BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26407_g1_i1 len=1313 path=[1291:0-1312]

Length=1313
                                                                      Score     E

ref|XP_006340324.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    323   6e-106   
ref|XP_009592505.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    323   1e-105   
ref|XP_010037586.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    320   1e-104   
ref|XP_004251221.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    320   1e-104   
ref|XP_011098510.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    319   5e-104   
ref|XP_007036155.1|  Ubiquitin-conjugating enzyme E2 5 isoform 1        318   6e-104   
ref|XP_010271991.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    316   6e-103   
ref|XP_002321579.1|  hypothetical protein POPTR_0015s08470g             315   9e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011028598.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    315   1e-102   
ref|XP_008393051.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    312   2e-101   
ref|XP_010254271.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    311   4e-101   
gb|KDP45387.1|  hypothetical protein JCGZ_09636                         312   4e-101   
gb|EYU44716.1|  hypothetical protein MIMGU_mgv1a014494mg                310   2e-100   
gb|KHG06323.1|  Ubiquitin-conjugating enzyme E2 4 -like protein         309   2e-100   
ref|XP_002280126.2|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    308   5e-100   Vitis vinifera
gb|KDP31131.1|  hypothetical protein JCGZ_11507                         307   2e-99    
gb|AFK44151.1|  unknown                                                 307   2e-99    
ref|XP_004508848.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    307   2e-99    
ref|XP_010532272.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    305   8e-99    
ref|XP_007155401.1|  hypothetical protein PHAVU_003G198300g             305   1e-98    
ref|XP_007209657.1|  hypothetical protein PRUPE_ppa012074mg             305   1e-98    
ref|XP_006439774.1|  hypothetical protein CICLE_v10022463mg             304   3e-98    
ref|XP_004298926.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    303   5e-98    
ref|XP_006470379.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    303   7e-98    
ref|XP_006600652.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    302   1e-97    
gb|AFK44595.1|  unknown                                                 301   2e-97    
ref|XP_006374516.1|  hypothetical protein POPTR_0015s08470g             301   3e-97    
ref|XP_003608946.1|  Ubiquitin carrier protein                          301   4e-97    
ref|XP_010678729.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    300   1e-96    
ref|XP_006853122.1|  hypothetical protein AMTR_s00038p00146240          299   2e-96    
ref|XP_010037581.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    298   3e-96    
ref|XP_006579381.1|  PREDICTED: uncharacterized protein LOC100527...    298   9e-96    
ref|XP_002511435.1|  ubiquitin-conjugating enzyme h, putative           297   1e-95    Ricinus communis
ref|XP_010913550.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    296   2e-95    
ref|NP_001237311.1|  uncharacterized protein LOC100527526               296   4e-95    
ref|XP_008780946.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    295   3e-94    
ref|XP_004138119.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    293   4e-94    
ref|XP_002517368.1|  ubiquitin-conjugating enzyme h, putative           293   5e-94    Ricinus communis
emb|CDP20894.1|  unnamed protein product                                293   7e-94    
ref|XP_009381635.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    292   1e-93    
ref|XP_010107447.1|  Ubiquitin-conjugating enzyme E2 5                  291   2e-93    
ref|XP_008453110.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    291   2e-93    
ref|XP_007036157.1|  Ubiquitin-conjugating enzyme E2 5 isoform 3        290   3e-93    
gb|KGN64295.1|  hypothetical protein Csa_1G045930                       290   6e-92    
ref|XP_004152466.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    286   3e-91    
ref|XP_002964045.1|  ubiquitin-conjugating enzyme 5, E2                 285   7e-91    
ref|XP_010913548.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    283   9e-90    
ref|XP_010663198.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    280   2e-89    
ref|XP_001759393.1|  predicted protein                                  280   9e-89    
ref|XP_011029312.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    280   9e-89    
gb|ACN39971.1|  unknown                                                 279   2e-88    Picea sitchensis
ref|XP_006343959.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    278   2e-88    
ref|XP_004245589.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       278   3e-88    
ref|XP_002298025.1|  Ubiquitin-conjugating enzyme E2-21 kDa 3 fam...    278   4e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006446454.1|  hypothetical protein CICLE_v10018163mg             277   6e-88    
ref|XP_010676458.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       278   6e-88    
ref|XP_006470380.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    277   6e-88    
gb|ABK21140.1|  unknown                                                 277   7e-88    Picea sitchensis
ref|XP_011022652.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    277   9e-88    
gb|EYU38331.1|  hypothetical protein MIMGU_mgv1a014569mg                277   1e-87    
ref|XP_006476536.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    276   1e-87    
ref|XP_004510772.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    276   1e-87    
ref|XP_010089080.1|  Ubiquitin-conjugating enzyme E2 5                  276   2e-87    
ref|XP_010255296.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    276   2e-87    
ref|XP_011072993.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       276   2e-87    
gb|ABK23779.1|  unknown                                                 275   3e-87    Picea sitchensis
gb|AFK43668.1|  unknown                                                 275   4e-87    
emb|CDP12044.1|  unnamed protein product                                275   5e-87    
ref|XP_011080934.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    275   6e-87    
ref|XP_010940566.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    275   9e-87    
ref|XP_007209658.1|  hypothetical protein PRUPE_ppa012080mg             274   1e-86    
ref|NP_001237603.1|  ubiquitin carrier protein 4                        274   1e-86    
ref|XP_003548669.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    273   2e-86    
gb|KHF98807.1|  Ubiquitin-conjugating enzyme E2 5 -like protein         273   2e-86    
gb|KEH18844.1|  ubiquitin-conjugating enzyme                            273   2e-86    
gb|KDP25412.1|  hypothetical protein JCGZ_20568                         273   2e-86    
ref|XP_010055667.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    273   2e-86    
ref|XP_007135093.1|  hypothetical protein PHAVU_010G100200g             273   4e-86    
ref|XP_007040285.1|  Ubiquitin-conjugating enzyme 5                     273   4e-86    
ref|XP_008787422.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    273   4e-86    
ref|XP_009790425.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    273   4e-86    
ref|XP_003525387.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    272   5e-86    
gb|AFK34026.1|  unknown                                                 273   5e-86    
ref|XP_002304506.1|  Ubiquitin-conjugating enzyme E2-21 kDa 3 fam...    272   5e-86    Populus trichocarpa [western balsam poplar]
ref|XP_004143895.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    272   5e-86    
gb|KDP28606.1|  hypothetical protein JCGZ_14377                         272   8e-86    
ref|XP_002276343.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    272   8e-86    Vitis vinifera
ref|XP_006600654.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    271   9e-86    
ref|XP_008779270.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    272   9e-86    
ref|XP_010935786.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    272   9e-86    
ref|XP_009592682.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    271   1e-85    
ref|XP_002279927.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    271   1e-85    Vitis vinifera
ref|XP_009397539.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    271   1e-85    
ref|XP_008794268.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    271   2e-85    
ref|XP_006374515.1|  hypothetical protein POPTR_0015s08470g             270   2e-85    
ref|XP_010275657.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    270   3e-85    
ref|XP_008342748.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    270   4e-85    
ref|XP_009375015.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    270   4e-85    
ref|XP_003552403.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    270   4e-85    
ref|XP_004306758.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    270   5e-85    
ref|XP_010913549.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    270   5e-85    
ref|XP_007218489.1|  hypothetical protein PRUPE_ppa012120mg             270   5e-85    
sp|P16577.1|UBC4_WHEAT  RecName: Full=Ubiquitin-conjugating enzym...    270   6e-85    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010254946.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    270   6e-85    
ref|XP_009349265.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    270   7e-85    
ref|XP_004298815.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    270   7e-85    
ref|XP_008233026.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    269   9e-85    
ref|XP_002511883.1|  ubiquitin-conjugating enzyme h, putative           269   9e-85    Ricinus communis
ref|XP_002509830.1|  ubiquitin-conjugating enzyme h, putative           269   1e-84    Ricinus communis
ref|XP_011023305.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    269   1e-84    
ref|XP_004133859.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    269   1e-84    
ref|XP_006339599.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    269   2e-84    
ref|XP_004503694.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    268   2e-84    
ref|XP_007139813.1|  hypothetical protein PHAVU_008G060900g             268   2e-84    
ref|NP_001242818.1|  uncharacterized protein LOC100805356               268   2e-84    
ref|XP_010933128.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    268   3e-84    
ref|NP_001236928.1|  uncharacterized protein LOC100527756               268   3e-84    
ref|XP_009783359.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    268   4e-84    
ref|XP_008453111.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    267   4e-84    
ref|XP_010913552.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    267   4e-84    
ref|XP_002302592.2|  ubiquitin carrier protein 4                        268   4e-84    Populus trichocarpa [western balsam poplar]
ref|XP_002465854.1|  hypothetical protein SORBIDRAFT_01g047040          267   4e-84    Sorghum bicolor [broomcorn]
ref|XP_004229945.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    267   5e-84    
ref|XP_010670105.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    267   6e-84    
ref|XP_007051764.1|  Ubiquitin-conjugating enzyme E2 5 isoform 2        267   6e-84    
ref|XP_008438028.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    267   7e-84    
ref|XP_010087938.1|  Ubiquitin-conjugating enzyme E2 5                  267   7e-84    
ref|XP_009400670.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    267   8e-84    
ref|XP_006302819.1|  hypothetical protein CARUB_v10020943mg             268   8e-84    
ref|XP_009628118.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    266   9e-84    
dbj|BAK02014.1|  predicted protein                                      266   1e-83    
ref|XP_002886384.1|  ubiquitin-conjugating enzyme 37                    266   1e-83    
ref|XP_008801319.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    266   1e-83    
ref|XP_010430489.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       266   1e-83    
gb|EMT01071.1|  Ubiquitin-conjugating enzyme E2 5                       266   1e-83    
gb|ABB47726.2|  Ubiquitin-conjugating enzyme E2-23 kDa, putative,...    266   1e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010418415.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    266   1e-83    
ref|XP_011093127.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    266   1e-83    
ref|XP_004985701.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    266   2e-83    
ref|NP_564817.2|  ubiquitin-conjugating enzyme E2 5                     266   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002467149.1|  hypothetical protein SORBIDRAFT_01g020460          266   2e-83    Sorghum bicolor [broomcorn]
gb|EMS63342.1|  Ubiquitin-conjugating enzyme E2 5                       266   2e-83    
ref|NP_001132906.1|  uncharacterized protein LOC100194405               266   2e-83    Zea mays [maize]
ref|XP_003557690.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    266   2e-83    
emb|CDY62172.1|  BnaC06g42330D                                          266   2e-83    
ref|XP_006491142.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    265   2e-83    
ref|XP_008438167.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    265   2e-83    
ref|XP_006661803.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    265   3e-83    
ref|XP_009125181.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    265   3e-83    
ref|XP_010559097.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    265   3e-83    
ref|XP_009626849.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    265   3e-83    
tpg|DAA49812.1|  TPA: putative ubiquitin-conjugating enzyme family      265   4e-83    
ref|XP_010234779.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    265   4e-83    
ref|NP_001132171.1|  uncharacterized protein LOC100193596               265   4e-83    Zea mays [maize]
ref|XP_010234781.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    265   4e-83    
ref|XP_008647817.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    265   5e-83    
ref|XP_009133760.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6       265   6e-83    
ref|XP_008780945.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    266   8e-83    
emb|CDP08792.1|  unnamed protein product                                264   1e-82    
emb|CDY58954.1|  BnaCnng33990D                                          264   1e-82    
gb|KDO86231.1|  hypothetical protein CISIN_1g030092mg                   264   1e-82    
gb|ACG24376.1|  ubiquitin-conjugating enzyme E2-21 kDa 1                264   1e-82    Zea mays [maize]
ref|XP_006397787.1|  hypothetical protein EUTSA_v10001650mg             264   1e-82    
ref|XP_006358673.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    263   1e-82    
ref|XP_004248050.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    263   1e-82    
ref|XP_010436081.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       264   2e-82    
ref|XP_002985720.1|  ubiquitin-conjugating enzyme 5, E2                 263   2e-82    
ref|XP_010447359.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    264   2e-82    
ref|XP_002868603.1|  hypothetical protein ARALYDRAFT_493844             264   2e-82    
gb|EPS69444.1|  ubiquitin carrier protein                               263   2e-82    
gb|KFK33016.1|  hypothetical protein AALP_AA6G319600                    263   2e-82    
ref|XP_008780947.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    264   2e-82    
ref|NP_568589.1|  ubiquitin-conjugating enzyme E2 4                     263   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405362.1|  hypothetical protein EUTSA_v10027948mg             263   2e-82    
ref|XP_006286283.1|  hypothetical protein CARUB_v10007860mg             263   2e-82    
ref|XP_009381639.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    262   2e-82    
ref|NP_001266400.1|  putative ubiquitin-conjugating enzyme family       270   3e-82    
ref|XP_009791637.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    263   3e-82    
ref|XP_008647901.1|  PREDICTED: putative ubiquitin-conjugating en...    269   3e-82    
ref|XP_011036629.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       263   3e-82    
ref|XP_002320806.1|  ubiquitin carrier protein 4                        263   3e-82    Populus trichocarpa [western balsam poplar]
emb|CDX95674.1|  BnaC03g25550D                                          263   3e-82    
ref|XP_009389296.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    263   3e-82    
ref|XP_009367807.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    263   4e-82    
ref|XP_011092673.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    262   5e-82    
ref|XP_010441297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    262   5e-82    
gb|AAA32900.1|  ubiquitin conjugating enzyme                            262   8e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142401.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    261   1e-81    
ref|XP_006827545.1|  hypothetical protein AMTR_s00009p00214490          261   1e-81    
ref|XP_009140085.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       261   1e-81    
gb|KHN46724.1|  Ubiquitin-conjugating enzyme E2 5                       262   1e-81    
ref|XP_007051763.1|  Ubiquitin-conjugating enzyme E2 5 isoform 1        261   2e-81    
ref|XP_002974421.1|  ubiquitin-conjugating enzyme 5, E2                 260   3e-81    
ref|XP_003558810.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    260   3e-81    
ref|XP_010940563.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    261   3e-81    
ref|XP_007160084.1|  hypothetical protein PHAVU_002G291200g             259   4e-81    
ref|XP_010275656.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    259   1e-80    
ref|XP_003627554.1|  Ubiquitin carrier protein                          258   2e-80    
ref|XP_010553532.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    257   5e-80    
emb|CDY27337.1|  BnaC04g50680D                                          257   8e-80    
ref|XP_010913546.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    257   2e-79    
ref|XP_010913547.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    256   2e-79    
ref|XP_010508073.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6       255   4e-79    
ref|XP_002882046.1|  ubiquitin-conjugating enzyme 6                     254   5e-79    
ref|NP_566062.1|  ubiquitin-conjugating enzyme E2 6                     254   5e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533643.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    254   9e-79    
ref|XP_010506595.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    253   1e-78    
ref|XP_010940567.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    253   1e-78    
ref|XP_008787423.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    252   2e-78    
gb|KDO66251.1|  hypothetical protein CISIN_1g030996mg                   252   2e-78    
ref|XP_010658145.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    252   4e-78    
ref|XP_006295060.1|  hypothetical protein CARUB_v10024128mg             252   4e-78    
ref|XP_006465385.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    250   7e-78    
gb|AFK33447.1|  unknown                                                 251   1e-77    
ref|XP_010518259.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    251   1e-77    
ref|XP_009397721.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    250   2e-77    
gb|AFK45061.1|  unknown                                                 250   3e-77    
ref|XP_010918820.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       248   4e-77    
ref|NP_001064719.1|  Os10g0447100                                       247   8e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010933129.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    248   1e-76    
ref|XP_006598954.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    247   1e-76    
gb|KDP25854.1|  hypothetical protein JCGZ_22884                         248   2e-76    
gb|KFK37384.1|  hypothetical protein AALP_AA4G250300                    247   3e-76    
ref|XP_006405361.1|  hypothetical protein EUTSA_v10027948mg             246   4e-76    
ref|XP_010935784.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    248   7e-76    
ref|XP_010935785.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    248   8e-76    
ref|XP_006586692.1|  PREDICTED: uncharacterized protein LOC100805...    245   1e-75    
gb|KHN29339.1|  Ubiquitin-conjugating enzyme E2 5                       246   1e-75    
gb|EYU42972.1|  hypothetical protein MIMGU_mgv1a0146272mg               244   1e-75    
ref|XP_007051766.1|  Ubiquitin-conjugating enzyme E2 5 isoform 4        245   1e-75    
ref|XP_008360712.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    245   1e-75    
ref|XP_008647825.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    245   1e-75    
ref|XP_005650676.1|  ubiquitin conjugating enzyme                       246   1e-75    
gb|KGN56505.1|  hypothetical protein Csa_3G121800                       244   3e-75    
ref|XP_006580568.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    244   3e-75    
gb|EPS57624.1|  ubiquitin carrier protein                               242   8e-75    
ref|XP_011028600.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    242   1e-74    
gb|KDO86232.1|  hypothetical protein CISIN_1g030092mg                   242   2e-74    
ref|XP_004155833.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    242   2e-74    
emb|CCG82921.1|  Ubiquitin-conjugating enzyme E2 8                      243   2e-74    
ref|XP_002955388.1|  hypothetical protein VOLCADRAFT_65865              243   2e-74    
ref|XP_009783360.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    241   5e-74    
ref|XP_010913551.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    241   6e-74    
ref|XP_008360711.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    241   7e-74    
gb|ADE77794.1|  unknown                                                 241   7e-74    
ref|XP_009628119.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    240   9e-74    
gb|EMT26310.1|  Ubiquitin-conjugating enzyme E2-23 kDa                  241   1e-73    
ref|XP_007268439.1|  hypothetical protein FOMMEDRAFT_125850             240   1e-73    
ref|XP_006584539.1|  PREDICTED: uncharacterized protein LOC100527...    240   1e-73    
ref|XP_007051765.1|  Ubiquitin-conjugating enzyme E2 5 isoform 3        241   2e-73    
gb|AAG52444.1|AC010852_1  putative ubiquitin-conjugating enzyme; ...    239   2e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KDN40970.1|  putative ubiquitin-conjugating enzyme e2-23 kda         240   3e-73    
ref|XP_010559098.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    239   3e-73    
ref|NP_001241807.1|  ubiquitin-conjugating enzyme E2-21 kDa 1           238   5e-73    
ref|XP_010940565.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    239   6e-73    
ref|XP_005849389.1|  hypothetical protein CHLNCDRAFT_57433              239   6e-73    
gb|ACG24713.1|  ubiquitin-conjugating enzyme E2-21 kDa 1                238   6e-73    Zea mays [maize]
ref|XP_007382143.1|  hypothetical protein PUNSTDRAFT_119552             238   9e-73    
ref|XP_007405457.1|  hypothetical protein MELLADRAFT_41986              238   2e-72    
gb|KEH21089.1|  ubiquitin-conjugating enzyme                            236   2e-72    
ref|XP_008374901.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    236   3e-72    
emb|CAA50503.1|  ubiquitin carrier protein                              237   3e-72    Arabidopsis thaliana [mouse-ear cress]
gb|EGU78302.1|  hypothetical protein FOXB_11163                         236   6e-72    
gb|KDE04596.1|  ubiquitin-conjugating enzyme E2 8                       236   6e-72    
ref|XP_004347903.1|  ubiquitin-protein ligase                           236   1e-71    
gb|KFH71855.1|  ubiquitin-conjugating enzyme E2 8                       235   1e-71    
ref|XP_006295061.1|  hypothetical protein CARUB_v10024128mg             234   1e-71    
gb|ESA07486.1|  hypothetical protein GLOINDRAFT_349458                  235   1e-71    
ref|XP_001690015.1|  ubiquitin conjugating enzyme E2                    235   2e-71    Chlamydomonas reinhardtii
ref|XP_007880708.1|  hypothetical protein PFL1_04988                    235   2e-71    
emb|CDH55830.1|  ubiquitin-conjugating enzyme e2 8                      234   2e-71    
emb|CDS09344.1|  Putative Ubiquitin-conjugating enzyme E2 8             234   2e-71    
ref|XP_006679982.1|  hypothetical protein BATDEDRAFT_35380              234   3e-71    
ref|NP_001148188.1|  ubiquitin-conjugating enzyme E2-21 kDa 1           234   3e-71    Zea mays [maize]
emb|CBQ73369.1|  probable ubiquitin-conjugating enzyme e2-23 kda        234   5e-71    
emb|CCF52557.1|  probable ubiquitin-conjugating enzyme e2-23 kda        234   6e-71    
dbj|GAA95767.1|  hypothetical protein E5Q_02424                         233   7e-71    
ref|XP_001906091.1|  hypothetical protein                               233   7e-71    Podospora anserina S mat+
ref|XP_008034846.1|  hypothetical protein TRAVEDRAFT_27362              233   8e-71    
emb|CDX95675.1|  BnaC03g25560D                                          233   8e-71    
ref|XP_002493011.1|  Ubiquitin-conjugating enzyme that negatively...    233   1e-70    
ref|XP_503847.2|  YALI0E12081p                                          233   1e-70    
ref|XP_001876684.1|  predicted protein                                  232   2e-70    
ref|XP_005707261.1|  ubiquitin-conjugating enzyme E2                    233   2e-70    
ref|XP_007366093.1|  hypothetical protein DICSQDRAFT_86817              232   3e-70    
ref|XP_007875589.1|  hypothetical protein PNEG_03497                    231   3e-70    
emb|CDI53810.1|  probable ubiquitin-conjugating enzyme e2-23 kda        232   3e-70    
ref|XP_007920494.1|  hypothetical protein MYCFIDRAFT_76860              232   3e-70    
gb|EPS95351.1|  hypothetical protein FOMPIDRAFT_1032934                 231   4e-70    
ref|XP_009854632.1|  hypothetical protein NEUTE1DRAFT_96207             231   4e-70    
gb|EST05256.1|  ubiquitin-protein ligase                                233   4e-70    
gb|KDQ21024.1|  hypothetical protein BOTBODRAFT_27040                   231   6e-70    
ref|XP_008351691.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    229   6e-70    
ref|XP_005716365.1|  Ubiquitin-conjugating enzyme, E2                   231   6e-70    
gb|EME49711.1|  hypothetical protein DOTSEDRAFT_40871                   231   7e-70    
ref|XP_003664159.1|  hypothetical protein MYCTH_2111167                 231   8e-70    
dbj|GAC97554.1|  ubiquitin-conjugating enzyme                           231   1e-69    
gb|EPB85018.1|  ubiquitin-conjugating enzyme E2 8                       230   1e-69    
ref|XP_007672937.1|  hypothetical protein BAUCODRAFT_30071              230   1e-69    
ref|XP_001773359.1|  predicted protein                                  229   1e-69    
dbj|GAK65778.1|  ubiquitin-conjugating enzyme E2 8                      230   1e-69    
ref|XP_006694468.1|  putative ubiquitin carrier protein                 231   1e-69    
gb|KDR83726.1|  hypothetical protein GALMADRAFT_236073                  230   1e-69    
dbj|GAC76043.1|  ubiquitin-protein ligase                               234   2e-69    
ref|XP_009267919.1|  Ubiquitin-conjugating enzyme E2 8                  237   3e-69    
gb|KEQ87270.1|  hypothetical protein M438DRAFT_343637                   228   6e-69    
ref|XP_007391644.1|  hypothetical protein PHACADRAFT_249257             228   6e-69    
ref|XP_007862289.1|  ubiquitin--protein ligase                          228   6e-69    
gb|EMS19964.1|  ubiquitin-conjugating enzyme E2 H                       228   6e-69    
emb|CAA73327.1|  ubiquitin-conjugating enzyme type E2                   228   8e-69    
ref|XP_005536164.1|  probable ubiquitin conjugating enzyme E2           230   1e-68    
gb|KDQ28956.1|  hypothetical protein PLEOSDRAFT_61374                   227   1e-68    
emb|CEG73548.1|  Putative Ubiquitin-conjugating enzyme E2 8             227   2e-68    
gb|EJU06180.1|  hypothetical protein DACRYDRAFT_19458                   228   2e-68    
gb|EFA81552.1|  hypothetical protein PPL_05541                          228   2e-68    
gb|ETS00385.1|  ubiquitin-conjugating enzyme h                          227   2e-68    
ref|XP_009397799.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    226   2e-68    
ref|XP_010247939.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    226   2e-68    
emb|CDM35301.1|  Ubiquitin-conjugating enzyme E2 8                      226   3e-68    
gb|EIE82645.1|  ubiquitin-conjugating enzyme E2 8                       226   3e-68    
gb|KFM23973.1|  Ubiquitin-conjugating enzyme E2 5                       227   3e-68    
ref|NP_596617.1|  ubiquitin conjugating enzyme Ubc8 (predicted)         226   4e-68    
gb|EFX01184.1|  ubiquitin-conjugating enzyme h                          226   5e-68    
ref|XP_010255297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    225   5e-68    
emb|CAA63316.1|  ubiquitin--protein ligase                              226   6e-68    
ref|XP_007786132.1|  Ubiquitin-conjugating enzyme E2 8                  226   7e-68    
ref|XP_007303039.1|  ubiquitin-conjugating enzyme                       225   7e-68    
gb|EXV05682.1|  ubiquitin-activating enzyme E2 family protein           226   7e-68    
ref|XP_003650501.1|  hypothetical protein THITE_164359                  225   9e-68    
ref|XP_003036455.1|  ubiquitin-conjugating-protein                      225   1e-67    
gb|EPX71182.1|  ubiquitin conjugating enzyme Ubc8                       225   1e-67    
ref|XP_008599556.1|  ubiquitin-conjugating enzyme                       225   1e-67    
gb|EMF16740.1|  ubiquitin-conjugating enzyme E2-21 kDa 2                225   1e-67    
ref|XP_007338063.1|  hypothetical protein AURDEDRAFT_110494             225   1e-67    
ref|XP_006955762.1|  hypothetical protein WALSEDRAFT_59010              224   3e-67    
gb|EUN27589.1|  hypothetical protein COCVIDRAFT_37296                   224   3e-67    
ref|XP_007684347.1|  hypothetical protein COCMIDRAFT_85460              224   3e-67    
ref|XP_001837183.2|  ubiquitin-conjugating enzyme                       224   3e-67    
ref|XP_007773392.1|  ubiquitin-conjugating enzyme                       223   5e-67    
ref|XP_007730641.1|  ubiquitin-conjugating enzyme E2 8                  223   6e-67    
gb|EXX79120.1|  E2 ubiquitin-conjugating protein UBC8                   222   8e-67    
ref|XP_007844616.1|  ubiquitin-conjugating enzyme h                     229   8e-67    
gb|EPY53623.1|  ubiquitin conjugating enzyme Ubc8                       223   8e-67    
gb|KEF51743.1|  ubiquitin-conjugating enzyme E2 8                       223   8e-67    
ref|XP_005706624.1|  ubiquitin-conjugating enzyme E2                    223   9e-67    
ref|XP_007719409.1|  ubiquitin-conjugating enzyme E2 8                  223   1e-66    
ref|XP_001394668.2|  ubiquitin-conjugating enzyme E2 8                  223   1e-66    
gb|KDQ64512.1|  hypothetical protein JAAARDRAFT_166836                  222   1e-66    
emb|CAK96987.1|  unnamed protein product                                222   1e-66    
ref|XP_009543669.1|  hypothetical protein HETIRDRAFT_425501             221   2e-66    
ref|XP_002557642.1|  Pc12g08100                                         222   2e-66    
gb|KIH90221.1|  ubiquitin-conjugating enzyme E2 H                       222   2e-66    
ref|XP_009158176.1|  ubiquitin-conjugating enzyme E2 8                  222   2e-66    
gb|KEQ61405.1|  hypothetical protein M437DRAFT_85856                    222   3e-66    
ref|XP_004366442.1|  Putative E2                                        222   3e-66    
gb|AFR97603.1|  ubiquitin-conjugating enzyme E2 H                       223   3e-66    
ref|XP_003298790.1|  hypothetical protein PTT_09607                     222   4e-66    
ref|XP_001268055.1|  ubiquitin-conjugating enzyme h                     221   5e-66    
ref|XP_002172123.1|  ubiquitin conjugating enzyme Ubc8                  221   6e-66    
gb|EHK48290.1|  hypothetical protein TRIATDRAFT_146505                  221   6e-66    
ref|XP_008718299.1|  ubiquitin-conjugating enzyme E2 8                  220   7e-66    
dbj|GAM19728.1|  hypothetical protein SAMD00019534_029030               221   8e-66    
ref|XP_007742766.1|  ubiquitin-conjugating enzyme E2 8                  220   8e-66    
ref|XP_003001904.1|  ubiquitin-conjugating enzyme                       220   1e-65    
ref|XP_007752403.1|  ubiquitin-conjugating enzyme E2 8                  220   1e-65    
ref|XP_008721807.1|  ubiquitin-conjugating enzyme E2 8                  220   1e-65    
gb|KGO72464.1|  Ubiquitin-conjugating enzyme, E2                        221   1e-65    
ref|XP_641236.1|  hypothetical protein DDB_G0280091                     218   6e-65    
ref|XP_007002480.1|  hypothetical protein TREMEDRAFT_37661              219   8e-65    
emb|CEJ91747.1|  Putative Ubiquitin-conjugating enzyme                  218   9e-65    
ref|XP_008438029.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    217   9e-65    
emb|CCO26476.1|  ubiquitin-conjugating enzyme E2 H                      217   1e-64    
ref|XP_457242.2|  DEHA2B06512p                                          217   1e-64    
gb|KFY77199.1|  hypothetical protein V499_03362                         218   2e-64    
gb|KEP50321.1|  ubiquitin-conjugating enzyme E2                         216   2e-64    
ref|XP_003324644.2|  ubiquitin-conjugating enzyme E2 8                  216   2e-64    
ref|XP_006669273.1|  Ubiquitin-conjugating enzyme                       218   2e-64    
gb|ESX01162.1|  Ubiquitin-conjugating enzyme E2 8                       216   3e-64    
ref|XP_007315619.1|  hypothetical protein SERLADRAFT_367087             215   4e-64    
ref|XP_001383392.1|  hypothetical protein PICST_57900                   216   4e-64    
gb|EXX79122.1|  E2 ubiquitin-conjugating protein UBC8                   214   7e-64    
ref|XP_009529493.1|  hypothetical protein PHYSODRAFT_354813             214   8e-64    
ref|XP_009261095.1|  hypothetical protein FPSE_09703                    216   9e-64    
gb|KHG12307.1|  Ubiquitin-conjugating enzyme E2 5 -like protein         214   9e-64    
gb|KEH18845.1|  ubiquitin-conjugating enzyme                            213   1e-63    
emb|CDI81712.1|  ubiquitin-conjugating enzyme e2, putative              215   1e-63    
ref|XP_004341551.1|  ubiquitinprotein ligase                            214   1e-63    
ref|XP_005824619.1|  hypothetical protein GUITHDRAFT_158581             214   2e-63    
ref|XP_009649614.1|  ubiquitin-conjugating enzyme                       214   2e-63    
ref|XP_008901421.1|  hypothetical protein, variant 1                    213   2e-63    
ref|XP_003852932.1|  hypothetical protein MYCGRDRAFT_70925              214   2e-63    
ref|XP_009494520.1|  ubiquitin-conjugating enzyme E2 H, variant         216   3e-63    
ref|XP_003867944.1|  Ubc8 protein                                       214   3e-63    
ref|XP_003065972.1|  Ubiquitin-conjugating enzyme E2-21 kDa 2 , p...    213   3e-63    
emb|CCM02495.1|  predicted protein                                      213   4e-63    
gb|KEQ74345.1|  ubiquitin-conjugating enzyme                            214   4e-63    
emb|CCE40645.1|  hypothetical protein CPAR2_106800                      213   4e-63    
ref|XP_007372314.1|  hypothetical protein SPAPADRAFT_58026              213   5e-63    
ref|XP_001931954.1|  ubiquitin-conjugating enzyme E2 H                  213   5e-63    
ref|XP_002797359.1|  ubiquitin-conjugating enzyme                       213   5e-63    
ref|XP_010940569.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    211   6e-63    
ref|XP_002909127.1|  ubiquitin-conjugating enzyme E2, putative          212   6e-63    
emb|CCD49367.1|  similar to ubiquitin-conjugating enzyme                213   9e-63    
ref|XP_002550291.1|  ubiquitin-conjugating enzyme E2-21 kDa 2           212   1e-62    
ref|XP_010940568.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    211   1e-62    
gb|ETS62102.1|  hypothetical protein PaG_03662                          217   1e-62    
gb|KDD74288.1|  ubiquitin-conjugating enzyme                            212   1e-62    
ref|XP_003886066.1|  Ubiquitin carrier protein, related                 213   2e-62    
gb|EUC57754.1|  ubiquitin-conjugating enzyme E2                         211   2e-62    
ref|XP_004194772.1|  Piso0_005288                                       211   3e-62    
gb|EJT52901.1|  ubiquitin-conjugating enzyme                            214   3e-62    
ref|XP_712965.1|  hypothetical protein CaO19.4540                       211   3e-62    
ref|XP_006967305.1|  predicted protein                                  210   3e-62    
ref|XP_002416842.1|  ubiquitin carrier protein, putative; ubiquit...    211   3e-62    
gb|EMG46831.1|  Ubiquitin carrier protein                               211   4e-62    
ref|XP_007913483.1|  putative ubiquitin-conjugating enzyme protein      211   4e-62    
gb|KHE87499.1|  hypothetical protein GE21DRAFT_1305975                  210   5e-62    
ref|XP_008888407.1|  ubiquitin-conjugating enzyme subfamily protein     211   9e-62    
ref|XP_007601349.1|  ubiquitin-conjugating enzyme                       209   1e-61    
ref|XP_002371727.1|  ubiquitin-conjugating enzyme E2, putative          211   1e-61    
gb|KFY79713.1|  hypothetical protein V498_08924                         209   1e-61    
ref|XP_957953.1|  hypothetical protein NCU10046                         209   1e-61    
emb|CDJ60917.1|  ubiquitin-conjugating enzyme e2, putative              210   1e-61    
ref|XP_003349160.1|  hypothetical protein SMAC_06996                    209   1e-61    
gb|KFY45963.1|  hypothetical protein V494_00683                         209   1e-61    
ref|XP_001744316.1|  hypothetical protein                               208   1e-61    
ref|XP_006684658.1|  hypothetical protein CANTEDRAFT_112946             209   2e-61    
gb|ERS97822.1|  ubiquitin-conjugating enzyme E2 8                       208   2e-61    
gb|KHN99091.1|  Ubiquitin-conjugating enzyme/RWD-like protein           208   2e-61    
gb|KID93058.1|  ubiquitin-conjugating enzyme h                          209   2e-61    
gb|EZF35186.1|  ubiquitin-conjugating enzyme E2 8                       208   2e-61    
ref|XP_008438030.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    207   3e-61    
ref|XP_004195863.1|  Piso0_005288                                       208   3e-61    
gb|EFQ33524.1|  ubiquitin-conjugating enzyme                            207   4e-61    
ref|XP_001526758.1|  ubiquitin-conjugating enzyme E2-21 kDa 2           208   7e-61    
ref|XP_003046209.1|  predicted protein                                  207   8e-61    
ref|XP_003718439.1|  ubiquitin-conjugating enzyme E2 8                  207   8e-61    
ref|XP_001596063.1|  hypothetical protein SS1G_02279                    207   9e-61    
gb|KDB24337.1|  hypothetical protein H109_03782                         207   9e-61    
ref|WP_028830608.1|  hypothetical protein                               208   9e-61    
gb|KIE03742.1|  ubiquitin-conjugating enzyme h                          207   9e-61    
gb|ENH69597.1|  Ubiquitin-conjugating enzyme E2 8                       207   1e-60    
gb|AAG52422.1|AC011622_10  putative ubiquitin-protein ligase, 5' ...    206   1e-60    
ref|XP_389489.1|  hypothetical protein FG09313.1                        207   1e-60    
gb|EJY82170.1|  Ubiquitin-conjugating enzyme E2, putative               208   1e-60    
ref|XP_007276681.1|  ubiquitin-conjugating enzyme                       206   1e-60    
ref|XP_007783473.1|  ubiquitin-conjugating enzyme E2 H                  207   1e-60    
ref|XP_750804.2|  ubiquitin conjugating enzyme Ubc8                     207   2e-60    
ref|XP_003967338.1|  PREDICTED: ubiquitin-conjugating enzyme E2 H...    206   2e-60    
ref|XP_008817154.1|  ubiquitin-conjugating enzyme E2 H                  206   2e-60    
gb|EMS49462.1|  Ubiquitin-conjugating enzyme E2 5                       205   2e-60    
gb|EAS03853.3|  ubiquitin-conjugating enzyme                            209   2e-60    
gb|EMR85631.1|  putative ubiquitin-conjugating enzyme protein           207   2e-60    
ref|XP_007809081.1|  ubiquitin-conjugating enzyme h                     206   2e-60    
gb|EGD95067.1|  hypothetical protein TESG_02560                         206   3e-60    
ref|XP_002261863.1|  Ubiquitin-conjugating enzyme                       206   3e-60    
pdb|2ONU|A  Chain A, Plasmodium Falciparum Ubiquitin Conjugating ...    204   3e-60    
ref|XP_680273.1|  ubiquitin-conjugating enzyme                          206   3e-60    
gb|KEY70736.1|  hypothetical protein S7711_03232                        207   3e-60    
ref|XP_449495.1|  hypothetical protein                                  207   3e-60    
emb|CCE34414.1|  probable ubiquitin-conjugating enzyme e2-23 kda        207   4e-60    
ref|XP_001608431.1|  ubiquitin-conjugating enzyme                       206   4e-60    
ref|XP_008681159.1|  PREDICTED: uncharacterized protein LOC100193...    206   4e-60    
gb|ETB58848.1|  hypothetical protein YYC_03616                          206   4e-60    
ref|XP_004221497.1|  ubiquitin-conjugating enzyme                       206   4e-60    
emb|CDO64769.1|  ubiquitin conjugating enzyme, putative                 206   4e-60    
ref|XP_567303.1|  hypothetical protein CNJ00500                         207   4e-60    
gb|KFH41208.1|  Ubiquitin-conjugating enzyme E2-like protein            205   4e-60    
gb|KFZ23369.1|  hypothetical protein V502_02145                         206   5e-60    
gb|EPQ64207.1|  hypothetical protein BGT96224_A20385                    204   5e-60    
gb|EPE04835.1|  ubiquitin-conjugating enzyme h                          204   5e-60    
emb|CCK71601.1|  hypothetical protein KNAG_0H01870                      206   5e-60    
ref|XP_001347614.1|  ubiquitin conjugating enzyme, putative             205   6e-60    
ref|XP_010252951.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    204   6e-60    
ref|XP_007294326.1|  ubiquitin-conjugating enzyme h                     204   6e-60    
gb|EER41594.1|  ubiquitin-conjugating enzyme E2                         204   6e-60    
gb|EGE03752.1|  ubiquitin-conjugating enzyme h                          204   7e-60    
gb|EKV12518.1|  Ubiquitin carrier protein                               205   7e-60    
ref|XP_002340782.1|  ubiquitin conjugating enzyme Ubc8, putative        204   7e-60    
gb|KFY17897.1|  hypothetical protein V492_00306                         205   8e-60    
ref|XP_010885597.1|  PREDICTED: ubiquitin-conjugating enzyme E2 H...    204   8e-60    
gb|EQB51980.1|  ubiquitin-conjugating enzyme                            205   9e-60    
gb|EGE77566.1|  ubiquitin carrier protein                               205   9e-60    
gb|KGO41002.1|  Ubiquitin-conjugating enzyme, E2                        204   1e-59    
ref|XP_001024098.2|  Ubiquitin-conjugating enzyme family protein        210   1e-59    
emb|CDW91337.1|  ubiquitin-conjugating enzyme                           207   1e-59    
ref|XP_451487.1|  hypothetical protein                                  204   1e-59    
gb|KEZ42981.1|  hypothetical protein SAPIO_CDS5432                      211   2e-59    
gb|ACO13596.1|  Ubiquitin-conjugating enzyme E2 H                       204   2e-59    
ref|XP_001487396.1|  hypothetical protein PGUG_00773                    204   2e-59    
gb|KDN72031.1|  putative ubiquitin-conjugating enzyme                   203   2e-59    
ref|XP_011117318.1|  hypothetical protein AOL_s00004g366                204   2e-59    
ref|XP_008020774.1|  hypothetical protein SETTUDRAFT_162302             203   2e-59    
gb|EWY95332.1|  ubiquitin-conjugating enzyme E2 H                       203   2e-59    
gb|EWZ42869.1|  ubiquitin-conjugating enzyme E2 H                       203   2e-59    
ref|XP_010755349.1|  PREDICTED: ubiquitin-conjugating enzyme E2 H...    203   2e-59    
ref|XP_006219975.1|  PREDICTED: ubiquitin-conjugating enzyme E2 H...    203   2e-59    
ref|XP_008313946.1|  PREDICTED: ubiquitin-conjugating enzyme E2 H       203   2e-59    
ref|XP_001258033.1|  ubiquitin-conjugating enzyme h                     203   2e-59    
pdb|2Z5D|A  Chain A, Human Ubiquitin-Conjugating Enzyme E2 H            203   3e-59    



>ref|XP_006340324.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=185

 Score =   323 bits (829),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVE IND I +FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN-ISTQKeesdeelsdeylSGQSDSEDEVA  456
            NGDAASLMMKDK QY+QKVKEYCERYAKKEN + T K+ESD+E+S+E  SGQSDS+DEV 
Sbjct  121  NGDAASLMMKDKNQYEQKVKEYCERYAKKENVVGTPKDESDDEISEEEFSGQSDSDDEVV  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|XP_009592505.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
 ref|XP_009592506.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
 ref|XP_009794391.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
sylvestris]
 ref|XP_009794393.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
sylvestris]
Length=185

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVE IND I +FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI-STQKeesdeelsdeylSGQSDSEDEVA  456
            NGDAASLMMKDK QY+QKVKEYCERYAKKENI  + K+ESDEE+S+E  SGQSDS+DEV 
Sbjct  121  NGDAASLMMKDKNQYEQKVKEYCERYAKKENIVGSPKDESDEEISEEDFSGQSDSDDEVV  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|XP_010037586.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 gb|KCW49310.1| hypothetical protein EUGRSUZ_K02866 [Eucalyptus grandis]
Length=185

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSG-QSDSEDEVA  456
            NGDAASLMMKD+KQYDQKVKEYCERYAKKE+IS  + E D +  +  + G +S  +DE+A
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAKKEHISNSRAEEDSDDEEISVEGSESSDDDEIA  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|XP_004251221.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
 ref|XP_004251222.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
Length=185

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDY VE IND I +FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYKVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN-ISTQKeesdeelsdeylSGQSDSEDEVA  456
            NGDAASLMMKDK QY+QKVKEYCERYAKKEN + T K++SD+E+S+E  SGQS+S+DEV 
Sbjct  121  NGDAASLMMKDKNQYEQKVKEYCERYAKKENVVGTPKDDSDDEISEEEFSGQSESDDEVV  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|XP_011098510.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Sesamum indicum]
Length=187

 Score =   319 bits (817),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 168/187 (90%), Gaps = 3/187 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVEPIND IN+FNVEFHGPKES YEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKE---NISTQKeesdeelsdeylSGQSDSEDE  462
            NGDAASLMMKDK QY+QKVKEYCERYAKKE   N  T   E +   ++ +  G+SDS+DE
Sbjct  121  NGDAASLMMKDKAQYEQKVKEYCERYAKKEHMDNTLTDDSEVEVSDNEAFSDGRSDSDDE  180

Query  461  VAGHADP  441
            VAG ADP
Sbjct  181  VAGRADP  187



>ref|XP_007036155.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 ref|XP_007036156.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOY20656.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOY20657.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
Length=184

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDE+SGSVCLDVINQSWSPMFDLLN+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIFHPNVDEMSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD+KQYDQKVKEYCERYAKKENI+    + + +  D        S+DE+AG
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAKKENITKSTADEESDEEDVTDEESKSSDDEIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_010271991.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVEPIND IN+FNVEFHGPKESLYEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVEFHGPKESLYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLL YPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLRYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLM+KD++QY+ KVKEYCERYAK+ENI+    E   +  D        S+DEVAG
Sbjct  121  NGDAASLMLKDQQQYEHKVKEYCERYAKRENITNVPTEESSDDEDISDGECESSDDEVAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_002321579.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ABK95704.1| unknown [Populus trichocarpa]
 gb|EEF05706.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=186

 Score =   315 bits (808),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N FNVEFHGPKESLYEGGVWK+ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLL+YPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI--STQKeesdeelsdeylSGQSDSEDEV  459
            NGDAASLMMKDK+QYDQKVKEYCERYAKKE+I  ST +E SDEE   +  SG SD EDE+
Sbjct  121  NGDAASLMMKDKEQYDQKVKEYCERYAKKEHIMNSTGEELSDEEDVSDEESGSSDEEDEI  180

Query  458  AGHADP  441
            AGH DP
Sbjct  181  AGHVDP  186



>ref|XP_011028598.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Populus euphratica]
 ref|XP_011028599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Populus euphratica]
Length=186

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 170/186 (91%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKES+YEGGVWK+ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESIYEGGVWKIHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLL+YPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI--STQKeesdeelsdeylSGQSDSEDEV  459
            NGDAASLMMKDK+QYDQKVKEYCERYAKKE+I  ST +E SDEE   +  SG SD EDE+
Sbjct  121  NGDAASLMMKDKEQYDQKVKEYCERYAKKEHIMNSTGEELSDEEDVSDEESGSSDEEDEI  180

Query  458  AGHADP  441
            AGH DP
Sbjct  181  AGHVDP  186



>ref|XP_008393051.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008393052.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008393053.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
Length=184

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD+K YDQKVKEYCERYAKKE+I+    + + +  +      + S+D++AG
Sbjct  121  NGDAASLMMKDRKLYDQKVKEYCERYAKKEHITNTTPDEESDDENISDEESNSSDDDIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_010254271.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254278.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254285.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDY VEPIND IN+FNVEFHGPKESLYEGGVWKV VELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVEPINDGINEFNVEFHGPKESLYEGGVWKVHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLL YPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLRYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLM+KD++QY+QKVKEYCE YAK+ENI+    E   +  D      + S+D+VAG
Sbjct  121  NGDAASLMLKDQQQYEQKVKEYCELYAKRENITNVPTEESSDDEDTSDGQSTTSDDDVAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>gb|KDP45387.1| hypothetical protein JCGZ_09636 [Jatropha curcas]
Length=217

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 166/194 (86%), Gaps = 3/194 (2%)
 Frame = -1

Query  1013  KHTTFSRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV  834
             +H    RMSSPSKRRDMDVMKLMMSDY VEPIND I++FNVEFHGPKESLYEGGVWK+ V
Sbjct  24    EHLLNERMSSPSKRRDMDVMKLMMSDYAVEPINDGISEFNVEFHGPKESLYEGGVWKIHV  83

Query  833   ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY  654
             ELPDAYPYKSPSIGFLNKIFHPNVDE+SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY
Sbjct  84    ELPDAYPYKSPSIGFLNKIFHPNVDEMSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY  143

Query  653   PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENIS---TQKeesdeelsdeylSG  483
             PNPSDPLNGDAASLMMKDKKQY++KVKEYCE YAKKENIS   ++    D    +     
Sbjct  144   PNPSDPLNGDAASLMMKDKKQYEEKVKEYCELYAKKENISKTLSEDSNEDNSDEEISDGE  203

Query  482   QSDSEDEVAGHADP  441
              + S+D VAG ADP
Sbjct  204   STSSDDNVAGDADP  217



>gb|EYU44716.1| hypothetical protein MIMGU_mgv1a014494mg [Erythranthe guttata]
 gb|EYU44717.1| hypothetical protein MIMGU_mgv1a014494mg [Erythranthe guttata]
Length=187

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 167/187 (89%), Gaps = 3/187 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDY VEPIND IN+FNVEFHGPKES YEGG WKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVEPINDGINEFNVEFHGPKESPYEGGFWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLN+FEVFLPQLLLYPNP DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPLDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS---TQKeesdeelsdeylSGQSDSEDE  462
            NGDAASLMMKDK QYD KVKEYCERYAKKE+I+   T + + D   +D Y  G+S+SED+
Sbjct  121  NGDAASLMMKDKTQYDLKVKEYCERYAKKEHINNTLTDESDGDVSDNDAYSDGRSESEDD  180

Query  461  VAGHADP  441
            VAG ADP
Sbjct  181  VAGRADP  187



>gb|KHG06323.1| Ubiquitin-conjugating enzyme E2 4 -like protein [Gossypium arboreum]
Length=185

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 169/187 (90%), Gaps = 5/187 (3%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNV+FHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVKFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            +KSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLN+FEVFLPQLLLYPNPSDPL
Sbjct  61   FKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS---TQKeesdeelsdeylSGQSDSEDE  462
            NGDAASLMMKD+KQYDQKVKEYCERYAKKE+I+     KE  DE+   +  +G SD  DE
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAKKEDITKSAADKETDDEDDITDEDTGSSD--DE  178

Query  461  VAGHADP  441
            +AGHADP
Sbjct  179  IAGHADP  185



>ref|XP_002280126.2| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 ref|XP_003634294.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 ref|XP_010663196.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 emb|CBI15064.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAAS+MMK+K QY++KVKEYCERYAKKENI+ ++ E D E  D      + S++++AG
Sbjct  121  NGDAASMMMKNKDQYEKKVKEYCERYAKKENITNERLEEDSEDEDFSDGKSASSDEDIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>gb|KDP31131.1| hypothetical protein JCGZ_11507 [Jatropha curcas]
Length=184

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLM++D+++YDQKVKEYCERYA+KENI     E      D        S++++AG
Sbjct  121  NGDAASLMIRDREKYDQKVKEYCERYARKENIMNSAAEEQSGEEDVSDDESGSSDNDIAG  180

Query  452  HADP  441
            H DP
Sbjct  181  HVDP  184



>gb|AFK44151.1| unknown [Lotus japonicus]
Length=186

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 167/186 (90%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDYTVE IND +++FNVEFHGPKESLYEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            +KSPSIGF+NKIFHPNVDELSGSVCLDVINQ+WSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   FKSPSIGFVNKIFHPNVDELSGSVCLDVINQNWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI--STQKeesdeelsdeylSGQSDSEDEV  459
            NGDAASLMMKDKK YDQKVKEYCERYAKKENI  ST  +ES++E        +  S+DE+
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAKKENITNSTADDESEDEEDISEEEERQSSDDEI  180

Query  458  AGHADP  441
             GHADP
Sbjct  181  PGHADP  186



>ref|XP_004508848.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=185

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDYTVE IND +++FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQS-DSEDEVA  456
            NGDAASLMMKDKK Y+QKVKEYCERYAKKENIS      +E   ++    +S  S+DE+ 
Sbjct  121  NGDAASLMMKDKKLYEQKVKEYCERYAKKENISNNCTSDEESDEEDISEAESQSSDDEIP  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|XP_010532272.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Tarenaya 
hassleriana]
 ref|XP_010532273.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Tarenaya 
hassleriana]
Length=185

 Score =   305 bits (782),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY+VE IND +N+FNVEFHGPKESLYEGGVWK+ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYSVETINDCLNEFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLN+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVA  456
            NGDAASLMM+D+ QYDQKV+EYCERYAKK   +   EE +E   ++   G++ S +DE+A
Sbjct  121  NGDAASLMMRDRTQYDQKVREYCERYAKKNGTAESDEEEEESEEEDVTDGETASTDDEIA  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|XP_007155401.1| hypothetical protein PHAVU_003G198300g [Phaseolus vulgaris]
 gb|ESW27395.1| hypothetical protein PHAVU_003G198300g [Phaseolus vulgaris]
Length=185

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDYTVE IND +++FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQS-DSEDEVA  456
            NGDAASLMMKDKK YDQKVKEYCERYAKKEN S      +    ++     S  S+D++ 
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAKKENNSNSTAGEESGDDEDISEEDSGSSDDDIP  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|XP_007209657.1| hypothetical protein PRUPE_ppa012074mg [Prunus persica]
 ref|XP_008239732.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Prunus 
mume]
 gb|EMJ10856.1| hypothetical protein PRUPE_ppa012074mg [Prunus persica]
Length=184

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD+K YDQKVKEYCERYAKKE+I+    + +    +        S+D++AG
Sbjct  121  NGDAASLMMKDRKLYDQKVKEYCERYAKKEHITNSTPDEESGDENISDEESDSSDDDIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_006439774.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006439775.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006439776.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006476744.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476745.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Citrus sinensis]
 gb|ESR53014.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|ESR53015.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|ESR53016.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|KDO69726.1| hypothetical protein CISIN_1g030037mg [Citrus sinensis]
 gb|KDO69727.1| hypothetical protein CISIN_1g030037mg [Citrus sinensis]
Length=184

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQSWSPMFDLLN+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLNIFESFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD+KQYDQKVKEYCERYAKKENI     + +    +        S+D++AG
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAKKENIVNSTADEESGDEEISEEESESSDDDIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_004298926.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKES+YEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESIYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD+K YDQKVKEYCE+YAKKE+I+    E +    +    G   S+D++AG
Sbjct  121  NGDAASLMMKDRKLYDQKVKEYCEKYAKKEHIANTTPEEESGEENISDEGSDSSDDDIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_006470379.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Citrus sinensis]
Length=187

 Score =   303 bits (776),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 169/187 (90%), Gaps = 3/187 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP KRR+MDVMKLMMSDY+VEPIND I++  VEFHGPK+SLYEGG+WK+RVELPDAYP
Sbjct  1    MSSPCKRREMDVMKLMMSDYSVEPINDGISELKVEFHGPKDSLYEGGIWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQ+WSPMFDLLN+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQTWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST--QKeesdeelsdeylSGQS-DSEDE  462
            NGDAASLMMKD+KQY+Q+VKEYCERYAKKENIS+   +E  ++  +++   GQS  S+D 
Sbjct  121  NGDAASLMMKDRKQYEQRVKEYCERYAKKENISSINSEETDEDISNEDISDGQSTSSDDN  180

Query  461  VAGHADP  441
            +AG ADP
Sbjct  181  IAGVADP  187



>ref|XP_006600652.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Glycine max]
 ref|XP_006600653.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Glycine max]
 gb|KHN18475.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=184

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKDKK YDQKVKEYCERYAKKENIS    E   +  D        S+DE+ G
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAKKENISNSTAEESGDEEDISEEESGSSDDEIPG  180

Query  452  HADP  441
             ADP
Sbjct  181  RADP  184



>gb|AFK44595.1| unknown [Medicago truncatula]
Length=185

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 162/184 (88%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDYTVE IND + +FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLTEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQS-DSEDEVA  456
            NGDAASLMMKDKK YDQKVKEYCERYAKKE+I+    + +E    +    ++  S+DE+ 
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAKKEHITNGTADDEESDEGDISEAETQSSDDEIP  180

Query  455  GHAD  444
            G AD
Sbjct  181  GRAD  184



>ref|XP_006374516.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ERP52313.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=182

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 165/186 (89%), Gaps = 6/186 (3%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N FNVEFHGPKES    GVWK+ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKES----GVWKIHVELPDAYP  56

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLL+YPNPSDPL
Sbjct  57   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  116

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI--STQKeesdeelsdeylSGQSDSEDEV  459
            NGDAASLMMKDK+QYDQKVKEYCERYAKKE+I  ST +E SDEE   +  SG SD EDE+
Sbjct  117  NGDAASLMMKDKEQYDQKVKEYCERYAKKEHIMNSTGEELSDEEDVSDEESGSSDEEDEI  176

Query  458  AGHADP  441
            AGH DP
Sbjct  177  AGHVDP  182



>ref|XP_003608946.1| Ubiquitin carrier protein [Medicago truncatula]
 gb|AES91143.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=185

 Score =   301 bits (770),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 163/184 (89%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDYTVE IND + +FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLTEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQS-DSEDEVA  456
            NGDAASLMMKDKK YDQKVKEYCERYAKKE+I+    + +E   ++    ++  S+DE+ 
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAKKEHITNGTADDEESDEEDISEAETQSSDDEIP  180

Query  455  GHAD  444
            G AD
Sbjct  181  GRAD  184



>ref|XP_010678729.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Beta 
vulgaris subsp. vulgaris]
Length=184

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY+VE IND +N+FN+ F+GPK+SLYEGGVWKV VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYSVETINDGLNEFNILFNGPKDSLYEGGVWKVHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN  DPL
Sbjct  61   YKSPSIGFINKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNALDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD++QY+QKVKEYC+RYAKKEN S Q  E + +  +        S+DE+AG
Sbjct  121  NGDAASLMMKDRQQYEQKVKEYCDRYAKKENFSIQGAEDESDEEEISDGQSESSDDEIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_006853122.1| hypothetical protein AMTR_s00038p00146240 [Amborella trichopoda]
 gb|ERN14589.1| hypothetical protein AMTR_s00038p00146240 [Amborella trichopoda]
Length=184

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +++FNVEF+GP ESLYEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMINDGMHEFNVEFNGPNESLYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGSVCLDVINQ+WSPMFDLLNVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQTWSPMFDLLNVFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMM+D++QY+QKVKEYCERYAK+ENIS   EES +E   E   G+S  E+EVAG
Sbjct  121  NGDAASLMMRDRQQYEQKVKEYCERYAKRENISNAAEESSDEEISEGDDGESSEEEEVAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_010037581.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 ref|XP_010037582.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 gb|KCW49308.1| hypothetical protein EUGRSUZ_K02864 [Eucalyptus grandis]
Length=184

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+ DVMKLMMSDYTVE IND +N+FNVEFHGPKESLYEGGVWK+ V+LPDAYP
Sbjct  1    MSSPSKRRERDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIWVKLPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSI F+NKI+HPNV+E+SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS  L
Sbjct  61   YKSPSIKFVNKIYHPNVNEMSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSSFL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD+KQYDQKVKEYC++YAKKE+IS  + E D +        +S  +DE+AG
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCKQYAKKEHISNSRAEEDSDEEISVEGSESSDDDEIAG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_006579381.1| PREDICTED: uncharacterized protein LOC100527526 isoform X1 [Glycine 
max]
 gb|KHN48608.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=185

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDYTVE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEAFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NGDAASLMMKDK+ YDQKVKEYCERYAKKENI  
Sbjct  121  NGDAASLMMKDKELYDQKVKEYCERYAKKENICN  154



>ref|XP_002511435.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF52037.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=184

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPK SLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKGSLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKD++QYD+KVKEY ++YAKK NI     E   E  D        S++++AG
Sbjct  121  NGDAASLMMKDREQYDEKVKEYLDKYAKKGNIMNSTAEEQSEEEDVSDEESGSSDNDIAG  180

Query  452  HADP  441
            H DP
Sbjct  181  HVDP  184



>ref|XP_010913550.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X5 [Elaeis guineensis]
Length=184

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDY VE IND +++FNVEFHGPKES YEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDLLN+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLM+KD++QY+QKVKEYCERYAK+E           +           ++D++ G
Sbjct  121  NGDAASLMLKDQQQYEQKVKEYCERYAKREKFENASLNGSSDEEISDNESTGSADDDIPG  180

Query  452  HADP  441
             ADP
Sbjct  181  DADP  184



>ref|NP_001237311.1| uncharacterized protein LOC100527526 [Glycine max]
 gb|ACU16622.1| unknown [Glycine max]
Length=185

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDYT+E IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTMETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEAFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NGDAASLMMKDK+ YDQKVKEYCERYAKKENI  
Sbjct  121  NGDAASLMMKDKELYDQKVKEYCERYAKKENICN  154



>ref|XP_008780946.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Phoenix dactylifera]
Length=234

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -1

Query  998  SRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDA  819
            ++MSSPSKRRDMDVMKLMMSDYTVE IND +++FNVEFHGPKES YEGGVWKV VELPDA
Sbjct  49   TKMSSPSKRRDMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESPYEGGVWKVHVELPDA  108

Query  818  YPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSD  639
            YPYKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDL N+FEVFLPQLLLYPNP+D
Sbjct  109  YPYKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLSNIFEVFLPQLLLYPNPAD  168

Query  638  PLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEV  459
            PLNGDAASLM+KD++QY+QKVKEYCERYAK+E       +   +           + D++
Sbjct  169  PLNGDAASLMLKDQQQYEQKVKEYCERYAKREKFENPSFDGSTDEEISDNESTGSANDDI  228

Query  458  AGHADP  441
             G ADP
Sbjct  229  LGAADP  234



>ref|XP_004138119.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_004166497.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 gb|KGN63598.1| hypothetical protein Csa_1G005590 [Cucumis sativus]
Length=188

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 168/188 (89%), Gaps = 4/188 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +++FNVEFHGPKESLYE GVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN--ISTQKeesdeelsdeylSGQSD--SED  465
            NGDAASLMMKD KQYD+KVKEYCERYAKK+N    T ++ES+E+   +  SG S    +D
Sbjct  121  NGDAASLMMKDPKQYDEKVKEYCERYAKKDNDIKCTGEDESEEDEISDNESGSSGKDDDD  180

Query  464  EVAGHADP  441
            +VAGHADP
Sbjct  181  DVAGHADP  188



>ref|XP_002517368.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF44910.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=186

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVEPIND IN+FNV+FHGPK SLYEGGVWK+ VELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVKFHGPKRSLYEGGVWKIHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GFLNKI+HPNVDE+SGSVCLDVINQSW+PMFDL N+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFLNKIYHPNVDEMSGSVCLDVINQSWNPMFDLFNIFEDFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS--TQKeesdeelsdeylSGQSDSEDEV  459
            N DA SLM+KDKK Y++KVKEYCERYAKKENIS    +E +D    D    G + S+D V
Sbjct  121  NSDAGSLMIKDKKLYEEKVKEYCERYAKKENISKTISEERNDISHEDISDGGSTPSDDNV  180

Query  458  AGHAD  444
            AG AD
Sbjct  181  AGEAD  185



>emb|CDP20894.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MDVMKLMMSDY+VE +ND +++FNV FHGPKES YEGGVWKV VELPDAYP
Sbjct  1    MTSPSKRREMDVMKLMMSDYSVETVNDGLSEFNVLFHGPKESTYEGGVWKVHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLN+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASLMMKDK QY+QKVKEYCERYAK ENI   KE+ + E  D      + S+DE+ G
Sbjct  121  NGDAASLMMKDKTQYEQKVKEYCERYAKAENIVKSKEDEESEEEDISDGHCTSSDDEIPG  180

Query  452  HADP  441
              DP
Sbjct  181  LEDP  184



>ref|XP_009381635.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381636.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381637.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381638.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVE  ND + +FNVEFHGPK+S YEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETTNDGLTEFNVEFHGPKQSPYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDLLN+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAASL++KD++QY+QKVKEYCERYAK+E +    + SDE++SD+ ++G SD+ D +AG
Sbjct  121  NGDAASLLLKDQQQYEQKVKEYCERYAKREKLEDVSDGSDEDISDDEVTG-SDNVD-IAG  178

Query  452  HADP  441
             ADP
Sbjct  179  DADP  182



>ref|XP_010107447.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXC16031.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=186

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPK+SLYEGG WK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKDSLYEGGFWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSG+VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGAVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS--TQKeesdeelsdeylSGQSDSEDEV  459
            NGDAASLMMK++K YDQKVKEYCE+YAKKE+I   T +EES +E            +D++
Sbjct  121  NGDAASLMMKNRKLYDQKVKEYCEKYAKKEHIVNMTPEEESGDEEHTADEESDQSDDDDI  180

Query  458  AGHAD  444
            AGHAD
Sbjct  181  AGHAD  185



>ref|XP_008453110.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Cucumis melo]
Length=187

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 165/187 (88%), Gaps = 3/187 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +++FNVEFHGPKESLYE GVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN---ISTQKeesdeelsdeylSGQSDSEDE  462
            NGDAASLMMKD KQYD+KVKEYCERYAKK+N    + + E  ++E+SD         +D+
Sbjct  121  NGDAASLMMKDPKQYDEKVKEYCERYAKKDNNIKCTGEDESEEDEISDNESGSSGGDDDD  180

Query  461  VAGHADP  441
            +AGHADP
Sbjct  181  IAGHADP  187



>ref|XP_007036157.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
 gb|EOY20658.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
Length=169

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYPYKSPSIGF+NKIFHP
Sbjct  1    MMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYPYKSPSIGFMNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQSWSPMFDLLN+FEVFLPQLLLYPNPSDPLNGDAASLMMKD+KQY
Sbjct  61   NVDEMSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKQY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            DQKVKEYCERYAKKENI+    + + +  D        S+DE+AGHADP
Sbjct  121  DQKVKEYCERYAKKENITKSTADEESDEEDVTDEESKSSDDEIAGHADP  169



>gb|KGN64295.1| hypothetical protein Csa_1G045930 [Cucumis sativus]
Length=252

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP+KRRDMDVMKLMMSDY VE I+D +++FNVEF+GPKES+YEGGVWK+ VELPDAYP
Sbjct  79   MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  138

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQ+WSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  139  YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLLNVFEVFLPQLLLYPNPSDPL  198

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS  534
            NGDAASLM+KD+ QYDQKVKEYCERYAK+EN++
Sbjct  199  NGDAASLMLKDRSQYDQKVKEYCERYAKRENVT  231



>ref|XP_004152466.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 1 [Cucumis 
sativus]
 ref|XP_004152467.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 2 [Cucumis 
sativus]
 ref|XP_004157792.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 1 [Cucumis 
sativus]
 ref|XP_004157793.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 2 [Cucumis 
sativus]
 ref|XP_008438150.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Cucumis melo]
 ref|XP_008438158.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Cucumis melo]
Length=183

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP+KRRDMDVMKLMMSDY VE I+D +++FNVEF+GPKES+YEGGVWK+ VELPDAYP
Sbjct  1    MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQ+WSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NGDAASLM+KD+ QYDQKVKEYCERYAK+EN++ 
Sbjct  121  NGDAASLMLKDRSQYDQKVKEYCERYAKRENVTN  154



>ref|XP_002964045.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 ref|XP_002975471.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ23672.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ34378.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=182

 Score =   285 bits (729),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (87%), Gaps = 2/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE +ND +N+FNVEFHGP++S Y+ G WKVRVELP+AYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMVNDGMNEFNVEFHGPRDSPYQTGTWKVRVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+IFHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+ +YDQKVKEYCERYAK E+ +   EES +    +     SD  +E+AG
Sbjct  121  NGEAAALMMRDRDRYDQKVKEYCERYAKSEDTAAHPEESSDAEVTDEDYASSD--EEMAG  178

Query  452  HADP  441
            HADP
Sbjct  179  HADP  182



>ref|XP_010913548.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X3 [Elaeis guineensis]
Length=205

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 155/205 (76%), Gaps = 21/205 (10%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLM---------------------MSDYTVEPINDEINKFNVEFHGP  876
            MSSPSKRRDMDVMK M                     MSDY VE IND +++FNVEFHGP
Sbjct  1    MSSPSKRRDMDVMKFMERCQGAMQTPQYACSVWQGRMMSDYIVETINDGLSEFNVEFHGP  60

Query  875  KESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDL  696
            KES YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDL
Sbjct  61   KESPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDL  120

Query  695  LNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKees  516
            LN+FEVFLPQLLLYPNP+DPLNGDAASLM+KD++QY+QKVKEYCERYAK+E         
Sbjct  121  LNIFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVKEYCERYAKREKFENASLNG  180

Query  515  deelsdeylSGQSDSEDEVAGHADP  441
              +           ++D++ G ADP
Sbjct  181  SSDEEISDNESTGSADDDIPGDADP  205



>ref|XP_010663198.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X2 
[Vitis vinifera]
 ref|XP_010663199.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X2 
[Vitis vinifera]
Length=169

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYPYKSPSIGF+NKIFHP
Sbjct  1    MMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYPYKSPSIGFVNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPLNGDAAS+MMK+K QY
Sbjct  61   NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPLNGDAASMMMKNKDQY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            ++KVKEYCERYAKKENI+ ++ E D E  D      + S++++AGHADP
Sbjct  121  EKKVKEYCERYAKKENITNERLEEDSEDEDFSDGKSASSDEDIAGHADP  169



>ref|XP_001759393.1| predicted protein [Physcomitrella patens]
 gb|EDQ75695.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   280 bits (715),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 161/184 (88%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE +ND +++F VEFHGP+ES Y+ G WK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMVNDGMSEFYVEFHGPRESPYQEGTWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+IFHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D++ Y+QKVKEYCERYAK E+I    E+S ++   E     S S++E+AG
Sbjct  121  NGEAAALMMRDREHYEQKVKEYCERYAKAEDIGRHPEDSSDDELSEEEDCMS-SDEEMAG  179

Query  452  HADP  441
            HADP
Sbjct  180  HADP  183



>ref|XP_011029312.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Populus euphratica]
Length=212

 Score =   280 bits (717),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 159/186 (85%), Gaps = 1/186 (1%)
 Frame = -1

Query  998  SRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDA  819
            ++MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPKESLY+GGVW++RVELPDA
Sbjct  28   AKMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWRIRVELPDA  87

Query  818  YPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSD  639
            YPYKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SD
Sbjct  88   YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASD  147

Query  638  PLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEV  459
            PLNG+AA+LMM+D   YDQ+VKEYCE+YAK E+I  + EE   +         SD +D+V
Sbjct  148  PLNGEAAALMMRDHTGYDQRVKEYCEKYAKPEDIGAKPEEKSSDEEMSADDYNSD-DDQV  206

Query  458  AGHADP  441
            AG ADP
Sbjct  207  AGKADP  212



>gb|ACN39971.1| unknown [Picea sitchensis]
Length=183

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMM DY VE IND +N+F VEF+GP++S Y+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMGDYKVEMINDGMNEFYVEFNGPRDSPYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D++ Y+QKVKEYC RYAK E++  Q+EE   +         S S++EVAG
Sbjct  121  NGEAAALMMRDRQVYEQKVKEYCARYAKPEDVGKQEEEESSDEEVSEDEYGS-SDEEVAG  179

Query  452  HADP  441
            HADP
Sbjct  180  HADP  183



>ref|XP_006343959.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Solanum tuberosum]
Length=183

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEFHGPKES Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFHGPKESPYLGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQ+VKEYCE+YAKKE+     EE   +         S S+DEVAG
Sbjct  121  NGEAAALMMRDRTTYDQRVKEYCEKYAKKEDAGAPPEEKSSDEELSEEENVS-SDDEVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_004245589.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Solanum lycopersicum]
Length=183

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEFHGPKES Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFHGPKESPYLGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQKVKEYCE+YAKKE+     EE   +         S S+DE+AG
Sbjct  121  NGEAAALMMRDRTTYDQKVKEYCEKYAKKEDAGAPPEEKSSDEELSEEENVS-SDDELAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_002298025.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
 gb|ABK95388.1| unknown [Populus trichocarpa]
 gb|EEE82830.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
Length=183

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPKESLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D   YDQ+VKEYCE+YAK E+I  + EE   +         SD +D+VAG
Sbjct  121  NGEAAALMMRDHTAYDQRVKEYCEKYAKPEDIGAKPEEKSSDEELSEDDYNSD-DDQVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_006446454.1| hypothetical protein CICLE_v10018163mg [Citrus clementina]
 gb|ESR59694.1| hypothetical protein CICLE_v10018163mg [Citrus clementina]
Length=172

 Score =   277 bits (708),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 155/172 (90%), Gaps = 3/172 (2%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY+VEPIND I++  VEFHGPK+SLYEGG+WK+RVELPDAYPYKSPSIGF+NKIFHP
Sbjct  1    MMSDYSVEPINDGISELKVEFHGPKDSLYEGGIWKIRVELPDAYPYKSPSIGFVNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDELSGSVCLDVINQ+WSPMFDLLN+FEVFLPQLLLYPNPSDPLNGDAASLMMKD+KQY
Sbjct  61   NVDELSGSVCLDVINQTWSPMFDLLNIFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKQY  120

Query  587  DQKVKEYCERYAKKENIST--QKeesdeelsdeylSGQS-DSEDEVAGHADP  441
            +Q+VKEYCERYAKKENIS+   +E  ++  +++   GQS  S+D +AG ADP
Sbjct  121  EQRVKEYCERYAKKENISSINSEETDEDISNEDISDGQSTSSDDNIAGVADP  172



>ref|XP_010676458.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score =   278 bits (710),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEFHGP +S Y+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPSDSPYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEAFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSG--QSDSEDEV  459
            NG+AA+L+M+DK  Y+Q+VKEYCE+YAK E+I   +E+      +    G   SD +DEV
Sbjct  121  NGEAAALLMRDKATYEQRVKEYCEKYAKPEDIGAVQEDEQSSEEELSEDGYASSDGDDEV  180

Query  458  AGHADP  441
            AG ADP
Sbjct  181  AGKADP  186



>ref|XP_006470380.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Citrus sinensis]
Length=178

 Score =   277 bits (709),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  965  MDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFL  786
            M ++  MMSDY+VEPIND I++  VEFHGPK+SLYEGG+WK+RVELPDAYPYKSPSIGF+
Sbjct  1    MIIIWGMMSDYSVEPINDGISELKVEFHGPKDSLYEGGIWKIRVELPDAYPYKSPSIGFV  60

Query  785  NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMM  606
            NKIFHPNVDELSGSVCLDVINQ+WSPMFDLLN+FEVFLPQLLLYPNPSDPLNGDAASLMM
Sbjct  61   NKIFHPNVDELSGSVCLDVINQTWSPMFDLLNIFEVFLPQLLLYPNPSDPLNGDAASLMM  120

Query  605  KDKKQYDQKVKEYCERYAKKENIST--QKeesdeelsdeylSGQS-DSEDEVAGHADP  441
            KD+KQY+Q+VKEYCERYAKKENIS+   +E  ++  +++   GQS  S+D +AG ADP
Sbjct  121  KDRKQYEQRVKEYCERYAKKENISSINSEETDEDISNEDISDGQSTSSDDNIAGVADP  178



>gb|ABK21140.1| unknown [Picea sitchensis]
Length=183

 Score =   277 bits (709),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MDVMKLMMSDY VE +ND +++FNVEFHGP++S YEGGVWK+RVELPDAYP
Sbjct  1    MASPSKRREMDVMKLMMSDYKVEMLNDGMHEFNVEFHGPQDSPYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQTWSPMFDLVNVFESFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NGDAASLMM+D++QY+QKVKEYCERYA+ EN S 
Sbjct  121  NGDAASLMMRDREQYEQKVKEYCERYARGENGSN  154



>ref|XP_011022652.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Populus euphratica]
Length=183

 Score =   277 bits (708),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPKESLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEIINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN  DPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQNWSPMFDLVNVFEVFLPQLLLYPNALDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D   YDQKVKEYCE+YAK E+I  + EE   +         SD +DEVAG
Sbjct  121  NGEAAALMMRDGTAYDQKVKEYCEKYAKPEDIGARPEEKSSDEELSEDDYHSD-DDEVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>gb|EYU38331.1| hypothetical protein MIMGU_mgv1a014569mg [Erythranthe guttata]
Length=185

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMM+DY VE IND + +F VEFHGPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFFVEFHGPKESPYQEGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQ-KeesdeelsdeylSGQSDSEDEVA  456
            NGDAA+LMM+D+  YDQKVKEYCE+YAK E+     +E+S +E         + S++EVA
Sbjct  121  NGDAAALMMRDRTAYDQKVKEYCEKYAKAEDAGVAPEEKSSDEEELTEDEYAASSDEEVA  180

Query  455  GHADP  441
            G ADP
Sbjct  181  GKADP  185



>ref|XP_006476536.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Citrus sinensis]
 gb|KDO76260.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=184

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPKES Y+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQ+VKE+CE+YAK E+I    EE   +  +      + S++ VAG
Sbjct  121  NGEAAALMMRDRTAYDQRVKEFCEKYAKPEDIGGATEEKSSDDEELSEDEYASSDEAVAG  180

Query  452  HADP  441
              DP
Sbjct  181  QPDP  184



>ref|XP_004510772.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=184

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP +S Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVIFHGPNDSPYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQ+VKEYCE+YAK E+I    EE   +  +        S+++VAG
Sbjct  121  NGEAAALMMRDRATYDQRVKEYCEKYAKPEDIGAATEEKSSDEEELTEDEYDSSDEQVAG  180

Query  452  HADP  441
             ADP
Sbjct  181  KADP  184



>ref|XP_010089080.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXB37327.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=183

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPKES YEGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESPYEGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I   +EE   +         S S++ +AG
Sbjct  121  NGEAAALMMRDRTTYEQRVKEYCEKYAKSEDIGAAEEEKSSDEELSEDEYAS-SDEGMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_010255296.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Nelumbo nucifera]
Length=183

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F+V+F+GP +S Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFHVDFNGPSDSPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAA+LMM+D+  Y+QKVKEYCE+YAK E+I    EE   +         S S+D VAG
Sbjct  121  NGDAAALMMRDRAAYEQKVKEYCEKYAKPEDIGAAMEEKSSDEELSEDEYAS-SDDAVAG  179

Query  452  HADP  441
            HADP
Sbjct  180  HADP  183



>ref|XP_011072993.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Sesamum indicum]
Length=183

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMM+DY VE IND + +F VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVETINDGMQEFYVEFHGPKESPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+     EE   +         S S+DE+AG
Sbjct  121  NGEAAALMMRDRSAYEQRVKEYCEKYAKPEDAGVAGEEKSSDEELTEDEYAS-SDDEIAG  179

Query  452  HADP  441
              DP
Sbjct  180  KVDP  183



>gb|ABK23779.1| unknown [Picea sitchensis]
Length=183

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDV+KLMM DY VE IND +N+F VEF+GP++S Y+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVIKLMMGDYKVEMINDGMNEFYVEFNGPRDSPYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D++ Y+QKVKEYC RYAK +++  Q+EE   +         S S++EVAG
Sbjct  121  NGEAAALMMRDRQVYEQKVKEYCARYAKPKDVGKQEEEESSDEEVSEDEYGS-SDEEVAG  179

Query  452  HADP  441
            HADP
Sbjct  180  HADP  183



>gb|AFK43668.1| unknown [Lotus japonicus]
Length=184

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDYTVE IND + +F V FHGPKES YEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYTVEMINDGMQEFYVHFHGPKESPYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVD++SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDDMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQ+VKEY E++AK E+I    EE   +  +        S+++V G
Sbjct  121  NGEAAALMMRDRATYDQRVKEYIEKFAKPEHIGAATEEKSSDEEELSDEEYDSSDEQVVG  180

Query  452  HADP  441
             ADP
Sbjct  181  KADP  184



>emb|CDP12044.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEFHGPK+S Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+      E   +         S  ++EVAG
Sbjct  121  NGEAAALMMRDRNTYEQRVKEYCEKYAKPEDAGAAPAEKSSDEELSEDEYPSSDDEEVAG  180

Query  452  HADP  441
             ADP
Sbjct  181  KADP  184



>ref|XP_011080934.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Sesamum indicum]
Length=183

 Score =   275 bits (703),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEFHGPK+S Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA++MM+D+  Y+Q+VKEYCE+YAK E+     +E   +         S S+DEVAG
Sbjct  121  NGEAAAMMMRDRNAYEQRVKEYCEKYAKPEDAGAAPDEKSSDEELSEDEYGS-SDDEVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_010940566.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Elaeis guineensis]
Length=184

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPKESLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+     EE   +         S  ED V G
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPPEEDSSDGELSEDEYGSSDEDAVPG  180

Query  452  HADP  441
            + DP
Sbjct  181  NPDP  184



>ref|XP_007209658.1| hypothetical protein PRUPE_ppa012080mg [Prunus persica]
 ref|XP_008238927.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Prunus mume]
 gb|EMJ10857.1| hypothetical protein PRUPE_ppa012080mg [Prunus persica]
Length=184

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+F+GPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPKESPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I    EE   +  D        S+D VAG
Sbjct  121  NGEAAALMMRDRSAYEQRVKEYCEKYAKPEDIGGAPEEKSSDDEDLSEDEYDSSDDAVAG  180

Query  452  HADP  441
             ADP
Sbjct  181  QADP  184



>ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max]
 gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max]
 gb|KHN26954.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I    EE+  +         S S+++VAG
Sbjct  121  NGEAAALMMRDRATYEQRVKEYCEKYAKPEDIGAATEENSSDEELTEDEYDS-SDEQVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Glycine max]
Length=183

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I    EE+  +         S S+++VAG
Sbjct  121  NGEAAALMMRDRATYEQRVKEYCEKYAKPEDIGAATEENSSDEELSEDEYDS-SDEQVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>gb|KHF98807.1| Ubiquitin-conjugating enzyme E2 5 -like protein [Gossypium arboreum]
Length=184

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+S Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I    EE   +         +  ++E+AG
Sbjct  121  NGEAAALMMRDRTSYEQRVKEYCEKYAKPEDIGAVPEEKSSDEELSDDEYAASDDEEIAG  180

Query  452  HADP  441
             ADP
Sbjct  181  KADP  184



>gb|KEH18844.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=185

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSESPYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I    EE   +  +E    + DS DE VA
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKPEDIGAATEEKSSDEDEELTEDEYDSSDEQVA  180

Query  455  GHADP  441
            G ADP
Sbjct  181  GKADP  185



>gb|KDP25412.1| hypothetical protein JCGZ_20568 [Jatropha curcas]
Length=183

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVEFNGPKDSPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I   K E      +      +  +D+VAG
Sbjct  121  NGEAAALMMRDRSAYEQRVKEYCEKYAKAEDIGA-KPEEKSSDEELSDDDYASEDDQVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_010055667.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Eucalyptus 
grandis]
Length=183

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEFHGPK+S Y+GG+W++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYQGGLWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPADPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA++MM+D+  Y+Q+VKEYCE+YAK E++    E+   +         S S+DEVAG
Sbjct  121  NGEAAAIMMRDRGAYEQRVKEYCEKYAKPEDVGAAGEDKSSDEELSEDDYGS-SDDEVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_007135093.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris]
 gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris]
Length=183

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+L+M+D+  Y+Q+VKEYCE+YAK E+I    EE   +         S S+++VAG
Sbjct  121  NGEAAALLMRDRTSYEQRVKEYCEKYAKPEDIGAATEEQSSDEELSEDEYDS-SDEQVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_007040285.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao]
 gb|EOY24786.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao]
Length=184

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPKES Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E++    EE   +         +  ++E+AG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGAAPEEKSSDEELSEDEYAASDDEEIAG  180

Query  452  HADP  441
              DP
Sbjct  181  KPDP  184



>ref|XP_008787422.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Phoenix dactylifera]
Length=184

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPKESLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+SPSIGF+ KI HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVTKICHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+     EE   +         S  ED V G
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPPEEQSSDEELSEDESGSTDEDSVPG  180

Query  452  HADP  441
            + DP
Sbjct  181  NPDP  184



>ref|XP_009790425.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Nicotiana 
sylvestris]
Length=183

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMM+DY VE IND + +F VEFHGPKES Y+GGVWKVRVELPD YP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFYVEFHGPKESPYQGGVWKVRVELPDVYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+I+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINRIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQ+VKEYCE+YAK E+     EE   +         S S++EVAG
Sbjct  121  NGEAAALMMRDRTTYDQRVKEYCEKYAKSEDAGAVPEEKSSDEEVSEEEYAS-SDEEVAG  179

Query  452  HAD  444
             AD
Sbjct  180  KAD  182



>ref|XP_003525387.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Glycine max]
 gb|KHM99960.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMD+MKLMMSDY VE IND + +F VEFHGPK+S Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVETINDGMQEFFVEFHGPKDSPYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEVSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAA+LM++D   Y+Q+VKEYCE+YAK E++   +EES  +         S S+D + G
Sbjct  121  NGDAAALMIRDHATYEQRVKEYCEKYAKPEDVGAAQEESSSDDELSEDDYAS-SDDAIVG  179

Query  452  HADP  441
              DP
Sbjct  180  QPDP  183



>gb|AFK34026.1| unknown [Medicago truncatula]
Length=185

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSESPYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E++    EE   +  +E    + DS DE VA
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKPEDLGAATEEKSSDEDEELTEDEYDSSDEQVA  180

Query  455  GHADP  441
            G ADP
Sbjct  181  GKADP  185



>ref|XP_002304506.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
 gb|EEE79485.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
Length=183

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPKESLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YK PSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN  DPL
Sbjct  61   YKPPSIGFINKIYHPNVDEMSGSVCLDVINQNWSPMFDLVNVFEVFLPQLLLYPNALDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D   YDQ+VKEYCE+YAK E+I  + EE   +         SD +D+VAG
Sbjct  121  NGEAAALMMRDGTAYDQRVKEYCEKYAKPEDIGARPEEKSSDEELSEDDYNSD-DDQVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_004143895.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_004169019.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_008437307.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Cucumis melo]
 gb|KGN50082.1| hypothetical protein Csa_5G152970 [Cucumis sativus]
Length=183

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPK+SLY+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETINDSMQEFYVDFHGPKDSLYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NG+AA++MM+D+  Y+Q+VKEYCE+YAK E+I  
Sbjct  121  NGEAAAVMMRDRTAYEQRVKEYCEKYAKPEDIGA  154



>gb|KDP28606.1| hypothetical protein JCGZ_14377 [Jatropha curcas]
Length=183

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ IND++ +F V FHGP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I   +EE   +        +S  E E+AG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDIGAAEEEKCSDEELTEDEYESHDE-EMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  EADP  183



>ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Vitis vinifera]
 ref|XP_010661801.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Vitis vinifera]
 emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera]
 emb|CBI40397.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP +S Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDSPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E++    EE   +  +        S++ VAG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGAAPEEKSSDEEELSEDDYDSSDEAVAG  180

Query  452  HADP  441
             ADP
Sbjct  181  QADP  184



>ref|XP_006600654.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Glycine max]
Length=160

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N+FNVEFHGPKESLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NGDAASLMMKDKK YDQKVK
Sbjct  121  NGDAASLMMKDKKLYDQKVK  140



>ref|XP_008779270.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=184

 Score =   272 bits (695),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPKESLY+GGVWK+RVELP AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPGAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK ++     EE+  +         S  ED V G
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPDDAGASPEENSSDEELSEDEYGSSDEDVVPG  180

Query  452  HADP  441
            + DP
Sbjct  181  NPDP  184



>ref|XP_010935786.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Elaeis guineensis]
Length=184

 Score =   272 bits (695),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGPKESLY+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+IFHPNVDE+SGSVCLDVINQ+WSPMFDL+N+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINIFEAFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCERYAK E+     EE+  +         S  ED V G
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCERYAKPEDAGAPPEENSSDEEPTEDEYDSSDEDAVPG  180

Query  452  HADP  441
            + DP
Sbjct  181  NPDP  184



>ref|XP_009592682.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Nicotiana 
tomentosiformis]
Length=183

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMM+DY VE IND + +F VEFHGPKES Y+GGVWKVRV LPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFYVEFHGPKESPYQGGVWKVRVGLPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+I+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNRIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQ+VKEYCE+YAK E+     EE   +         S S++EVAG
Sbjct  121  NGEAAALMMRDRTTYDQRVKEYCEKYAKSEDAGAVPEEKSSDEEGSEEEYAS-SDEEVAG  179

Query  452  HAD  444
             AD
Sbjct  180  KAD  182



>ref|XP_002279927.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 isoform X1 [Vitis 
vinifera]
 emb|CAN60588.1| hypothetical protein VITISV_023123 [Vitis vinifera]
 emb|CBI34362.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V+FHGP +S Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPGDSPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK ENI    EE   +      + +S S++ VAG
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPENIGAAPEEKSSDEELSEDNYES-SDEAVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  QADP  183



>ref|XP_009397539.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND I +F V+FHGP ESLY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGIQEFFVDFHGPSESLYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+QKVKEYC++YAK E+I    E+   E         S S+++V G
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCKKYAKPEDIGASPEDESSEEELSEDEYDS-SDEQVVG  179

Query  452  HADP  441
              DP
Sbjct  180  KPDP  183



>ref|XP_008794268.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=183

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V+FHGP ESLY+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNESLYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+QKVKEYCERYAK E+I    E+   +        + DS DE V 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCERYAKPEDIGAPPEDKSSDEELTED--EYDSSDEAVV  178

Query  455  GHADP  441
            G+ DP
Sbjct  179  GNPDP  183



>ref|XP_006374515.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ERP52312.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=159

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +N FNVEFHGPKESLYEGGVWK+ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLL+YPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NGDAASLMMKDK+QYDQKVK
Sbjct  121  NGDAASLMMKDKEQYDQKVK  140



>ref|XP_010275657.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Nelumbo nucifera]
Length=183

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+F+GP +S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPSDSPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK EN+    E+   +         S S++ VAG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPENVGAAVEDQSSDEELSEDEYAS-SDEGVAG  179

Query  452  HADP  441
            HADP
Sbjct  180  HADP  183



>ref|XP_008342748.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008338824.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
Length=183

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND +++F V+FHGP +S+Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVA  456
            NG+AA+LMM+D+  Y+Q+VKE+C +YAK E+I       +E   +E    +SDS +D+VA
Sbjct  121  NGEAAALMMRDRPAYEQRVKEFCLKYAKPEDIGAAP--EEESSDEEMSDAESDSCDDQVA  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GQADP  183



>ref|XP_009375015.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Pyrus 
x bretschneideri]
Length=183

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+F GPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFKGPKESPYQEGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YDQ+VKEYCE+YAK+E++    EE   +         S  +D VAG
Sbjct  121  NGEAAALMMRDRTAYDQRVKEYCEKYAKEEDVGGAPEEQSSDEELSEDEYDS-GDDAVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  QADP  183



>ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Glycine max]
 gb|KHM99359.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGP +S Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I   +   ++   +E    + DS DE V 
Sbjct  121  NGEAAALMMRDRPSYEQRVKEYCEKYAKPEDIG--EATEEKSSDEEMSEDEYDSSDEQVV  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GKADP  183



>ref|XP_004306758.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Fragaria vesca 
subsp. vesca]
Length=183

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 159/185 (86%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ IND +++F V+FHGP ES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVA  456
            NG+AA+LMM+D+  Y+Q+VKEYC +YAK E+I       D+   +E    +SDS +D+VA
Sbjct  121  NGEAAALMMRDRASYEQRVKEYCLKYAKPEDIGA--VPEDKSSDEELSENESDSCDDQVA  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GQADP  183



>ref|XP_010913549.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X4 
[Elaeis guineensis]
Length=198

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDY VE IND +++FNVEFHGPKES YEGGVWKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDLLN+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NGDAASLM+KD++QY+QKVK
Sbjct  121  NGDAASLMLKDQQQYEQKVK  140



>ref|XP_007218489.1| hypothetical protein PRUPE_ppa012120mg [Prunus persica]
 gb|EMJ19688.1| hypothetical protein PRUPE_ppa012120mg [Prunus persica]
Length=183

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ IND +++F V+FHGP ES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVA  456
            NG+AA+LMM+D+  Y+Q+VKE+C++YAK E+I       D+   +E    +SDS +D+VA
Sbjct  121  NGEAAALMMRDRAAYEQRVKEFCQKYAKPEDIGA--VPEDKSSDEELSEDESDSCDDQVA  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GQADP  183



>sp|P16577.1|UBC4_WHEAT RecName: Full=Ubiquitin-conjugating enzyme E2-23 kDa; AltName: 
Full=Ubiquitin carrier protein; AltName: Full=Ubiquitin-protein 
ligase [Triticum aestivum]
 gb|AAA34309.1| ubiquitin carrier protein [Triticum aestivum]
Length=184

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ IND +++F V FHGPK+S+Y+GGVWKVRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFFVHFHGPKDSIYQGGVWKVRVELTEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AASLMM+DK  Y+ KVKEYCERYAK E+IS ++EE + +       G    ++ + G
Sbjct  121  NGEAASLMMRDKNAYENKVKEYCERYAKPEDISPEEEEEESDEELSDAEGYDSGDEAIMG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_010254946.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254947.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254948.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMM+DY VE IND +++F VEF+GP  SLY GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMTDYKVETINDSVSEFFVEFNGPPNSLYSGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+I+HPN+DE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIYHPNIDEMSGSVCLDVINQTWSPMFDLINIFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+K Y+QKVKE+C RYAK E+I  Q+
Sbjct  121  NGEAAALMMRDRKVYEQKVKEHCARYAKPEDIRGQQ  156



>ref|XP_009349265.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Pyrus 
x bretschneideri]
Length=183

 Score =   270 bits (689),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND +++F V+FHGP +S+Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVA  456
            NG+AA+LMM+D+  Y+Q+VKE+C +YAK E+I       +E   +E    +SDS +D+VA
Sbjct  121  NGEAAALMMRDRPAYEQRVKEFCLKYAKAEDIGAAP--EEESSDEEMSDAESDSCDDQVA  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GQADP  183



>ref|XP_004298815.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   270 bits (689),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE I+D++ +F V+F+GPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETIDDDMQEFFVDFNGPKESPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQNWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+DK  Y+Q+VKE+ E+YAK E+I   +EE   +         S  ++ VAG
Sbjct  121  NGEAAALMMRDKTAYEQRVKEFREKYAKPEDIGAAQEEKSSDEELSEDEYASSDDEAVAG  180

Query  452  HADP  441
             ADP
Sbjct  181  KADP  184



>ref|XP_008233026.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Prunus mume]
Length=183

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ IND +++F V+FHGP ES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVA  456
            NG+AA++MM+D+  Y+Q+VKE+C++YAK E+I       D+   +E    +SDS +D+VA
Sbjct  121  NGEAAAMMMRDRAAYEQRVKEFCQKYAKPEDIGA--VPEDKSSDEELSEDESDSCDDQVA  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GQADP  183



>ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF50552.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=183

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP +S Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNDSPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSED-EVA  456
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I       ++   +E    + DS+D E+A
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPEDIGA--ATEEKSSDEEVSDDEYDSQDEEMA  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GQADP  183



>ref|XP_002509830.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF51217.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=183

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF+GPK+S Y+GG+W++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVEFNGPKDSPYQGGLWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E++  + EE   +         S+ E +VAG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGVKPEEKSSDEELSDDDYGSEDE-QVAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_011023305.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Populus euphratica]
 gb|ABK96745.1| unknown [Populus trichocarpa x Populus deltoides]
Length=183

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F+GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+DK  Y+Q+VKEYCE+YAK E+I    EE   +        +S  +DE+AG
Sbjct  121  NGEAAALMMRDKPAYEQRVKEYCEKYAKPEDIGAAPEEKSSDEELSEDEYES-LDDEMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  QADP  183



>ref|XP_004133859.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
Length=183

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGP ES Y GG+W++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI  537
            NG+AA+LMM+D+  Y+QKVKEYCERYAK E+I
Sbjct  121  NGEAAALMMRDRVAYEQKVKEYCERYAKPEDI  152



>ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=184

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  YD +VKE+C++YAK E++     E      +   +    ++D VAG
Sbjct  121  NGEAAALMMRDRAAYDLRVKEFCQKYAKPEDVGAAAPEEKSSDEELSEAEYDSADDAVAG  180

Query  452  HADP  441
              DP
Sbjct  181  PVDP  184



>ref|XP_004503694.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=183

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMD+MKLMM+DY VE IND + +F VEFHGPK+S Y+ GVWK+RVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMTDYKVEMINDGMQEFFVEFHGPKDSPYQEGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLL YPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLNYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAA+LMM+D   Y+QKVKEYCERYAK E+I    EE+  +         S S+D +AG
Sbjct  121  NGDAAALMMRDCAAYEQKVKEYCERYAKPEDIGATHEENSSDEEQSEDDCAS-SDDAIAG  179

Query  452  HADP  441
              DP
Sbjct  180  EPDP  183



>ref|XP_007139813.1| hypothetical protein PHAVU_008G060900g [Phaseolus vulgaris]
 gb|ESW11807.1| hypothetical protein PHAVU_008G060900g [Phaseolus vulgaris]
Length=183

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPK+S Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPKDSPYLGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+ +VKEYCE+YAK E+I   +   ++   +E    + DS DE V 
Sbjct  121  NGEAAALMMRDRSAYELRVKEYCEKYAKPEDIG--EVTEEKSSDEEMSEDEYDSSDEQVV  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GKADP  183



>ref|NP_001242818.1| uncharacterized protein LOC100805356 [Glycine max]
 gb|ACU13261.1| unknown [Glycine max]
Length=183

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 155/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGP +S Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK +HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKFYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I   +   ++   +E    + DS DE V 
Sbjct  121  NGEAAALMMRDRPSYEQRVKEYCEKYAKPEDIG--EATEEKSSDEEMSEDEYDSSDEQVV  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GKADP  183



>ref|XP_010933128.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Elaeis guineensis]
Length=183

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 157/185 (85%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V+FHGP +SLY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNDSLYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+QKVKEYC+RYAK E+I       D+   +E    + DS DE V 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCQRYAKPEDIGAPP--EDKSSDEELTEDEYDSSDEAVV  178

Query  455  GHADP  441
            G+ DP
Sbjct  179  GNPDP  183



>ref|NP_001236928.1| uncharacterized protein LOC100527756 [Glycine max]
 gb|ACU16916.1| unknown [Glycine max]
 gb|KHN16806.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMD+MKLMMSDY VE +ND + +F VEFHGPK+S Y+GGVWKVRV+LPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVETVNDGMQEFFVEFHGPKDSPYQGGVWKVRVDLPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDE+SGSVCLDVI+Q+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVISQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAA+LM++D   Y+Q+VKEYCE+YAK E++   +EES  +         S S+D + G
Sbjct  121  NGDAAALMIRDHATYEQRVKEYCEKYAKPEDVGAVQEESSSDDEPSEDDYAS-SDDAIVG  179

Query  452  HADP  441
              DP
Sbjct  180  QPDP  183



>ref|XP_009783359.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Nicotiana sylvestris]
Length=183

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWKV+VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKVKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q VKEYC++YAK E++    EE   +         SD E E+AG
Sbjct  121  NGEAAALMMRDRTAYEQSVKEYCQKYAKPEDVGAAAEEKSSDEELSEAEYDSDDE-EMAG  179

Query  452  HADP  441
              DP
Sbjct  180  PVDP  183



>ref|XP_008453111.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Cucumis melo]
Length=171

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MDVMKLMMSDY VE IND +++FNVEFHGPKESLYE GVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NGDAASLMMKD KQYD+KVK
Sbjct  121  NGDAASLMMKDPKQYDEKVK  140



>ref|XP_010913552.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X7 [Elaeis guineensis]
Length=169

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND +++FNVEFHGPKES YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP
Sbjct  1    MMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDELSGS+CLDVINQSWSPMFDLLN+FEVFLPQLLLYPNP+DPLNGDAASLM+KD++QY
Sbjct  61   NVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +QKVKEYCERYAK+E           +           ++D++ G ADP
Sbjct  121  EQKVKEYCERYAKREKFENASLNGSSDEEISDNESTGSADDDIPGDADP  169



>ref|XP_002302592.2| ubiquitin carrier protein 4 [Populus trichocarpa]
 gb|EEE81865.2| ubiquitin carrier protein 4 [Populus trichocarpa]
Length=183

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F+GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+DK  Y+Q+V+EYCE+YAK E+I    EE   +        +S  +DE+AG
Sbjct  121  NGEAAALMMRDKPAYEQRVEEYCEKYAKPEDIGAAPEEKSSDEELSEDEYES-LDDEMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  QADP  183



>ref|XP_002465854.1| hypothetical protein SORBIDRAFT_01g047040 [Sorghum bicolor]
 gb|EER92852.1| hypothetical protein SORBIDRAFT_01g047040 [Sorghum bicolor]
Length=183

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAA+LMM+D+  Y+QKVKEYCE+YAK E+     E+   +         S  E E+ G
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVIPEDKSSDEELSEDENDSGDE-EIMG  179

Query  452  HADP  441
              DP
Sbjct  180  KPDP  183



>ref|XP_004229945.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Solanum lycopersicum]
Length=184

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+ +VKE+C++YAK E++     E      +   +    ++D VAG
Sbjct  121  NGEAAALMMRDRAAYELRVKEFCQKYAKPEDVGAAAPEEKSSDEELSEAEYDSADDAVAG  180

Query  452  HADP  441
              DP
Sbjct  181  PVDP  184



>ref|XP_010670105.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Beta 
vulgaris subsp. vulgaris]
Length=183

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEFHGP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPSESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+     EE+  E         S S++ + G
Sbjct  121  NGEAAALMMRDRAAYEQRVKEYCEKYAKPEDAGAVPEENTSEEELSDDEYAS-SDEAMVG  179

Query  452  HADP  441
             ADP
Sbjct  180  EADP  183



>ref|XP_007051764.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theobroma cacao]
 gb|EOX95921.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theobroma cacao]
Length=183

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I    EE   +         S S+D VAG
Sbjct  121  NGEAAALMMRDRGAYEQRVKEYCEKYAKPEDIGAAPEEKTSDEELSGEDYDS-SDDAVAG  179

Query  452  HADP  441
              DP
Sbjct  180  QPDP  183



>ref|XP_008438028.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Cucumis melo]
Length=183

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGP ES Y GG+W++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI  537
            NG+AA+LMM+D+  Y+QKVKEYCERYAK E+I
Sbjct  121  NGEAAALMMRDRVAYEQKVKEYCERYAKPEDI  152



>ref|XP_010087938.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXB30860.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=183

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 154/185 (83%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGP +S Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPSDSPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+Q+VKEY E+YAK E+I    ++   +        +SDS DE V 
Sbjct  121  NGEAAALMMRDRAAYEQRVKEYREKYAKPEDIGATAKDKSSDEELSED--ESDSGDEQVV  178

Query  455  GHADP  441
            G ADP
Sbjct  179  GQADP  183



>ref|XP_009400670.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V+FHGP ESLY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVDFHGPNESLYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y++KVKEYC++YAK E+I    E+   +         S S+++V G
Sbjct  121  NGEAAALMMRDRPAYEEKVKEYCQKYAKPEDIGASPEDKLSDEELSEDEYDS-SDEQVVG  179

Query  452  HADP  441
              DP
Sbjct  180  KPDP  183



>ref|XP_006302819.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella]
 gb|EOA35717.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella]
Length=214

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+S+YEGGVWK+RVELPDAYP
Sbjct  30   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  89

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  90   YKSPSIGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  149

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAK-KENISTQKeesdeelsdeylSGQSDSEDEVA  456
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK +E+      + +    +    G  + +  +A
Sbjct  150  NGEAAALMMRDRPTYEQRVKEYCEKYAKPREDAEDMSSDDEMSEEEYASDGDDEDDVAIA  209

Query  455  GHADP  441
            G  DP
Sbjct  210  GKLDP  214



>ref|XP_009628118.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Nicotiana tomentosiformis]
Length=183

 Score =   266 bits (681),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AASLMM+D+  Y+ +VKEYC++YAK E++    EE   +         S ++D VAG
Sbjct  121  NGEAASLMMRDRAAYELRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDS-ADDAVAG  179

Query  452  HADP  441
              DP
Sbjct  180  PVDP  183



>dbj|BAK02014.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02064.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87655.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=184

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ IND + +F V FHGP +S+Y+GGVWKVRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMQEFFVHFHGPNDSIYQGGVWKVRVELTEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AASLMM+DK  Y+QKVKEYCERYAK E+IS ++EE + +            ++ + G
Sbjct  121  NGEAASLMMRDKNAYEQKVKEYCERYAKAEDISPEEEEEESDEELSDAEVCDSGDEAIMG  180

Query  452  HADP  441
            HADP
Sbjct  181  HADP  184



>ref|XP_002886384.1| ubiquitin-conjugating enzyme 37 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62643.1| ubiquitin-conjugating enzyme 37 [Arabidopsis lyrata subsp. lyrata]
Length=185

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+S+YEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEV--  459
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK     T++  SD+E+S++  +   D ED+V  
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKP-RADTEEMSSDDEMSEDEYASDCDDEDDVAI  179

Query  458  AGHADP  441
            AG  DP
Sbjct  180  AGKLDP  185



>ref|XP_008801319.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=183

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 154/185 (83%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V FHGP ESLY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVYFHGPNESLYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVF+PQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFIPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+     E+   +        + DS DE V 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPPEDKSSDEELSED--EYDSSDEAVV  178

Query  455  GHADP  441
            G+ DP
Sbjct  179  GNPDP  183



>ref|XP_010430489.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Camelina sativa]
 ref|XP_010473625.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Camelina sativa]
Length=186

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+S+YEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEV--  459
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK      +    DE   ++  +   D ED+V  
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKPREDDEEMSSDDEMSEEDEYASDGDDEDDVAI  180

Query  458  AGHADP  441
            AG  DP
Sbjct  181  AGKLDP  186



>gb|EMT01071.1| Ubiquitin-conjugating enzyme E2 5 [Aegilops tauschii]
Length=185

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP+ESLY+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGMQEFLVEFRGPQESLYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+SPSIGF+NKI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS-TQKeesdeelsdeylSGQSDSEDEVA  456
            NG+AA+L+M+D+  Y+QKVKE+CE+YAK E+   T ++ S +E   E     S  ++ + 
Sbjct  121  NGEAAALLMRDRPAYEQKVKEFCEKYAKPEDAGITPEDNSSDEELSEEDDDDSGDDEPIL  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>gb|ABB47726.2| Ubiquitin-conjugating enzyme E2-23 kDa, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EEC67067.1| hypothetical protein OsI_33825 [Oryza sativa Indica Group]
 gb|EEE51050.1| hypothetical protein OsJ_31710 [Oryza sativa Japonica Group]
Length=183

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+   
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGV  154



>ref|XP_010418415.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Camelina sativa]
Length=186

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+S+YEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEV--  459
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK      +    DE   ++  +   D ED+V  
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKPREGDEEMSSDDEMSEEDEYASDGDDEDDVAI  180

Query  458  AGHADP  441
            AG  DP
Sbjct  181  AGKLDP  186



>ref|XP_011093127.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Sesamum 
indicum]
Length=183

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 153/185 (83%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP +S Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDSPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+QKVKEYC+RYAK E++  + EE   +        + DS DE V 
Sbjct  121  NGEAAALMMRDRAAYEQKVKEYCQRYAKPEDVGAEPEEKSSDEEMSED--EYDSSDEAVV  178

Query  455  GHADP  441
            G  DP
Sbjct  179  GPVDP  183



>ref|XP_004985701.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Setaria italica]
Length=183

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NGDAA+LMM+D+  Y+QKVKEYCE+YAK E+   
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGV  154



>ref|NP_564817.2| ubiquitin-conjugating enzyme E2 5 [Arabidopsis thaliana]
 sp|P42749.2|UBC5_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 5; AltName: Full=Ubiquitin 
carrier protein 5; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 2; AltName: Full=Ubiquitin-protein ligase 
5 [Arabidopsis thaliana]
 gb|AAL67043.1| putative E2, ubiquitin-conjugating enzyme UBC5 [Arabidopsis thaliana]
 gb|AAM45109.1| putative E2, ubiquitin-conjugating enzyme UBC5 [Arabidopsis thaliana]
 gb|AAY44846.1| ubiquitinating enzyme [Arabidopsis thaliana]
 dbj|BAF02237.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AEE34149.1| ubiquitin-conjugating enzyme E2 5 [Arabidopsis thaliana]
Length=185

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 159/186 (85%), Gaps = 3/186 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF GPK+S+YEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEV--  459
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK     T++  SD+E+S++  +   D ED+V  
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKP-RADTEEMSSDDEMSEDEYASDGDDEDDVAI  179

Query  458  AGHADP  441
            AG  DP
Sbjct  180  AGKLDP  185



>ref|XP_002467149.1| hypothetical protein SORBIDRAFT_01g020460 [Sorghum bicolor]
 ref|XP_004982987.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Setaria italica]
 gb|EER94147.1| hypothetical protein SORBIDRAFT_01g020460 [Sorghum bicolor]
Length=183

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPTESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPED  151



>gb|EMS63342.1| Ubiquitin-conjugating enzyme E2 5 [Triticum urartu]
Length=185

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP+ESLY+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGMQEFLVEFRGPEESLYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+SPSIGF+NKI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS-TQKeesdeelsdeylSGQSDSEDEVA  456
            NG+AA+L+M+D+  Y+QKVKE+CE+YAK E+   T ++ S +E   E     S  ++ + 
Sbjct  121  NGEAAALLMRDRPAYEQKVKEFCEKYAKPEDAGITPEDNSSDEELSEEDDDDSGDDEPIL  180

Query  455  GHADP  441
            GHADP
Sbjct  181  GHADP  185



>ref|NP_001132906.1| uncharacterized protein LOC100194405 [Zea mays]
 gb|ACF81944.1| unknown [Zea mays]
 gb|AFW89659.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAK  549
            NGDAA+LMM+D+  Y+QKVKEYCE+YAK
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAK  148



>ref|XP_003557690.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Brachypodium 
distachyon]
Length=186

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 155/186 (83%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V FHGP +S+Y+GGVWKVRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVHFHGPNDSIYQGGVWKVRVELTEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdey-lSGQSDSEDE-V  459
            NGDAA+LMM+D+  YDQKV+EYC+RYAK E+    +EE +    +     G +DS DE +
Sbjct  121  NGDAAALMMRDQSAYDQKVREYCQRYAKPEDAGVDEEEEEPSDEELSDAEGYNDSGDEAI  180

Query  458  AGHADP  441
             G+ DP
Sbjct  181  MGNPDP  186



>emb|CDY62172.1| BnaC06g42330D [Brassica napus]
Length=189

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+ +VKEYC++YAK    S  K   +E   +EY S  ++ +D +AG
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCDKYAKPGESSEDKSSDEELSEEEYCSDDNEDDDAIAG  180

Query  452  HADP  441
              DP
Sbjct  181  QPDP  184



>ref|XP_006491142.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Citrus sinensis]
Length=183

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND I +F V F GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPN+DE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NGDAA+L+M+D+  Y+Q+VKEY E+YAK E+I    +E+  +         S S+D +AG
Sbjct  121  NGDAAALLMRDRAAYEQRVKEYREKYAKAEDIEAAPDENSSDEEMSEDEYNS-SDDAMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>ref|XP_008438167.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Cucumis melo]
Length=176

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 7/154 (5%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP+KRRDMDVMKLMMSDY VE I+D +++FNVEF+GPKES+YEGGVWK+ VELPDAYP
Sbjct  1    MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQ+WSPMF       VFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMF-------VFLPQLLLYPNPSDPL  113

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NGDAASLM+KD+ QYDQKVKEYCERYAK+EN++ 
Sbjct  114  NGDAASLMLKDRSQYDQKVKEYCERYAKRENVTN  147



>ref|XP_006661803.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Oryza brachyantha]
Length=183

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+   
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGV  154



>ref|XP_009125181.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brassica rapa]
 emb|CDX67494.1| BnaA07g15340D [Brassica napus]
Length=184

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+ +VKEYC++YAK    S  K   +E   +EY S  ++ +D +AG
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCDKYAKPGEGSEDKSSDEELSEEEYCSDDNEDDDAIAG  180

Query  452  HADP  441
              DP
Sbjct  181  QPDP  184



>ref|XP_010559097.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE INDE+  F V FHGP +SLY+GGVW++RVELPD+YP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDEMRAFYVRFHGPTDSLYQGGVWRIRVELPDSYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NG+AASLMM+D+  Y+QKVKEYC+RYAK  +I  
Sbjct  121  NGEAASLMMRDRAAYEQKVKEYCKRYAKPVDIGA  154



>ref|XP_009626849.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
Length=183

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWK++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKMKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLTNMFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYC++YAK E++    EE   +         SD E E+AG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDSDDE-EMAG  179

Query  452  HADP  441
              DP
Sbjct  180  PVDP  183



>tpg|DAA49812.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
 tpg|DAA49815.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+
Sbjct  121  NGEAAALMMRDRPVYEQKVKEYCEKYAKPED  151



>ref|XP_010234779.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=184

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
            NG+AA+LMM+D+  Y+QKVKEYC++YAK E+
Sbjct  121  NGEAAALMMRDRPSYEQKVKEYCQKYAKPED  151



>ref|NP_001132171.1| uncharacterized protein LOC100193596 [Zea mays]
 gb|ACF80907.1| unknown [Zea mays]
 gb|AFW68671.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=186

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+
Sbjct  121  NGEAAALMMRDRPVYEQKVKEYCEKYAKPED  151



>ref|XP_010234781.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=184

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
            NG+AA+LMM+D+  Y+QKVKEYC++YAK E+
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCQKYAKPED  151



>ref|XP_008647817.1| PREDICTED: ubiquitin-conjugating enzyme E2-21 kDa 1 isoform X1 
[Zea mays]
 tpg|DAA43379.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ +ND + +F VEF GP ES+Y+GG+W+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NGDAA+LMM+D+  Y+QKVKEYCE+YAK E+   
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGV  154



>ref|XP_009133760.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 [Brassica rapa]
 emb|CDX83382.1| BnaA03g21240D [Brassica napus]
Length=187

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 156/187 (83%), Gaps = 3/187 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ +ND+++ F V FHGP +SLYEGGVWK++VELPDAYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLHMFYVTFHGPTDSLYEGGVWKIKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKe---esdeelsdeylSGQSDSEDE  462
            NG+AASL+M+D+  Y+ KVKEYC+RYAK E+I   +E   + D++ S       SD  DE
Sbjct  121  NGEAASLLMRDRPAYELKVKEYCKRYAKPEDIGAPEEISSDDDDDDSMSERGSDSDDNDE  180

Query  461  VAGHADP  441
            VAG ADP
Sbjct  181  VAGKADP  187



>ref|XP_008780945.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Phoenix dactylifera]
Length=248

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  998  SRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDA  819
            ++MSSPSKRRDMDVMKLMMSDYTVE IND +++FNVEFHGPKES YEGGVWKV VELPDA
Sbjct  49   TKMSSPSKRRDMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESPYEGGVWKVHVELPDA  108

Query  818  YPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSD  639
            YPYKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDL N+FEVFLPQLLLYPNP+D
Sbjct  109  YPYKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLSNIFEVFLPQLLLYPNPAD  168

Query  638  PLNGDAASLMMKDKKQYDQK  579
            PLNGDAASLM+KD++QY+QK
Sbjct  169  PLNGDAASLMLKDQQQYEQK  188



>emb|CDP08792.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ IND + +F V FHGP +S Y GGVWK+RVELPD+YP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDIINDGMQEFYVHFHGPNDSPYHGGVWKIRVELPDSYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYC++YAK E++    EE   +         S S+D VAG
Sbjct  121  NGEAAALMMRDQTAYEQRVKEYCQKYAKPEDVGAVSEEKSSDEELSEDEYDS-SDDAVAG  179

Query  452  HADP  441
              DP
Sbjct  180  PVDP  183



>emb|CDY58954.1| BnaCnng33990D [Brassica napus]
Length=186

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEV--  459
            NG+AA+LMM+D+  Y+ +VKEYCE+YAK    S  K   +E   +EY S  ++ +D+V  
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCEKYAKAGEGSEDKSSDEELSEEEYGSDDNEEDDDVAI  180

Query  458  AGHADP  441
            AG+ DP
Sbjct  181  AGNPDP  186



>gb|KDO86231.1| hypothetical protein CISIN_1g030092mg [Citrus sinensis]
Length=183

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND I +F V F GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPN+DE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+L+M+D+  Y+Q+VKEY E+YAK E+I    +E+  +         S S+D +AG
Sbjct  121  NGEAAALLMRDRAAYEQRVKEYREKYAKAEDIEAAPDENSSDEEMSEDEYNS-SDDAMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  KADP  183



>gb|ACG24376.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
Length=183

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVQMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
            NG+AA+LMM+D+  Y+QKVKEYCE+YAK E+
Sbjct  121  NGEAAALMMRDRPVYEQKVKEYCEKYAKPED  151



>ref|XP_006397787.1| hypothetical protein EUTSA_v10001650mg [Eutrema salsugineum]
 gb|ESQ39240.1| hypothetical protein EUTSA_v10001650mg [Eutrema salsugineum]
Length=189

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 157/189 (83%), Gaps = 5/189 (3%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK-----eesdeelsdeylSGQSDSE  468
            NG+AASL+M+D+  Y+QKVKEYC+ YAK E+I+ Q+     ++ D++ S       SD  
Sbjct  121  NGEAASLLMRDRAAYEQKVKEYCKTYAKPEDIAPQENSSDDDDDDDDDSMSEAGSDSDDN  180

Query  467  DEVAGHADP  441
            +E+AG ADP
Sbjct  181  EEIAGKADP  189



>ref|XP_006358673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=183

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWK++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEISGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+Q+VKEYC++YAK E++       ++   DE    + DS+DE +A
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVGA--VPEEKSSDDELSEAEYDSDDEAMA  178

Query  455  GHADP  441
            G  DP
Sbjct  179  GPVDP  183



>ref|XP_004248050.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
Length=183

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWK++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEISGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+Q+VKEYC++YAK E++       D+   +E    + DS+DE +A
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVGA--VPEDKSSDEELSEAEYDSDDEAMA  178

Query  455  GHADP  441
            G  DP
Sbjct  179  GPVDP  183



>ref|XP_010436081.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Camelina sativa]
Length=188

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDK  156



>ref|XP_002985720.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ13298.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=183

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPS+RR+MDVMKLMMSDY VE +ND +N+F V+F GP +S YE GVWKVRVELPD+YP
Sbjct  1    MSSPSRRREMDVMKLMMSDYKVEMLNDGMNEFIVDFQGPADSPYESGVWKVRVELPDSYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDE SGSVCLDVIN +WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDESSGSVCLDVINHTWSPMFDLVNVFESFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+A SLMM+DK++Y+QKVKEYCERYAK ++   Q    +    +    G + SED+  G
Sbjct  121  NGEAGSLMMRDKEKYEQKVKEYCERYAKPKD--AQTAVEESSDEEISDDGYTSSEDDTMG  178

Query  452  -HADP  441
              ADP
Sbjct  179  WQADP  183



>ref|XP_010447359.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Camelina sativa]
Length=189

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDK  156



>ref|XP_002868603.1| hypothetical protein ARALYDRAFT_493844 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44862.1| hypothetical protein ARALYDRAFT_493844 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDK  156



>gb|EPS69444.1| ubiquitin carrier protein [Genlisea aurea]
Length=186

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY VE IND + +F V FHGP  S Y GGVWK+RVELPDAYP
Sbjct  1    MASPSKRREMDLMKLMMSDYKVETINDGVQEFFVHFHGPSGSPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ WSPMFDL+NVFEVF+PQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIYHPNVDEISGSVCLDVINQKWSPMFDLVNVFEVFMPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKE  543
            NG+AA+LMM+D+  YDQ+VKEYCE+YAK E
Sbjct  121  NGEAAALMMRDRAAYDQRVKEYCEKYAKAE  150



>gb|KFK33016.1| hypothetical protein AALP_AA6G319600 [Arabis alpina]
Length=187

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDK  156



>ref|XP_008780947.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X3 
[Phoenix dactylifera]
 ref|XP_008780948.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X3 
[Phoenix dactylifera]
Length=198

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMDVMKLMMSDYTVE IND +++FNVEFHGPKES YEGGVWKV VELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESPYEGGVWKVHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDL N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLSNIFEVFLPQLLLYPNPADPL  120

Query  632  NGDAASLMMKDKKQYDQK  579
            NGDAASLM+KD++QY+QK
Sbjct  121  NGDAASLMLKDQQQYEQK  138



>ref|NP_568589.1| ubiquitin-conjugating enzyme E2 4 [Arabidopsis thaliana]
 sp|P42748.2|UBC4_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 4; AltName: Full=Ubiquitin 
carrier protein 4; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 1; AltName: Full=Ubiquitin-protein ligase 
4 [Arabidopsis thaliana]
 dbj|BAB08506.1| ubiquitin-conjugating enzyme E2-21 kD 1 (ubiquitin-protein ligase 
4) (ubiquitin carrier protein 4) [Arabidopsis thaliana]
 gb|AAL38801.1| putative E2, ubiquitin-conjugating enzyme UBC4 [Arabidopsis thaliana]
 gb|AAM20237.1| putative ubiquitin-conjugating enzyme E2-21 kD 1 [Arabidopsis 
thaliana]
 gb|AAY44845.1| ubiquitinating enzyme [Arabidopsis thaliana]
 gb|AED94667.1| ubiquitin-conjugating enzyme E2 4 [Arabidopsis thaliana]
Length=187

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDK  156



>ref|XP_006405362.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
 dbj|BAJ34442.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46815.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
Length=187

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDK  156



>ref|XP_006286283.1| hypothetical protein CARUB_v10007860mg [Capsella rubella]
 gb|EOA19181.1| hypothetical protein CARUB_v10007860mg [Capsella rubella]
Length=191

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDK  156



>ref|XP_009381639.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=167

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 153/169 (91%), Gaps = 2/169 (1%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDYTVE  ND + +FNVEFHGPK+S YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP
Sbjct  1    MMSDYTVETTNDGLTEFNVEFHGPKQSPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDELSGS+CLDVINQSWSPMFDLLN+FEVFLPQLLLYPNP+DPLNGDAASL++KD++QY
Sbjct  61   NVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPLNGDAASLLLKDQQQY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +QKVKEYCERYAK+E +    + SDE++SD+ ++G SD+ D +AG ADP
Sbjct  121  EQKVKEYCERYAKREKLEDVSDGSDEDISDDEVTG-SDNVD-IAGDADP  167



>ref|NP_001266400.1| putative ubiquitin-conjugating enzyme family [Zea mays]
 gb|ACR38079.1| unknown [Zea mays]
 tpg|DAA49816.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=370

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  1007  TTFSRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVEL  828
             +  S+MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVEL
Sbjct  183   SPLSKMSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVEL  242

Query  827   PDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN  648
             PDAYPYKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN
Sbjct  243   PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN  302

Query  647   PSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
             PSDPLNG+AA+LMM+D+  Y+QKVKEYCE+YAK E+
Sbjct  303   PSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPED  338


 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+QK K
Sbjct  121  NGEAAALMMRDRPVYEQKGK  140



>ref|XP_009791637.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Nicotiana 
sylvestris]
Length=183

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F GP ES Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFLGPTESPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AASLMM+D+  Y+ +VKEYC++YAK E++    EE   +         S ++D VAG
Sbjct  121  NGEAASLMMRDRAAYELRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDS-ADDAVAG  179

Query  452  HADP  441
              DP
Sbjct  180  PVDP  183



>ref|XP_008647901.1| PREDICTED: putative ubiquitin-conjugating enzyme family isoform 
X1 [Zea mays]
Length=361

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  1007  TTFSRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVEL  828
             +  S+MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVEL
Sbjct  174   SPLSKMSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVEL  233

Query  827   PDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN  648
             PDAYPYKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN
Sbjct  234   PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN  293

Query  647   PSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
             PSDPLNG+AA+LMM+D+  Y+QKVKEYCE+YAK E+
Sbjct  294   PSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPED  329


 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  956  MKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKI  777
            +  MMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYPYKSPSIGF+NKI
Sbjct  4    LSWMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYPYKSPSIGFINKI  63

Query  776  FHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDK  597
            +HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+
Sbjct  64   YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  123

Query  596  KQYDQKVK  573
              Y+QK K
Sbjct  124  PVYEQKGK  131



>ref|XP_011036629.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Populus euphratica]
Length=183

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F+GP ES Y GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+SPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVF+PQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFIPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+DK  Y+ +VKEYCE+YAK E+I    EE   +        +S  +DE+AG
Sbjct  121  NGEAAALMMRDKPAYELRVKEYCEKYAKPEDIGAAPEEKSSDEELSEDEYES-LDDEMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  QADP  183



>ref|XP_002320806.1| ubiquitin carrier protein 4 [Populus trichocarpa]
 gb|EEE99121.1| ubiquitin carrier protein 4 [Populus trichocarpa]
Length=183

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F+GP ES Y GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+SPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVF+PQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFIPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+DK  Y+ +VKEYCE+YAK E+I    EE+  +        +S  +DE+AG
Sbjct  121  NGEAAALMMRDKPAYELRVKEYCEKYAKPEDIGAAPEENSSDEELSEDEYES-LDDEMAG  179

Query  452  HADP  441
             ADP
Sbjct  180  QADP  183



>emb|CDX95674.1| BnaC03g25550D [Brassica napus]
Length=187

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 156/187 (83%), Gaps = 3/187 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ +ND+++ F V FHGP +SLYEGGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLHMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKe---esdeelsdeylSGQSDSEDE  462
            NG+AASL+M+D+  Y+ KVKEYC+RYAK E+I   +E   + D++ S       SD  DE
Sbjct  121  NGEAASLLMRDRPAYELKVKEYCKRYAKPEDIGAPEEISSDDDDDDSMSERGSDSDDNDE  180

Query  461  VAGHADP  441
            +AG ADP
Sbjct  181  IAGKADP  187



>ref|XP_009389296.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLM+SDY VE +ND + +F V+FHGP ESLY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMISDYKVEMVNDGMQEFFVDFHGPNESLYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKEN  540
            NG+AA+LMM+D+  Y+QKVKEYC++YA  E+
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCQKYATPED  151



>ref|XP_009367807.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Pyrus x bretschneideri]
Length=190

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 157/182 (86%), Gaps = 3/182 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND +++F V+FHGP +S+Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVA  456
            NG+AA+LMM+D+  Y+Q+VKE+C +YAK E+I       +E   +E    +SDS +D+VA
Sbjct  121  NGEAAALMMRDRPAYEQRVKEFCLKYAKPEDIGGAP--EEESSDEEMSDAESDSCDDQVA  178

Query  455  GH  450
            G 
Sbjct  179  GR  180



>ref|XP_011092673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Sesamum indicum]
Length=183

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 149/185 (81%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP +S Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTDSPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+LMM+D+  Y+ +V+EYCE+YAK E+     EE   +        + DS DE V 
Sbjct  121  NGEAAALMMRDRGAYEHRVREYCEKYAKAEDAGAAPEEKSSDEELSED--EYDSSDEAVV  178

Query  455  GHADP  441
            G  DP
Sbjct  179  GKVDP  183



>ref|XP_010441297.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Camelina sativa]
Length=189

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RV+LPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVQLPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAK  549
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>gb|AAA32900.1| ubiquitin conjugating enzyme [Arabidopsis thaliana]
Length=187

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D   Y+Q+VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDHPAYEQRVKEYCEKYAKPGEGSEDK  156



>ref|XP_009142401.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Brassica rapa]
 emb|CDY37084.1| BnaA04g26620D [Brassica napus]
Length=189

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 154/189 (81%), Gaps = 5/189 (3%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLYEGGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST-----QKeesdeelsdeylSGQSDSE  468
            NG+AASL+M+D+  Y++KVKEYC+ YAK E+I         ++ DE+ S       SD  
Sbjct  121  NGEAASLLMRDRAAYEKKVKEYCKAYAKPEDIGAPEEISSDDDDDEDDSMSERGSDSDDN  180

Query  467  DEVAGHADP  441
            DE+AG ADP
Sbjct  181  DEIAGKADP  189



>ref|XP_006827545.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda]
 gb|ERM94961.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda]
Length=183

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMD+MKLMMSDY V+ IND + +F V+FHGP ES Y+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVDMINDGMQEFYVDFHGPNESPYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMF+L+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFELVNVFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+V+EY E+YAK E++    +E   +         S S++  AG
Sbjct  121  NGEAAALMMRDRTAYEQRVQEYKEKYAKPEHVGVNPDEKSSDEELSDEEYAS-SDEGFAG  179

Query  452  HADP  441
             ADP
Sbjct  180  QADP  183



>ref|XP_009140085.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Brassica rapa]
 emb|CDY39744.1| BnaA04g11090D [Brassica napus]
Length=186

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLYEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+ +VKEYCE+YAK    S  K
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCEKYAKPGEGSEDK  156



>gb|KHN46724.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=205

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 155/206 (75%), Gaps = 23/206 (11%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK----------------------EYCERYAKKENISTQKee  519
            NG+AA+LMM+D+  Y+Q+VK                      EYCE+YAK E+I    EE
Sbjct  121  NGEAAALMMRDRATYEQRVKVENSMSVIHMYQLFTQVHTLSIEYCEKYAKPEDIGAATEE  180

Query  518  sdeelsdeylSGQSDSEDEVAGHADP  441
            +  +         S S+++VAG ADP
Sbjct  181  NSSDEELSEDEYDS-SDEQVAGKADP  205



>ref|XP_007051763.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOX95920.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
Length=187

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 151/188 (80%), Gaps = 5/188 (3%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK----EYCERYAKKENISTQKeesdeelsdeylSGQSDSED  465
            NG+AA+LMM+D+  Y+Q+VK    EYCE+YAK E+I    EE   +         S S+D
Sbjct  121  NGEAAALMMRDRGAYEQRVKVHHLEYCEKYAKPEDIGAAPEEKTSDEELSGEDYDS-SDD  179

Query  464  EVAGHADP  441
             VAG  DP
Sbjct  180  AVAGQPDP  187



>ref|XP_002974421.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ24643.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=183

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 150/185 (81%), Gaps = 3/185 (2%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPS+RR+MDVMKLMMSDY VE +ND +N+F V+F GP +S YE GVWKVRVELPD+YP
Sbjct  1    MSSPSRRREMDVMKLMMSDYKVEMLNDGMNEFIVDFQGPADSPYESGVWKVRVELPDSYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDE SGSVCLDVIN +WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDESSGSVCLDVINHTWSPMFDLVNVFESFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+A SLMM+DK++Y+QKVKEYCERYAK ++   Q    +    +      + SED+  G
Sbjct  121  NGEAGSLMMRDKERYEQKVKEYCERYAKPKD--AQTAVEESSDGEISDDSYTSSEDDTLG  178

Query  452  -HADP  441
              ADP
Sbjct  179  WQADP  183



>ref|XP_003558810.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=185

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMM DY VE +ND + +F +EF GP ESLY+GGVWKVRVE PDAYP
Sbjct  1    MSSPSKRREMDLMKLMMRDYKVEMVNDGMQEFFIEFRGPNESLYQGGVWKVRVEFPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+SPS+GF NKI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSVGFCNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VA  456
            NG+AA+L+M+D+  Y+QKVKE CE+YAK E+     E++  E      +     +DE + 
Sbjct  121  NGEAAALLMRDRAAYEQKVKECCEKYAKPEDAGITPEDNSSEEEPSEEADDDSGDDEPIL  180

Query  455  GHADP  441
            GH DP
Sbjct  181  GHPDP  185



>ref|XP_010940563.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Elaeis guineensis]
Length=206

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 152/206 (74%), Gaps = 22/206 (11%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKE-------------------  870
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPKE                   
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKEITLEAGRGMHQSLPLLTNF  60

Query  869  ---SLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFD  699
                LY+GGVWK+RVELPDAYPYKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFD
Sbjct  61   RDFGLYQGGVWKIRVELPDAYPYKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFD  120

Query  698  LLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKee  519
            L+NVFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  Y+QKVKEYCE+YAK E+     EE
Sbjct  121  LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPPEE  180

Query  518  sdeelsdeylSGQSDSEDEVAGHADP  441
               +         S  ED V G+ DP
Sbjct  181  DSSDGELSEDEYGSSDEDAVPGNPDP  206



>ref|XP_007160084.1| hypothetical protein PHAVU_002G291200g [Phaseolus vulgaris]
 gb|ESW32078.1| hypothetical protein PHAVU_002G291200g [Phaseolus vulgaris]
Length=183

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRRDMD+MKLMMSDY VE IND + +F VEF GPK+S YE GVWK++VELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVEMINDGMQEFFVEFRGPKDSPYEVGVWKIKVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSG+VCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGAVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            N DAA LM++D   Y+Q+VKEYCE+YAK E+I   ++    E         + S+D + G
Sbjct  121  NSDAA-LMIRDHATYEQRVKEYCEKYAKPEDIGAVEDPDSSEDELSEEDSYASSDDAIVG  179

Query  452  HADP  441
              DP
Sbjct  180  QPDP  183



>ref|XP_010275656.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Nelumbo nucifera]
Length=201

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 19/202 (9%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+F+GP +S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPSDSPYQGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK------------------EYCERYAKKENISTQKeesdee  507
            NG+AA+LMM+D+  Y+Q+VK                  EYCE+YAK EN+    E+   +
Sbjct  121  NGEAAALMMRDRTAYEQRVKVAVLSIDARCFQLLDDNQEYCEKYAKPENVGAAVEDQSSD  180

Query  506  lsdeylSGQSDSEDEVAGHADP  441
                     S S++ VAGHADP
Sbjct  181  EELSEDEYAS-SDEGVAGHADP  201



>ref|XP_003627554.1| Ubiquitin carrier protein [Medicago truncatula]
Length=191

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 155/191 (81%), Gaps = 7/191 (4%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKE---SLYEGGVWKVRVELPD  822
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP E    LY+GGVWKVRVELPD
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSEIDSVLYQGGVWKVRVELPD  60

Query  821  AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSP---MFDLLNVFEVFLPQLLLYP  651
            AYPYKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSP   M  L+NVFEVFLPQLLLYP
Sbjct  61   AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPCLVMIYLVNVFEVFLPQLLLYP  120

Query  650  NPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS  471
            NPSDPLNG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I    EE   +  +E    + DS
Sbjct  121  NPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAKPEDIGAATEEKSSDEDEELTEDEYDS  180

Query  470  EDE-VAGHADP  441
             DE VAG ADP
Sbjct  181  SDEQVAGKADP  191



>ref|XP_010553532.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Tarenaya hassleriana]
Length=189

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+F+GPK+S YEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPKDSPYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSVGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQ  528
            NG+AA+L M+D+  YDQ+VKEY E+YAK EN + +
Sbjct  121  NGEAAALQMRDRAAYDQRVKEYTEKYAKPENTAAE  155



>emb|CDY27337.1| BnaC04g50680D [Brassica napus]
Length=189

 Score =   257 bits (656),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLYEGGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKIFHPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIFHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST  531
            NG+AASL+M+D+  Y++KVKEYC+ YAK E+I  
Sbjct  121  NGEAASLLMRDRAAYEKKVKEYCKAYAKPEDIGA  154



>ref|XP_010913546.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Elaeis guineensis]
Length=219

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 135/161 (84%), Gaps = 21/161 (13%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLM---------------------MSDYTVEPINDEINKFNVEFHGP  876
            MSSPSKRRDMDVMK M                     MSDY VE IND +++FNVEFHGP
Sbjct  1    MSSPSKRRDMDVMKFMERCQGAMQTPQYACSVWQGRMMSDYIVETINDGLSEFNVEFHGP  60

Query  875  KESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDL  696
            KES YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDL
Sbjct  61   KESPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDL  120

Query  695  LNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK  573
            LN+FEVFLPQLLLYPNP+DPLNGDAASLM+KD++QY+QKVK
Sbjct  121  LNIFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVK  161



>ref|XP_010913547.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Elaeis guineensis]
Length=209

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 136/163 (83%), Gaps = 21/163 (13%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLM---------------------MSDYTVEPINDEINKFNVEFHGP  876
            MSSPSKRRDMDVMK M                     MSDY VE IND +++FNVEFHGP
Sbjct  1    MSSPSKRRDMDVMKFMERCQGAMQTPQYACSVWQGRMMSDYIVETINDGLSEFNVEFHGP  60

Query  875  KESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDL  696
            KES YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS+CLDVINQSWSPMFDL
Sbjct  61   KESPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDL  120

Query  695  LNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY  567
            LN+FEVFLPQLLLYPNP+DPLNGDAASLM+KD++QY+QKVK +
Sbjct  121  LNIFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVKAF  163



>ref|XP_010508073.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 [Camelina sativa]
Length=187

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSED----  465
            NG+AASL+M+D+  Y+ KVKEYC++YA+ E  ++  ++ D++      +G SDS+D    
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCDKYAQPEKENSSDDDDDDDDDSMSENG-SDSDDDDAN  179

Query  464  EVAGHADP  441
            E+ G ADP
Sbjct  180  EIVGKADP  187



>ref|XP_002882046.1| ubiquitin-conjugating enzyme 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58305.1| ubiquitin-conjugating enzyme 6 [Arabidopsis lyrata subsp. lyrata]
Length=186

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAK--KENISTQKeesdeelsdeylSGQSDSEDEV  459
            NG+AASL+M+D+  Y+ KVKEYCE+YAK  KEN+S   E+ D++   E  S   D +DE+
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCEKYAKPEKENLSDDDEDDDDDSMSEDGSDSDDDDDEI  180

Query  458  AGHADP  441
             G ADP
Sbjct  181  VGKADP  186



>ref|NP_566062.1| ubiquitin-conjugating enzyme E2 6 [Arabidopsis thaliana]
 sp|P42750.2|UBC6_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 6; AltName: Full=Ubiquitin 
carrier protein 6; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 3; AltName: Full=Ubiquitin-protein ligase 
6 [Arabidopsis thaliana]
 gb|AAB32508.1| UBC6=E2-related ubiquitin-conjugating protein [Arabidopsis thaliana, 
Peptide, 183 aa]
 gb|AAC62907.1| E2, ubiquitin-conjugating enzyme 6 (UBC6) [Arabidopsis thaliana]
 gb|AAO63272.1| At2g46030 [Arabidopsis thaliana]
 gb|AAY44847.1| ubiquitinating enzyme [Arabidopsis thaliana]
 dbj|BAF00193.1| putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana]
 gb|AEC10634.1| ubiquitin-conjugating enzyme E2 6 [Arabidopsis thaliana]
Length=183

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ +ND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENI  537
            NG+AASL+M+D+  Y+ KVKEYCE+YAK E I
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCEKYAKPEEI  152



>ref|XP_010533643.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Tarenaya hassleriana]
Length=192

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+S YEGGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYEGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSVGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNASDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKE  543
            NG+AA+L M+D+  Y+Q+VKEY E+YAK E
Sbjct  121  NGEAAALQMRDRAAYEQRVKEYTEKYAKPE  150



>ref|XP_010506595.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Camelina sativa]
Length=183

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 154/187 (82%), Gaps = 7/187 (4%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSED---E  462
            NG+AASL+M+D+  Y+ KVKEYC++YA+ E    ++  SD++  D      SDS+D   E
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCDKYAQPE----KENSSDDDDDDSMSENGSDSDDDANE  176

Query  461  VAGHADP  441
            + G ADP
Sbjct  177  IVGKADP  183



>ref|XP_010940567.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X4 
[Elaeis guineensis]
Length=164

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPKESLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+QKVK
Sbjct  121  NGEAAALMMRDRPAYEQKVK  140



>ref|XP_008787423.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Phoenix dactylifera]
Length=157

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGPKESLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+SPSIGF+ KI HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVTKICHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQ  528
            NG+AA+LMM+D+  Y+QKVK   +R      I  Q
Sbjct  121  NGEAAALMMRDRPAYEQKVKGCTDRMTAHLQIGLQ  155



>gb|KDO66251.1| hypothetical protein CISIN_1g030996mg [Citrus sinensis]
Length=167

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 149/187 (80%), Gaps = 23/187 (12%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP KRR+MDVMKLMMSDY+VEPIND I++  VEFHGPK+SLYEGG+WK+RVELPDAYP
Sbjct  1    MSSPCKRREMDVMKLMMSDYSVEPINDGISELKVEFHGPKDSLYEGGIWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKIFHPNVDELSGSVCLDVINQ+WSPMF                    DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQTWSPMF--------------------DPL  100

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIST--QKeesdeelsdeylSGQS-DSEDE  462
            NGDAASLMMKD+KQY+Q+VKEYCERYAKKENIS+   +E  ++  +++   GQS  S+D 
Sbjct  101  NGDAASLMMKDRKQYEQRVKEYCERYAKKENISSINSEETDEDISNEDISDGQSTSSDDN  160

Query  461  VAGHADP  441
            +AG ADP
Sbjct  161  IAGVADP  167



>ref|XP_010658145.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 isoform X2 [Vitis 
vinifera]
Length=176

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 149/184 (81%), Gaps = 8/184 (4%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V+FHGP +S Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPGDSPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMF       VFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF-------VFLPQLLLYPNPSDPL  113

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKEYCE+YAK ENI    EE   +      + +S S++ VAG
Sbjct  114  NGEAAALMMRDRPAYEQRVKEYCEKYAKPENIGAAPEEKSSDEELSEDNYES-SDEAVAG  172

Query  452  HADP  441
             ADP
Sbjct  173  QADP  176



>ref|XP_006295060.1| hypothetical protein CARUB_v10024128mg [Capsella rubella]
 gb|EOA27958.1| hypothetical protein CARUB_v10024128mg [Capsella rubella]
Length=187

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ +ND++  F V FHGP +SLYEGGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVF+ FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFDSFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKE  543
            NG+AASL+M+D+  Y+ KVKEYCE+YAK E
Sbjct  121  NGEAASLLMRDRPAYELKVKEYCEKYAKAE  150



>ref|XP_006465385.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Citrus sinensis]
 gb|KDO76261.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=150

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPKES Y+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  YDQ+VK
Sbjct  121  NGEAAALMMRDRTAYDQRVK  140



>gb|AFK33447.1| unknown [Lotus japonicus]
Length=178

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP+KRRDMD MKLMMSDY VE IND++ +F VEFHGPK S Y+ GVWK++VE+PDAYP
Sbjct  1    MSSPTKRRDMDFMKLMMSDYKVETINDDMQEFFVEFHGPKNSPYQDGVWKLKVEIPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            +KSPSIGF+NKI+HPN+DE SG++CLDVINQ WSPM+DL+NVFEVFLPQLLLYPN SDP+
Sbjct  61   FKSPSIGFVNKIYHPNIDEPSGTICLDVINQRWSPMYDLINVFEVFLPQLLLYPNASDPM  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            N DAA LM+KD   Y+QKV+EYCE+YAK E+I   +
Sbjct  121  NADAADLMLKDPAAYEQKVREYCEKYAKPEDIGATQ  156



>ref|XP_010518259.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Camelina sativa]
Length=181

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKE  543
            NG+AASL+M+D+  Y+ KVKEYC++YA+ E
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCDKYAQPE  150



>ref|XP_009397721.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=183

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MS PSKRR+MD+MKLMMSDY VE  ND +++F V+FHGPKES Y+GGVW++RVELPD YP
Sbjct  1    MSFPSKRREMDLMKLMMSDYKVEMTNDGMHEFLVDFHGPKESPYQGGVWRIRVELPDGYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y SPSIGF+NK++HPNVDE+SGS+CLDVINQ+WSPM+DL+NVFEVFLPQLLLYPNP DPL
Sbjct  61   YHSPSIGFVNKMYHPNVDEMSGSICLDVINQTWSPMYDLVNVFEVFLPQLLLYPNPLDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+L+M+D+  Y+QKVKEYC +YAK E+I    EE   +         S S++++ G
Sbjct  121  NGEAAALLMRDEPAYEQKVKEYCLKYAKPEDIGASPEEKSSDEELSENECDS-SDEQMLG  179

Query  452  HADP  441
              DP
Sbjct  180  KPDP  183



>gb|AFK45061.1| unknown [Lotus japonicus]
Length=195

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP+KRRDMD MKLMMSDY VE IND++ +F VEFHGPK S Y+ GVWK++VE+PDAYP
Sbjct  1    MSSPTKRRDMDFMKLMMSDYKVETINDDMQEFFVEFHGPKNSPYQDGVWKLKVEIPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            +KSPSIGF+NKI+HPN+DE SG++CLDVINQ WSPM+DL+NVFEVFLPQLLLYPN SDP+
Sbjct  61   FKSPSIGFVNKIYHPNIDEPSGTICLDVINQRWSPMYDLINVFEVFLPQLLLYPNASDPM  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            N DAA LM+KD   Y+QKV+EYCE+YAK E+I   +
Sbjct  121  NADAADLMLKDPAAYEQKVREYCEKYAKPEDIGATQ  156



>ref|XP_010918820.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Elaeis guineensis]
Length=146

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V FHGP ESLY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYRVEMVNDGMQEFYVYFHGPNESLYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+QKVK
Sbjct  121  NGEAAALMMRDRPAYEQKVK  140



>ref|NP_001064719.1| Os10g0447100 [Oryza sativa Japonica Group]
 gb|ABG66102.1| Ubiquitin-conjugating enzyme E2-23 kDa, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26633.1| Os10g0447100 [Oryza sativa Japonica Group]
 dbj|BAG90217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=144

 Score =   247 bits (631),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+QKVK
Sbjct  121  NGEAAALMMRDRPAYEQKVK  140



>ref|XP_010933129.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Elaeis guineensis]
Length=164

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE +ND + +F V+FHGP +SLY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNDSLYQGGVWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+QKVK
Sbjct  121  NGEAAALMMRDRPAYEQKVK  140



>ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Glycine max]
Length=155

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+Q+VK
Sbjct  121  NGEAAALMMRDRATYEQRVK  140



>gb|KDP25854.1| hypothetical protein JCGZ_22884 [Jatropha curcas]
Length=184

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSS SKRR++DVMKLMM+DY VE IND IN+ +VEFHGPKES YEGG+WK++V LPDAYP
Sbjct  1    MSSQSKRREIDVMKLMMNDYAVELINDRINEIHVEFHGPKESPYEGGIWKIKVALPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            Y+ PSI FLNKIFHPN+ E SG+VC+DVI QSWSPMFDLLNVFE+FLPQLLLYPNPS P+
Sbjct  61   YEHPSIVFLNKIFHPNIGEKSGNVCMDVIKQSWSPMFDLLNVFEIFLPQLLLYPNPSHPM  120

Query  632  NGDAASLMM-KDKKQYDQKVKEYCERYAKKENIS  534
            N DAA L+  KDKKQY++KVKEYC+ YAKKENIS
Sbjct  121  NRDAAFLLTKKDKKQYEEKVKEYCKLYAKKENIS  154



>gb|KFK37384.1| hypothetical protein AALP_AA4G250300 [Arabis alpina]
Length=188

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MD+MKLMMSDY V+ IND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYA  552
            NG+AASL+M+D+  Y++KVKEYC+ YA
Sbjct  121  NGEAASLLMRDRPAYEKKVKEYCKLYA  147



>ref|XP_006405361.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
 gb|ESQ46814.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
Length=148

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+Q+VK
Sbjct  121  NGEAAALMMRDRPAYEQRVK  140



>ref|XP_010935784.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Elaeis guineensis]
Length=235

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 152/235 (65%), Gaps = 51/235 (22%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGPKESLY+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF-----------------------  702
            YKSPSIGF+N+IFHPNVDE+SGSVCLDVINQ+WSPMF                       
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFGKELITPILSLCMNFMADVEQGC  120

Query  701  ----------------------------DLLNVFEVFLPQLLLYPNPSDPLNGDAASLMM  606
                                        DL+N+FE FLPQLLLYPNPSDPLNG+AA+LMM
Sbjct  121  LLDTEFAAIYLFILDIISAFNMFASVFSDLINIFEAFLPQLLLYPNPSDPLNGEAAALMM  180

Query  605  KDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +D+  Y+Q+VKEYCERYAK E+     EE+  +         S  ED V G+ DP
Sbjct  181  RDRPAYEQRVKEYCERYAKPEDAGAPPEENSSDEEPTEDEYDSSDEDAVPGNPDP  235



>ref|XP_010935785.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Elaeis guineensis]
Length=220

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGPKESLY+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+IFHPNVDE+SGSVCLDVINQ+WSPMFDL+N+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINIFEAFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+Q+VK
Sbjct  121  NGEAAALMMRDRPAYEQRVK  140



>ref|XP_006586692.1| PREDICTED: uncharacterized protein LOC100805356 isoform X1 [Glycine 
max]
Length=166

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGP +S Y GGVWKVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+Q+VK
Sbjct  121  NGEAAALMMRDRPSYEQRVK  140



>gb|KHN29339.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=185

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 141/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  959  VMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNK  780
            V + MMSDY VE IND + +F V+FHGP +S Y GGVWKVRVELPDAYPYKSPSIGF+NK
Sbjct  14   VFRRMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINK  73

Query  779  IFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKD  600
            I+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPLNG+AA+LMM+D
Sbjct  74   IYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRD  133

Query  599  KKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +  Y+Q+VKEYCE+YAK E+I    EE   +         S S+++V G ADP
Sbjct  134  RPSYEQRVKEYCEKYAKPEDIGEATEEKSSDEEMSEDEYDS-SDEQVVGKADP  185



>gb|EYU42972.1| hypothetical protein MIMGU_mgv1a0146272mg, partial [Erythranthe 
guttata]
Length=140

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP+KRR+MD+MKLMMSDY VE IND +++F V FHGP +S Y GGVWKVRVELPDAYP
Sbjct  1    MSSPTKRREMDLMKLMMSDYKVEMINDGMHQFYVHFHGPSDSPYHGGVWKVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NK++HPNVDE SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDETSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+DK  Y+QKVK
Sbjct  121  NGEAAALMMRDKAAYEQKVK  140



>ref|XP_007051766.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theobroma cacao]
 gb|EOX95923.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theobroma cacao]
Length=174

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 145/184 (79%), Gaps = 10/184 (5%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V F GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+LMM+D+  Y+Q+VKE     A +E  S ++   ++            S+D VAG
Sbjct  121  NGEAAALMMRDRGAYEQRVKEDIGA-APEEKTSDEELSGEDY---------DSSDDAVAG  170

Query  452  HADP  441
              DP
Sbjct  171  QPDP  174



>ref|XP_008360712.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Malus domestica]
Length=168

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            M SDY VE IND + +F V+F+GPKESLY+GGVW++RVEL DAYPYKSPSIGF+NKI+HP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPLNG+AA+L M+D+  Y
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVAGHADP  441
            DQ+VK YCE+YAK E+I   +   D+   +E   G+ DS +D VAGHADP
Sbjct  121  DQRVKXYCEKYAKPEDIGGAR--EDQSSDEELSEGEYDSGDDAVAGHADP  168



>ref|XP_008647825.1| PREDICTED: ubiquitin-conjugating enzyme E2-21 kDa 1 isoform X2 
[Zea mays]
Length=162

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY V+ +ND + +F VEF GP ES+Y+GG+W+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQK  579
            NGDAA+LMM+D+  Y+QK
Sbjct  121  NGDAAALMMRDRPAYEQK  138



>ref|XP_005650676.1| ubiquitin conjugating enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE26132.1| ubiquitin conjugating enzyme [Coccomyxa subellipsoidea C-169]
Length=190

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRR+MDVMKLMMSD+ VE +ND +N+  VEF GPK+S YEGG W+V VELPD YP
Sbjct  1    MTSPSKRREMDVMKLMMSDWKVELVNDSVNELYVEFQGPKDSPYEGGFWRVHVELPDGYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+I+HPNVDE++GSVCLDVINQ+WSPMFDLLNVFE FLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIYHPNVDEMAGSVCLDVINQTWSPMFDLLNVFETFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENIS  534
            NG+AA+L+M++ + Y+ KVKE   R+AKKE+++
Sbjct  121  NGEAAALLMREPEAYNAKVKECTARFAKKEDVA  153



>gb|KGN56505.1| hypothetical protein Csa_3G121800 [Cucumis sativus]
Length=163

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND + +F V+FHGP ES Y GG+W++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK  525
            NG+AA+LMM+D+  Y+QK     + +A  E+I+  K
Sbjct  121  NGEAAALMMRDRVAYEQKKSR--QVHAMPESIAENK  154



>ref|XP_006580568.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Glycine max]
Length=168

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND + +F VEFHGPK+S Y+GGVWKVRVELPDAYPYKSPSIGF+NKIFHP
Sbjct  1    MMSDYKVETINDGMQEFFVEFHGPKDSPYQGGVWKVRVELPDAYPYKSPSIGFVNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPLNGDAA+LM++D   Y
Sbjct  61   NVDEVSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPLNGDAAALMIRDHATY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +Q+VKEYCE+YAK E++   +EES  +         S S+D + G  DP
Sbjct  121  EQRVKEYCEKYAKPEDVGAAQEESSSDDELSEDDYAS-SDDAIVGQPDP  168



>gb|EPS57624.1| ubiquitin carrier protein, partial [Genlisea aurea]
Length=140

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND I +F V F GP +S Y GGVWK+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFKGPNDSPYHGGVWKIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVF+PQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFMPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+LMM+D+  Y+QKVK
Sbjct  121  NGEAAALMMRDRAAYEQKVK  140



>ref|XP_011028600.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Populus euphratica]
Length=149

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 131/145 (90%), Gaps = 2/145 (1%)
 Frame = -1

Query  869  SLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  690
             +YEGGVWK+ VELPDAYPYKSPSIGF+NKIFHPNVDELSGSVCLDVINQSWSPMFDLLN
Sbjct  5    CIYEGGVWKIHVELPDAYPYKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  64

Query  689  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENI--STQKees  516
            VFEVFLPQLL+YPNPSDPLNGDAASLMMKDK+QYDQKVKEYCERYAKKE+I  ST +E S
Sbjct  65   VFEVFLPQLLIYPNPSDPLNGDAASLMMKDKEQYDQKVKEYCERYAKKEHIMNSTGEELS  124

Query  515  deelsdeylSGQSDSEDEVAGHADP  441
            DEE   +  SG SD EDE+AGH DP
Sbjct  125  DEEDVSDEESGSSDEEDEIAGHVDP  149



>gb|KDO86232.1| hypothetical protein CISIN_1g030092mg [Citrus sinensis]
Length=153

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSPSKRR+MD+MKLMMSDY VE IND I +F V F GP ES Y GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+NKI+HPN+DE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVK  573
            NG+AA+L+M+D+  Y+Q+VK
Sbjct  121  NGEAAALLMRDRAAYEQRVK  140



>ref|XP_004155833.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
Length=168

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND + +F V+FHGP ES Y GG+W++RVELPDAYPYKSPSIGFLNKI+HP
Sbjct  1    MMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYPYKSPSIGFLNKIYHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  Y
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRVAY  120

Query  587  DQKVKEYCERYAKKENI  537
            +QKVKEYCERYAK E+I
Sbjct  121  EQKVKEYCERYAKPEDI  137



>emb|CCG82921.1| Ubiquitin-conjugating enzyme E2 8 [Taphrina deformans PYCC 5710]
Length=183

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            MSSP +R + DVMK++MSDY V  +ND + +F V FHGPKE+ ++GG+WKV VELPD YP
Sbjct  1    MSSPKRRIETDVMKMLMSDYEVTLVNDNMQEFYVRFHGPKETPFQGGIWKVHVELPDQYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+IFHPN+DELSGSVCLDVINQ+WSPMFD++N+FEVFLPQLL YPNPSDPL
Sbjct  61   YKSPSIGFINRIFHPNIDELSGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNPSDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            NG+AA+L+M++ K Y+ KVK+Y  RYA KE I    +   E+ S       SD ED +AG
Sbjct  121  NGEAAALLMREPKTYEVKVKDYVARYATKEAIDATSDAESEDESMSSAGSYSDEED-LAG  179

Query  452  HAD  444
              +
Sbjct  180  EME  182



>ref|XP_002955388.1| hypothetical protein VOLCADRAFT_65865 [Volvox carteri f. nagariensis]
 gb|EFJ43459.1| hypothetical protein VOLCADRAFT_65865 [Volvox carteri f. nagariensis]
Length=204

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 142/183 (78%), Gaps = 6/183 (3%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M+SPSKRRDMDVMKLMMSD+ VE + D I++F+V+F+GPK+S YEGGVWKV VELPDAYP
Sbjct  1    MASPSKRRDMDVMKLMMSDWKVELVEDNISEFHVDFYGPKDSPYEGGVWKVHVELPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGF+N+ +HPN+DE SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFMNRCYHPNIDEASGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            N +AA+L+M++   Y  KVK+Y +RYA+ E +           +        D E EV G
Sbjct  121  NSEAAALLMREPLAYANKVKDYVQRYARPERVLGHN------PAAVNNKSSDDEEAEVDG  174

Query  452  HAD  444
              D
Sbjct  175  EGD  177



>ref|XP_009783360.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Nicotiana sylvestris]
Length=168

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND + +F V FHGP ES Y GGVWKV+VELPDAYPYKSPSIGF+NKI+HP
Sbjct  1    MMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKVKVELPDAYPYKSPSIGFVNKIYHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL NVFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  Y
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +Q VKEYC++YAK E++    EE   +         SD E E+AG  DP
Sbjct  121  EQSVKEYCQKYAKPEDVGAAAEEKSSDEELSEAEYDSDDE-EMAGPVDP  168



>ref|XP_010913551.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X6 
[Elaeis guineensis]
Length=183

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND +++FNVEFHGPKES YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP
Sbjct  1    MMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDELSGS+CLDVINQSWSPMFDLLN+FEVFLPQLLLYPNP+DPLNGDAASLM+KD++QY
Sbjct  61   NVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQY  120

Query  587  DQKVK  573
            +QKVK
Sbjct  121  EQKVK  125



>ref|XP_008360711.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Malus domestica]
Length=169

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            M SDY VE IND + +F V+F+GPKESLY+GGVW++RVEL DAYPYKSPSIGF+NKI+HP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPLNG+AA+L M+D+  Y
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAY  120

Query  587  DQKVK-EYCERYAKKENISTQKeesdeelsdeylSGQSDS-EDEVAGHADP  441
            DQ+VK  YCE+YAK E+I   +   D+   +E   G+ DS +D VAGHADP
Sbjct  121  DQRVKGXYCEKYAKPEDIGGAR--EDQSSDEELSEGEYDSGDDAVAGHADP  169



>gb|ADE77794.1| unknown [Picea sitchensis]
Length=183

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 1/184 (1%)
 Frame = -1

Query  992  MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP  813
            M +  KRRDMDVMKLMM DY VE   D +N+F VEF GP++S Y G VWK+ VE+PDAYP
Sbjct  1    MGNLGKRRDMDVMKLMMRDYKVETAKDGLNEFYVEFKGPRDSPYNGRVWKIHVEIPDAYP  60

Query  812  YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  633
            YKSPSIGFLN+I+HPNVDE+SGSVCLDV+NQSWSPMFDL N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNRIYHPNVDEMSGSVCLDVLNQSWSPMFDLSNIFEVFLPQLLLYPNPTDPL  120

Query  632  NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAG  453
            N +AA+LMM+D+  YDQ+VKE+  +YAK E +  +K+E +    +      S  E+E+  
Sbjct  121  NEEAAALMMRDRNLYDQRVKEHSAKYAKSE-LEGRKQEDESSSDEISDDEYSSCEEEMTD  179

Query  452  HADP  441
            H DP
Sbjct  180  HTDP  183



>ref|XP_009628119.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X2 
[Nicotiana tomentosiformis]
Length=168

 Score =   240 bits (613),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND + +F V FHGP ES Y GGVWK+RVELPDAYPYKSPSIGF+NKI+HP
Sbjct  1    MMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYPYKSPSIGFINKIYHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPLNG+AASLMM+D+  Y
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAASLMMRDRAAY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            + +VKEYC++YAK E++    EE   +         S ++D VAG  DP
Sbjct  121  ELRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDS-ADDAVAGPVDP  168



>gb|EMT26310.1| Ubiquitin-conjugating enzyme E2-23 kDa [Aegilops tauschii]
Length=211

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY V+ IND + +F V FHGPK+S+Y+GGVWKVRVEL +AYPYKSPSIGF NKI+HP
Sbjct  42   MMSDYKVDMINDGMQEFFVHFHGPKDSIYQGGVWKVRVELTEAYPYKSPSIGFTNKIYHP  101

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPLNG+AASLMM+DK  Y
Sbjct  102  NVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAY  161

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDE-VAGHADP  441
            + KVKEYCERYAK E+IS ++EE +E   +   +   DS DE + GHADP
Sbjct  162  ENKVKEYCERYAKPEDISPEEEEEEESDEELSDAEGYDSGDEAIMGHADP  211



>ref|XP_007268439.1| hypothetical protein FOMMEDRAFT_125850 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD01162.1| hypothetical protein FOMMEDRAFT_125850 [Fomitiporia mediterranea 
MF3/22]
Length=185

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -1

Query  992  MSSPSKRR-DMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAY  816
            M+SPSKRR + DVMKL+MSDY V  +ND I +F V FHGP+E+ + GGVWK+ VELPD Y
Sbjct  1    MTSPSKRRIETDVMKLLMSDYEVTLVNDNIQEFYVRFHGPEETPFAGGVWKIHVELPDQY  60

Query  815  PYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDP  636
            PYKSPSIGF+NKIFHPN+DELSGSVCLDVINQ+WSPMFD++N+FEVFLPQLL YPNP+DP
Sbjct  61   PYKSPSIGFMNKIFHPNIDELSGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNPNDP  120

Query  635  LNGDAASLMMKDKKQYDQKVKEYCERYAKKE  543
            LNGDAA+L+M+  K YD KVK+Y +RYA KE
Sbjct  121  LNGDAAALLMRHPKDYDAKVKDYVQRYATKE  151



>ref|XP_006584539.1| PREDICTED: uncharacterized protein LOC100527756 isoform X1 [Glycine 
max]
Length=168

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE +ND + +F VEFHGPK+S Y+GGVWKVRV+LPDAYPYKSPSIGF+NKIFHP
Sbjct  1    MMSDYKVETVNDGMQEFFVEFHGPKDSPYQGGVWKVRVDLPDAYPYKSPSIGFVNKIFHP  60

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVI+Q+WSPMFDL+NVFEVFLPQLLLYPN SDPLNGDAA+LM++D   Y
Sbjct  61   NVDEMSGSVCLDVISQTWSPMFDLVNVFEVFLPQLLLYPNASDPLNGDAAALMIRDHATY  120

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +Q+VKEYCE+YAK E++   +EES  +         S S+D + G  DP
Sbjct  121  EQRVKEYCEKYAKPEDVGAVQEESSSDDEPSEDDYAS-SDDAIVGQPDP  168



>ref|XP_007051765.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
 gb|EOX95922.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
Length=194

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  947  MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP  768
            MMSDY VE IND + +F V F GP ES Y GGVW++RVELPDAYPYKSPSIGF+NKI+HP
Sbjct  27   MMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHP  86

Query  767  NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY  588
            NVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  Y
Sbjct  87   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRGAY  146

Query  587  DQKVKEYCERYAKKENISTQKeesdeelsdeylSGQSDSEDEVAGHADP  441
            +Q+VKEYCE+YAK E+I    EE   +         S S+D VAG  DP
Sbjct  147  EQRVKEYCEKYAKPEDIGAAPEEKTSDEELSGEDYDS-SDDAVAGQPDP  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3404794646940