRAEI  60



>ref|XP_009337254.1| PREDICTED: UMP-CMP kinase 3-like isoform X5 [Pyrus x bretschneideri]
Length=232

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  177  NGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +G    Q+  +GSL  +    VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  7    DGKKEAQQEAHGSLA-DLNPTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  64



>gb|KGN46282.1| hypothetical protein Csa_6G079760 [Cucumis sativus]
Length=209

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             S  +  NGS    KK  VVFVLGGPGSGKGTQCA IVEHFG+TH SAGDLLRAEI
Sbjct  7    VSTSEEANGSTVQ-KKPTVVFVLGGPGSGKGTQCACIVEHFGFTHFSAGDLLRAEI  61



>ref|XP_010546799.1| PREDICTED: UMP-CMP kinase 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546800.1| PREDICTED: UMP-CMP kinase 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010546801.1| PREDICTED: UMP-CMP kinase 3 isoform X2 [Tarenaya hassleriana]
Length=206

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS   NK   VVFVLGGPGSGKGTQCA IV+ +GYTHLSAGDLLRAEI
Sbjct  7    KEANGSGTENKPT-VVFVLGGPGSGKGTQCANIVKQYGYTHLSAGDLLRAEI  57



>ref|XP_001766287.1| predicted protein [Physcomitrella patens]
 gb|EDQ68919.1| predicted protein [Physcomitrella patens]
Length=249

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             +++ GV       K +KVVFVLGGPGSGKGTQCAKIV+ FG+ HLSAGDLLRAEI
Sbjct  24   VAMENGVAAKRSPVKDLKVVFVLGGPGSGKGTQCAKIVDTFGFVHLSAGDLLRAEI  79



>ref|XP_008347073.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Malus domestica]
 ref|XP_008347074.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Malus domestica]
Length=232

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  27   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  64



>ref|XP_004510143.1| PREDICTED: UMP/CMP kinase-like isoform X1 [Cicer arietinum]
Length=232

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  NGS   N    VVFVLGGPGSGKGTQCA +V++FGYTHLSAGDLLRAEI
Sbjct  10   KDTNGSF-LNTNPTVVFVLGGPGSGKGTQCANVVQNFGYTHLSAGDLLRAEI  60



>ref|XP_004423550.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 1 [Ceratotherium 
simum simum]
Length=211

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQKGVNG----SLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS +K  +     +    KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSARKSRDAEDSKAREKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>emb|CDY05528.1| BnaA02g31630D [Brassica napus]
Length=215

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 2/53 (4%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVL-GGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    KK  V+FVL GGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEVNGT-SSAKKPNVIFVLAGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  61



>ref|XP_009337253.1| PREDICTED: UMP-CMP kinase 3-like isoform X4 [Pyrus x bretschneideri]
Length=236

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  31   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  68



>ref|XP_009337252.1| PREDICTED: UMP-CMP kinase 3-like isoform X3 [Pyrus x bretschneideri]
Length=240

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  35   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  72



>emb|CDY65143.1| BnaC02g48410D [Brassica napus]
Length=215

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 2/53 (4%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVL-GGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    KK  V+FVL GGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KEVNGT-SSAKKPTVIFVLAGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  61



>ref|XP_009337251.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Pyrus x bretschneideri]
Length=244

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  39   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  76



>ref|XP_009337250.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Pyrus x bretschneideri]
Length=248

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  VVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            VVFVLGGPGSGKGTQCA IVEHFG+THLSAGDLLRAEI
Sbjct  43   VVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEI  80



>ref|XP_006635126.1| PREDICTED: UMP-CMP kinase-like [Lepisosteus oculatus]
Length=219

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            LP   K +VVFVLGGPG+GKGTQCA+IVE +GYTHLSAGDLLRAE
Sbjct  20   LPLVMKPQVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGDLLRAE  64



>ref|XP_008460060.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Cucumis melo]
 gb|ADN34101.1| uridylate kinase [Cucumis melo subsp. melo]
Length=209

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             S  +  NGS    KK  VVFVLGGPGSGKGTQCA IVEHFG+TH SAGDLLR EI
Sbjct  7    VSTSEEANGS-AAKKKPTVVFVLGGPGSGKGTQCAYIVEHFGFTHFSAGDLLRGEI  61



>ref|XP_004145023.1| PREDICTED: UMP/CMP kinase-like isoform 1 [Cucumis sativus]
 ref|XP_004153201.1| PREDICTED: UMP/CMP kinase-like isoform 1 [Cucumis sativus]
 ref|XP_004168235.1| PREDICTED: UMP/CMP kinase-like isoform 1 [Cucumis sativus]
Length=240

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             S  +  NGS    KK  VVFVLGGPGSGKGTQCA IVEHFG+TH SAGDLLRAEI
Sbjct  7    VSTSEEANGSTVQ-KKPTVVFVLGGPGSGKGTQCACIVEHFGFTHFSAGDLLRAEI  61



>ref|XP_006655698.1| PREDICTED: UMP-CMP kinase-like isoform X1 [Oryza brachyantha]
 ref|XP_006655699.1| PREDICTED: UMP-CMP kinase-like isoform X2 [Oryza brachyantha]
Length=241

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  SLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            S P  KK+ +VFV+GGPGSGKGTQCAKIV+ FG+THLSAGDLLR E
Sbjct  11   SFPPGKKITIVFVIGGPGSGKGTQCAKIVKQFGFTHLSAGDLLREE  56



>ref|XP_004145024.1| PREDICTED: UMP/CMP kinase-like isoform 2 [Cucumis sativus]
 ref|XP_004153202.1| PREDICTED: UMP/CMP kinase-like isoform 2 [Cucumis sativus]
 ref|XP_004168236.1| PREDICTED: UMP/CMP kinase-like isoform 2 [Cucumis sativus]
Length=210

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             KK  VVFVLGGPGSGKGTQCA IVEHFG+TH SAGDLLRAEI
Sbjct  20   QKKPTVVFVLGGPGSGKGTQCACIVEHFGFTHFSAGDLLRAEI  62



>gb|AAD41679.1|AF086603_1 adenylate kinase [Ceratopteris richardii]
Length=165

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +  KVVFVLGGPGSGKGTQCA IVE F +THLSAGDLLRAEI
Sbjct  20   QSAKVVFVLGGPGSGKGTQCASIVEQFAFTHLSAGDLLRAEI  61



>ref|XP_005346103.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Microtus 
ochrogaster]
 ref|XP_005346104.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Microtus 
ochrogaster]
Length=194

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIVE +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVEKYGYTHLSTGDLLRAEV  47



>ref|XP_005087597.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Mesocricetus 
auratus]
Length=210

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSI----QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
            GCCS     ++    +    KK K++FV+GGPGSGKGTQC KIVE +GYTHLS GDLLRA
Sbjct  2    GCCSSSEPREEQDRKAREKLKKAKIIFVVGGPGSGKGTQCEKIVEKYGYTHLSTGDLLRA  61

Query  6    EI  1
            E+
Sbjct  62   EV  63



>gb|EMS48079.1| Uridylate kinase [Triticum urartu]
Length=221

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KKV V FVLGGPGSGKGTQC+ IVEHFG+THLSAG+LLR+EI
Sbjct  25   KKVAVAFVLGGPGSGKGTQCSNIVEHFGFTHLSAGELLRSEI  66



>ref|XP_002986589.1| hypothetical protein SELMODRAFT_235054 [Selaginella moellendorffii]
 gb|EFJ12446.1| hypothetical protein SELMODRAFT_235054 [Selaginella moellendorffii]
Length=221

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  KVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KV+FVLGGPGSGKGTQCAKIVE FG+ HLSAGDLLRAEI
Sbjct  28   KVIFVLGGPGSGKGTQCAKIVEKFGFVHLSAGDLLRAEI  66



>ref|XP_002965261.1| hypothetical protein SELMODRAFT_270489 [Selaginella moellendorffii]
 gb|EFJ34099.1| hypothetical protein SELMODRAFT_270489 [Selaginella moellendorffii]
Length=221

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  KVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KV+FVLGGPGSGKGTQCAKIVE FG+ HLSAGDLLRAEI
Sbjct  28   KVIFVLGGPGSGKGTQCAKIVEKFGFVHLSAGDLLRAEI  66



>gb|EMT05129.1| Uridylate kinase [Aegilops tauschii]
Length=343

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KKV VVFVLGGPGSGKGTQC+ IVEHFG+THLSAG+LLR+EI
Sbjct  21   KKVAVVFVLGGPGSGKGTQCSNIVEHFGFTHLSAGELLRSEI  62



>ref|XP_008460054.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Cucumis melo]
 ref|XP_008460055.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Cucumis melo]
 ref|XP_008460056.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Cucumis melo]
 ref|XP_008460057.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Cucumis melo]
 ref|XP_008460059.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Cucumis melo]
Length=240

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  CSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             S  +  NGS    KK  VVFVLGGPGSGKGTQCA IVEHFG+TH SAGDLLR EI
Sbjct  7    VSTSEEANGS-AAKKKPTVVFVLGGPGSGKGTQCAYIVEHFGFTHFSAGDLLRGEI  61



>ref|XP_010062064.1| PREDICTED: UMP-CMP kinase isoform X3 [Eucalyptus grandis]
 ref|XP_010062073.1| PREDICTED: UMP-CMP kinase isoform X3 [Eucalyptus grandis]
 ref|XP_010062081.1| PREDICTED: UMP-CMP kinase isoform X3 [Eucalyptus grandis]
 gb|KCW90821.1| hypothetical protein EUGRSUZ_A02880 [Eucalyptus grandis]
Length=207

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             G L   K + + FVLGGPGSGKGTQCAKIVE+FGYTHLSAG+LLR EI
Sbjct  12   EGCLSKEKNLYITFVLGGPGSGKGTQCAKIVENFGYTHLSAGELLRQEI  60



>ref|XP_010062046.1| PREDICTED: UMP-CMP kinase isoform X1 [Eucalyptus grandis]
 gb|KCW90818.1| hypothetical protein EUGRSUZ_A02880 [Eucalyptus grandis]
Length=240

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = -2

Query  207  GGLHSKGSSFNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLS  28
            G   SK   F+      KG  G L   K + + FVLGGPGSGKGTQCAKIVE+FGYTHLS
Sbjct  27   GAYSSKAMEFSSAEPF-KG-EGCLSKEKNLYITFVLGGPGSGKGTQCAKIVENFGYTHLS  84

Query  27   AGDLLRAEI  1
            AG+LLR EI
Sbjct  85   AGELLRQEI  93



>ref|XP_010062055.1| PREDICTED: UMP-CMP kinase isoform X2 [Eucalyptus grandis]
 gb|KCW90819.1| hypothetical protein EUGRSUZ_A02880 [Eucalyptus grandis]
Length=239

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             G L   K + + FVLGGPGSGKGTQCAKIVE+FGYTHLSAG+LLR EI
Sbjct  44   EGCLSKEKNLYITFVLGGPGSGKGTQCAKIVENFGYTHLSAGELLRQEI  92



>gb|KCW90820.1| hypothetical protein EUGRSUZ_A02880 [Eucalyptus grandis]
Length=230

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             G L   K + + FVLGGPGSGKGTQCAKIVE+FGYTHLSAG+LLR EI
Sbjct  44   EGCLSKEKNLYITFVLGGPGSGKGTQCAKIVENFGYTHLSAGELLRQEI  92



>ref|XP_010025667.1| PREDICTED: probable UMP/CMP kinase 4 [Eucalyptus grandis]
Length=126

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
             GSL   KK  VVFVLGGPG GKG QCA IV+HFG+THLSAGDLLRAEI
Sbjct  11   EGSLTE-KKPTVVFVLGGPGCGKGAQCANIVQHFGFTHLSAGDLLRAEI  58



>ref|XP_007528918.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Erinaceus 
europaeus]
Length=211

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQKGVN--GSLPHNK--KVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS +K  +   S+   K  K K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSTEKPQDKTDSMAKEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>ref|XP_009111704.1| PREDICTED: UMP-CMP kinase 3-like isoform X2 [Brassica rapa]
Length=209

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    K+  V+FVLGGPGSGKGTQCA IV+HFG THLSAGDLLRAEI
Sbjct  10   KEVNGT-ASEKRPAVIFVLGGPGSGKGTQCAYIVDHFGCTHLSAGDLLRAEI  60



>ref|XP_010982602.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Camelus dromedarius]
Length=211

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQKGVNGSLPHN----KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS +   +    H     KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSARDSRSLEDSHAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>ref|XP_009111702.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Brassica rapa]
 ref|XP_009111703.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Brassica rapa]
Length=211

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K VNG+    K+  V+FVLGGPGSGKGTQCA IV+HFG THLSAGDLLRAEI
Sbjct  10   KEVNGT-ASEKRPAVIFVLGGPGSGKGTQCAYIVDHFGCTHLSAGDLLRAEI  60



>ref|XP_010065264.1| PREDICTED: UMP-CMP kinase 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW62632.1| hypothetical protein EUGRSUZ_G00158 [Eucalyptus grandis]
Length=194

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K+  VVFVLGGPG GKGTQCA IV+HFG+THLSAGDLLRAEI
Sbjct  4    KRPTVVFVLGGPGCGKGTQCANIVQHFGFTHLSAGDLLRAEI  45



>ref|XP_005087598.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Mesocricetus 
auratus]
Length=194

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIVE +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVEKYGYTHLSTGDLLRAEV  47



>ref|XP_010949465.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Camelus bactrianus]
Length=172

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQKGVNGSLPHN----KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS +   +    H     KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSARDSRSLEDSHAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>ref|XP_004307819.1| PREDICTED: adenylate kinase-like [Fragaria vesca subsp. vesca]
Length=231

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  PIQSQAGGGLHSKGSS-FNGCCSIQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVE  52
            P+ S +    H++ +S F  C S         P      + FVLGGPGSGKGTQCAKIVE
Sbjct  10   PLISHSKPSAHNQAASAFKICESFTSQSETVTPSKAAPFITFVLGGPGSGKGTQCAKIVE  69

Query  51   HFGYTHLSAGDLLRAEI  1
             FG+TH+SAGDLLR EI
Sbjct  70   AFGFTHVSAGDLLRREI  86



>ref|XP_006181932.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Camelus ferus]
 ref|XP_010949462.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Camelus bactrianus]
Length=211

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQKGVNGSLPHN----KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS +   +    H     KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSARDSRSLEDSHAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>ref|XP_006205542.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Vicugna pacos]
Length=211

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQKGVNGSLPHN----KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS +   +    H     KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSARDSRSLEDSHAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>ref|XP_006154122.1| PREDICTED: adenylate kinase isoenzyme 1 [Tupaia chinensis]
Length=210

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  174  GCCS-----IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLR  10
            GCCS      +K +       KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLR
Sbjct  2    GCCSSSDPRTEKDLEAR-EKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLR  60

Query  9    AEI  1
            AE+
Sbjct  61   AEV  63



>ref|XP_786761.3| PREDICTED: UMP-CMP kinase-like isoform 3 [Strongylocentrotus 
purpuratus]
Length=246

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = -2

Query  222  QSQAGGGLHSKGSSFNGCCSIQKGVNGSLPH---NKKVKVVFVLGGPGSGKGTQCAKIVE  52
            Q Q GG  H+         ++Q     S+P    + K +VVFVLGGPG+GKGTQC KIVE
Sbjct  21   QLQGGGTPHADDDGERDREAVQSPAASSIPTVMASNKPEVVFVLGGPGAGKGTQCQKIVE  80

Query  51   HFGYTHLSAGDLLRAE  4
             FG+ HLSAGDLLRAE
Sbjct  81   KFGFVHLSAGDLLRAE  96



>ref|XP_006744205.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Leptonychotes 
weddellii]
Length=210

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = -2

Query  174  GCCSIQK---GVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
             CCS ++    V+ +    KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE
Sbjct  3    ACCSGRRRAAEVSKAREKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAE  62

Query  3    I  1
            +
Sbjct  63   V  63



>ref|XP_004593598.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Ochotona 
princeps]
Length=210

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQ----KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
            GCCS      +  + +    KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  2    GCCSSNDPRSRADSQAREKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  61

Query  6    EI  1
            E+
Sbjct  62   EV  63



>ref|NP_001056578.1| Os06g0109600 [Oryza sativa Japonica Group]
 sp|Q5VRN0.1|KCY1_ORYSJ RecName: Full=Probable UMP/CMP kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD67693.1| putative Uridylate kinase [Oryza sativa Japonica Group]
 dbj|BAD67896.1| putative Uridylate kinase [Oryza sativa Japonica Group]
 dbj|BAF18492.1| Os06g0109600 [Oryza sativa Japonica Group]
 dbj|BAG90214.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79855.1| hypothetical protein OsI_21335 [Oryza sativa Indica Group]
 gb|EEE64963.1| hypothetical protein OsJ_19856 [Oryza sativa Japonica Group]
Length=243

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            P  KK+ +VFV+GGPGSGKGTQCAKIV+ FG+THLSAGDLLR E
Sbjct  14   PPGKKITIVFVIGGPGSGKGTQCAKIVKQFGFTHLSAGDLLREE  57



>ref|XP_008509573.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Equus przewalskii]
Length=217

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = -2

Query  183  SFNGCCSI----QKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDL  16
            +   CCS+     +  + +    KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDL
Sbjct  6    TMGACCSVTNPRDQEDSKAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDL  65

Query  15   LRAEI  1
            LRAE+
Sbjct  66   LRAEV  70



>ref|XP_010469223.1| PREDICTED: probable UMP-CMP kinase 1 isoform X2 [Camelina sativa]
Length=186

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQC  +V+HF YTH SAGDLLRAEI
Sbjct  16   PRWKKSTVVFVLGGPGSGKGTQCGNVVKHFSYTHFSAGDLLRAEI  60



>sp|P12115.2|KAD1_CYPCA RecName: Full=Adenylate kinase isoenzyme 1; Short=AK 1; AltName: 
Full=ATP-AMP transphosphorylase 1; AltName: Full=ATP:AMP 
phosphotransferase; AltName: Full=Adenylate monophosphate kinase; 
AltName: Full=Myokinase [Cyprinus carpio]
Length=194

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K  K+VFV+GGPGSGKGTQC KIVE +GYTHLS+GDLLRAE+
Sbjct  6    KDAKIVFVVGGPGSGKGTQCEKIVEKYGYTHLSSGDLLRAEV  47



>ref|XP_010469222.1| PREDICTED: probable UMP-CMP kinase 1 isoform X1 [Camelina sativa]
Length=222

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  PHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            P  KK  VVFVLGGPGSGKGTQC  +V+HF YTH SAGDLLRAEI
Sbjct  16   PRWKKSTVVFVLGGPGSGKGTQCGNVVKHFSYTHFSAGDLLRAEI  60



>ref|XP_006983551.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006983552.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=194

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>dbj|BAA97655.1| adenylate kinase isozyme 1 [Rattus norvegicus]
Length=194

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>emb|CDP05314.1| unnamed protein product [Coffea canephora]
Length=235

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  147  NGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            +G+ P      + FVLGGPGSGKGTQCA+IVE+FG+THLSAGDLLR EI
Sbjct  45   DGTFPRGITPFITFVLGGPGSGKGTQCARIVENFGFTHLSAGDLLRQEI  93



>ref|XP_010611968.1| PREDICTED: adenylate kinase isoenzyme 1 [Fukomys damarensis]
Length=185

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>gb|KEP52442.1| UMP-CMP kinase [Rhizoctonia solani 123E]
Length=228

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            K  +G    +KKV V+FVLGGPG+GKGTQCA+IVE FG+ HLSAGDLLR E
Sbjct  11   KASDGPAFDSKKVMVIFVLGGPGAGKGTQCARIVEDFGFVHLSAGDLLREE  61



>ref|NP_001124519.1| adenylate kinase isoenzyme 1 [Canis lupus familiaris]
 gb|ACF49493.1| adenylate kinase 1 [Canis lupus familiaris]
Length=210

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -2

Query  174  GCCSIQ-KGVNGSLPHNK--KVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
             CCS   + V  S    K  K K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE
Sbjct  3    ACCSRNHRNVEDSKAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAE  62

Query  3    I  1
            +
Sbjct  63   V  63



>gb|KDN43280.1| hypothetical protein RSAG8_06247, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=116

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  129  NKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            +KKV V+FVLGGPG+GKGTQCA+IVE FG+ HLSAGDLLR E
Sbjct  27   SKKVMVIFVLGGPGAGKGTQCARIVEDFGFVHLSAGDLLREE  68



>ref|XP_001775972.1| predicted protein [Physcomitrella patens]
 gb|EDQ59164.1| predicted protein [Physcomitrella patens]
Length=246

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            K++KVVFVLGGPGSGKGTQCAKIV+ +G+ HLSAGDLLRAEI
Sbjct  33   KELKVVFVLGGPGSGKGTQCAKIVDTYGFEHLSAGDLLRAEI  74



>ref|XP_004677358.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Condylura 
cristata]
Length=194

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS+GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSSGDLLRAEV  47



>ref|XP_004302283.1| PREDICTED: UMP/CMP kinase-like isoform 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_004302284.1| PREDICTED: UMP/CMP kinase-like isoform 2 [Fragaria vesca subsp. 
vesca]
Length=209

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  123  KVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            K  VVFVLGGPGSGKGTQCA IV+HFG+THLSAGDLLRAE
Sbjct  21   KPTVVFVLGGPGSGKGTQCANIVKHFGFTHLSAGDLLRAE  60



>ref|XP_005982698.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Pantholops 
hodgsonii]
Length=211

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQ--KGVNGSLPHNK--KVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS+   + +  S    K  K K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSVTDPRIMEDSRAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>ref|XP_004453108.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 1 [Dasypus novemcinctus]
Length=211

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCSIQ----KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
             CCS      K  + +    KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRA
Sbjct  3    ACCSTTDPRFKEDSKAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA  62

Query  6    EI  1
            E+
Sbjct  63   EV  64



>ref|XP_005881506.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Myotis brandtii]
Length=194

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_006074533.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Bubalus bubalis]
 ref|XP_006074534.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Bubalus bubalis]
 ref|XP_006074535.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X4 [Bubalus bubalis]
 ref|XP_006074536.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X5 [Bubalus bubalis]
 ref|XP_006074537.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X6 [Bubalus bubalis]
 ref|XP_006074538.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X7 [Bubalus bubalis]
 ref|XP_006074539.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X8 [Bubalus bubalis]
Length=194

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_002915223.1| PREDICTED: adenylate kinase isoenzyme 1-like [Ailuropoda melanoleuca]
Length=210

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -2

Query  174  GCCS-IQKGVNGSLPHNK--KVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
             CCS  ++    S    K  K K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE
Sbjct  3    ACCSGTRRTAEDSKAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAE  62

Query  3    I  1
            +
Sbjct  63   V  63



>gb|EUC59506.1| adenylate kinase [Rhizoctonia solani AG-3 Rhs1AP]
Length=185

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  156  KGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            K  +G    +KKV V+FVLGGPG+GKGTQCA+IVE FG+ HLSAGDLLR E
Sbjct  11   KASDGPAFDSKKVMVIFVLGGPGAGKGTQCARIVEDFGFVHLSAGDLLREE  61



>ref|XP_006102144.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Myotis lucifugus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_002872215.1| uridylate kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48474.1| uridylate kinase [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 2/44 (5%)
 Frame = -2

Query  126  KKVKVVFV--LGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK  V+FV  +GGPGSGKGTQCA IVEHFGYTHLSAGDLLRAEI
Sbjct  10   KKPTVIFVFSIGGPGSGKGTQCAYIVEHFGYTHLSAGDLLRAEI  53



>ref|NP_077325.2| adenylate kinase isoenzyme 1 [Rattus norvegicus]
 sp|P39069.3|KAD1_RAT RecName: Full=Adenylate kinase isoenzyme 1; Short=AK 1; AltName: 
Full=ATP-AMP transphosphorylase 1; AltName: Full=ATP:AMP 
phosphotransferase; AltName: Full=Adenylate monophosphate kinase; 
AltName: Full=Myokinase [Rattus norvegicus]
 gb|AAH89797.1| Adenylate kinase 1 [Rattus norvegicus]
 gb|EDL93225.1| adenylate kinase 1, isoform CRA_d [Rattus norvegicus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_006768594.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Myotis davidii]
Length=184

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|NP_001013600.1| adenylate kinase isoenzyme 1 [Bos taurus]
 ref|XP_005213229.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Bos taurus]
 ref|XP_010855189.1| PREDICTED: adenylate kinase isoenzyme 1 [Bison bison bison]
 sp|P00570.2|KAD1_BOVIN RecName: Full=Adenylate kinase isoenzyme 1; Short=AK 1; AltName: 
Full=ATP-AMP transphosphorylase 1; AltName: Full=ATP:AMP 
phosphotransferase; AltName: Full=Adenylate monophosphate kinase; 
AltName: Full=Myokinase [Bos taurus]
 gb|AAX08968.1| adenylate kinase 1 [Bos taurus]
 gb|AAI14797.1| Adenylate kinase 1 [Bos taurus]
 tpg|DAA24273.1| TPA: adenylate kinase 1 [Bos taurus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_006074532.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Bubalus bubalis]
Length=246

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 11/82 (13%)
 Frame = -2

Query  222  QSQAGGGLHSKGS-SFNGCCSIQKGVNGSLPHN-------KKVKVVFVLGGPGSGKGTQC  67
            QS  G G  ++ + +   CCS   G +  +  +       KK K++FV+GGPGSGKGTQC
Sbjct  21   QSLRGEGWGTQQTGTMGACCS---GTDPRIMEDSRAREKLKKTKIIFVVGGPGSGKGTQC  77

Query  66   AKIVEHFGYTHLSAGDLLRAEI  1
             KIV+ +GYTHLS GDLLRAE+
Sbjct  78   EKIVQKYGYTHLSTGDLLRAEV  99



>ref|XP_004453109.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 2 [Dasypus novemcinctus]
 ref|XP_004453110.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 3 [Dasypus novemcinctus]
 ref|XP_004453111.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 4 [Dasypus novemcinctus]
 ref|XP_004453112.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 5 [Dasypus novemcinctus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_008249249.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Oryctolagus 
cuniculus]
Length=210

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -2

Query  174  GCCS----IQKGVNGSLPHNKKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRA  7
            GCCS     ++  + +    KK K++FV+GGPGSGKGTQC KIV  +GYTHLS GDLLRA
Sbjct  2    GCCSSTDPRRRADSRAREKLKKAKIIFVVGGPGSGKGTQCEKIVHKYGYTHLSTGDLLRA  61

Query  6    EI  1
            E+
Sbjct  62   EV  63



>gb|EFB25034.1| hypothetical protein PANDA_003186 [Ailuropoda melanoleuca]
Length=206

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  18   KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  59



>ref|XP_003785379.1| PREDICTED: adenylate kinase isoenzyme 1 [Otolemur garnettii]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_008150818.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Eptesicus 
fuscus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_006768592.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Myotis davidii]
 ref|XP_006768593.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Myotis davidii]
 gb|ELK26591.1| Adenylate kinase isoenzyme 1 [Myotis davidii]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_008696948.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Ursus maritimus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|NP_001185719.1| adenylate kinase isoenzyme 1 isoform 2 [Mus musculus]
 ref|NP_001185720.1| adenylate kinase isoenzyme 1 isoform 2 [Mus musculus]
 ref|NP_001185721.1| adenylate kinase isoenzyme 1 isoform 2 [Mus musculus]
 ref|XP_006497687.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Mus musculus]
 sp|Q9R0Y5.1|KAD1_MOUSE RecName: Full=Adenylate kinase isoenzyme 1; Short=AK 1; AltName: 
Full=ATP-AMP transphosphorylase 1; AltName: Full=ATP:AMP 
phosphotransferase; AltName: Full=Adenylate monophosphate kinase; 
AltName: Full=Myokinase [Mus musculus]
 emb|CAB52407.1| Adenylate kinase [Mus musculus]
 gb|AAH14802.1| Ak1 protein [Mus musculus]
 dbj|BAC32808.1| unnamed protein product [Mus musculus]
 dbj|BAC40822.1| unnamed protein product [Mus musculus]
 gb|ABF46940.1| adenylate kinase 1 [Mus musculus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_003480663.2| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Sus scrofa]
Length=268

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = -2

Query  183  SFNGCCSIQ--KGVNGSLPHNK--KVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDL  16
            +   CCS +  + V  S    K  K K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDL
Sbjct  57   TMGACCSARDLRSVEDSKAREKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDL  116

Query  15   LRAEI  1
            LRAE+
Sbjct  117  LRAEV  121



>ref|XP_005908510.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Bos mutus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_003995955.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Felis catus]
 ref|XP_006939566.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X4 [Felis catus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_010982603.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Camelus dromedarius]
 ref|XP_010982604.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Camelus dromedarius]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_007094507.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Panthera 
tigris altaica]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_006205543.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Vicugna pacos]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_008150817.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Eptesicus 
fuscus]
Length=211

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  23   KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  64



>ref|XP_009243149.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Pongo abelii]
 ref|XP_009243150.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Pongo abelii]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_003940642.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Saimiri boliviensis 
boliviensis]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_001094708.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 1 [Macaca mulatta]
 ref|XP_002800220.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 4 [Macaca mulatta]
 ref|XP_002800221.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 5 [Macaca mulatta]
 ref|XP_003264228.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 1 [Nomascus leucogenys]
 ref|XP_003264229.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 2 [Nomascus leucogenys]
 ref|XP_003264230.1| PREDICTED: adenylate kinase isoenzyme 1 isoform 3 [Nomascus leucogenys]
 ref|XP_004088878.1| PREDICTED: adenylate kinase isoenzyme 1 [Nomascus leucogenys]
 ref|XP_005582204.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Macaca fascicularis]
 ref|XP_009187366.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Papio anubis]
 ref|XP_009187368.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Papio anubis]
 ref|XP_009187369.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Papio anubis]
 ref|XP_010366124.1| PREDICTED: adenylate kinase isoenzyme 1 [Rhinopithecus roxellana]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_004677357.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Condylura 
cristata]
Length=210

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 3/61 (5%)
 Frame = -2

Query  174  GCCSI-QKGVNGSLPHNK--KVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAE  4
            GCCS   +    +    K  K K++FV+GGPGSGKGTQC KIV+ +GYTHLS+GDLLRAE
Sbjct  3    GCCSAGPRDTEDARAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSSGDLLRAE  62

Query  3    I  1
            +
Sbjct  63   V  63



>gb|EPY83275.1| adenylate kinase isoenzyme 1 [Camelus ferus]
Length=191

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_005625076.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Canis lupus 
familiaris]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_004593599.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Ochotona 
princeps]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|NP_001155354.1| adenylate kinase isoenzyme 1 [Ovis aries]
 ref|XP_005982699.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_005982700.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Pantholops 
hodgsonii]
 ref|XP_005982701.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X4 [Pantholops 
hodgsonii]
 gb|ACR46648.1| AK1 [Ovis aries]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_006918058.1| PREDICTED: adenylate kinase isoenzyme 1 [Pteropus alecto]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_006181933.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Camelus ferus]
 ref|XP_010949463.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Camelus bactrianus]
 ref|XP_010949464.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Camelus bactrianus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>gb|EDL93222.1| adenylate kinase 1, isoform CRA_a [Rattus norvegicus]
Length=186

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_007656868.1| PREDICTED: adenylate kinase isoenzyme 1-like, partial [Ornithorhynchus 
anatinus]
Length=79

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIVE +GYTHLS GDLLR E+
Sbjct  6    KKSKIIFVVGGPGSGKGTQCEKIVEKYGYTHLSTGDLLRDEV  47



>ref|XP_004757304.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Mustela putorius 
furo]
 ref|XP_004757305.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Mustela putorius 
furo]
 ref|XP_004800129.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Mustela putorius 
furo]
 ref|XP_004800130.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X3 [Mustela putorius 
furo]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_008569083.1| PREDICTED: adenylate kinase isoenzyme 1 [Galeopterus variegatus]
Length=194

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_005881504.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Myotis brandtii]
 gb|EPQ17187.1| Adenylate kinase isoenzyme 1 [Myotis brandtii]
Length=211

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 14/67 (21%)
 Frame = -2

Query  174  GCCSIQKGVNGSLPHN---------KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAG  22
            GCCS     +G+L            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS G
Sbjct  3    GCCS-----SGNLRSEEDSKAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTG  57

Query  21   DLLRAEI  1
            DLLRAE+
Sbjct  58   DLLRAEV  64



>ref|XP_005881505.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Myotis brandtii]
Length=201

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  23   KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  64



>ref|XP_006102142.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X1 [Myotis lucifugus]
Length=211

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 14/67 (21%)
 Frame = -2

Query  174  GCCSIQKGVNGSLPHN---------KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAG  22
            GCCS     +G+L            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS G
Sbjct  3    GCCS-----SGNLRSEEDSKAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTG  57

Query  21   DLLRAEI  1
            DLLRAE+
Sbjct  58   DLLRAEV  64



>ref|XP_004641596.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Octodon degus]
Length=194

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



>ref|XP_007101851.1| PREDICTED: adenylate kinase isoenzyme 1 [Physeter catodon]
Length=211

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  23   KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  64



>ref|XP_006102143.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Myotis lucifugus]
Length=201

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  23   KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  64



>ref|XP_008509579.1| PREDICTED: adenylate kinase isoenzyme 1 isoform X2 [Equus przewalskii]
Length=194

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  KKVKVVFVLGGPGSGKGTQCAKIVEHFGYTHLSAGDLLRAEI  1
            KK K++FV+GGPGSGKGTQC KIV+ +GYTHLS GDLLRAE+
Sbjct  6    KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 594120442748