BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26391_g1_i1 len=648 path=[626:0-647]

Length=648
                                                                      Score     E

ref|XP_009603828.1|  PREDICTED: uncharacterized protein LOC104098725    119   3e-28   
ref|XP_009627393.1|  PREDICTED: uncharacterized protein LOC104117946    116   1e-27   
ref|XP_009620919.1|  PREDICTED: uncharacterized protein LOC104112639    119   2e-27   
ref|XP_009606568.1|  PREDICTED: uncharacterized protein LOC104100903    107   3e-25   
ref|XP_009802303.1|  PREDICTED: uncharacterized protein LOC104247867    108   7e-25   
ref|XP_009763153.1|  PREDICTED: uncharacterized protein LOC104215104    108   2e-24   
ref|XP_009758885.1|  PREDICTED: uncharacterized protein LOC104211522    106   6e-24   
ref|XP_009782875.1|  PREDICTED: uncharacterized protein LOC104231559    107   7e-24   
ref|XP_009776758.1|  PREDICTED: uncharacterized protein LOC104226...    104   4e-23   
ref|XP_009624556.1|  PREDICTED: uncharacterized protein LOC104115591    103   5e-23   
ref|XP_009762621.1|  PREDICTED: uncharacterized protein LOC104214623    103   6e-23   
ref|XP_009596645.1|  PREDICTED: uncharacterized protein LOC104092693    102   1e-22   
ref|XP_009603676.1|  PREDICTED: uncharacterized protein LOC104098594    105   2e-22   
ref|XP_006343440.1|  PREDICTED: uncharacterized protein LOC102595406    105   4e-22   
ref|XP_009599028.1|  PREDICTED: uncharacterized protein LOC104094751  99.8    4e-22   
ref|XP_009770675.1|  PREDICTED: uncharacterized protein LOC104221332    100   8e-22   
ref|XP_009792321.1|  PREDICTED: uncharacterized protein LOC104239391  99.8    1e-21   
ref|XP_009796827.1|  PREDICTED: uncharacterized protein LOC104243350    101   1e-21   
ref|XP_009622344.1|  PREDICTED: uncharacterized protein LOC104113766  99.8    2e-21   
ref|XP_009608434.1|  PREDICTED: uncharacterized protein LOC104102442  99.8    2e-21   
ref|XP_009793730.1|  PREDICTED: uncharacterized protein LOC104240565  97.4    3e-21   
ref|XP_009597454.1|  PREDICTED: uncharacterized protein LOC104093421  99.0    4e-21   
ref|XP_009788948.1|  PREDICTED: uncharacterized protein LOC104236667    100   5e-21   
ref|XP_009799703.1|  PREDICTED: uncharacterized protein LOC104245743  98.6    6e-21   
ref|XP_009610573.1|  PREDICTED: uncharacterized protein LOC104104253  99.4    1e-20   
ref|XP_009622696.1|  PREDICTED: uncharacterized protein LOC104114055  95.1    2e-20   
ref|XP_009802343.1|  PREDICTED: uncharacterized protein LOC104247891  95.5    2e-20   
ref|XP_009791951.1|  PREDICTED: uncharacterized protein LOC104239115  95.5    2e-20   
ref|XP_009625564.1|  PREDICTED: uncharacterized protein LOC104116418  94.7    3e-20   
ref|XP_009785855.1|  PREDICTED: uncharacterized protein LOC104234058  97.1    4e-20   
ref|XP_009611219.1|  PREDICTED: uncharacterized protein LOC104104767  93.6    1e-19   
ref|XP_009601161.1|  PREDICTED: uncharacterized protein LOC104096488  94.0    2e-19   
ref|XP_009780879.1|  PREDICTED: uncharacterized protein LOC104229860  95.1    2e-19   
ref|XP_009786204.1|  PREDICTED: uncharacterized protein LOC104234350  96.7    3e-19   
ref|XP_009778376.1|  PREDICTED: uncharacterized protein LOC104227758  94.4    6e-19   
ref|XP_009778722.1|  PREDICTED: uncharacterized protein LOC104228034  92.0    2e-18   
ref|XP_010243665.1|  PREDICTED: uncharacterized protein LOC104587667  90.5    2e-18   
ref|XP_009606477.1|  PREDICTED: uncharacterized protein LOC104100839  89.0    3e-18   
ref|XP_009624636.1|  PREDICTED: uncharacterized protein LOC104115667  89.4    4e-18   
ref|XP_004250606.1|  PREDICTED: uncharacterized protein LOC101247390  92.8    4e-18   
ref|XP_009797305.1|  PREDICTED: uncharacterized protein LOC104243753  90.9    6e-18   
ref|XP_009616442.1|  PREDICTED: uncharacterized protein LOC104108979  87.8    3e-17   
ref|XP_009629028.1|  PREDICTED: uncharacterized protein LOC104119281  87.8    4e-17   
ref|XP_007017129.1|  Uncharacterized protein TCM_042328               90.1    5e-17   
ref|XP_007024114.1|  Uncharacterized protein TCM_028693               85.5    7e-17   
ref|XP_009758745.1|  PREDICTED: uncharacterized protein LOC104211395  87.8    7e-17   
ref|XP_009762570.1|  PREDICTED: uncharacterized protein LOC104214577  84.3    1e-16   
ref|XP_009587301.1|  PREDICTED: uncharacterized protein LOC104085051  84.7    1e-16   
ref|XP_009778225.1|  PREDICTED: uncharacterized protein LOC104227642  84.3    2e-16   
ref|XP_009790176.1|  PREDICTED: uncharacterized protein LOC104237684  85.5    2e-16   
ref|XP_009609484.1|  PREDICTED: uncharacterized protein LOC104103292  87.4    3e-16   
ref|XP_008788610.1|  PREDICTED: uncharacterized protein LOC103706329  84.7    3e-16   
ref|XP_010324843.1|  PREDICTED: uncharacterized protein LOC104648721  86.3    4e-16   
ref|XP_009760586.1|  PREDICTED: uncharacterized protein LOC104212910  85.5    4e-16   
ref|XP_009804630.1|  PREDICTED: uncharacterized protein LOC104249829  85.1    7e-16   
ref|XP_010682155.1|  PREDICTED: uncharacterized protein LOC104897045  82.8    1e-15   
ref|XP_009599752.1|  PREDICTED: uncharacterized protein LOC104095345  82.4    1e-15   
ref|XP_009769452.1|  PREDICTED: uncharacterized protein LOC104220308  84.7    2e-15   
ref|XP_009767379.1|  PREDICTED: uncharacterized protein LOC104218552  81.6    2e-15   
ref|XP_008780116.1|  PREDICTED: uncharacterized protein LOC103699900  83.6    2e-15   
ref|XP_009794930.1|  PREDICTED: uncharacterized protein LOC104241686  84.7    2e-15   
ref|XP_009767123.1|  PREDICTED: uncharacterized protein LOC104218348  80.9    3e-15   
ref|XP_009794046.1|  PREDICTED: uncharacterized protein LOC104240851  81.3    3e-15   
ref|XP_009596492.1|  PREDICTED: uncharacterized protein LOC104092572  81.6    3e-15   
ref|XP_009803099.1|  PREDICTED: uncharacterized protein LOC104248527  83.2    4e-15   
ref|XP_008780242.1|  PREDICTED: uncharacterized protein LOC103700043  81.3    5e-15   
ref|XP_009127062.1|  PREDICTED: uncharacterized protein LOC103851934  84.3    5e-15   
ref|XP_009757806.1|  PREDICTED: uncharacterized protein LOC104210576  80.5    6e-15   
ref|XP_009595534.1|  PREDICTED: uncharacterized protein LOC104091817  80.9    6e-15   
ref|XP_009604618.1|  PREDICTED: uncharacterized protein LOC104099357  80.5    6e-15   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737               84.3    6e-15   
ref|XP_009764242.1|  PREDICTED: uncharacterized protein LOC104215986  82.0    8e-15   
ref|XP_009798563.1|  PREDICTED: uncharacterized protein LOC104244775  80.1    8e-15   
gb|AAG50806.1|AC079281_8  unknown protein                             83.6    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009769215.1|  PREDICTED: uncharacterized protein LOC104220099  79.0    1e-14   
ref|XP_004301904.1|  PREDICTED: uncharacterized protein LOC101292910  82.8    1e-14   
ref|XP_009767006.1|  PREDICTED: uncharacterized protein LOC104218260  79.0    1e-14   
ref|XP_009796364.1|  PREDICTED: uncharacterized protein LOC104242949  81.3    1e-14   
ref|XP_009759123.1|  PREDICTED: uncharacterized protein LOC104211724  79.3    2e-14   
ref|XP_007017131.1|  Uncharacterized protein TCM_033752               82.8    2e-14   
ref|XP_009789341.1|  PREDICTED: uncharacterized protein LOC104236983  79.7    2e-14   
ref|XP_009770925.1|  PREDICTED: uncharacterized protein LOC104221560  80.1    2e-14   
ref|XP_008805763.1|  PREDICTED: uncharacterized protein LOC103718624  82.4    2e-14   
ref|XP_006367861.1|  PREDICTED: uncharacterized protein LOC102578882  81.3    3e-14   
ref|XP_009794682.1|  PREDICTED: uncharacterized protein LOC104241434  79.7    3e-14   
ref|XP_007026456.1|  Uncharacterized protein TCM_021520               81.3    3e-14   
ref|XP_008776777.1|  PREDICTED: uncharacterized protein LOC103696833  80.1    5e-14   
ref|XP_009629929.1|  PREDICTED: uncharacterized protein LOC104119987  80.9    6e-14   
ref|XP_008779502.1|  PREDICTED: uncharacterized protein LOC103699235  79.7    8e-14   
ref|XP_004233579.1|  PREDICTED: uncharacterized protein LOC101260201  80.9    8e-14   
ref|XP_009622845.1|  PREDICTED: uncharacterized protein LOC104114174  78.2    9e-14   
emb|CAA18234.1|  putative protein                                     80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CCA65997.1|  hypothetical protein                                 80.1    1e-13   
ref|XP_008375268.1|  PREDICTED: uncharacterized protein LOC103438509  78.6    1e-13   
ref|XP_010549576.1|  PREDICTED: uncharacterized protein LOC104820714  78.2    1e-13   
ref|XP_010315025.1|  PREDICTED: uncharacterized protein LOC104645339  79.3    2e-13   
dbj|BAB01845.1|  non-LTR retroelement reverse transcriptase-like ...  79.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAA66812.1|  non-ltr retrotransposon reverse transcriptase-li...  79.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796308.1|  PREDICTED: uncharacterized protein LOC104242893  78.2    2e-13   
ref|XP_009586734.1|  PREDICTED: uncharacterized protein LOC104084550  74.3    2e-13   
ref|XP_010507487.1|  PREDICTED: uncharacterized protein LOC104784120  78.6    2e-13   
ref|XP_008776564.1|  PREDICTED: uncharacterized protein LOC103696659  79.0    2e-13   
ref|XP_009597123.1|  PREDICTED: uncharacterized protein LOC104093116  74.7    2e-13   
ref|XP_009767124.1|  PREDICTED: uncharacterized protein LOC104218349  78.2    2e-13   
ref|XP_008374980.1|  PREDICTED: uncharacterized protein LOC103438233  78.2    3e-13   
ref|XP_009618786.1|  PREDICTED: uncharacterized protein LOC104110923  78.6    3e-13   
ref|XP_008778839.1|  PREDICTED: uncharacterized protein LOC103698583  78.2    4e-13   
ref|XP_009599389.1|  PREDICTED: uncharacterized protein LOC104095045  75.1    4e-13   
ref|XP_008779976.1|  PREDICTED: uncharacterized protein LOC103699749  77.8    4e-13   
ref|XP_009590368.1|  PREDICTED: uncharacterized protein LOC104087564  78.2    4e-13   
ref|XP_007010205.1|  Uncharacterized protein TCM_043617               77.4    5e-13   
ref|XP_011101880.1|  PREDICTED: uncharacterized protein LOC105179919  74.7    5e-13   
ref|XP_009759375.1|  PREDICTED: uncharacterized protein LOC104211932  76.6    5e-13   
ref|XP_008779917.1|  PREDICTED: uncharacterized protein LOC103699694  76.6    6e-13   
ref|XP_006358721.1|  PREDICTED: uncharacterized protein LOC102596481  77.8    6e-13   
ref|XP_009772930.1|  PREDICTED: uncharacterized protein LOC104223235  74.7    7e-13   
ref|XP_010551659.1|  PREDICTED: uncharacterized protein LOC104822217  77.0    7e-13   
ref|XP_009793107.1|  PREDICTED: uncharacterized protein LOC104240027  77.0    9e-13   
ref|XP_010412393.1|  PREDICTED: uncharacterized protein LOC104698678  74.7    1e-12   
ref|XP_009607655.1|  PREDICTED: uncharacterized protein LOC104101836  74.7    1e-12   
ref|XP_008780361.1|  PREDICTED: uncharacterized protein LOC103700181  72.0    1e-12   
ref|XP_006577509.1|  PREDICTED: uncharacterized protein LOC102660778  76.3    1e-12   
ref|XP_008791119.1|  PREDICTED: uncharacterized protein LOC103708118  76.6    1e-12   
ref|XP_009603118.1|  PREDICTED: uncharacterized protein LOC104098156  76.3    1e-12   
ref|XP_010644016.1|  PREDICTED: uncharacterized protein LOC104877459  76.3    2e-12   
ref|XP_011013113.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  76.6    2e-12   
ref|XP_008779726.1|  PREDICTED: uncharacterized protein LOC103699482  73.2    2e-12   
ref|XP_010507041.1|  PREDICTED: uncharacterized protein LOC104783602  72.8    2e-12   
ref|XP_008779909.1|  PREDICTED: uncharacterized protein LOC103699684  75.5    2e-12   
ref|XP_008231741.1|  PREDICTED: uncharacterized protein LOC103330914  75.9    2e-12   
ref|XP_006354967.1|  PREDICTED: uncharacterized protein LOC102599840  73.2    3e-12   
ref|XP_009789074.1|  PREDICTED: uncharacterized protein LOC104236765  72.4    3e-12   
ref|XP_008803836.1|  PREDICTED: uncharacterized protein LOC103717291  75.1    3e-12   
ref|XP_009794363.1|  PREDICTED: uncharacterized protein LOC104241142  72.8    3e-12   
ref|XP_009144152.1|  PREDICTED: uncharacterized protein LOC103867818  75.5    4e-12   
ref|XP_010687131.1|  PREDICTED: uncharacterized protein LOC104901277  74.3    4e-12   
ref|XP_008791350.1|  PREDICTED: uncharacterized protein LOC103708283  72.8    4e-12   
ref|XP_011093956.1|  PREDICTED: uncharacterized protein LOC105173776  73.9    4e-12   
ref|XP_002450418.1|  hypothetical protein SORBIDRAFT_05g005061        75.1    4e-12   Sorghum bicolor [broomcorn]
ref|XP_008383872.1|  PREDICTED: uncharacterized protein LOC103446515  74.3    4e-12   
gb|KFK28834.1|  hypothetical protein AALP_AA7G055000                  74.7    5e-12   
ref|XP_010669076.1|  PREDICTED: uncharacterized protein LOC104886313  72.0    5e-12   
ref|XP_008797555.1|  PREDICTED: putative rRNA methyltransferase       74.3    6e-12   
ref|XP_008805704.1|  PREDICTED: uncharacterized protein LOC103718591  71.2    6e-12   
ref|XP_008782101.1|  PREDICTED: uncharacterized protein LOC103701716  72.8    6e-12   
ref|XP_009803225.1|  PREDICTED: uncharacterized protein LOC104248620  74.3    7e-12   
ref|XP_008780512.1|  PREDICTED: uncharacterized protein LOC103700340  72.0    7e-12   
ref|XP_009758321.1|  PREDICTED: uncharacterized protein LOC104211025  74.3    7e-12   
ref|XP_007046404.1|  Uncharacterized protein TCM_011923               74.7    8e-12   
ref|XP_008775925.1|  PREDICTED: uncharacterized protein LOC103696163  72.8    8e-12   
ref|XP_010489852.1|  PREDICTED: uncharacterized protein LOC104767537  74.3    8e-12   
ref|XP_008777729.1|  PREDICTED: uncharacterized protein LOC103697602  73.6    9e-12   
ref|XP_009784545.1|  PREDICTED: uncharacterized protein LOC104232966  72.8    1e-11   
ref|XP_008778148.1|  PREDICTED: uncharacterized protein LOC103697979  73.6    1e-11   
ref|XP_008779968.1|  PREDICTED: uncharacterized protein LOC103699741  73.2    1e-11   
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase   73.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010313000.1|  PREDICTED: uncharacterized protein LOC104644619  73.6    2e-11   
ref|XP_009588715.1|  PREDICTED: uncharacterized protein LOC104086215  72.0    2e-11   
ref|XP_008231245.1|  PREDICTED: uncharacterized protein LOC103330439  70.9    2e-11   
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764  73.2    2e-11   
ref|XP_008354730.1|  PREDICTED: uncharacterized protein LOC103418377  72.4    2e-11   
ref|XP_010682308.1|  PREDICTED: uncharacterized protein LOC104897183  70.5    2e-11   
emb|CAN63032.1|  hypothetical protein VITISV_024672                   72.8    3e-11   Vitis vinifera
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803  72.8    3e-11   
ref|XP_010532354.1|  PREDICTED: uncharacterized protein LOC104808378  72.0    3e-11   
gb|KFK28833.1|  hypothetical protein AALP_AA7G055000                  72.8    3e-11   
ref|XP_010529057.1|  PREDICTED: uncharacterized protein LOC104806035  71.2    3e-11   
ref|XP_009781794.1|  PREDICTED: uncharacterized protein LOC104230633  71.2    4e-11   
ref|XP_010669917.1|  PREDICTED: uncharacterized protein LOC104887033  70.9    4e-11   
ref|XP_009600115.1|  PREDICTED: uncharacterized protein LOC104095652  68.9    5e-11   
ref|XP_010666673.1|  PREDICTED: uncharacterized protein LOC104883809  70.9    6e-11   
ref|XP_009102111.1|  PREDICTED: uncharacterized protein LOC103828248  70.5    6e-11   
ref|XP_011101582.1|  PREDICTED: uncharacterized protein LOC105179641  70.9    6e-11   
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768  71.6    7e-11   
ref|XP_008362180.1|  PREDICTED: uncharacterized protein LOC103425857  71.2    8e-11   
ref|XP_009616379.1|  PREDICTED: uncharacterized protein LOC104108929  70.9    9e-11   
ref|XP_009758093.1|  PREDICTED: uncharacterized protein LOC104210819  69.7    1e-10   
gb|KEH41477.1|  endonuclease/exonuclease/phosphatase family protein   70.5    1e-10   
ref|XP_008349387.1|  PREDICTED: uncharacterized protein LOC103412619  70.5    1e-10   
ref|XP_010684022.1|  PREDICTED: uncharacterized protein LOC104898625  69.7    1e-10   
ref|XP_009108843.1|  PREDICTED: uncharacterized protein LOC103834526  70.5    1e-10   
ref|XP_010689810.1|  PREDICTED: uncharacterized protein LOC104903471  69.3    1e-10   
ref|XP_009615867.1|  PREDICTED: uncharacterized protein LOC104108513  67.4    2e-10   
ref|XP_010506876.1|  PREDICTED: uncharacterized protein LOC104783414  68.6    2e-10   
ref|XP_007026457.1|  Uncharacterized protein TCM_021521               70.5    2e-10   
ref|XP_010468589.1|  PREDICTED: uncharacterized protein LOC104748682  67.0    2e-10   
ref|XP_008794416.1|  PREDICTED: uncharacterized protein LOC103710479  70.1    2e-10   
ref|XP_008798235.1|  PREDICTED: uncharacterized protein LOC103713184  66.6    2e-10   
ref|XP_010681482.1|  PREDICTED: uncharacterized protein LOC104896429  67.4    2e-10   
ref|XP_011072308.1|  PREDICTED: uncharacterized protein LOC105157594  69.3    2e-10   
gb|AAM82604.1|AF525305_2  putative AP endonuclease/reverse transc...  69.7    2e-10   Brassica napus [oilseed rape]
ref|XP_008348238.1|  PREDICTED: uncharacterized protein LOC103411380  69.7    2e-10   
ref|XP_010683802.1|  PREDICTED: uncharacterized protein LOC104898414  68.6    2e-10   
ref|XP_010690182.1|  PREDICTED: uncharacterized protein LOC104903769  68.2    3e-10   
ref|XP_009136057.1|  PREDICTED: uncharacterized protein LOC103860217  69.3    3e-10   
ref|XP_009594094.1|  PREDICTED: uncharacterized protein LOC104090648  65.9    3e-10   
ref|XP_009600461.1|  PREDICTED: uncharacterized protein LOC104095915  68.6    3e-10   
ref|XP_007017130.1|  Uncharacterized protein TCM_042329               69.7    3e-10   
ref|XP_009619303.1|  PREDICTED: uncharacterized protein LOC104111332  65.9    3e-10   
ref|XP_010436877.1|  PREDICTED: uncharacterized protein LOC104720698  68.9    4e-10   
ref|XP_009628669.1|  PREDICTED: uncharacterized protein LOC104118986  68.2    4e-10   
ref|XP_008788892.1|  PREDICTED: uncharacterized protein LOC103706536  68.2    5e-10   
ref|XP_007212580.1|  hypothetical protein PRUPE_ppa015871mg           68.9    5e-10   
ref|XP_010669053.1|  PREDICTED: uncharacterized protein LOC104886290  67.4    6e-10   
emb|CCA66020.1|  hypothetical protein                                 68.6    6e-10   
ref|XP_010501556.1|  PREDICTED: uncharacterized protein LOC104778826  68.6    6e-10   
ref|XP_009624266.1|  PREDICTED: uncharacterized protein LOC104115358  64.3    6e-10   
ref|XP_009788999.1|  PREDICTED: uncharacterized protein LOC104236712  67.0    6e-10   
ref|XP_006591584.1|  PREDICTED: uncharacterized protein LOC102666004  67.0    6e-10   
gb|AAC28221.1|  similar to reverse transcriptases (PFam: rvt.hmm,...  68.2    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677721.1|  PREDICTED: uncharacterized protein LOC104893322  68.2    7e-10   
ref|XP_007220765.1|  hypothetical protein PRUPE_ppa026078mg           67.4    7e-10   
ref|XP_011081473.1|  PREDICTED: uncharacterized protein LOC105164519  67.4    7e-10   
ref|XP_009778879.1|  PREDICTED: uncharacterized protein LOC104228170  66.2    8e-10   
ref|XP_010424048.1|  PREDICTED: uncharacterized protein LOC104709079  67.0    9e-10   
ref|XP_009613071.1|  PREDICTED: uncharacterized protein LOC104106272  67.0    9e-10   
gb|KEH36675.1|  endonuclease/exonuclease/phosphatase family protein   65.5    9e-10   
ref|XP_009762468.1|  PREDICTED: uncharacterized protein LOC104214497  67.0    9e-10   
ref|XP_007026458.1|  Uncharacterized protein TCM_021522               68.2    1e-09   
ref|XP_008780097.1|  PREDICTED: uncharacterized protein LOC103699880  64.7    1e-09   
ref|XP_011074610.1|  PREDICTED: uncharacterized protein LOC105159297  66.6    1e-09   
ref|XP_010490225.1|  PREDICTED: uncharacterized protein LOC104767965  65.5    1e-09   
ref|XP_010683368.1|  PREDICTED: uncharacterized protein LOC104898060  65.9    1e-09   
emb|CDX94387.1|  BnaC01g17970D                                        67.0    2e-09   
ref|XP_002445372.1|  hypothetical protein SORBIDRAFT_07g013775        67.0    2e-09   Sorghum bicolor [broomcorn]
ref|XP_008776718.1|  PREDICTED: uncharacterized protein LOC103696782  65.1    2e-09   
ref|XP_010039464.1|  PREDICTED: uncharacterized protein LOC104428159  67.0    2e-09   
gb|KEH19175.1|  endonuclease/exonuclease/phosphatase family protein   66.6    2e-09   
ref|XP_009112993.1|  PREDICTED: uncharacterized protein LOC103838310  67.0    2e-09   
ref|XP_009123480.1|  PREDICTED: uncharacterized protein LOC103848300  66.6    2e-09   
ref|XP_009144617.1|  PREDICTED: uncharacterized protein LOC103868259  67.0    2e-09   
ref|XP_010484758.1|  PREDICTED: uncharacterized protein LOC104763036  66.6    2e-09   
ref|XP_010507014.1|  PREDICTED: uncharacterized protein LOC104783570  66.6    2e-09   
ref|XP_010312970.1|  PREDICTED: uncharacterized protein LOC104644590  66.2    2e-09   
ref|XP_010693313.1|  PREDICTED: uncharacterized protein LOC104906276  65.5    2e-09   
ref|XP_009604419.1|  PREDICTED: uncharacterized protein LOC104099205  64.7    3e-09   
ref|XP_009144061.1|  PREDICTED: uncharacterized protein LOC103867715  66.2    4e-09   
gb|EMT09703.1|  Elongation factor 1-alpha                             65.9    4e-09   
ref|XP_010042087.1|  PREDICTED: uncharacterized protein LOC104431099  65.9    4e-09   
gb|KEH21061.1|  endonuclease/exonuclease/phosphatase family protein   65.1    4e-09   
emb|CDY24720.1|  BnaC04g13250D                                        64.7    4e-09   
ref|XP_010696413.1|  PREDICTED: uncharacterized protein LOC104908941  65.1    5e-09   
ref|XP_007010390.1|  Retrotransposon, unclassified-like protein       65.9    5e-09   
gb|KEH17749.1|  endonuclease/exonuclease/phosphatase family protein   63.2    5e-09   
ref|XP_007028332.1|  Uncharacterized protein TCM_024073               65.5    5e-09   
ref|XP_009605862.1|  PREDICTED: uncharacterized protein LOC104100355  64.3    5e-09   
ref|XP_009617971.1|  PREDICTED: uncharacterized protein LOC104110223  64.7    5e-09   
ref|XP_010666276.1|  PREDICTED: uncharacterized protein LOC104883442  65.5    5e-09   
ref|XP_009761020.1|  PREDICTED: uncharacterized protein LOC104213256  63.2    5e-09   
ref|XP_007028079.1|  Uncharacterized protein TCM_023221               64.7    6e-09   
ref|XP_010689915.1|  PREDICTED: uncharacterized protein LOC104903564  63.2    6e-09   
ref|XP_010672356.1|  PREDICTED: uncharacterized protein LOC104888940  65.1    7e-09   
ref|XP_009789138.1|  PREDICTED: uncharacterized protein LOC104236821  64.3    7e-09   
ref|XP_006357717.1|  PREDICTED: uncharacterized protein LOC102595469  65.1    8e-09   
ref|XP_010678890.1|  PREDICTED: uncharacterized protein LOC104894366  64.3    8e-09   
ref|XP_004301926.1|  PREDICTED: uncharacterized protein LOC101300737  62.4    8e-09   
ref|XP_010436852.1|  PREDICTED: uncharacterized protein LOC104720672  63.9    8e-09   
ref|XP_009612234.1|  PREDICTED: uncharacterized protein LOC104105593  64.3    8e-09   
gb|ABN08700.1|  Endonuclease/exonuclease/phosphatase                  64.7    8e-09   Medicago truncatula
gb|KHN15589.1|  hypothetical protein glysoja_045000                   60.8    9e-09   
ref|XP_010683357.1|  PREDICTED: uncharacterized protein LOC104898048  63.2    1e-08   
ref|XP_010696425.1|  PREDICTED: uncharacterized protein LOC104908952  64.3    1e-08   
ref|XP_009794470.1|  PREDICTED: uncharacterized protein LOC104241241  64.3    1e-08   
ref|XP_010314574.1|  PREDICTED: uncharacterized protein LOC104645186  63.5    1e-08   
gb|EPS63383.1|  hypothetical protein M569_11401                       64.3    1e-08   
ref|XP_006596654.1|  PREDICTED: uncharacterized protein LOC102666338  63.2    1e-08   
ref|XP_010322031.1|  PREDICTED: uncharacterized protein LOC104647885  63.5    1e-08   
ref|XP_007052625.1|  Uncharacterized protein TCM_005953               64.3    1e-08   
ref|XP_010463070.1|  PREDICTED: uncharacterized protein LOC104743720  63.2    2e-08   
ref|XP_009776297.1|  PREDICTED: uncharacterized protein LOC104226101  62.8    2e-08   
ref|XP_010525650.1|  PREDICTED: uncharacterized protein LOC104803416  63.2    2e-08   
ref|XP_009597573.1|  PREDICTED: uncharacterized protein LOC104093526  63.2    2e-08   
ref|XP_011101370.1|  PREDICTED: uncharacterized protein LOC105179450  63.2    2e-08   
ref|XP_009118133.1|  PREDICTED: uncharacterized protein LOC103843180  63.9    2e-08   
gb|KEH41590.1|  endonuclease/exonuclease/phosphatase family protein   63.5    2e-08   
ref|XP_010319987.1|  PREDICTED: uncharacterized protein LOC104647107  63.9    2e-08   
ref|XP_008366056.1|  PREDICTED: uncharacterized protein LOC103429702  63.5    2e-08   
ref|XP_008780427.1|  PREDICTED: uncharacterized protein LOC103700248  62.8    2e-08   
ref|XP_010687394.1|  PREDICTED: uncharacterized protein LOC104901504  63.5    2e-08   
ref|XP_010678551.1|  PREDICTED: uncharacterized protein LOC104894083  63.5    2e-08   
ref|XP_007022832.1|  Uncharacterized protein TCM_026877               63.5    2e-08   
ref|XP_009765405.1|  PREDICTED: uncharacterized protein LOC104216959  63.2    2e-08   
ref|XP_010681540.1|  PREDICTED: uncharacterized protein LOC104896489  62.8    2e-08   
ref|XP_008358855.1|  PREDICTED: uncharacterized protein LOC103422573  63.5    2e-08   
ref|XP_010324137.1|  PREDICTED: uncharacterized protein LOC104648511  62.0    3e-08   
ref|XP_009625398.1|  PREDICTED: uncharacterized protein LOC104116280  62.4    3e-08   
ref|XP_010667105.1|  PREDICTED: uncharacterized protein LOC104884190  63.2    3e-08   
ref|XP_009774912.1|  PREDICTED: uncharacterized protein LOC104224892  62.8    3e-08   
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388  63.2    3e-08   
ref|XP_009123123.1|  PREDICTED: uncharacterized protein LOC103847813  63.2    3e-08   
ref|XP_011079457.1|  PREDICTED: uncharacterized protein LOC105162973  62.4    3e-08   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330               63.2    3e-08   
ref|XP_008804435.1|  PREDICTED: uncharacterized protein LOC103717723  62.4    3e-08   
gb|KEH28007.1|  endonuclease/exonuclease/phosphatase family protein   62.0    3e-08   
ref|XP_010683801.1|  PREDICTED: uncharacterized protein LOC104898413  62.8    3e-08   
gb|KFK29890.1|  hypothetical protein AALP_AA7G192200                  63.2    3e-08   
ref|XP_009598929.1|  PREDICTED: uncharacterized protein LOC104094661  62.8    3e-08   
ref|XP_004252671.1|  PREDICTED: uncharacterized protein LOC101246698  62.0    3e-08   
ref|XP_011101714.1|  PREDICTED: uncharacterized protein LOC105179775  62.4    3e-08   
gb|KEH41789.1|  endonuclease/exonuclease/phosphatase family protein   63.2    3e-08   
emb|CCA66040.1|  hypothetical protein                                 62.8    4e-08   
ref|XP_004242524.1|  PREDICTED: uncharacterized protein LOC101258077  62.8    4e-08   
gb|AAC67331.1|  putative non-LTR retroelement reverse transcriptase   62.8    4e-08   
ref|XP_010451627.1|  PREDICTED: uncharacterized protein LOC104733777  62.8    4e-08   
gb|AAD21699.1|  Contains reverse transcriptase domain (rvt) PF|00078  62.8    4e-08   
ref|XP_010669431.1|  PREDICTED: uncharacterized protein LOC104886663  62.0    4e-08   
gb|KEH24937.1|  endonuclease/exonuclease/phosphatase family protein   61.2    4e-08   
ref|XP_009626139.1|  PREDICTED: uncharacterized protein LOC104116889  60.1    4e-08   
ref|XP_008375089.1|  PREDICTED: uncharacterized protein LOC103438319  62.8    4e-08   
ref|XP_010694718.1|  PREDICTED: uncharacterized protein LOC104907481  62.0    4e-08   
ref|XP_010484733.1|  PREDICTED: uncharacterized protein LOC104763006  61.2    5e-08   
ref|XP_009119793.1|  PREDICTED: uncharacterized protein LOC103844733  62.0    5e-08   
ref|XP_010692743.1|  PREDICTED: uncharacterized protein LOC104905805  60.8    6e-08   
ref|XP_011101519.1|  PREDICTED: uncharacterized protein LOC105179578  62.0    6e-08   
ref|XP_010541758.1|  PREDICTED: uncharacterized protein LOC104815137  62.0    6e-08   
ref|XP_011085143.1|  PREDICTED: uncharacterized protein LOC105167219  62.4    6e-08   
gb|KEH22791.1|  endonuclease/exonuclease/phosphatase family protein   62.0    6e-08   
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940  62.0    7e-08   
emb|CCA65995.1|  hypothetical protein                                 62.0    7e-08   
emb|CAN77450.1|  hypothetical protein VITISV_016971                   61.6    7e-08   
ref|XP_010691898.1|  PREDICTED: uncharacterized protein LOC104905145  61.2    8e-08   
ref|XP_010681530.1|  PREDICTED: uncharacterized protein LOC104896477  61.2    8e-08   
ref|XP_008798868.1|  PREDICTED: uncharacterized protein LOC103713639  61.6    8e-08   
ref|XP_009103824.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.6    8e-08   
ref|XP_010046594.1|  PREDICTED: uncharacterized protein LOC104435567  59.3    9e-08   
ref|XP_006388111.1|  hypothetical protein POPTR_0333s00200g           61.6    9e-08   
gb|KEH17203.1|  endonuclease/exonuclease/phosphatase family protein   59.7    1e-07   
ref|XP_009615056.1|  PREDICTED: uncharacterized protein LOC104107849  61.2    1e-07   
ref|XP_010549577.1|  PREDICTED: uncharacterized protein LOC104820715  61.6    1e-07   
emb|CAN78577.1|  hypothetical protein VITISV_020585                   61.6    1e-07   
emb|CAH67890.1|  OSIGBa0153E02-OSIGBa0093I20.19                       61.6    1e-07   
ref|XP_010690625.1|  PREDICTED: uncharacterized protein LOC104904131  60.8    1e-07   
ref|XP_010693412.1|  PREDICTED: uncharacterized protein LOC104906368  61.2    1e-07   
gb|KEH16703.1|  endonuclease/exonuclease/phosphatase family protein   60.8    1e-07   
ref|XP_010462654.1|  PREDICTED: uncharacterized protein LOC104743246  60.1    1e-07   
ref|XP_009146106.1|  PREDICTED: uncharacterized protein LOC103869784  61.2    1e-07   
ref|XP_009768284.1|  PREDICTED: uncharacterized protein LOC104219319  60.8    1e-07   
ref|XP_009802945.1|  PREDICTED: uncharacterized protein LOC104248390  60.8    1e-07   
gb|AAK09240.1|AC084320_27  putative reverse transcriptase             61.2    1e-07   
ref|XP_008218992.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.2    1e-07   
ref|XP_011074608.1|  PREDICTED: uncharacterized protein LOC105159295  60.8    1e-07   
ref|XP_008366684.1|  PREDICTED: uncharacterized protein LOC103430323  60.8    1e-07   
ref|XP_011083323.1|  PREDICTED: uncharacterized protein LOC105165859  60.8    1e-07   
ref|XP_009121309.1|  PREDICTED: uncharacterized protein LOC103846154  60.1    2e-07   
ref|XP_008245992.1|  PREDICTED: uncharacterized protein LOC103344145  60.8    2e-07   
ref|XP_011083377.1|  PREDICTED: uncharacterized protein LOC105165918  60.5    2e-07   
ref|XP_009790511.1|  PREDICTED: uncharacterized protein LOC104237965  60.1    2e-07   
ref|XP_004980332.1|  PREDICTED: uncharacterized protein LOC101786154  60.5    2e-07   
ref|XP_010040665.1|  PREDICTED: uncharacterized protein LOC104429505  60.1    2e-07   
ref|XP_010681605.1|  PREDICTED: uncharacterized protein LOC104896545  58.9    2e-07   
ref|XP_006836497.1|  hypothetical protein AMTR_s00108p00123240        60.5    2e-07   
ref|XP_008779840.1|  PREDICTED: uncharacterized protein LOC103699597  58.2    2e-07   
ref|XP_010026225.1|  PREDICTED: uncharacterized protein LOC104416548  60.1    2e-07   
ref|XP_010430863.1|  PREDICTED: uncharacterized protein LOC104715119  60.5    2e-07   
ref|XP_008779963.1|  PREDICTED: uncharacterized protein LOC103699738  58.2    2e-07   
ref|XP_010674013.1|  PREDICTED: uncharacterized protein LOC104890289  59.7    2e-07   
ref|XP_010691902.1|  PREDICTED: uncharacterized protein LOC104905150  60.1    3e-07   
ref|XP_009594786.1|  PREDICTED: uncharacterized protein LOC104091210  60.1    3e-07   
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816  60.1    3e-07   
ref|XP_010685067.1|  PREDICTED: uncharacterized protein LOC104899550  60.1    3e-07   
ref|XP_010431586.1|  PREDICTED: uncharacterized protein LOC104715920  59.3    3e-07   
ref|XP_010681662.1|  PREDICTED: uncharacterized protein LOC104896592  60.1    3e-07   
ref|XP_011012765.1|  PREDICTED: uncharacterized protein LOC105116948  60.1    3e-07   
ref|XP_011101356.1|  PREDICTED: uncharacterized protein LOC105179437  59.3    3e-07   
ref|XP_010513191.1|  PREDICTED: uncharacterized protein LOC104789152  60.1    3e-07   
ref|XP_009760649.1|  PREDICTED: uncharacterized protein LOC104212974  59.3    3e-07   
gb|AAC95175.1|  putative non-LTR retroelement reverse transcriptase   60.1    3e-07   
ref|XP_010436306.1|  PREDICTED: uncharacterized protein LOC104720031  59.7    4e-07   
ref|XP_010681227.1|  PREDICTED: uncharacterized protein LOC104896208  59.7    4e-07   
emb|CCA66009.1|  hypothetical protein                                 59.7    4e-07   
gb|AAC33961.1|  contains similarity to reverse trancriptase (Pfam...  59.7    4e-07   
ref|XP_010692776.1|  PREDICTED: uncharacterized protein LOC104905838  59.3    4e-07   
ref|XP_010418651.1|  PREDICTED: uncharacterized protein LOC104704229  59.7    4e-07   
ref|XP_007214027.1|  hypothetical protein PRUPE_ppa016677mg           59.7    4e-07   
ref|XP_009139319.1|  PREDICTED: uncharacterized protein LOC103863313  59.7    4e-07   
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase   59.7    4e-07   
ref|XP_009793992.1|  PREDICTED: uncharacterized protein LOC104240803  59.3    4e-07   
ref|XP_011101972.1|  PREDICTED: uncharacterized protein LOC105180007  58.5    4e-07   
ref|XP_010668235.1|  PREDICTED: uncharacterized protein LOC104885230  59.7    4e-07   
ref|XP_007031312.1|  Uncharacterized protein TCM_016762               59.7    5e-07   
ref|XP_010675063.1|  PREDICTED: uncharacterized protein LOC104891112  58.9    5e-07   
ref|XP_007210729.1|  hypothetical protein PRUPE_ppa021798mg           59.3    5e-07   
emb|CAB40051.1|  putative protein                                     59.3    5e-07   
ref|XP_008779925.1|  PREDICTED: uncharacterized protein LOC103699702  56.2    5e-07   
ref|XP_010040240.1|  PREDICTED: uncharacterized protein LOC104429032  59.3    5e-07   
ref|XP_009624077.1|  PREDICTED: uncharacterized protein LOC104115201  58.9    5e-07   
ref|XP_007046402.1|  Uncharacterized protein TCM_011921               59.3    5e-07   
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  59.3    5e-07   
emb|CDX95431.1|  BnaC01g33230D                                        58.9    5e-07   
ref|XP_010691909.1|  PREDICTED: uncharacterized protein LOC104905156  59.3    5e-07   
ref|XP_008794068.1|  PREDICTED: uncharacterized protein LOC103710200  58.5    5e-07   
ref|XP_010054225.1|  PREDICTED: uncharacterized protein LOC104442498  57.4    6e-07   
ref|XP_010451890.1|  PREDICTED: uncharacterized protein LOC104734083  58.2    6e-07   
emb|CAN70803.1|  hypothetical protein VITISV_044067                   59.3    6e-07   
ref|XP_010666935.1|  PREDICTED: uncharacterized protein LOC104884042  58.9    6e-07   
ref|XP_009788441.1|  PREDICTED: uncharacterized protein LOC104236251  57.8    6e-07   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  59.3    6e-07   
ref|XP_009796747.1|  PREDICTED: uncharacterized protein LOC104243277  56.2    6e-07   
ref|XP_009589754.1|  PREDICTED: uncharacterized protein LOC104087066  58.2    6e-07   
ref|XP_010666310.1|  PREDICTED: uncharacterized protein LOC104883478  57.0    7e-07   
ref|XP_007036030.1|  Uncharacterized protein TCM_021518               58.9    7e-07   
ref|XP_002452516.1|  hypothetical protein SORBIDRAFT_04g027285        58.9    7e-07   
ref|XP_007023867.1|  Uncharacterized protein TCM_028259               57.8    7e-07   
emb|CAN68838.1|  hypothetical protein VITISV_030956                   58.9    7e-07   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase   58.9    7e-07   
ref|XP_010051231.1|  PREDICTED: uncharacterized protein LOC104439929  58.9    7e-07   
ref|XP_009762797.1|  PREDICTED: uncharacterized protein LOC104214780  57.4    7e-07   
ref|XP_010451883.1|  PREDICTED: uncharacterized protein LOC104734075  58.2    7e-07   
ref|XP_010681296.1|  PREDICTED: uncharacterized protein LOC104896275  58.2    7e-07   
ref|XP_010695629.1|  PREDICTED: uncharacterized protein LOC104908231  58.5    7e-07   
ref|XP_010681506.1|  PREDICTED: uncharacterized protein LOC104896455  58.5    7e-07   
gb|KEH26190.1|  endonuclease/exonuclease/phosphatase family protein   58.2    8e-07   
ref|XP_010692491.1|  PREDICTED: uncharacterized protein LOC104905603  58.9    8e-07   
ref|XP_011101787.1|  PREDICTED: uncharacterized protein LOC105179848  58.5    8e-07   
ref|XP_010684856.1|  PREDICTED: uncharacterized protein LOC104899377  58.2    8e-07   
ref|XP_010682511.1|  PREDICTED: uncharacterized protein LOC104897349  58.5    8e-07   
ref|XP_007214485.1|  hypothetical protein PRUPE_ppa020617mg           58.2    8e-07   
emb|CDY70705.1|  BnaCnng69440D                                        58.2    8e-07   
ref|XP_009629829.1|  PREDICTED: uncharacterized protein LOC104119922  57.0    9e-07   
ref|XP_009626052.1|  PREDICTED: uncharacterized protein LOC104116818  56.2    9e-07   
ref|XP_010688983.1|  PREDICTED: uncharacterized protein LOC104902779  58.2    9e-07   
emb|CCA66054.1|  hypothetical protein                                 58.5    9e-07   
ref|XP_010322091.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.5    9e-07   
emb|CAN71156.1|  hypothetical protein VITISV_036760                   58.5    9e-07   
gb|KEH17121.1|  endonuclease/exonuclease/phosphatase family protein   58.2    9e-07   
ref|XP_010314938.1|  PREDICTED: uncharacterized protein LOC104645277  58.2    9e-07   
ref|XP_008238489.1|  PREDICTED: uncharacterized protein LOC103337115  58.5    9e-07   
gb|AAF97969.1|AC000103_19  F21J9.30                                   58.5    9e-07   
emb|CDY04691.1|  BnaC05g17290D                                        57.8    1e-06   
ref|XP_009761559.1|  PREDICTED: uncharacterized protein LOC104213719  58.2    1e-06   
ref|XP_010677310.1|  PREDICTED: uncharacterized protein LOC104892980  58.2    1e-06   
ref|XP_008227624.1|  PREDICTED: uncharacterized protein LOC103327111  58.2    1e-06   
ref|XP_007023195.1|  Non-LTR retroelement reverse transcriptase       58.5    1e-06   
ref|XP_009592356.1|  PREDICTED: uncharacterized protein LOC104089217  57.8    1e-06   
gb|AAG03119.1|AC004133_13  F5A9.24                                    58.5    1e-06   
gb|ABW81176.1|  non-LTR reverse transcriptase                         58.2    1e-06   
gb|KEH39697.1|  endonuclease/exonuclease/phosphatase family protein   57.8    1e-06   
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.5    1e-06   
ref|XP_006576625.1|  PREDICTED: uncharacterized protein LOC102663449  58.2    1e-06   
ref|XP_011074614.1|  PREDICTED: uncharacterized protein LOC105159301  57.8    1e-06   
ref|XP_009787084.1|  PREDICTED: uncharacterized protein LOC104235105  57.8    1e-06   
gb|KHN13309.1|  hypothetical protein glysoja_038813                   57.4    1e-06   
ref|XP_010668194.1|  PREDICTED: uncharacterized protein LOC104885189  57.0    1e-06   
ref|XP_009790175.1|  PREDICTED: uncharacterized protein LOC104237683  56.6    1e-06   
emb|CAN80026.1|  hypothetical protein VITISV_004059                   58.2    1e-06   
ref|XP_010682303.1|  PREDICTED: uncharacterized protein LOC104897176  57.8    1e-06   
emb|CAE05638.2|  OSJNBa0038O10.4                                      58.2    1e-06   
ref|XP_002446678.1|  hypothetical protein SORBIDRAFT_06g020403        58.2    1e-06   
ref|XP_009140866.1|  PREDICTED: uncharacterized protein LOC103864849  58.2    1e-06   
ref|XP_007210850.1|  hypothetical protein PRUPE_ppa015649mg           55.8    1e-06   
ref|XP_011075308.1|  PREDICTED: uncharacterized protein LOC105159808  57.8    1e-06   
ref|XP_010687526.1|  PREDICTED: uncharacterized protein LOC104901634  57.8    1e-06   
ref|XP_010684619.1|  PREDICTED: uncharacterized protein LOC104899180  58.2    1e-06   
ref|XP_010677750.1|  PREDICTED: uncharacterized protein LOC104893352  56.2    1e-06   
ref|XP_010677980.1|  PREDICTED: uncharacterized protein LOC104893557  58.2    1e-06   
ref|XP_010679582.1|  PREDICTED: uncharacterized protein LOC104894914  58.2    1e-06   
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855  58.2    1e-06   
ref|XP_011074615.1|  PREDICTED: uncharacterized protein LOC105159302  57.4    1e-06   
emb|CDY54297.1|  BnaC01g41960D                                        57.0    2e-06   
ref|XP_011081406.1|  PREDICTED: uncharacterized protein LOC105164454  57.8    2e-06   
emb|CCA66036.1|  hypothetical protein                                 57.8    2e-06   
ref|XP_007020279.1|  Uncharacterized protein TCM_036723               57.0    2e-06   
ref|XP_009145194.1|  PREDICTED: uncharacterized protein LOC103868890  57.8    2e-06   
ref|XP_010034367.1|  PREDICTED: uncharacterized protein LOC104423599  55.8    2e-06   
ref|XP_010681977.1|  PREDICTED: uncharacterized protein LOC104896888  57.8    2e-06   
ref|XP_006607078.1|  PREDICTED: uncharacterized protein LOC102667760  57.4    2e-06   
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191  57.8    2e-06   
ref|XP_010229386.1|  PREDICTED: uncharacterized protein LOC100829951  57.4    2e-06   
gb|KEH25180.1|  endonuclease/exonuclease/phosphatase family protein   57.4    2e-06   
ref|XP_010692876.1|  PREDICTED: uncharacterized protein LOC104905918  57.4    2e-06   
ref|XP_006601502.1|  PREDICTED: uncharacterized protein LOC102661986  57.0    2e-06   
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743  57.8    2e-06   
ref|XP_008369981.1|  PREDICTED: uncharacterized protein LOC103433498  57.8    2e-06   
ref|XP_010666661.1|  PREDICTED: uncharacterized protein LOC104883796  57.4    2e-06   
ref|XP_010684567.1|  PREDICTED: uncharacterized protein LOC104899129  57.0    2e-06   
ref|XP_002467237.1|  hypothetical protein SORBIDRAFT_01g021820        56.2    2e-06   
ref|XP_010694404.1|  PREDICTED: uncharacterized protein LOC104907208  57.0    2e-06   
ref|XP_010694539.1|  PREDICTED: uncharacterized protein LOC104907323  57.4    2e-06   
emb|CAN72731.1|  hypothetical protein VITISV_037853                   57.4    2e-06   
ref|XP_010059042.1|  PREDICTED: uncharacterized protein LOC104446949  57.0    2e-06   
ref|XP_011101578.1|  PREDICTED: uncharacterized protein LOC105179638  57.4    2e-06   
ref|XP_006601492.1|  PREDICTED: uncharacterized protein LOC102659487  57.0    2e-06   
ref|XP_011100867.1|  PREDICTED: uncharacterized protein LOC105178980  56.6    2e-06   
ref|XP_009764330.1|  PREDICTED: uncharacterized protein LOC104216067  57.0    2e-06   
ref|XP_010668371.1|  PREDICTED: uncharacterized protein LOC104885380  57.0    2e-06   
gb|KEH16720.1|  endonuclease/exonuclease/phosphatase family protein   56.6    2e-06   
ref|XP_010681618.1|  PREDICTED: uncharacterized protein LOC104896557  57.0    2e-06   
ref|XP_011075695.1|  PREDICTED: uncharacterized protein LOC105160127  57.0    3e-06   
ref|XP_011101575.1|  PREDICTED: uncharacterized protein LOC105179634  57.0    3e-06   
gb|KEH15675.1|  endonuclease/exonuclease/phosphatase family protein   55.8    3e-06   
ref|XP_011004865.1|  PREDICTED: uncharacterized protein LOC105111252  57.0    3e-06   
ref|XP_008235658.1|  PREDICTED: uncharacterized protein LOC103334459  56.2    3e-06   
ref|XP_010431262.1|  PREDICTED: uncharacterized protein LOC104715566  55.8    3e-06   
ref|XP_010456985.1|  PREDICTED: uncharacterized protein LOC104738517  57.0    3e-06   
ref|XP_010692800.1|  PREDICTED: uncharacterized protein LOC104905858  56.2    3e-06   
ref|XP_009115062.1|  PREDICTED: uncharacterized protein LOC103840316  57.0    3e-06   
gb|KEH23489.1|  endonuclease/exonuclease/phosphatase family protein   57.0    3e-06   
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860  57.0    3e-06   
ref|XP_011004665.1|  PREDICTED: uncharacterized protein LOC105111104  57.0    3e-06   
gb|KFK22273.1|  hypothetical protein AALP_AAs69811U000200             56.6    3e-06   



>ref|XP_009603828.1| PREDICTED: uncharacterized protein LOC104098725 [Nicotiana tomentosiformis]
Length=383

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 104/199 (52%), Gaps = 5/199 (3%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAK  415
            I WN+R V S+G+  R   L ++ K   + L EPF   S L  +   LG     +    K
Sbjct  5    IIWNIRGVESKGAFDRFIKLKKRHKVSFVALQEPFLHSSQLENYKRKLGMHGALANFNGK  64

Query  414  IWVF*DRCLS*P--LGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAA  241
            IW F D   +      H   +      +  +    +++VYA  + R R++LW+ +E M +
Sbjct  65   IWCFWDSSYTCTEIFNHKQHLTLSIQHISSLEVCSVTIVYAKSKSRRRKKLWESLEQMNS  124

Query  240  REVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWN  61
            +    G W+I GDFNCI+   EK+GG+P+   KS +F NC++   + +  Y GNDFTW N
Sbjct  125  Q--FQGPWSIFGDFNCIVNATEKEGGRPHRLRKSLDFINCMNECGILDVGYSGNDFTWTN  182

Query  60   GRRGSQAVWERLDRVLVNE  4
             RR  + + ERLD+V  N+
Sbjct  183  NRRKMKRIRERLDKVFYND  201



>ref|XP_009627393.1| PREDICTED: uncharacterized protein LOC104117946 [Nicotiana tomentosiformis]
Length=295

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 105/200 (53%), Gaps = 5/200 (3%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAK  415
            I WN+R + + G++ R++ L    K   + +LEPF + +H+  + + L      S    K
Sbjct  5    ITWNIRGIRTSGAIERLKTLKHLHKLSFISVLEPFLNNTHINYYRIQLSMHQAASNINYK  64

Query  414  IWVF*DRCLS*PL--GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAA  241
            IW+F D+  +  +      Q+      +  +G   L++VYA C+  +R+ LW+++   + 
Sbjct  65   IWIFWDQDFTGSIIDQDEQQMTVELKHVEAVGVFQLTIVYAKCKANLRRPLWEVLRQTSL  124

Query  240  REVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWN  61
                   W ++GDFN I   EEK GG PY   KS EF + I+   L    +YG+ +TW N
Sbjct  125  --TCTIPWCVLGDFNVIASIEEKIGGLPYQMRKSLEFLSMIEDCGLVVLGFYGSRYTWSN  182

Query  60   GRRGSQAVWERLDRVLVNEN  1
            GR     +W+RLDR +VN+N
Sbjct  183  GRGPGSIIWKRLDREMVNDN  202



>ref|XP_009620919.1| PREDICTED: uncharacterized protein LOC104112639 [Nicotiana tomentosiformis]
Length=731

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 68/202 (34%), Positives = 112/202 (55%), Gaps = 5/202 (2%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-  424
            +K + WN+R V +Q +  +V N+ +Q +  I+ LLEPF+    +  +   LG E   S  
Sbjct  2    IKTLIWNIRSVNTQQAFQKVINMQKQHRFCIVALLEPFQKQGFIHYYRTRLGMETALSNI  61

Query  423  TAKIWVF*DRCLS*PLG-HGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEA  250
              KIW+F D  +   L     Q ++++V    IG +++++VVY  C    R ELW+ +  
Sbjct  62   NGKIWLFIDATVDWELLIDTDQQITIKVLYQGIGKHIIMTVVYVKCSSLERLELWNNLYC  121

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            +A+    +  W + GDFN IL  EEK GG P    +  +F   ++S  L ++ + G+ FT
Sbjct  122  LASDM--ELPWLVGGDFNVILNEEEKIGGLPVYPPEYEDFAFYVNSCELFDTGHTGSPFT  179

Query  69   WWNGRRGSQAVWERLDRVLVNE  4
            WWNGR   + +++RLDR+ VN+
Sbjct  180  WWNGRANEECIFKRLDRIFVNQ  201



>ref|XP_009606568.1| PREDICTED: uncharacterized protein LOC104100903 [Nicotiana tomentosiformis]
Length=178

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 98/172 (57%), Gaps = 5/172 (3%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PL-GHGYQIVSMRVTL  337
            I+ L+EPF+    + ++   LG EN  S    KIW+F +  +   L     Q +++++  
Sbjct  9    IVALMEPFQKQGLIQKYRRRLGMENTISNINGKIWLFINVLVEWELLIDTEQHITIKIFH  68

Query  336  PVIGN-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQ  160
              IG  +M++ VYA C    R ELWD +  +A+    +  W + GDFN IL  EEK GGQ
Sbjct  69   QDIGKYIMMTFVYAKCSSMERLELWDNLYYLASDM--ELPWMVGGDFNVILSEEEKIGGQ  126

Query  159  PYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            P    +  +F  C++S  L ++ Y G+ FTWWNGR  S+ +++RLDR+ VN+
Sbjct  127  PVYPPEYEDFAFCVNSCGLFDTGYKGSLFTWWNGRSNSECIFKRLDRIFVNQ  178



>ref|XP_009802303.1| PREDICTED: uncharacterized protein LOC104247867 [Nicotiana sylvestris]
 ref|XP_009778006.1| PREDICTED: uncharacterized protein LOC104227462 [Nicotiana sylvestris]
Length=239

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 110/204 (54%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+  + RQ     + L+EP +    L ++   +G     S  
Sbjct  1    MNALIWNIRSVNTQQAFERLTKMHRQKHYDFVGLMEPKQQAKKLERYRNKIGLTQAISNV  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIG-----NLMLSVVYASCERRVRQELWDL  259
            + KIW F D      +   Y IV  ++TL +       + +L+++YA C+   R ELWD 
Sbjct  61   SNKIWAFIDEVFE--VTVMYNIVQ-QLTLRLFHTESHVDFVLTLIYAKCDAIERIELWDS  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AMA R++ +  W + GDFN I + EEK GG P +  +  +F++CI++  L +  + G+
Sbjct  118  LYAMA-RDMEEP-WLVGGDFNVIWQEEEKFGGLPVSLNEIDDFRHCINTCNLFDLGFKGS  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             FTWWNGR     +++RLDR L N
Sbjct  176  IFTWWNGRAEEDCIFKRLDRCLAN  199



>ref|XP_009763153.1| PREDICTED: uncharacterized protein LOC104215104 [Nicotiana sylvestris]
Length=281

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 110/204 (54%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q S  R++ +  Q   +I+ L+EP +    L ++   +G     S  
Sbjct  1    MNALIWNIRPVNTQQSFERLKKMHMQNHNEIVGLMEPKQQAKKLERYRNKIGLAQAISNV  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDL  259
            + KIW F D      +   Y +V  ++TL +         +L+++YA C+   R E+WD 
Sbjct  61   SNKIWAFIDEVFE--VTVMYNMVQ-QLTLRLFHTESHVEFVLTLIYAKCDAIERIEIWDS  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AMA R++ D  W + GDFN I   +EK GG P +  +  +F++C+++  L +  + GN
Sbjct  118  LYAMA-RDM-DEPWLVGGDFNVIWDEKEKFGGLPVSLNEIDDFRHCVNTCNLFDLGFKGN  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             FTWWNGR     +++RLDR L N
Sbjct  176  IFTWWNGRAEEDCIFKRLDRCLAN  199



>ref|XP_009758885.1| PREDICTED: uncharacterized protein LOC104211522 [Nicotiana sylvestris]
Length=286

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 106/204 (52%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  I WN+R V +Q +  R+  ++RQ     + L+EP +D   L  +   +G     S  
Sbjct  1    MDAIIWNIRSVNTQQAFERLVTMLRQHHFDFVGLMEPMQDNKRLELYRRKIGLSQAFSNI  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDL  259
            + K+W F D      + +    +  ++TL +I        ++++VYA C+   R ELWD 
Sbjct  61   SNKVWNFVDDLYEVTVLYD---MEQQLTLKMIHTETHIVQIITLVYAKCDAIERIELWDS  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AMAA    D  W + GDFN I   EEK GG      +  +F++C+++  L + V+ G+
Sbjct  118  LYAMAAD--MDIPWLVGGDFNVIWDEEEKFGGLLVTLNEVNDFRHCMNTCNLFDLVFKGS  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             +TWWNGR     +++RLDR + N
Sbjct  176  IYTWWNGRAEEDCIFKRLDRCMAN  199



>ref|XP_009782875.1| PREDICTED: uncharacterized protein LOC104231559 [Nicotiana sylvestris]
Length=442

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 108/201 (54%), Gaps = 5/201 (2%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+  + R+   + + L+EP +    L ++   +G     S  
Sbjct  1    MNALIWNIRSVNTQQAFERLTKMHRKNHYEFVGLMEPKQQAKKLERYRNKIGLAQAISNV  60

Query  420  A-KIWVF*DRCLS*PLGHGY-QIVSMRV-TLPVIGNLMLSVVYASCERRVRQELWDLIEA  250
            + KIW F D      + +   Q +++R+         +L+++YA C+   R ELWD +  
Sbjct  61   SNKIWAFIDEVFEVVVMYNMVQQLTLRLFHTEKHAEFVLTLIYAKCDAIERIELWDSLYE  120

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            MA R++ D  W + GDFN I   EEK GG P +  +  +F++C+++  L + V+ G+ FT
Sbjct  121  MA-RDM-DAPWLVGGDFNVIWDEEEKFGGLPVSLNEIDDFRHCVNTCNLFDLVFKGSIFT  178

Query  69   WWNGRRGSQAVWERLDRVLVN  7
            WWNGR     +++RLDR L N
Sbjct  179  WWNGRAEEDCIFKRLDRCLAN  199



>ref|XP_009776758.1| PREDICTED: uncharacterized protein LOC104226443 isoform X1 [Nicotiana 
sylvestris]
Length=312

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 106/203 (52%), Gaps = 9/203 (4%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  I WN+R V +Q +  R+  + RQ     + L+EP  D S L  +   +G     S  
Sbjct  1    MDAIIWNIRSVNTQQAFERLVTMHRQHNFDFIGLMEPKHDGSKLDLYRRQIGLSQAFSNI  60

Query  420  A-KIWVF*DRCLS*PLGHGY-QIVSMRVT---LPVIGNLMLSVVYASCERRVRQELWDLI  256
            + K+W F D      + +   Q + +++T     ++ N+ L  VYA C+   R ELWD +
Sbjct  61   SNKVWAFVDVLYDVTILYDMDQQLMLQMTHTETHIVQNVTL--VYAKCDAIERIELWDSL  118

Query  255  EAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGND  76
             AMAA +  D  W + GDFN I   EEK GG P    +  +F++C+++  + +  + G+ 
Sbjct  119  YAMAADK--DIPWLVGGDFNVIWDEEEKFGGLPVTLNEVADFRHCMNTCNIFDLGFKGSI  176

Query  75   FTWWNGRRGSQAVWERLDRVLVN  7
            +TWWNGR     +++RLDR + N
Sbjct  177  YTWWNGRAEEDFIFKRLDRCMTN  199



>ref|XP_009624556.1| PREDICTED: uncharacterized protein LOC104115591 [Nicotiana tomentosiformis]
Length=272

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 95/167 (57%), Gaps = 5/167 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIG  325
            +EPF+   H+ ++   LG +N  S    KIW+F DR +   L     Q V+++V    IG
Sbjct  1    MEPFQKTKHIQRYMRRLGMDNAYSNINGKIWLFLDRVVEWELLNDTEQHVTIKVYHKDIG  60

Query  324  -NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
             +++++ +YA C    R ELWD +  +A     +  W + GDFN IL  EEK GG P   
Sbjct  61   KHIIITFIYAKCSSLERLELWDNLYNIAND--MELPWVVGGDFNVILSEEEKIGGLPVYP  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            ++  +F  C++SS L +  Y  + FTWWNGR  ++ +++ LDR+LVN
Sbjct  119  SEYEDFTFCVNSSGLIDLGYEESPFTWWNGRPNAECIFKWLDRILVN  165



>ref|XP_009762621.1| PREDICTED: uncharacterized protein LOC104214623 [Nicotiana sylvestris]
Length=286

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 107/204 (52%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+  + RQ   + + L+EP +    L ++   +G     S  
Sbjct  1    MNALIWNIRSVNTQQAFERLTKMHRQNHYEFVGLMEPKQQAKKLERYRNKIGLAQAISNV  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDL  259
            + KIW F D      +   Y +V  ++TL +         +L+++YA C+   R ELWD 
Sbjct  61   SNKIWAFIDEVFE--VTVMYNMVQ-QLTLRLFHTESHVEFVLTLIYAKCDAIERIELWDS  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AMA R++ D  W +  DFN I   EEK GG P +  +  +F+ C+++  L +  + G+
Sbjct  118  LYAMA-RDM-DAPWLVGSDFNLIWDEEEKFGGLPVSLYEIDDFRYCVNTCNLFDLGFKGS  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             FTWWNGR     +++RLDR L N
Sbjct  176  VFTWWNGRAEEDYIFKRLDRCLPN  199



>ref|XP_009596645.1| PREDICTED: uncharacterized protein LOC104092693 [Nicotiana tomentosiformis]
Length=234

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 97/172 (56%), Gaps = 7/172 (4%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFENRCS-GTAKIWVF*DRCLS*PL--GHGYQIVSMRVT  340
            I+ L+EPF+    +  +   LG E   S    KIW+F D  +   L     +Q+ ++R+ 
Sbjct  9    IIALMEPFQKQRFIQNYRRRLGIEAAISNANGKIWLFLDVVVQWDLLIDTEHQL-TIRIY  67

Query  339  LPVIGN-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGG  163
                G  +M++ VYA C    R ELWD +  +A R++ +  W + GDFN IL  EEK GG
Sbjct  68   YQDFGKYIMMTFVYAKCSSLDRLELWDNLYYLA-RDI-ELPWVVGGDFNVILNEEEKIGG  125

Query  162  QPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             P    +  +F  CI+S  L ++ Y G+ FTWWNGR  ++ +++RLD++LVN
Sbjct  126  LPVYTPEYEDFAFCINSCGLFDNGYKGSPFTWWNGRPNAECIFKRLDKILVN  177



>ref|XP_009603676.1| PREDICTED: uncharacterized protein LOC104098594 [Nicotiana tomentosiformis]
Length=866

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 108/201 (54%), Gaps = 5/201 (2%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+  + R+   + + L+EP +    L ++   +GF    +  
Sbjct  1    MDALIWNIRSVNTQQAFERLIKMHRKNHYEFIGLMEPMQQAKKLERYRRKIGFAQAIANV  60

Query  420  A-KIWVF*DRCLS*PLGHGY-QIVSMR-VTLPVIGNLMLSVVYASCERRVRQELWDLIEA  250
            + KIW F D      + +   Q +++R V       L+L +VY  C+   R E+WD + A
Sbjct  61   SNKIWAFIDEIFDVTIMYNMVQELTLRLVHSETHVELVLPLVYGKCDAIERIEIWDSMYA  120

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            MA R++    W + G FN I   EEK GG P +  ++ +F++CI++  L +  + G+ FT
Sbjct  121  MA-RDMAVP-WLVGGFFNIIWDEEEKYGGLPVSLNETNDFRHCINTCNLFDLGFKGSIFT  178

Query  69   WWNGRRGSQAVWERLDRVLVN  7
            WWNGR G   +++RLDR L N
Sbjct  179  WWNGRAGEDCIFKRLDRCLAN  199



>ref|XP_006343440.1| PREDICTED: uncharacterized protein LOC102595406 [Solanum tuberosum]
Length=866

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 96/169 (57%), Gaps = 8/169 (5%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFEN---RCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVI  328
            +EPF+DLS L ++   LG +     CSG  +IW+F             Q V+++V    +
Sbjct  1    MEPFQDLSDLERYRRRLGHDTALVNCSG--QIWIFTKDVHVDVNEDSTQQVTLKVVHQNM  58

Query  327  G-NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN  151
            G   +++VVYASC    R+ELW+ I+ +++       W + GDFN IL  EEK GG P  
Sbjct  59   GVEALVTVVYASCNAINREELWNSIQHISSH--ISLPWLVGGDFNVILSPEEKLGGFPVY  116

Query  150  KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
              ++ +F NCI +S L +  Y G+ +TWWNGR     +++RLDR+L N+
Sbjct  117  CQETEDFANCIATSSLYDLGYIGSTYTWWNGRSEDACIFKRLDRILGNQ  165



>ref|XP_009599028.1| PREDICTED: uncharacterized protein LOC104094751 [Nicotiana tomentosiformis]
Length=196

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 91/169 (54%), Gaps = 9/169 (5%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFE---NRCSGTAKIWVF*DRCLS*P-LGHGYQIVSMRVTLPV  331
            +EPF + S L +F   LGF+     CS   KIWVF D  ++   +    Q +   +    
Sbjct  1    MEPFCNSSKLEKFRRGLGFDFAFANCSN--KIWVFGDNIVNCTVIDDMPQYIDCSINSNG  58

Query  330  IGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN  151
            +  L +++VY + +  +R+ LWD  + ++  +     W + GDFN I+  EEKKG + Y+
Sbjct  59   V-TLFITLVYVNYKAHIRESLWD--DILSFSDDMTSPWMVAGDFNSIVEPEEKKGSRIYS  115

Query  150  KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
              KS  F NCI  S L +  YYGN FTW NG   S+ +W RLDR LVN 
Sbjct  116  MCKSLPFINCIVGSGLMDLGYYGNPFTWCNGWAPSKRIWARLDRALVNS  164



>ref|XP_009770675.1| PREDICTED: uncharacterized protein LOC104221332 [Nicotiana sylvestris]
Length=240

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 96/175 (55%), Gaps = 11/175 (6%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFE----NRCSGTAKIWVF*DRCLS*PL-GHGYQIVSMR  346
            ++ L EPF     L  +   LGF+    N+CS   K+W F +  L   +  +  Q ++++
Sbjct  1    MVILQEPFLSSDKLEDYRRFLGFDQAVSNKCS---KLWCFWNNVLECEIIDNSRQKITLK  57

Query  345  VTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKG  166
            +         ++ +YA      R++LW  + +M+ R   +G W I+GDF  I+  EEKKG
Sbjct  58   IKEDE-HTYWITAIYARNNVAKRRKLWTKLRSMSNR--VNGPWTILGDFKTIMAPEEKKG  114

Query  165  GQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            G P+  +KS +F  C+D  R+ +  Y GN FTW NG RG + +  RLDRVL+NE+
Sbjct  115  GTPHTLSKSADFIRCMDDCRMSDLGYTGNPFTWCNGSRGRRRINTRLDRVLINED  169



>ref|XP_009792321.1| PREDICTED: uncharacterized protein LOC104239391 [Nicotiana sylvestris]
Length=245

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 108/196 (55%), Gaps = 6/196 (3%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT-AK  415
            + WNVR V +Q +  R+  L R++   ++ L E ++D+  L  +  SL  +   +    K
Sbjct  5    LIWNVRSVNTQKAFQRLIKLHRKYNFYLIGL-ETWQDIDQLEIYRRSLDIKTVVANVNGK  63

Query  414  IWVF*DRCLS*PLGHGY-QIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMAA  241
            IW F D  +   + +   Q +++++   V+G +L++++VYA C    R ELW+ +  +A+
Sbjct  64   IWAFIDEDIDVEVLYDMEQQLNLKLFHRVLGKHLIVTLVYAKCTALERIELWESLYHLAS  123

Query  240  REVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWN  61
              +    W + GDFN IL  EEK GG P +  +  +F  C+D+  L +  + G+ +TWWN
Sbjct  124  DMMI--PWLVGGDFNVILSEEEKYGGLPVSNNEVADFAYCVDTCALYDVGFKGSLYTWWN  181

Query  60   GRRGSQAVWERLDRVL  13
            GR     +++R+DR L
Sbjct  182  GRSDDACIFKRIDRYL  197



>ref|XP_009796827.1| PREDICTED: uncharacterized protein LOC104243350 [Nicotiana sylvestris]
Length=408

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 108/204 (53%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+    R+   +I+ L+EP +    L ++   +G     S  
Sbjct  1    MNALIWNIRSVNTQQAFERLTKRHRKNHYEIVGLMEPKQQAKKLERYRNKIGLAQAISNV  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDL  259
            + KIW F        +   Y +V  ++TL +         +L+++YA C+   R E+WD 
Sbjct  61   SNKIWAFIYEVFEVTIM--YNMVQ-QLTLRLFHTESQVEFVLTLIYAKCDAIERIEIWDS  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AMA R+V D  W + GDFN I   +EK GG P    ++ +F++C+++  L +  + G+
Sbjct  118  LYAMA-RDV-DAPWLVGGDFNVIWHEKEKFGGLPVLLNENDDFRHCVNTCNLFDLGFKGS  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             FTWWNGR     +++RLDR L N
Sbjct  176  IFTWWNGRAEEDCIFKRLDRCLAN  199



>ref|XP_009622344.1| PREDICTED: uncharacterized protein LOC104113766 [Nicotiana tomentosiformis]
Length=302

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 102/200 (51%), Gaps = 5/200 (3%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAK  415
            I WN R + + G++ R++ L +      + +LEPF D +HL  F + L   +  S    K
Sbjct  5    IIWNARGIRTSGAIERLKLLKKLHNLSFITVLEPFLDTNHLIYFRLQLSMHHAASNINNK  64

Query  414  IWVF*DRCLS*P-LGHGYQIVSMRVT-LPVIGNLMLSVVYASCERRVRQELWDLIEAMAA  241
            IW+F D   +   L    Q +++ +  +       L+++YA C+  +R  LW+ +   + 
Sbjct  65   IWIFWDNEFTRQVLDQDEQQLTIELKHVEAAKTFHLTIIYAKCKTAMRILLWETLRLKST  124

Query  240  REVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWN  61
              +    W I+G FN I   EEK GG PY  ++S +F + ++   L    +YG  +TW N
Sbjct  125  --MCTMPWCIIGYFNVISSTEEKIGGVPYQMSESLDFLSMMEDCELVGLGFYGPRYTWSN  182

Query  60   GRRGSQAVWERLDRVLVNEN  1
            G+     VW+RLDR L N+N
Sbjct  183  GKGPGSIVWKRLDRGLANDN  202



>ref|XP_009608434.1| PREDICTED: uncharacterized protein LOC104102442 [Nicotiana tomentosiformis]
Length=309

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 104/208 (50%), Gaps = 19/208 (9%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +QG+  R+  + R++    + ++EP +    L +++  +GF      +
Sbjct  1    MNALIWNIRSVNTQGAFERIIEMQRKYHFHFIGIMEPMQQSRKLEKYNRKIGFTQAIVNS  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMR----VTLPVIGN-----LMLSVVYASCERRVRQE  271
            + KIW F D          Y IV +     +TL +         +L++VYA C+   R E
Sbjct  61   SNKIWAFIDERF-------YVIVVIDMVQCLTLKLYDTEDHKEFILTLVYAKCDHIERIE  113

Query  270  LWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESV  91
            LWD +  +A        W + GDFN I   EEK GG   +  +  +F++C+++  L +  
Sbjct  114  LWDSLYYLARYMTTP--WLVGGDFNVIWDEEEKFGGLLVSLNEVDDFRHCMNTCNLTDMG  171

Query  90   YYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            + G+ +TWWNGR     + +RLDRV  N
Sbjct  172  FKGSIYTWWNGRAEKDCILKRLDRVFAN  199



>ref|XP_009793730.1| PREDICTED: uncharacterized protein LOC104240565 [Nicotiana sylvestris]
Length=191

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 97/184 (53%), Gaps = 5/184 (3%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +  +  RV  + RQ++   + L+EP +    + Q+   LGFE      
Sbjct  1    MNALIWNIRPVNTMQAFERVITMDRQYQFDFIALMEPMQQTRTVDQYRRRLGFEQVVVNI  60

Query  420  A-KIWVF*DRCLS*-PLGHGYQIVSMRVT-LPVIGNLMLSVVYASCERRVRQELWDLIEA  250
            + KIW+F D+      L +  Q +++R+T        ++++VYA C    R ELWD + +
Sbjct  61   SNKIWIFIDQKYDFYILFNMKQQITLRMTDTDDHKEFIITMVYAKCHAIERIELWDTLYS  120

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            +A        W + GDFN I   EEK GG P +  +  +F++CI++  L +  + G+ FT
Sbjct  121  LATD--MSLPWLVGGDFNVIWDEEEKFGGLPVHINEIDDFRHCINTCNLFDLGFKGSIFT  178

Query  69   WWNG  58
            WWNG
Sbjct  179  WWNG  182



>ref|XP_009597454.1| PREDICTED: uncharacterized protein LOC104093421 [Nicotiana tomentosiformis]
Length=315

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 89/166 (54%), Gaps = 5/166 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIG  325
            +EPF+   HL ++ + L  E   S    KIW+F +  +   L     Q V +RV    I 
Sbjct  1    MEPFQKPRHLQRYRIILNMETTFSNLNGKIWLFFNSVVEWELVTETAQQVVVRVFHHDIS  60

Query  324  -NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
             ++M++ VYA C    R ELWD +  +A     +  W + GDFN IL  +EK GG P + 
Sbjct  61   QHIMMTFVYAKCSSVERLELWDNLYCLACD--MELPWLVGGDFNVILHEDEKIGGLPVHP  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLV  10
             +  +F  C++S  L +  Y  N FTWW+GR  S+ +++RLDR+ V
Sbjct  119  PEYEDFAFCVNSCDLFDHDYKENPFTWWSGRPNSECIFKRLDRIFV  164



>ref|XP_009788948.1| PREDICTED: uncharacterized protein LOC104236667 [Nicotiana sylvestris]
Length=488

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 102/195 (52%), Gaps = 4/195 (2%)
 Frame = -1

Query  582  NVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT-AKIWV  406
            N++ V S+  +HR++ L+     + + + EPF     L  +   L F++ CS    +IW 
Sbjct  192  NIKGVRSKKVIHRLKKLININNSQYVAIFEPFVSNDKLEGYRKFLDFQHCCSNNIGQIWY  251

Query  405  F*DRCLS*PL-GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVG  229
            F +   +  +     Q +++        ++ +  VYA  + + R++LW   E  +   V 
Sbjct  252  FWNSYNTTTVTAISEQHITIHFQNIFGKDIYIFAVYAKGKSKDRRDLWHSFELDSM--VI  309

Query  228  DGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRG  49
            D  W + GDFN I+   +K GGQP+   +S EFQ CI +  L +  Y G+++TW N RR 
Sbjct  310  DTPWCVGGDFNIIMDPNKKLGGQPHRMYRSLEFQTCISNCGLIDMGYNGSNYTWCNNRRS  369

Query  48   SQAVWERLDRVLVNE  4
             + +W+RLDR+ VN+
Sbjct  370  GKKIWKRLDRIFVND  384



>ref|XP_009799703.1| PREDICTED: uncharacterized protein LOC104245743, partial [Nicotiana 
sylvestris]
Length=316

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 100/190 (53%), Gaps = 5/190 (3%)
 Frame = -1

Query  567  ASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT-AKIWVF*DRC  391
              + +  RV N+ ++    I+ L+EP +    L ++   LG E   S    KIW+F D  
Sbjct  47   PKESAFQRVINMQKEHGFFIVALMEPKQKKKFLNRYRRRLGMEAAISNVNGKIWLFFDSV  106

Query  390  LS*PLG-HGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRW  217
            +   L     Q +++RV    +G  +M++ VYA      R ELWD +  +A+    +  W
Sbjct  107  VEWDLVVDNEQQITIRVYHQDLGIYIMMTFVYAKFCALERLELWDSLYCLASD--MELPW  164

Query  216  AIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAV  37
             + GDFN +L  EEK GG P    +  +F  C++S  L +  + G+ FTWWNGR   + +
Sbjct  165  LVGGDFNVVLGKEEKIGGLPVYPPEYEDFAFCVNSCELFDLGFKGSPFTWWNGRPNEECI  224

Query  36   WERLDRVLVN  7
            ++RLDR++VN
Sbjct  225  FKRLDRIMVN  234



>ref|XP_009610573.1| PREDICTED: uncharacterized protein LOC104104253 [Nicotiana tomentosiformis]
Length=465

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 107/202 (53%), Gaps = 11/202 (5%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAK  415
            + WN R + +Q + +R+ NL R++   ++ L+EP++D++ L ++   LG ++  +    K
Sbjct  5    LVWNARSINTQKAFNRLINLHRKYNFYLIGLMEPWQDINKLEEYRRKLGTQSAYANMNGK  64

Query  414  IWVF*DRCLS*PLGHGYQIVSMRVTLPVIG-----NLMLSVVYASCERRVRQELWDLIEA  250
            IW F D  +   +      +  ++TL +        L +++VYA C+   R ELW+ +  
Sbjct  65   IWAFVDEDIDVDIVMN---MEQQMTLKLFHRNLNKELYVTLVYAKCDATERIELWNSMYH  121

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            +A+       W + GDFN IL  EEK  G     ++  +F + +D+  L +  + G+ +T
Sbjct  122  LASD--MKSPWLVGGDFNVILLEEEKYRGHHVYLSEVEDFSHFMDTCALYDLGFKGSLYT  179

Query  69   WWNGRRGSQAVWERLDRVLVNE  4
            WWNGR     +++RLDR   N+
Sbjct  180  WWNGRSDIDCIFKRLDRYFANQ  201



>ref|XP_009622696.1| PREDICTED: uncharacterized protein LOC104114055 [Nicotiana tomentosiformis]
Length=185

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 98/181 (54%), Gaps = 5/181 (3%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-  424
            +K + WN+R V +Q +  RV N+ R+F   ++ L+EPF++  H+ ++   L  E   +  
Sbjct  7    IKALIWNIRHVKTQQAFQRVINMQREFGFFVVALMEPFQNSRHIQRYRRRLNMEAVFAKL  66

Query  423  TAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEA  250
              KIW+F D  +   +    +Q V++++    I  ++M + VY  C    R ELWD +  
Sbjct  67   NRKIWLFFDAIVVWEIVMDTHQQVTIKLYHQDISQHIMCTFVYVKCSSLERLELWDSLYY  126

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            +A+    +  W + GDFN +L  +EK GG P +  +  +F  C++SSRL +  Y G+  T
Sbjct  127  LASD--MELPWMVGGDFNVLLHEDEKIGGLPVHPPEYEDFAFCVNSSRLFDLGYKGSPIT  184

Query  69   W  67
            W
Sbjct  185  W  185



>ref|XP_009802343.1| PREDICTED: uncharacterized protein LOC104247891, partial [Nicotiana 
sylvestris]
Length=223

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 103/204 (50%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+  + R+   + + L+E  +   +L ++   +G     S  
Sbjct  1    MNALIWNIRPVNTQQAFERLTKMHRKNHYEFVGLMEQKQQAKNLERYRNKIGLAQAISNV  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDL  259
            + KIW F D      + +    +  ++TL +         +L+++YA C+   R ELW  
Sbjct  61   SNKIWAFIDEVFEVTIMNS---MVQQLTLRLFHTESHVEFVLTLIYAKCDAIERIELWGS  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AMA   V    W + GDFN I   EEK GG P +  +  +F++C+++  L +  + G+
Sbjct  118  LYAMARYMVAP--WLVGGDFNVIWDEEEKFGGLPVSLNEIDDFRHCVNTCNLFDLGFKGS  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             FTWWNG      +++RLDR L N
Sbjct  176  IFTWWNGIADEDCIFKRLDRCLAN  199



>ref|XP_009791951.1| PREDICTED: uncharacterized protein LOC104239115 [Nicotiana sylvestris]
Length=224

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 90/168 (54%), Gaps = 5/168 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PLGHGY-QIVSMRVTLPVIG  325
            +EPF     +  +   +GF    S    KIW F              Q +++ ++    G
Sbjct  1    MEPFVQKEKIEGYKKFMGFHQCISNDNGKIWCFWTTNCQTTTMTNEDQQITINISEEGGG  60

Query  324  N-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
            N L ++ VYA C    R+ELW  +E + A  + +G W + GDFN IL  +EK  G+PY  
Sbjct  61   NGLFVTAVYAKCTSTERRELWHSLERVNA--MVNGPWCVGGDFNSILDTDEKLEGRPYRI  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             KS +F NC+++  L ++ Y G  FTW N RR S+ +W+RLDR+++N+
Sbjct  119  NKSIDFSNCMNNCELLDAGYVGVKFTWCNNRRPSKRIWKRLDRIMIND  166



>ref|XP_009625564.1| PREDICTED: uncharacterized protein LOC104116418 [Nicotiana tomentosiformis]
Length=196

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 86/167 (51%), Gaps = 5/167 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSGT-AKIWVF*DRCLS*P--LGHGYQIVSMRVTLPVI  328
            +EPF+    + ++   LG E   S    KIW+F D  +     +    Q+  M     + 
Sbjct  1    MEPFQKQRFIQKYRSRLGMETTISNVNGKIWLFLDVVIQWDVIIDTEQQLTIMVYHQHLC  60

Query  327  GNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
             +++++ VYA C    R ELWD +  +A+    +  W + GDFN +L  E+  GG P   
Sbjct  61   KHIIMTFVYAKCSSLDRLELWDNLYYLASDM--ELPWVVGGDFNIVLNEEDNIGGLPVYP  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
                +F  C++S  L +  Y G+ FTWWNGR  S+ +++RLDR+ VN
Sbjct  119  PDYEDFALCVNSYGLFDMGYKGSPFTWWNGRSNSECIFKRLDRIFVN  165



>ref|XP_009785855.1| PREDICTED: uncharacterized protein LOC104234058 [Nicotiana sylvestris]
Length=426

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 102/191 (53%), Gaps = 3/191 (2%)
 Frame = -1

Query  570  VASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DR  394
            ++S G+  R++ ++R      + + EPF  + HL +F   LG++N  +   ++IW+F + 
Sbjct  47   ISSSGAFDRLKQIIRLQNLPFIAISEPFHKVDHLDKFISMLGYDNTHANINSQIWIFWNN  106

Query  393  CLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWA  214
             L+  +          +   +  N++++ VYA C+  +R+ LW+ +  ++        W 
Sbjct  107  DLNCNVVEESDQQVTCIIEWMGTNILVTFVYAKCDAGLREHLWNNLRDISQN--YKLPWY  164

Query  213  IMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVW  34
            I GDFNCI+   +K+GG  +  +KS      I    L +  + G+ FTW NG   ++ VW
Sbjct  165  IAGDFNCIIDPSKKQGGNLHRMSKSMPMIQFIMDCNLIDPGFSGSQFTWCNGWSPNRRVW  224

Query  33   ERLDRVLVNEN  1
            +R+DRVLVN++
Sbjct  225  KRIDRVLVNQD  235



>ref|XP_009611219.1| PREDICTED: uncharacterized protein LOC104104767 [Nicotiana tomentosiformis]
Length=202

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 5/168 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIG  325
            +EPF+    + ++   LG +   S    KIW+F D  +   L     Q +++++    +G
Sbjct  1    MEPFQKQGLIHKYKRRLGMDTAISNINGKIWLFFDAMVEWELLSDTDQQLTIKIYHQYVG  60

Query  324  -NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
             +++++ VYA C    R ELWD +  + A    +  W + GDFN +L  EE  GG P   
Sbjct  61   QHIIMTFVYAKCSSLDRLELWDNLYYLVAD--MELPWVVGGDFNVVLHEEENIGGLPVYP  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             +   F  C++SS L ++ Y  + FTWWNGR  +  +++ LDR+LVN+
Sbjct  119  PEIENFAFCVNSSSLFDTGYKRSPFTWWNGRSDAGCIFKSLDRILVNQ  166



>ref|XP_009601161.1| PREDICTED: uncharacterized protein LOC104096488 [Nicotiana tomentosiformis]
Length=286

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 93/171 (54%), Gaps = 5/171 (3%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PL-GHGYQIVSMRVTL  337
            I+ L+E F+   H+ ++   LG +N  S    KIW+F D  +   L     Q V+++V  
Sbjct  9    IVTLVEQFQKAEHIQRYRRRLGMDNAYSNINGKIWLFLDIVVEWELLIDTEQQVTIKVYH  68

Query  336  PVIG-NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQ  160
              IG +++L+ VYA      R +LWD +  +A     +  W + GDFN IL  EE  GG 
Sbjct  69   KDIGKHIILTFVYAKFSSLERLKLWDNLYNLAND--MEMPWVVGGDFNVILSEEENIGGL  126

Query  159  PYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            P    +  +F +C++ S L +    G+ FTWWNGR   + +++RLDR+LVN
Sbjct  127  PVYPPEYEDFASCVNLSGLFDLCCKGSPFTWWNGRPNVECIFKRLDRILVN  177



>ref|XP_009780879.1| PREDICTED: uncharacterized protein LOC104229860 [Nicotiana sylvestris]
Length=440

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 106/204 (52%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+  + R+   + + L+EP +    L ++   +G     S  
Sbjct  1    MDALIWNIRSVNTQQAFERLTKMHRKNHYEFVGLMEPKQQAKKLERYRNKIGLAQAISNV  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDL  259
            + KIW F D      +   Y +V  ++TL +         +L ++YA C+   R ELWD 
Sbjct  61   SNKIWAFIDEVFE--VAVMYNMVQ-QLTLRLFHTEKHVEFVLILIYAKCDAIERIELWDS  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AMA R++ D  W + GDFN I   EEK GG   +  +  +F++C+++  L +  + G+
Sbjct  118  LYAMA-RDM-DAPWLVGGDFNVIWDEEEKFGGLLVSLNEIDDFRHCVNTCNLFDLGFKGS  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             FTW +GR     +++RLDR L N
Sbjct  176  IFTWLDGRAEEDCIFKRLDRCLAN  199



>ref|XP_009786204.1| PREDICTED: uncharacterized protein LOC104234350 [Nicotiana sylvestris]
Length=863

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 98/186 (53%), Gaps = 10/186 (5%)
 Frame = -1

Query  540  RNLVRQF-KPKILCLLEPFKDLSHLGQFSVSLGFEN---RCSGTAKIWVF*DRCLS*PLG  373
            RN+ +   K +I+ + EPF   + + ++   LGFE     C+G  KIWV         + 
Sbjct  312  RNICKSLHKTQIIAIQEPFVKANQIDKYRRGLGFEGCYANCNG--KIWVLWSAEFDAAVA  369

Query  372  -HGYQIVSMRVTLPVIGNLM-LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDF  199
             +  Q ++ ++T    G ++  + VYA  ++ +R  LWD +  +      D  W I GDF
Sbjct  370  ENNEQQITFKITRKNDGEVVWFTAVYAKSKQYLRVPLWDNL--IHCNNYIDDPWCIYGDF  427

Query  198  NCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDR  19
            N I+  +EKKGG P+   KS EF +C++   + ++ Y G  FTW N R   Q +W+RLDR
Sbjct  428  NAIMGPKEKKGGNPHRMEKSWEFISCMEDCGMVDASYKGLRFTWCNARGRHQRIWKRLDR  487

Query  18   VLVNEN  1
            V +N +
Sbjct  488  VFINHH  493



>ref|XP_009778376.1| PREDICTED: uncharacterized protein LOC104227758 [Nicotiana sylvestris]
Length=482

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 104/204 (51%), Gaps = 11/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  I WNVR V +  +  R+  + R+   + + +LEP +    + ++   +G        
Sbjct  1    MDAIIWNVRSVNTMQAFERLITMHRKHHFEFIRILEPMQPSHKMERYRARIGLAQAVVNM  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDL  259
            + KIW F D      + +    ++ ++TL ++ +     L+L++VYA C+R  R EL D 
Sbjct  61   SNKIWAFIDEIFEVTILYN---MTQQLTLRLMHSETHVELILTLVYAKCDRTKRIELRDT  117

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            + AM +         + GDF  I   EEK GG P +  +  +F++CI++  L +  + G+
Sbjct  118  LYAMTSDMTV--HCLVGGDFYVIWDEEEKYGGLPVSLIEVDDFRHCINNYNLTDLGFKGS  175

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             FTWWNGR   + +++RLDR   N
Sbjct  176  IFTWWNGRSEEECIFKRLDRCFGN  199



>ref|XP_009778722.1| PREDICTED: uncharacterized protein LOC104228034, partial [Nicotiana 
sylvestris]
Length=384

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 100/199 (50%), Gaps = 23/199 (12%)
 Frame = -1

Query  570  VASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*DR  394
             A QG L   +  V   K     L+EP +    L ++   +G     S  + KIW F D 
Sbjct  13   AARQGDLSPTQ--VENAKSAAKGLMEPKQQAKKLERYKNKIGLAQAISYVSNKIWAFIDE  70

Query  393  CLS*PLGHGYQIVSM-----RVTLPVIGN-----LMLSVVYASCERRVRQELWDLIEAMA  244
                     +++V M     ++TL +         +L+++YA C+   R ELWD +  MA
Sbjct  71   V--------FEVVVMYNMVQQLTLGLFHTEKHVEFVLTLIYAKCDAIERIELWDSLYEMA  122

Query  243  AREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWW  64
             R++ D  W + GDFN I   EEK GG P +  +  +F++C+++  L + V+ G+ FTWW
Sbjct  123  -RDM-DAPWLVGGDFNVIWDEEEKFGGLPVSLNEIDDFRHCVNTCNLFDLVFKGSIFTWW  180

Query  63   NGRRGSQAVWERLDRVLVN  7
            NGR     +++RLDR L N
Sbjct  181  NGRAEEDCIFKRLDRCLAN  199



>ref|XP_010243665.1| PREDICTED: uncharacterized protein LOC104587667 [Nelumbo nucifera]
Length=243

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 99/199 (50%), Gaps = 4/199 (2%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-RCSG  424
            M  + WN+R +A+  S+  +  L + +K  ++ + EP      L Q S  L       + 
Sbjct  1    MNGLFWNIRGIANDPSITCLIKLCKLYKLGVVAVSEPMIGDDRLSQISKRLNMTGFMVNI  60

Query  423  TAKIWVF*DRCLS*PLGHGY-QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAM  247
            ++KI +F +   S  L     QI+S++VT     +  LSVVYA C+R  R  LWD+I  +
Sbjct  61   SSKIVLFWNSLFSVQLIKDCDQILSVKVTTTTNESFALSVVYAKCDRMERMSLWDIIWNL  120

Query  246  AAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTW  67
            A+R      W +  DFN I   EEK G +  N +   +F + I+   L +  + G+ FTW
Sbjct  121  ASR--ISKPWLLARDFNVITCKEEKVGERNPNVSTMDDFVDLINVIGLVDLGFSGSRFTW  178

Query  66   WNGRRGSQAVWERLDRVLV  10
             N R     VW  LDRVLV
Sbjct  179  CNNREELDCVWAHLDRVLV  197



>ref|XP_009606477.1| PREDICTED: uncharacterized protein LOC104100839 [Nicotiana tomentosiformis]
Length=168

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 86/167 (51%), Gaps = 5/167 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PL--GHGYQIVSMRVTLPVI  328
            +EPF+    +  +   LG E   S    KIW+F D  +   +      Q+  M     + 
Sbjct  1    MEPFQKQRLIQNYWRRLGMEAAISNINGKIWLFLDVVVQWDMVIDTDQQLTIMVYHQDIE  60

Query  327  GNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
             ++M++ VYA C    R ELWD    ++ R++ +  W + GDFN IL  EEK GG P   
Sbjct  61   KHIMMTFVYAKCLSMERLELWDNPHYLS-RDM-ELPWVVGGDFNVILNEEEKIGGLPVYP  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             K  +F   ++S  L +  Y G+ FTWWNG+  S+ +++RLDR  VN
Sbjct  119  PKYEDFAFFVNSCGLFDMGYKGSPFTWWNGKPNSECIFKRLDRSFVN  165



>ref|XP_009624636.1| PREDICTED: uncharacterized protein LOC104115667 [Nicotiana tomentosiformis]
Length=204

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 77/141 (55%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  TAKIWVF*DRCLS*PLGHGY-QIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLIEA  250
              KIW+F D  +   L     Q V+++V   VIG  +M++ VY+ C    R ELWD +  
Sbjct  9    NGKIWLFFDSVVEWELLIDVEQQVTIKVYHQVIGKYIMMTFVYSKCSSLERLELWDSLYY  68

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            +A+    +  W + GDFN +L  EEK GG P    +   F  C++S  L +  Y G+ FT
Sbjct  69   LASD--MELPWLVRGDFNVVLSEEEKLGGLPMYPPEYENFAFCVNSCGLFDLGYKGSPFT  126

Query  69   WWNGRRGSQAVWERLDRVLVN  7
            WWN R  +Q +++RLD + VN
Sbjct  127  WWNRRPNAQCIFKRLDMIFVN  147



>ref|XP_004250606.1| PREDICTED: uncharacterized protein LOC101247390 [Solanum lycopersicum]
Length=612

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 91/185 (49%), Gaps = 31/185 (17%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*D------------RCLS*PLGH  370
            I+ +LEPF D  ++  F V L  +N  S   +KIWVF +            + ++  + H
Sbjct  6    IIAILEPFSDSVNIQSFKVQLNMDNATSNCNSKIWVFWNNDIDCNILDEDEQQITCDMKH  65

Query  369  G---YQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDF  199
                YQ  S             + +YA C+  +R+ LWD +   A+  V    W  +GD+
Sbjct  66   NELKYQFTS-------------TFIYAKCKEYLRRPLWDKLLHHAS--VSTNPWCAVGDY  110

Query  198  NCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDR  19
            N I   +EK GG PYN  KS +F   I++  L +  + G+ FTW N R  +  +W+RLDR
Sbjct  111  NVIFDVDEKLGGLPYNMRKSMDFIALIEACGLVDIGFSGHRFTWSNKRGFNNRIWKRLDR  170

Query  18   VLVNE  4
             LVN+
Sbjct  171  ALVND  175



>ref|XP_009797305.1| PREDICTED: uncharacterized protein LOC104243753 [Nicotiana sylvestris]
Length=424

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 108/238 (45%), Gaps = 42/238 (18%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M    WN R V +Q +  R+  + RQ     + L+EP +    L ++   +G     S  
Sbjct  1    MNAFIWNKRSVNTQQAFERLTKMHRQNHYDFVGLMEPKQQAKKLERYRNKIGIAQAISNV  60

Query  420  A-KIWVF*DRC------------LS*PLGHG--------------YQIVSMRVTLPVIGN  322
            + KIW F D              L+  L H               Y++  + V   ++  
Sbjct  61   SNKIWAFIDEVFEVTVMYNMVQQLTLRLFHTESHVEFVLTLIYAKYEVFEVTVMYNMVQQ  120

Query  321  L-------------MLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRG  181
            L             +L+++YA C+   + ELWD + AMA R++ +  W   GDFN I   
Sbjct  121  LTLRLFHTESHVEFVLTLIYAKCDAIEKIELWDSLYAMA-RDM-EAPWLAGGDFNIIWDE  178

Query  180  EEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            EEK GG P +  +  +F++CI++  L +  + G+ FTWWNGR     +++RLDR L N
Sbjct  179  EEKFGGLPVSLNEINDFRHCINTCNLFDLGFKGSIFTWWNGRAEEDCIFKRLDRCLAN  236



>ref|XP_009616442.1| PREDICTED: uncharacterized protein LOC104108979 [Nicotiana tomentosiformis]
Length=315

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 90/185 (49%), Gaps = 5/185 (3%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  I WN R V ++ +  R   + RQ   + +  +EP +    L ++ + +GF    +  
Sbjct  1    MDAIMWNARSVNTKQAFERPVTMHRQHHFEFIGFMEPMQQARKLERYRMKIGFAQAIANV  60

Query  420  A-KIWVF*DRCLS*PLGHGY--QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEA  250
            + KIW F D      + +    Q++           L+L++VYA C+   R +LWD + A
Sbjct  61   SNKIWAFIDEVFEVTILYDMVQQLILRLFHTETHVELILTMVYAKCDAIERIKLWDSLYA  120

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            MA          + GDFN I   EE  GG P +  +  +F++CI++  L +  + G+ +T
Sbjct  121  MARDMTVPC--LVSGDFNVIWDEEETFGGLPVSLDEVDDFRHCINTCNLTDLGFKGSIYT  178

Query  69   WWNGR  55
            WWNGR
Sbjct  179  WWNGR  183



>ref|XP_009629028.1| PREDICTED: uncharacterized protein LOC104119281 [Nicotiana tomentosiformis]
Length=344

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 83/159 (52%), Gaps = 5/159 (3%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PL-GHGYQIVSMRVTL  337
            I+ L+E F+   H+ ++   LG +N  S    KIW+F D  +   L  +  Q V+++V  
Sbjct  7    IVALMESFQKTEHIQRYRRILGMDNAYSNINGKIWLFIDSVVEWELLIYTEQQVTIKVYH  66

Query  336  PVIGN-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQ  160
              IG  ++++ VYA C    R ELWD +   A     +  W + GDFN IL  E K GG 
Sbjct  67   KDIGKYIIMTFVYAKCSSLERLELWDNLYNRAND--MEMPWVVGGDFNVILSEEAKIGGL  124

Query  159  PYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQ  43
            P    +  +F +C++SS L +  Y GN  TWWN R  ++
Sbjct  125  PVYPTEYEDFSSCVNSSGLFDLGYKGNPITWWNSRPNAE  163



>ref|XP_007017129.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
 gb|EOY34748.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
Length=910

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 102/200 (51%), Gaps = 12/200 (6%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENR-CSGTAK  415
            + WNVR ++ +    R++ L    K KIL +LEP  D+S    F   LGFE    + + K
Sbjct  5    LIWNVRGISGRVIQRRLKKLQLMHKIKILAILEPMVDISKAEFFRRKLGFEKVIVNSSQK  64

Query  414  IWVF*DRCLS*PLGHGY-QIVSMRVTLPVI-GNLMLSVVYASCERRVRQELWDLIEAMAA  241
            IW+F    L   +   + Q + +R+T P +  +   + VYA C R  R  LWD +  +AA
Sbjct  65   IWLFHSLELHSDIILDHPQCLHVRLTSPWLEKSFFATFVYAKCTRSERTFLWDCLRRLAA  124

Query  240  R-EVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWW  64
              EV    W + GDFN IL+ EE+  G   ++    +F + +    L +  + GN FTW 
Sbjct  125  DIEVP---WLVGGDFNIILKREERLYGSAPHEGSMEDFASVLLDCGLLDGGFEGNPFTWT  181

Query  63   NGRRGSQAVWERLDRVLVNE  4
            N R     +++RLDRV+ N 
Sbjct  182  NNR-----MFQRLDRVVYNH  196



>ref|XP_007024114.1| Uncharacterized protein TCM_028693 [Theobroma cacao]
 gb|EOY26736.1| Uncharacterized protein TCM_028693 [Theobroma cacao]
Length=197

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 96/202 (48%), Gaps = 14/202 (7%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN---RCSGT  421
            + WNVR ++S     R++ L    K K L +LEP  D S        LGFE     CS  
Sbjct  5    LVWNVRGISSAVIQRRIKKLQLLHKMKTLVILEPMVDNSKADFIRRKLGFEKVFKNCS--  62

Query  420  AKIWVF*DRCLS*P-LGHGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAM  247
             KIW+F    LS   L    Q + +++T+P +   L+ S ++  C R  R  LWD +  +
Sbjct  63   QKIWLFHSVDLSCEVLLDQVQCLHVKLTMPWLEIPLLASFIFVKCTRSERLILWDCLRGL  122

Query  246  AAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTW  67
            +A       W + GDFN I+R  E+  G   +     +F   +    L +  Y GN FTW
Sbjct  123  SANI--HAPWIVGGDFNAIIRSGERMNGAAPHGGSMEDFATALLDCGLMDGEYEGNPFTW  180

Query  66   WNGRRGSQAVWERLDRVLVNEN  1
             N R     +++RLDR++ N +
Sbjct  181  TNNR-----MFQRLDRMVYNHH  197



>ref|XP_009758745.1| PREDICTED: uncharacterized protein LOC104211395 [Nicotiana sylvestris]
Length=427

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN  322
            +EP +    L  +   +GF       + KIW F D      + +  +   M + L   G+
Sbjct  1    MEPKQHARKLENYRRKIGFAQAFGNVSNKIWAFIDEIYEVNIMYDLE-QQMTLHLYNTGD  59

Query  321  ---LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN  151
                +L++VYASC+   R ELWD + A A R++ D  W + GDFN I   EEK GG P +
Sbjct  60   NKEFILTLVYASCDATKRIELWDSLYAFA-RDM-DRPWLVGGDFNVIWDEEEKFGGLPVH  117

Query  150  KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              K  +F++C+++  L +  + G+ +TWWNGR     ++++LDR+L N
Sbjct  118  MNKVLDFRHCVNNCNLFDLGFKGSIYTWWNGRGEEDCIFKQLDRILAN  165



>ref|XP_009762570.1| PREDICTED: uncharacterized protein LOC104214577 [Nicotiana sylvestris]
Length=165

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 86/163 (53%), Gaps = 9/163 (6%)
 Frame = -1

Query  528  RQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*DRCLS*PLGHGY-QIV  355
            RQ     + L+EP +D S L  +   +GF    S  + K+W F D      + +   Q +
Sbjct  3    RQHDFDFVGLMEPMQDGSKLELYRRQIGFSQAFSNISNKVWAFVDELYDVTILYDMEQQL  62

Query  354  SMRVTLP---VIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            ++++T     ++ N+ L  VYA C+   R ELWD + AMAA    D  W + GDFN I  
Sbjct  63   TLQMTHTETRIVQNVTL--VYAKCDAIERIELWDSLYAMAAD--MDVPWLVGGDFNVIWD  118

Query  183  GEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGR  55
             EEK GG+P    +  +F++C+++  L    + G+ +TWWNGR
Sbjct  119  DEEKFGGRPVTLNEVDDFRHCMNTCNLFNLGFNGSIYTWWNGR  161



>ref|XP_009587301.1| PREDICTED: uncharacterized protein LOC104085051 [Nicotiana tomentosiformis]
Length=181

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = -1

Query  336  PVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQP  157
            P   +L L+ V A C    R+ELW  +E +      +G W I GDFN IL  ++ KG  P
Sbjct  5    PANCDLFLTAVCAKCTENERRELWSSLEDIHTH--INGPWCIGGDFNVILDLDKNKGDNP  62

Query  156  YNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            Y    S EF NC+D+  + +  + G  FTW N  R  + +W+RLDRV VN+
Sbjct  63   YRMHISFEFSNCMDNCEMVDLGFVGPRFTWCNNWRARKRIWKRLDRVFVND  113



>ref|XP_009778225.1| PREDICTED: uncharacterized protein LOC104227642 [Nicotiana sylvestris]
Length=191

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 2/120 (2%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q +++R+      ++ ++ VYA C  R R++ W  IE ++    G   W I GDFN I+ 
Sbjct  16   QQLTLRIKDKDRSDIHITAVYAKCTARERKDFWANIEDISNDIAGP--WCIGGDFNVIMD  73

Query  183  GEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             EEK GG+P+   +S +F   ++   L +  Y+G  FTW N RR ++ +W+RLD ++VN+
Sbjct  74   SEEKLGGRPHRAHRSVDFTATMEYCGLVDLGYFGPRFTWCNNRRTNKRIWKRLDSIIVND  133



>ref|XP_009790176.1| PREDICTED: uncharacterized protein LOC104237684 [Nicotiana sylvestris]
Length=338

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 69/122 (57%), Gaps = 7/122 (6%)
 Frame = -1

Query  357  VSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNC  193
            +  ++TL +  N     ++L++VYA CE   R ELWD + A+A+       W + GDFN 
Sbjct  6    MQQQLTLKITNNSTQQEIILTLVYAKCEHIERIELWDTLYALASDMTKP--WIVGGDFNV  63

Query  192  ILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
            I   EEK GG P    +  +F  CI++  L +  + G+ FTWWNGR    +++ RLDRVL
Sbjct  64   IWDEEEKFGGLPVPLNEVDDFGQCINTFNLNDLGFKGSIFTWWNGRGEEDSIFTRLDRVL  123

Query  12   VN  7
             N
Sbjct  124  GN  125



>ref|XP_009609484.1| PREDICTED: uncharacterized protein LOC104103292 [Nicotiana tomentosiformis]
Length=595

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 88/167 (53%), Gaps = 5/167 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSGT-AKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIG  325
            +E F++   +  +   LG +   S    KIW+F D  +   L     Q +++RV    IG
Sbjct  1    MELFQNQRFIQNYRRRLGIDVATSNVNGKIWLFLDSVVQWDLLIDTEQQLTIRVYHQDIG  60

Query  324  N-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
              +M++ VYA C      ELWD +  +A+    +  W + GDFN +L  +EK GG     
Sbjct  61   KYIMMTFVYAKCSSLDILELWDSLYYLASD--MELPWLVGGDFNVLLNEKEKIGGLSVYP  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             +  +F  C++S  L ++ Y G+ FTWWNGR  ++ ++ RLDR+ VN
Sbjct  119  PEYEDFAFCVNSCELFDTGYKGSPFTWWNGRPNAECIFRRLDRIFVN  165



>ref|XP_008788610.1| PREDICTED: uncharacterized protein LOC103706329 [Phoenix dactylifera]
Length=288

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 99/218 (45%), Gaps = 30/218 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQ----FSV-------  454
            M+ + WN R  A    +   R LV+   P+I  L E       LG+    F V       
Sbjct  1    MRILTWNCRGAAKPAFMSSFRRLVQIHSPEICFLYETRLSGRGLGRVLRRFEVDWETYVV  60

Query  453  -SLGFENRC-----SGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASC  292
             S G           G A + VF          +  Q V M ++ P +   +L  VYAS 
Sbjct  61   ESQGLSGGIVALWKRGVATVDVF---------HNCSQQVLMIISEPNVAPWVLCGVYAST  111

Query  291  ERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR-EFQNCID  115
              R R+ LWD +  + A+       AI+GDFNCIL G EK+GG+ +  +  R EF++ + 
Sbjct  112  AYRTRRALWDELTHLIAQGFPT---AIVGDFNCILEGSEKRGGRAFTDSMDRREFRDFLS  168

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             + L +  + G  FTW N + G   VWERLDR + + +
Sbjct  169  RNGLVDLGFSGPQFTWCNNQAGRARVWERLDRAIASTD  206



>ref|XP_010324843.1| PREDICTED: uncharacterized protein LOC104648721 [Solanum lycopersicum]
Length=474

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 87/176 (49%), Gaps = 24/176 (14%)
 Frame = -1

Query  495  EPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*D---RCLS*PLGHGYQIVSM---RVTL  337
            EPF + S L  + + L  +   S +  KIW+F     +C         QIV M    ++ 
Sbjct  141  EPFANSSQLDSYRMRLLMDYSYSNSNNKIWIFWSDKVKC---------QIVDMDQQHISC  191

Query  336  PVI-----GNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEK  172
             VI      N  ++ VYA C+  +R+ L D    M         W I+GDFN I   +EK
Sbjct  192  EVIHEHCSDNFHITYVYAKCKEYLRKPLRD---GMLKWSTTVKPWCIIGDFNVITSTQEK  248

Query  171  KGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             GG+ YN  KS EF N I+S  L +  Y+G  FTW N R+    +W+RLDR +VN+
Sbjct  249  CGGRAYNINKSLEFINIIESCGLTDLGYHGQYFTWCNHRKDGARIWKRLDRGMVND  304



>ref|XP_009760586.1| PREDICTED: uncharacterized protein LOC104212910 [Nicotiana sylvestris]
Length=393

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 80/142 (56%), Gaps = 10/142 (7%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDLIE  253
            KIW F D      +   Y +V  ++TL +         +L+++YA C+   R ELWD + 
Sbjct  29   KIWAFIDEVFE--VNVMYNMVQ-QLTLRLFHTESHVEFVLTLIYAKCDAIERIELWDSLY  85

Query  252  AMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDF  73
            AMA R++ D  W + GDFN I   EEK GG P +  +  +F++C+++  L +  + G+ F
Sbjct  86   AMA-RDM-DAPWLVGGDFNVIWDEEEKFGGLPVSLNEIDDFRHCVNTCNLFDLGFKGSIF  143

Query  72   TWWNGRRGSQAVWERLDRVLVN  7
            TWWNGR     +++RLDR L N
Sbjct  144  TWWNGRAEEDCIFKRLDRCLAN  165



>ref|XP_009804630.1| PREDICTED: uncharacterized protein LOC104249829 [Nicotiana sylvestris]
Length=418

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 103/192 (54%), Gaps = 17/192 (9%)
 Frame = -1

Query  555  SLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLG-FENRCSGTAKIWVF*DRCLS*P  379
            +  R+  + RQ   + + ++E  +  + L  +   +G  +   + + KIWVF D      
Sbjct  3    AFERLVIMQRQHHFQFIGIMELMQRATKLEWYRRKIGMLQVYANVSNKIWVFVDE-----  57

Query  378  LGHGYQIV---SMRVTLPVIG-----NLMLSVVYASCERRVRQELWDLIEAMAAREVGDG  223
              HG  I+     ++TL +       +L+++ VYA C+   R ELWD + A+A R++ D 
Sbjct  58   -DHGVDIIINMDQQMTLKITNMDSGRSLIVTFVYAKCDSTERIELWDSLYALA-RDM-DL  114

Query  222  RWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQ  43
             W + GDFN I   EEK GG+P +  +  +F++C+++  L +  + G+ +T WNG+    
Sbjct  115  PWLVGGDFNVIWDEEEKFGGRPVHMNEVFDFRHCVNTCNLFDLGFKGSIYTLWNGQGEDD  174

Query  42   AVWERLDRVLVN  7
             +++RLDR+L N
Sbjct  175  CIFKRLDRILAN  186



>ref|XP_010682155.1| PREDICTED: uncharacterized protein LOC104897045 [Beta vulgaris 
subsp. vulgaris]
Length=277

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 100/229 (44%), Gaps = 20/229 (9%)
 Frame = -1

Query  636  TKGGGASISDC*----------MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPF  487
            +K G   +SDC           MK I WNVR  ++   +    ++VR  +P I  + E  
Sbjct  30   SKKGKGPMSDCPNLQKNLPNLKMKIIVWNVRGASNNAFVPHAWDVVRMNEPSIFIIFEAK  89

Query  486  KDLSHLGQFSVSLGFENRCS--------GTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPV  331
             +     Q +  LGF++  +        G   IW      +S      Y   S+    P 
Sbjct  90   AEECRARQVTQLLGFDDFKAIPPHGLKGGIWLIWKKTIELVSWSEVSPYYFHSLFKFSPK  149

Query  330  IGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN  151
               ++L+ ++A C  R R E+W  +E     +     W ++GD N I    EK GG+ + 
Sbjct  150  HSEVLLTGMHAPCTARERHEIWKNMEQNLPPD--QTPWMVVGDLNEIRNQNEKSGGRVFR  207

Query  150  KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             ++ +   + +D + L +  + GN FTW N R G+  + ERLDR L N 
Sbjct  208  SSQCKALDSFMDVAGLVDLGFDGNPFTWTNAREGAALIRERLDRALANH  256



>ref|XP_009599752.1| PREDICTED: uncharacterized protein LOC104095345 [Nicotiana tomentosiformis]
Length=240

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCIL  187
            Q +++RV    IG ++M++ VYA C    R ELWD +  +A+    +  W + GDFN +L
Sbjct  30   QQMTIRVYHQDIGKHIMMTFVYAKCCALERLELWDNLYYLASD--MELPWLVGGDFNVVL  87

Query  186  RGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
              +E+ GG P    +  +F  CI+S  L +  Y G+ FTWWNGR   + ++++LD++L
Sbjct  88   GEDERIGGFPVYPPEYEDFAFCINSCELFDLGYKGSPFTWWNGRPNEECIFKKLDKIL  145



>ref|XP_009769452.1| PREDICTED: uncharacterized protein LOC104220308 [Nicotiana sylvestris]
Length=552

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 98/207 (47%), Gaps = 34/207 (16%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  I WNVR V S  +  R+  + RQ   K + ++EP +    L ++   +G     S  
Sbjct  1    MNAIIWNVRSVKSMQAFERLITMQRQHHFKFIGIMEPKQKRKKLERYRRRIGMLQAFSNV  60

Query  420  A-KIWVF*DRCLS*PLGHGYQIV-------SMRVT-LPVIGNLMLSVVYASCERRVRQEL  268
            + KIWVF D        HG  IV       +++ T L +  + +++ VYA C        
Sbjct  61   SNKIWVFVDD------DHGVDIVYDLEQQLTLKFTNLDIQISFVVTFVYAKC--------  106

Query  267  WDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVY  88
             D IE +A            GDFN     EEK GG P +  +  +F++CI +  L +  +
Sbjct  107  -DSIEPLACG----------GDFNVTWDEEEKFGGLPISLNEINDFRHCITTCNLSDLGF  155

Query  87   YGNDFTWWNGRRGSQAVWERLDRVLVN  7
             G+ +TWWNGR  +  +++RLDR L N
Sbjct  156  KGSIYTWWNGRGEADCIFKRLDRCLGN  182



>ref|XP_009767379.1| PREDICTED: uncharacterized protein LOC104218552 [Nicotiana sylvestris]
Length=202

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
            L+++YA C+  +R+ LW+++   ++    +  W ++GDFN I   EEK GG PY  +KS 
Sbjct  12   LTIIYAKCKPLLRRPLWEVLNQKSSS--CNVPWCVIGDFNVIASVEEKIGGIPYQMSKSI  69

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            EF +      L +  YYG  +TW NGR     +W+RLDR L N+
Sbjct  70   EFLSMTKDCGLVDLGYYGPKYTWSNGRGQCSIMWKRLDRGLAND  113



>ref|XP_008780116.1| PREDICTED: uncharacterized protein LOC103699900 [Phoenix dactylifera]
Length=425

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 100/220 (45%), Gaps = 34/220 (15%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCS--  427
            M+ + WN R  A    +   R LV+   P+I  L E    LS  G   V   FE      
Sbjct  1    MRILAWNCRGAAKPAFMSSFRRLVQIHSPEICLLYE--TRLSGRGLDRVLRRFEVEWESY  58

Query  426  -----------------GTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYA  298
                             G A I VF   C         Q V M ++ P     +LS VYA
Sbjct  59   VVESQELSGGIVALWKRGVATIDVF-HNCA--------QQVLMIISEPNGAPWILSGVYA  109

Query  297  SCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNC  121
            S + R R+ +WD +  + A+       AI+GDFNCIL   EK+GG+ + +    REF++ 
Sbjct  110  STDHRTRRVMWDELTHLIAQGFPT---AIVGDFNCILERSEKRGGRVFTDSVDRREFRDF  166

Query  120  IDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            I S+ L +  + G+ FTW N + G   VWER+DR + + +
Sbjct  167  ISSNGLVDLGFSGSQFTWCNNQSGCARVWERIDRAVASAD  206



>ref|XP_009794930.1| PREDICTED: uncharacterized protein LOC104241686 [Nicotiana sylvestris]
Length=641

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 7/120 (6%)
 Frame = -1

Query  348  RVTLPVIGNLM-----LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            +VTL   GN +     ++ VYA C    R+ LW+ +E MA   + +  W   GDFN I+ 
Sbjct  107  QVTLCFKGNCISDDSYVTAVYAKCSATERKALWESLENMA--NIINEPWCTGGDFNVIME  164

Query  183  GEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
              EK GG PY   KS +F   +++  L + VY G   TW N RR  + +W RLDR+L+N+
Sbjct  165  SREKLGGSPYRAYKSFDFVTTMETCGLIDIVYVGPKHTWCNNRRPRKRIWNRLDRILIND  224



>ref|XP_009767123.1| PREDICTED: uncharacterized protein LOC104218348 [Nicotiana sylvestris]
Length=207

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
            L++ YA CE  +R+ LWD++   ++       W ++GDFN I   EEK GG PY  +K  
Sbjct  14   LTMYYAKCEPVMRRPLWDILRHKSSTYTIP--WCVIGDFNVIAFVEEKIGGIPYQMSKIL  71

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            +F +  + S L + VYYG+ +T  NGR  +   W+RLDR LVN+
Sbjct  72   DFFSMTEDSGLVDLVYYGHKYTGSNGRGPNSISWKRLDRGLVND  115



>ref|XP_009794046.1| PREDICTED: uncharacterized protein LOC104240851 [Nicotiana sylvestris]
Length=251

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLI-EAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS  139
            L+V+YA C+  +R+ LW+++ +      +    W ++GDFN I   +E  GG PY  +KS
Sbjct  47   LTVIYAKCKTNLRRPLWEVLRQKFLTYTIP---WCVIGDFNVIASIKENIGGLPYQLSKS  103

Query  138  REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             +F N I+   L +  +YG  +TW NGR     +W+RLD+ +VN+N
Sbjct  104  MDFLNMIEDCGLVDLGFYGPRYTWSNGRAPGSIIWKRLDKGMVNDN  149



>ref|XP_009596492.1| PREDICTED: uncharacterized protein LOC104092572 [Nicotiana tomentosiformis]
Length=266

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 2/106 (2%)
 Frame = -1

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            +++++ V A C    R ELWD +  +A+    D  W +  DFN IL   EK G  P +  
Sbjct  40   HIIMTFVNAKCSSLERLELWDYLYYLASD--MDMPWLVGSDFNVILYEHEKIGRLPVHPP  97

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +  +F  CI+S  L +  Y  N FTWWNG    Q +++RLDR+ VN
Sbjct  98   EYEDFAFCINSYGLFDLDYKANPFTWWNGSPNEQCIFKRLDRIFVN  143



>ref|XP_009803099.1| PREDICTED: uncharacterized protein LOC104248527 [Nicotiana sylvestris]
Length=431

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 79/142 (56%), Gaps = 10/142 (7%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDLIE  253
            KIW F D      + +    ++ ++TL ++ +     L+L++VYA C+R  R ELWD + 
Sbjct  20   KIWAFIDEIFEVSILYN---MTQQLTLRLMHSETHVELILTLVYAKCDRTERIELWDTLY  76

Query  252  AMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDF  73
            AMA+       W + G+FN I   EEK GG P +  +  +F++CI++  L +  + G+ F
Sbjct  77   AMASDITVP--WLVGGNFNVIRDEEEKYGGLPVSLIEVDDFRHCINTCNLTDLGFKGSIF  134

Query  72   TWWNGRRGSQAVWERLDRVLVN  7
            TWWNGR     +++ LDR   N
Sbjct  135  TWWNGRSEEDCIFKILDRCFGN  156



>ref|XP_008780242.1| PREDICTED: uncharacterized protein LOC103700043 [Phoenix dactylifera]
Length=271

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 69/122 (57%), Gaps = 4/122 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q V M V+ P     +L  VYAS   RVR+ LW  I ++ A+ V      ++GDFNCIL 
Sbjct  72   QQVVMVVSAPDAPPWVLCGVYASTNYRVRRVLWQEITSLTAQGVPT---VVVGDFNCILS  128

Query  183  GEEKKGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              +K+GG  + ++   REF++ +  + L +  Y G+ FTW N + GS  VWERLDR   +
Sbjct  129  SGDKRGGAAFTDRVDRREFRDFVSRTGLVDLGYSGSQFTWCNNQLGSARVWERLDRAFAS  188

Query  6    EN  1
             +
Sbjct  189  PD  190



>ref|XP_009127062.1| PREDICTED: uncharacterized protein LOC103851934 [Brassica rapa]
Length=1719

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 72/128 (56%), Gaps = 8/128 (6%)
 Frame = -1

Query  378  LGHGYQIVSMRVTLPV-IGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGD  202
            +    Q+++  V LP     L++S+VY S  R  R++LW  +  + A  +    WA +GD
Sbjct  591  ISKSLQVITCSVKLPFQPTELVISIVYGSNFREERKDLWSEL-ILVASSISSHPWACLGD  649

Query  201  FNCILRGEEKKGGQPYNKAKS-REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERL  25
            FN IL  EE      Y+ +   REF++C+DS  L +  Y+GN FTW N +     V ++L
Sbjct  650  FNEILSPEEHSTCNNYSSSSGMREFKDCVDSCLLSDLPYFGNTFTWSNNK-----VAKKL  704

Query  24   DRVLVNEN  1
            DR+LVN+N
Sbjct  705  DRILVNDN  712



>ref|XP_009757806.1| PREDICTED: uncharacterized protein LOC104210576 [Nicotiana sylvestris]
Length=252

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 85/167 (51%), Gaps = 5/167 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*DRCLS*-PLGHGYQIVSMRVT-LPVI  328
            +EP +    L ++   LG        + KIW F D       L    Q +++R+T     
Sbjct  1    MEPKQQSRKLERYRSRLGLAQVFVNISNKIWAFIDDDFEVMVLFDMQQQLTLRLTDTNTQ  60

Query  327  GNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
               +L++VYA C+   R +LWD + A+A+       W +  DFN I   EEK GG P   
Sbjct  61   QEFILTLVYAKCDHIKRIKLWDTLYALASDMTTP--WIVRRDFNVIWDEEEKFGGLPVPI  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             +  +F++CI+S  L +  + G+ FTWWNGR     +++RLDRVL N
Sbjct  119  NEVDDFRHCINSCNLIDLGFKGSIFTWWNGRAEEDCIFKRLDRVLGN  165



>ref|XP_009595534.1| PREDICTED: uncharacterized protein LOC104091817 [Nicotiana tomentosiformis]
Length=299

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 4/139 (3%)
 Frame = -1

Query  417  KIWVF*DRCLS*P--LGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMA  244
            KIW+F D  +     +    Q+  M     +  ++M++ VYA C    R ELWD +  + 
Sbjct  11   KIWLFLDAMVQWDVVIDTDQQLTIMVYHQDIENHIMMTFVYAKCSSLERLELWDNLYYLD  70

Query  243  AREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWW  64
             R++ +  W + GDFN IL  EEK GG P    +  +F   ++S  L +  Y G+ F WW
Sbjct  71   -RDM-ELPWVVGGDFNMILNEEEKIGGLPVYPPEYEDFVFYVNSCGLFDMGYKGSPFIWW  128

Query  63   NGRRGSQAVWERLDRVLVN  7
            NGR  S+ +++RLDR  VN
Sbjct  129  NGRPNSECIFKRLDRSFVN  147



>ref|XP_009604618.1| PREDICTED: uncharacterized protein LOC104099357, partial [Nicotiana 
tomentosiformis]
Length=227

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
            ++VVYA      R ELWD +  +A+    +  W + GDF+ IL  EEK GG P    +  
Sbjct  1    MTVVYAKYSSLERLELWDNLYYLASD--MELPWLVGGDFHVILNEEEKIGGLPVYPPEYE  58

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            +F  C++S  L ++ + G+ FTWWNGR   + +++RLD + VN+
Sbjct  59   DFAFCVNSCELFDTGHTGSPFTWWNGRANEECIFKRLDTIFVNQ  102



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 94/184 (51%), Gaps = 10/184 (5%)
 Frame = -1

Query  546   RVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENR-CSGTAKIWVF*D-RCLS*PLG  373
             R++ L    + KIL +LEP  D S    F   +GFE    + + KIW+F     +   L 
Sbjct  868   RIKKLQLMHRLKILAILEPMVDTSKAEYFRRKMGFEKVIVNNSQKIWLFHSVEFICEVLL  927

Query  372   HGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFN  196
                Q + +RVT+P +   +  + VYA C R  R  LW+ +  +AA    +G W + GDFN
Sbjct  928   DHPQCLHVRVTIPWLDLPIFTTFVYAKCTRSERTPLWNCLRNLAADM--EGPWIVGGDFN  985

Query  195   CILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRV  16
              IL+ EE+  G   ++    +F + +    L +  + GN FTW N R     +++RLDR+
Sbjct  986   IILKREERLYGADPHEGSIEDFASVLLDCGLLDGGFEGNPFTWTNNR-----MFQRLDRM  1040

Query  15    LVNE  4
             + N+
Sbjct  1041  VYNQ  1044



>ref|XP_009764242.1| PREDICTED: uncharacterized protein LOC104215986 [Nicotiana sylvestris]
Length=425

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 92/201 (46%), Gaps = 23/201 (11%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  + WN+R V +Q +  R+  + R++  + + ++EP +    L  +   +GFE      
Sbjct  1    MNALIWNIRPVNTQRAFERLITMHRKYHFEFIGVIEPMQQSRKLDWYRRQIGFEQAIVNI  60

Query  420  A-KIWVF*D--RCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEA  250
            + KIW F D    +S  L    Q+             ML++VYA C+   R EL      
Sbjct  61   SNKIWAFIDGKYDVSIELNTVQQLTLKLFDTEEQKKSMLTLVYAKCDHNDRIEL------  114

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
                          GDFN I   EEK GG P +  +  +F++ +++  L +  + G+ + 
Sbjct  115  --------------GDFNVIWDEEEKFGGLPVSINEVDDFRHYMNTCNLTDMGFKGSIYN  160

Query  69   WWNGRRGSQAVWERLDRVLVN  7
            WWNGR     +++RLDRV  N
Sbjct  161  WWNGRAEEYCIFKRLDRVFTN  181



>ref|XP_009798563.1| PREDICTED: uncharacterized protein LOC104244775 [Nicotiana sylvestris]
Length=262

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 4/140 (3%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGY-QIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMA  244
            KIW F D      + +   Q +++R+T       L+L++ YA C+R  R ELWD + AM 
Sbjct  20   KIWAFIDEIFEVTILYNMTQQLTLRLTHTETHVELILTLGYAKCDRIERIELWDSLYAMT  79

Query  243  AREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWW  64
            +       W + GDFN I   EEK GG P +  +  +F++ I++  L +  + G+ FTWW
Sbjct  80   SDMTVP--WLVGGDFNVIWDEEEKFGGLPVSLIEVDDFRHYINTCNLTDLGFKGSIFTWW  137

Query  63   NGRRGSQAVWERLDRVLVNE  4
            NGR     +++RLDR   N 
Sbjct  138  NGRSEEDCIFKRLDRCFGNH  157



>gb|AAG50806.1|AC079281_8 unknown protein [Arabidopsis thaliana]
Length=1213

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 104/208 (50%), Gaps = 11/208 (5%)
 Frame = -1

Query  594  FICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPF----KDLSHLGQFSVSLGF-ENRC  430
              CWN+R   +       +  V+  KP    ++E      KD   +        F EN  
Sbjct  5    LFCWNIRGFNNVSHRSGFKKWVKANKPIFGGVIETHVKQPKDRKFINALLPGWSFVENYA  64

Query  429  -SGTAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELW-D  262
             S   KIWV  D  +   +     Q+++  V LP   + +++SVVYA+ E   R+ELW +
Sbjct  65   FSDLGKIWVMWDPSVQVVVVAKSLQMITCEVLLPGSPSWIIVSVVYAANEVASRKELWIE  124

Query  261  LIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN-KAKSREFQNCIDSSRLRESVYY  85
            ++  + +  +GD  W ++GDFN +L  +E       N     R+F++C+ ++ L +  Y 
Sbjct  125  IVNMVVSGIIGDRPWLVLGDFNQVLNPQEHSNPVSLNVDINMRDFRDCLLAAELSDLRYK  184

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            GN FTWWN +  +  V +++DR+LVN++
Sbjct  185  GNTFTWWN-KSHTTPVAKKIDRILVNDS  211



>ref|XP_009769215.1| PREDICTED: uncharacterized protein LOC104220099 [Nicotiana sylvestris]
Length=179

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 88/181 (49%), Gaps = 5/181 (3%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  I WNVR V +  +  R+  + R+   + + + EP +    + ++   +G        
Sbjct  1    MDAIIWNVRSVNTMQAFERLITMHRKHHFEFIGIREPMQQSHKMERYRARIGLAQAVVNV  60

Query  420  A-KIWVF*DRCLS*PLGHGY-QIVSMRVT-LPVIGNLMLSVVYASCERRVRQELWDLIEA  250
            + KIW F D      + +   Q +++R+T       L+L++VYA C+R  R ELWD + A
Sbjct  61   SNKIWAFIDEIFEVTILYNMTQQLTLRLTHTETHVELILTLVYAKCDRIERIELWDSLYA  120

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            MA+       W + G+FN I   EEK GG P +  +   F++ I++  L      G+ FT
Sbjct  121  MASDMTVP--WLVGGNFNVIYDEEEKFGGLPVSLIEVDNFRHYINTCNLTNLGLKGSIFT  178

Query  69   W  67
            W
Sbjct  179  W  179



>ref|XP_004301904.1| PREDICTED: uncharacterized protein LOC101292910 [Fragaria vesca 
subsp. vesca]
Length=851

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 94/203 (46%), Gaps = 13/203 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHL-GQFSVSLGFE-----  439
            MK   WN+R +A+  + +  +  VR    +ILC+ EPF  L  +   F  +LG +     
Sbjct  1    MKIFYWNLRGIANDPTQNAFKEFVRSHSLEILCIAEPFVALESIPASFWRNLGMQFIGAN  60

Query  438  NRCSGTAKIWVF*DRCLS*P----LGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQE  271
            +R S    +WVF    L  P    L    Q VS++V      N  ++ VYA      R++
Sbjct  61   DRGSQQPNLWVFCKISLV-PWVRVLYSSDQQVSLQVMFDST-NCFVTAVYARTTVVGRRK  118

Query  270  LWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESV  91
            LW+ I  +  R V +G W + GDFN +L   EKKGG P   +   EFQ   D   L   V
Sbjct  119  LWEDITDVKGRFV-NGPWLVFGDFNAVLGMHEKKGGGPVCMSSCEEFQVMSDVCELVHVV  177

Query  90   YYGNDFTWWNGRRGSQAVWERLD  22
              G +FTW   R     V  RLD
Sbjct  178  TKGAEFTWVRRRGLRGNVELRLD  200



>ref|XP_009767006.1| PREDICTED: uncharacterized protein LOC104218260 [Nicotiana sylvestris]
Length=201

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 75/139 (54%), Gaps = 4/139 (3%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGY-QIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMA  244
            KIW F D      + +   Q +++R+    I   L+L++VYA C+   R ELWD + AMA
Sbjct  20   KIWAFIDENFEVTILYNMTQHLTLRLMHSEIHVELILTLVYAKCDCTERIELWDTLYAMA  79

Query  243  AREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWW  64
            +       W + GDFN I   EEK G  P +  +  +F++CI++  L    + G+ FTW 
Sbjct  80   SDMTV--HWLVGGDFNVIWDEEEKYGRLPVSLIEVDDFRHCINTCNLTGLGFKGSIFTWC  137

Query  63   NGRRGSQAVWERLDRVLVN  7
            NGR   + +++RLDR   N
Sbjct  138  NGRSEEECIFKRLDRCFGN  156



>ref|XP_009796364.1| PREDICTED: uncharacterized protein LOC104242949 [Nicotiana sylvestris]
Length=410

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
            L++VYA C+   R ELWD + A+ +    +  W + GDFN I   EEK GG P +  +  
Sbjct  65   LTMVYAKCDAIERTELWDSLYALGSD--MNLPWIVGGDFNVIWDKEEKFGGFPVHINEVD  122

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +F++CID+S L    + G+ +TWWNGR     +++RLDR L N
Sbjct  123  DFRHCIDTSNLFYLGFKGSIYTWWNGRAEENCIFKRLDRCLAN  165



>ref|XP_009759123.1| PREDICTED: uncharacterized protein LOC104211724 [Nicotiana sylvestris]
Length=262

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 77/142 (54%), Gaps = 10/142 (7%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDLIE  253
            KIW F D      + +    ++ ++TL ++       L+L++VYA C+R  R ELWD + 
Sbjct  20   KIWAFIDEIFEVTILYN---MTQQLTLRLMHTETHVELILTLVYAKCDRIERIELWDTLY  76

Query  252  AMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDF  73
            AMA+       W + GDFN I   E+K GG P +  +  +F++ I++  L +  + G+ F
Sbjct  77   AMASDMTVP--WLVGGDFNVIWDEEDKYGGLPVSLLEVDDFRHYINTCNLTDLGFKGSIF  134

Query  72   TWWNGRRGSQAVWERLDRVLVN  7
            TWWN R     +++RLDR   N
Sbjct  135  TWWNERSEEDCIFKRLDRCFGN  156



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 92/188 (49%), Gaps = 20/188 (11%)
 Frame = -1

Query  546   RVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENR-CSGTAKIWVF*------DRCL  388
             R++ L    + KIL +LEP  D+S    F   LGFE    + + KIW+F       D  L
Sbjct  905   RLKKLQLMHRIKILAILEPMVDISKAEFFRRKLGFEKVIVNSSQKIWLFHSLELHSDIIL  964

Query  387   S*PLGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAI  211
               P     Q + +R+T P +      + VYA C R  R  LWD +  +AA    +  W +
Sbjct  965   DHP-----QCLHVRLTSPWLEKPFFATFVYAKCTRSERTLLWDCLRRLAAD--NEEPWLV  1017

Query  210   MGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWE  31
              GDFN IL+ EE+  G   ++    +F + +    L +  + GN FTW N R     +++
Sbjct  1018  GGDFNIILKREERLYGSAPHEGSMEDFASVLLDCGLLDGGFEGNPFTWTNNR-----MFQ  1072

Query  30    RLDRVLVN  7
             RLDRV+ N
Sbjct  1073  RLDRVVYN  1080



>ref|XP_009789341.1| PREDICTED: uncharacterized protein LOC104236983 [Nicotiana sylvestris]
Length=304

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 98/211 (46%), Gaps = 10/211 (5%)
 Frame = -1

Query  612  SDC*MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPF----KDLSHLGQFS--VS  451
            +D  M FI WN R   S       R+L+   +P ++ LLE      +++     F   + 
Sbjct  30   ADNHMNFIIWNCRGALSTEFRRNFRSLLDYNRPALVVLLETHCQTHQNVKENFNFDGMIE  89

Query  450  LGFENRCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTL-PVIGNLMLSVVYASCERRVRQ  274
            +       G A +W+     +  P+    Q +   V + P+    + +++YAS E   RQ
Sbjct  90   VAATRHFGGIAILWLSSVLDVD-PVATTAQEIHYHVLVKPLPFTFLFTIIYASNELVNRQ  148

Query  273  ELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRES  94
             LW+    M+  +   G W I GDFN I    +K GG P N + S +F +C++  ++ + 
Sbjct  149  SLWE--NFMSVYDNYKGPWIIGGDFNEITHVTDKFGGLPINNSHSHKFLDCLNYCQMTDL  206

Query  93   VYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             Y G+ +TW NGR   QA  + L  + V +N
Sbjct  207  GYKGSRYTWTNGRHKKQAWMDNLALLPVIDN  237



>ref|XP_009770925.1| PREDICTED: uncharacterized protein LOC104221560 [Nicotiana sylvestris]
Length=333

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 4/140 (3%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGY-QIVSMRVT-LPVIGNLMLSVVYASCERRVRQELWDLIEAMA  244
            K W F D      + +   Q +++R+T       L+L++ YA C+R  R ELWD + AMA
Sbjct  20   KSWAFIDEIFEVTILYNMTQQLTLRLTNTETYVELILTLFYAKCDRIERIELWDSLYAMA  79

Query  243  AREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWW  64
            +       W + GDFN I   EEK G  P +  +  +F++ I++  L +  + G+ FTWW
Sbjct  80   SDMTVP--WLVGGDFNVIWDEEEKFGSLPVSLIEVDDFRHYINTCNLTDLGFKGSIFTWW  137

Query  63   NGRRGSQAVWERLDRVLVNE  4
            NGR     +++RLDR L N 
Sbjct  138  NGRSEEDCIFKRLDRCLGNH  157



>ref|XP_008805763.1| PREDICTED: uncharacterized protein LOC103718624 [Phoenix dactylifera]
Length=987

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 70/122 (57%), Gaps = 4/122 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q V M V+ P +   +L  VY S + RVR+ LW  I  +AA+ +      ++GDFNCIL 
Sbjct  88   QQVVMVVSRPDVAPWVLCGVYVSTDHRVRRVLWREITNLAAQGIPT---VVVGDFNCILS  144

Query  183  GEEKKGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              EK+GG  + ++   REF++ +  + L +  + G  FTW N +RGS  VWERLDR   +
Sbjct  145  ENEKRGGAVFTDRVDRREFRDFVSRNGLVDLGFSGPQFTWCNNQRGSARVWERLDRAFAS  204

Query  6    EN  1
             +
Sbjct  205  PD  206



>ref|XP_006367861.1| PREDICTED: uncharacterized protein LOC102578882, partial [Solanum 
tuberosum]
Length=606

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 2/107 (2%)
 Frame = -1

Query  327  GNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
            G + ++ VYA C    R ELW+ +E +A     D  W + GDFN I    EK GG P ++
Sbjct  495  GQVKITAVYARCSALERMELWEDLEEVACN--TDCPWMVGGDFNTIADESEKLGGLPVSQ  552

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             +  +F  CI S  L E  + G+ +TWWNGR     +++RLDRV  N
Sbjct  553  VEVEDFVQCISSCELNEIKFSGSCYTWWNGRIEQDCIFKRLDRVFGN  599



>ref|XP_009794682.1| PREDICTED: uncharacterized protein LOC104241434 [Nicotiana sylvestris]
Length=363

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 60/106 (57%), Gaps = 2/106 (2%)
 Frame = -1

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            ++M++ VYA C    R ELWD +  +      +  W +  DFN +L  +EK  G P +  
Sbjct  101  HMMMTFVYAKCSVMERLELWDHLYYLEKD--MEFSWLVGWDFNVVLHEDEKIWGLPVHPP  158

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +  +F  C++S  L E  Y G+ FTWW+GR   + +++RLDR+ VN
Sbjct  159  EYEDFAFCVNSCGLFEQGYKGSPFTWWDGRPNDKCIFKRLDRIFVN  204



>ref|XP_007026456.1| Uncharacterized protein TCM_021520 [Theobroma cacao]
 gb|EOY06958.1| Uncharacterized protein TCM_021520 [Theobroma cacao]
Length=754

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 98/200 (49%), Gaps = 12/200 (6%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAK  415
            + WNVR +A      R++ L    K K+L +LEP  + S +      LGF+N  S  + K
Sbjct  205  LLWNVRGIAGTAVQRRLKKLKLMHKVKLLVVLEPMVNTSRINYIKRRLGFDNALSNCSHK  264

Query  414  IWVF*DR--CLS*PLGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLIEAMA  244
            IW+F     C    L    Q + ++++ P + + +  S VYA C R  R+ELW  +  ++
Sbjct  265  IWLFCSNEICCEVVLDQ-IQCLHVKLSSPWLPHPVYTSFVYAKCTRLERRELWSNLRIIS  323

Query  243  AREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWW  64
              +     W + GDFN I+  +E+  G   +     +  + +    L ++ + GN FTW 
Sbjct  324  --DSMQAPWLVGGDFNSIVSCDERLHGAIPHDGSMEDLSSTLLDCGLLDAGFEGNSFTWT  381

Query  63   NGRRGSQAVWERLDRVLVNE  4
            N R     +++RLDRV+ N 
Sbjct  382  NNR-----MFQRLDRVVYNH  396



>ref|XP_008776777.1| PREDICTED: uncharacterized protein LOC103696833 [Phoenix dactylifera]
Length=476

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 100/211 (47%), Gaps = 16/211 (8%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSV---------SL  448
            M+ + WN R  A    +   R LV+ + P+I  L E    LS  G   V         S 
Sbjct  1    MRILAWNCRGAAKPAFMSSFRRLVQIYSPEICLLYE--TRLSGRGLSRVLRRLEVDWESY  58

Query  447  GFENRCSGTAKIWVF*DRCLS*PLGHG-YQIVSMRVTLPVIGNLMLSVVYASCERRVRQE  271
              ++R      + ++     +  + H   Q V M ++ P     +L  VYAS   R R+ 
Sbjct  59   AVDSRGLSGGIVALWKRGVATVDIFHNCSQQVIMIISEPNAAPWILCGVYASTNHRTRRV  118

Query  270  LWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCIDSSRLRES  94
            LWD +  +  + +     A++GDFNCIL   EK+GG+ + +    REF++ +  + L + 
Sbjct  119  LWDELTHLITQGLPS---AMVGDFNCILEECEKRGGRAFTDSVDRREFRDFLSRNGLVDL  175

Query  93   VYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             + G  FTW N + G   VWERLDRV+ + +
Sbjct  176  GFSGPRFTWCNNQSGRARVWERLDRVVASTD  206



>ref|XP_009629929.1| PREDICTED: uncharacterized protein LOC104119987 [Nicotiana tomentosiformis]
Length=741

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 62/106 (58%), Gaps = 2/106 (2%)
 Frame = -1

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            ++M++ VYA C    R ELWD +  MAA  V +  W + GDFN +L  ++K GG P    
Sbjct  26   HIMMTFVYAKCSSLERLELWDNMYYMAA--VMELPWLVGGDFNVVLHEDKKIGGLPVYPL  83

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +  +F   ++S  L + VY G+ FTWWNGR     +++RLD +L +
Sbjct  84   EYEDFAFYVNSCGLFDQVYKGSPFTWWNGRTNDACIFKRLDGILTS  129



>ref|XP_008779502.1| PREDICTED: uncharacterized protein LOC103699235 [Phoenix dactylifera]
Length=469

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q V M V+ P     +L  VYAS   RVR+ LW  I ++ A+ V      ++GDFNCIL 
Sbjct  88   QQVVMVVSAPDAPPWVLCGVYASTNYRVRRFLWQEIASLTAQGVPT---VVVGDFNCILS  144

Query  183  GEEKKGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              +K+GG  + ++   REF++ +  + L +  Y G  FTW N + GS  VWERLDR   +
Sbjct  145  SGDKRGGVAFTDRVDRREFRDFVSRTGLVDLGYSGPQFTWCNNQLGSARVWERLDRAFAS  204

Query  6    EN  1
             +
Sbjct  205  PD  206



>ref|XP_004233579.1| PREDICTED: uncharacterized protein LOC101260201 [Solanum lycopersicum]
Length=1531

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAK  142
             +++ VYA C+ ++R+ LW   E+M  R      W  +GDFN I   +EK GG+ YN  K
Sbjct  389  FIITFVYAKCKDQLRKPLW---ESMLKRSNTSYPWCTIGDFNVISSTQEKLGGREYNINK  445

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            S EF + I++S L +  Y G  +TW N ++    VW+RLDR +VN+
Sbjct  446  SLEFISVIEASGLVDIGYNGQHYTWCNHKKNGDRVWKRLDRGMVND  491



>ref|XP_009622845.1| PREDICTED: uncharacterized protein LOC104114174 [Nicotiana tomentosiformis]
Length=332

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 73/141 (52%), Gaps = 4/141 (3%)
 Frame = -1

Query  423  TAKIWVF*DRCLS*P-LGHGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEA  250
              K W+F D  +    L    Q V++RV    IG ++M++ VYA C    R ELWD    
Sbjct  9    NGKFWLFFDIMIEWEVLLDTKQQVTIRVYHQDIGKHIMMTFVYAKCSSLKRLELWDKFYY  68

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            + +    +  W + GDFN I+  +EK         +  +F  C+ S  L +  Y G  FT
Sbjct  69   LLSD--MELPWVVGGDFNIIMHEDEKISVLLMYPPEYEDFAFCVISCGLFDLGYKGIPFT  126

Query  69   WWNGRRGSQAVWERLDRVLVN  7
            WWNGR  S+++++RLDR+ VN
Sbjct  127  WWNGRPNSESIFKRLDRIFVN  147



>emb|CAA18234.1| putative protein [Arabidopsis thaliana]
 emb|CAB79491.1| putative protein [Arabidopsis thaliana]
Length=1141

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 80/147 (54%), Gaps = 5/147 (3%)
 Frame = -1

Query  429  SGTAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLI  256
            S   KIWV  D  +   +     Q+++  V  P     +++SVVYA+ E   R+ELW  I
Sbjct  58   SDLGKIWVLWDPSVEVVIVAKSLQMITCEVLFPNSRTWIVISVVYAANEDDKRKELWREI  117

Query  255  EAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYN-KAKSREFQNCIDSSRLRESVYYG  82
             A+ A  V   R W ++GDFN +L   E       N   + R+F+ C+  + L + VY G
Sbjct  118  TALVASPVTFNRPWILLGDFNQVLHPHEHSRHVSLNVDRRIRDFRECLLDAELSDLVYKG  177

Query  81   NDFTWWNGRRGSQAVWERLDRVLVNEN  1
            + FTWWN +  ++ V +++DR+LVNE+
Sbjct  178  SSFTWWN-KSKTRPVAKKIDRILVNES  203



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 95/210 (45%), Gaps = 18/210 (9%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            MK I WNVR   S+  L    +LV+  KP +L LLE         Q +  LG+ N     
Sbjct  1    MKAIIWNVRGANSKAFLWHALDLVKMHKPDLLILLETKCSSLRADQATKRLGYVNFRIIP  60

Query  435  RCSGTAKIWVF*DRCLS------*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQ  274
                   IW+     ++          H + +  +R  +P    ++L+ ++A      R 
Sbjct  61   AFGKRGGIWLMWKADIALVHYADYQPNHFHALFKLRSDIP---EVLLTGMHAPSVVSERN  117

Query  273  ELW-DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRE  97
            + W DL E    R      W + GD N +L G EK GG+   K + ++ ++ I ++ L +
Sbjct  118  KYWVDLTEDSPPRGTP---WLVAGDMNEVLHGNEKMGGRQVGKEQGKQCKDWIAANALLD  174

Query  96   SVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              + G  FTW NGR G   + ERLDR LVN
Sbjct  175  LGFQGPKFTWTNGRTGGSLIKERLDRALVN  204



>ref|XP_008375268.1| PREDICTED: uncharacterized protein LOC103438509 [Malus domestica]
Length=440

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 91/206 (44%), Gaps = 11/206 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP---FKDLSHLGQFSVSLG---FE  439
            MK + WN+R + +  S   + N+ R   P ++C+ EP   F  +S     S++L    F 
Sbjct  1    MKVLFWNIRGIGNDDSXTELSNICRLHHPDLVCIAEPMVTFNSISAAYWDSLNLSALTFN  60

Query  438  NRCSGTAKIWVF*DRCLS*PL--GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
            +R +    +W+      + PL      Q V++R T   I +   +  YAS     R++LW
Sbjct  61   SRGTLAPNLWLLTSSACADPLVISISDQQVTVRCTFDHIPS-QFTFXYASTSSIKRRDLW  119

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
                 ++ R      W  +GDFN IL   E+ GG   ++A   EF N  D+         
Sbjct  120  AXF--ISLRPQTQVPWMAIGDFNAILGAHEQMGGGRPSQASCAEFXNMSDTCNFTHLNTS  177

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVN  7
            G  FTW NG R       RLDR L +
Sbjct  178  GAAFTWSNGWRSRGRTERRLDRSLCD  203



>ref|XP_010549576.1| PREDICTED: uncharacterized protein LOC104820714 [Tarenaya hassleriana]
Length=379

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 99/214 (46%), Gaps = 17/214 (8%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP-FKDLSHLGQFSVSLG----FEN  436
            MK  CWN+R V        VR+++R  +PKI  L+E   +D S   + + S+     F +
Sbjct  1    MKLFCWNIRGVNGAAKQQAVRDIIRTHRPKIGSLIETRVRDQSTASRIARSIAPSWNFAH  60

Query  435  RCSGT--AKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQEL  268
              +     +IW+  D  L   +     Q V+  V  P +G+ L ++ VY       R+ L
Sbjct  61   NYTTAELGRIWILWDPALVVNIYSASAQAVTCGVFDPALGSYLTVTFVYGLNTSSERRHL  120

Query  267  WDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQ----PYNKAKSREFQNCIDSSRL  103
            W  I  +A+  +   + W +MGDFN +LR +E         P+      +FQNC+ S+ L
Sbjct  121  WQEISLIASHPLVPAKPWVLMGDFNQVLRPQEHASPTARFLPHQGMV--DFQNCLLSTGL  178

Query  102  RESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             +    G  FTW N       +  +LDR LVN+ 
Sbjct  179  FDLPSKGAYFTWTNCSM-ENPIARKLDRALVNDT  211



>ref|XP_010315025.1| PREDICTED: uncharacterized protein LOC104645339 [Solanum lycopersicum]
Length=847

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/103 (41%), Positives = 60/103 (58%), Gaps = 3/103 (3%)
 Frame = -1

Query  312  SVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSRE  133
            + VYA C+  +R+ LW   E+M         W  +GDFN I   +EK+GG+ YN  KS E
Sbjct  332  TYVYAKCKDFLRRPLW---ESMLKWSNTGLPWCTIGDFNVIADTQEKRGGKEYNINKSLE  388

Query  132  FQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            F + I++  L +  Y G D+TW N R+    VW+RLDR +VN+
Sbjct  389  FISIIEACGLMDMGYNGQDYTWCNHRKNGDRVWKRLDRGMVND  431



>dbj|BAB01845.1| non-LTR retroelement reverse transcriptase-like protein [Arabidopsis 
thaliana]
Length=893

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 105/211 (50%), Gaps = 18/211 (9%)
 Frame = -1

Query  597  KFICWNVREVASQGSLHRVRNLVRQF---KPKILCLLEPFKDLSHLGQFSVSL-----GF  442
            K  CWNVR      S HR R   + F   KP    L+E         +F  +L       
Sbjct  4    KLFCWNVR--GFNISSHR-RGFKKWFLLNKPLFGGLIETHVKQPKEKKFISNLLPGWSFV  60

Query  441  EN-RCSGTAKIWVF*DRCLS*P-LGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQE  271
            EN   S   KIWV  D  +    +G   Q+++  + LP   +  ++S+VYAS E   R+E
Sbjct  61   ENYEFSVLGKIWVLWDPSVKVVVIGRSLQMITCELLLPDSPSWFVVSIVYASNEEGTRKE  120

Query  270  LWDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRES  94
            LW+ +  +A   V  GR W ++GDFN IL  E         K   R F++C+  S L + 
Sbjct  121  LWNELVQLALSPVVVGRSWIVLGDFNQILNPESAINANIGRKI--RAFRSCLLDSDLYDL  178

Query  93   VYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            VY G+ +TWWN +  S+ + +++DR+LVN++
Sbjct  179  VYKGSSYTWWN-KCSSRPLAKKIDRILVNDH  208



>emb|CAA66812.1| non-ltr retrotransposon reverse transcriptase-like protein [Arabidopsis 
thaliana]
Length=893

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 105/211 (50%), Gaps = 18/211 (9%)
 Frame = -1

Query  597  KFICWNVREVASQGSLHRVRNLVRQF---KPKILCLLEPFKDLSHLGQFSVSL-----GF  442
            K  CWNVR      S HR R   + F   KP    L+E         +F  +L       
Sbjct  4    KLFCWNVR--GFNISSHR-RGFKKWFLLNKPLFGGLIETHVKQPKEKKFISNLLPGWSFV  60

Query  441  EN-RCSGTAKIWVF*DRCLS*P-LGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQE  271
            EN   S   KIWV  D  +    +G   Q+++  + LP   +  ++S+VYAS E   R+E
Sbjct  61   ENYEFSVLGKIWVLWDPSVKVVVIGRSLQMITCELLLPDSPSWFVVSIVYASNEEGTRKE  120

Query  270  LWDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRES  94
            LW+ +  +A   V  GR W ++GDFN IL  E         K   R F++C+  S L + 
Sbjct  121  LWNELVQLALSPVVVGRSWIVLGDFNQILNPESAINANIGRKI--RAFRSCLLDSDLYDL  178

Query  93   VYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            VY G+ +TWWN +  S+ + +++DR+LVN++
Sbjct  179  VYKGSSYTWWN-KCSSRPLAKKIDRILVNDH  208



>ref|XP_009796308.1| PREDICTED: uncharacterized protein LOC104242893 [Nicotiana sylvestris]
Length=462

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 16/145 (11%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGYQIV---SMRVTLPVIG-----NLMLSVVYASCERRVRQELWD  262
            KIWVF D        HG  IV     ++TL +       + M++ VYA C+   R ELWD
Sbjct  11   KIWVFVDD------DHGVDIVYDLEQQLTLKLTNMDTQLSFMVTFVYAKCDSIERIELWD  64

Query  261  LIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYG  82
             +  +A+       W + GDFN I   EEK GG P +  +  +F++CI +  L +  + G
Sbjct  65   SLYNLASD--MSLPWLVGGDFNVIWDEEEKFGGLPVSLNEINDFRHCISTCNLGDPAFKG  122

Query  81   NDFTWWNGRRGSQAVWERLDRVLVN  7
            + + WWN R     +++RLDR L N
Sbjct  123  SIYMWWNRRGEDDCIFKRLDRCLGN  147



>ref|XP_009586734.1| PREDICTED: uncharacterized protein LOC104084550 [Nicotiana tomentosiformis]
Length=141

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = -1

Query  333  VIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY  154
            +I  LML V   + +RR   +LW+ +++++ R+V  G W+I+GDFN I+  EE  GG P+
Sbjct  2    IIQYLMLIVRSKANKRR---KLWNKLKSVS-RQV-QGPWSIVGDFNSIMTTEEPSGGIPH  56

Query  153  NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
              +KS +F  C++   + ++ + G+ FTW N RR S+    RLDR L+NE
Sbjct  57   CLSKSTDFITCMEDCGMSDAGFIGSSFTWCNSRRVSK----RLDRALINE  102



>ref|XP_010507487.1| PREDICTED: uncharacterized protein LOC104784120 [Camelina sativa]
Length=597

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 87/158 (55%), Gaps = 9/158 (6%)
 Frame = -1

Query  462  FSVSLGFENRCSGTAKIWVF*DRCLS*P-LGHGYQIVSMRVTLPVIGN-LMLSVVYASCE  289
            F  + GF    S   KIW+  D  +    L    Q+V+  V LP   + +++S++YAS +
Sbjct  384  FDENYGF----SDLGKIWIMWDPSVQVVVLSKSLQMVTSEVLLPEAKDKIIVSIIYASND  439

Query  288  RRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN-KAKSREFQNCID  115
               R+ELW +L+    ++ + +  W ++GDFN  L  +E       N   K+R+F++C+ 
Sbjct  440  EGQRKELWAELVSITNSQLMLNKPWIVLGDFNQTLNPDEHSSPATLNVDPKTRDFRDCLL  499

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             + L +  + G+ FTWWN +  ++ + ++LDRVLVN +
Sbjct  500  EADLSDMTFKGSTFTWWN-KSKTRLIAKKLDRVLVNSH  536



>ref|XP_008776564.1| PREDICTED: uncharacterized protein LOC103696659 [Phoenix dactylifera]
Length=757

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 98/218 (45%), Gaps = 30/218 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQF---------SVSL  448
            M+ + WN RE A    +   R LV+    KI  L E       L +          S ++
Sbjct  1    MRILAWNCREAAKPAFMSSFRRLVQIHSSKICLLYETRLSGRGLSRILRRLEVDWESYAV  60

Query  447  GFENRCSGTAKIW--------VF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASC  292
              +    G   +W        VF          +  Q V M ++ P     +L  VYAS 
Sbjct  61   DSQGLSGGIVALWKRGVATVDVF---------HNCSQQVIMIISEPNAAPWVLCGVYASI  111

Query  291  ERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCID  115
              R ++ LWD +  + A+ +     A++GDFNCIL   EK+GG+ + +    REF++ + 
Sbjct  112  NHRTKRILWDELTHLIAQGLPS---AMVGDFNCILEECEKRGGRAFTDSVDRREFRDFLS  168

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             + L +  + G  FTW N + G   VWERLDRV+ + +
Sbjct  169  RNGLVDLGFSGPRFTWCNNQSGRARVWERLDRVVASTD  206



>ref|XP_009597123.1| PREDICTED: uncharacterized protein LOC104093116 [Nicotiana tomentosiformis]
Length=167

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 83/161 (52%), Gaps = 5/161 (3%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFENRCSGT-AKIWVF*DRCLS*PL-GHGYQIVSMRVT-  340
             + L EPF     +  +   LG++N  S   +KIW F +  L+  +     Q ++  +  
Sbjct  6    FVALQEPFLSGDQIDGYRNKLGYDNALSNAHSKIWCFWNSNLTCTVKSKSRQQIAFHIHH  65

Query  339  LPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQ  160
                 N   +VVYA      R+ LW+ + +++ R++    W+I GDFN I+  EE  GG 
Sbjct  66   TNSDNNFWFTVVYARSRAIKRRRLWNKLRSLS-RQI-HAPWSIAGDFNSIMTTEENSGGN  123

Query  159  PYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAV  37
            P+  +KS +F +C++   + +  + G+ FTW NGRR ++ +
Sbjct  124  PHCLSKSTDFISCMEECGMTDPGFTGSPFTWCNGRRRAEEL  164



>ref|XP_009767124.1| PREDICTED: uncharacterized protein LOC104218349 [Nicotiana sylvestris]
Length=485

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAK  142
             +L++VYA C+   R ELWD + A+A+       W + GDFN I   EEK GG      +
Sbjct  23   FILTLVYAKCDYIERIELWDTLYALASDMTTP--WIVGGDFNVIWDEEEKFGGLLVPINE  80

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              +F++CI+S  L +  + G+ FTWWNGR     +++RLD VL N
Sbjct  81   VDDFRHCINSRNLIDLGFKGSIFTWWNGRAEEDCIFKRLDHVLDN  125



>ref|XP_008374980.1| PREDICTED: uncharacterized protein LOC103438233 [Malus domestica]
Length=553

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 92/207 (44%), Gaps = 13/207 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP---FKDLSHLGQFSVSLG---FE  439
            MK + WN+R + +  S   + N+ R   P ++C+ EP   F  +S     S++L    F 
Sbjct  1    MKVLFWNIRGIGNDDSRTELSNICRLHHPDLVCIAEPMVTFNSISAAYWDSLNLSXLTFN  60

Query  438  NRCSGTAKIWVF*DRCLS*PL--GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
            +R +    +W+      + PL      Q V++R T   I +   + VYAS     R++LW
Sbjct  61   SRGTLAPNLWLLTSSACADPLVISISDQQVTVRCTFDHIPS-QFTFVYASTSPIKRRDLW  119

Query  264  -DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVY  88
             D I      +V    W  +GDFN IL   E+ GG   ++    +F N  D+        
Sbjct  120  ADFISLRPQTQVP---WMAIGDFNAILGAHEQMGGGRPSQGSCAQFSNMSDTCNFTHLNT  176

Query  87   YGNDFTWWNGRRGSQAVWERLDRVLVN  7
             G  FTW NG R       RLDR L +
Sbjct  177  SGAAFTWSNGWRSRGRTERRLDRSLCD  203



>ref|XP_009618786.1| PREDICTED: uncharacterized protein LOC104110923 [Nicotiana tomentosiformis]
Length=874

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/101 (39%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = -1

Query  306  VYASCERRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREF  130
            +YA C   +R+ELW +L+    + +   G WAI+GDFN I   EE   G PY   KS +F
Sbjct  1    MYAKCRSNLRKELWANLVNFSVSHK---GPWAIIGDFNVISDHEENNRGNPYRIDKSFDF  57

Query  129  QNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              C+    L+++ + GN  TW+N R     +W+RLDR++ N
Sbjct  58   LECLTECGLQDAGFLGNIVTWYNNRVTPDTIWKRLDRMVYN  98



>ref|XP_008778839.1| PREDICTED: uncharacterized protein LOC103698583, partial [Phoenix 
dactylifera]
Length=639

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 66/118 (56%), Gaps = 4/118 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q V M V+ P     +L  VYAS + RVR+ LW  I  + A+ +      ++GDFNCI  
Sbjct  88   QQVVMVVSEPDAAPWVLCGVYASIDHRVRRVLWQEITNLIAQGIPT---VMVGDFNCIQE  144

Query  183  GEEKKGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
              EK+GG  + +K   REF++    + L +  + G  FTW N ++GS  VWERLDR L
Sbjct  145  ASEKRGGAAFTDKVDRREFRDFASQNGLVDLGFSGPRFTWCNNQQGSARVWERLDRAL  202



>ref|XP_009599389.1| PREDICTED: uncharacterized protein LOC104095045 [Nicotiana tomentosiformis]
Length=224

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -1

Query  219  WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            W + GDFN ++  +EK GG P +  +  +F  C++SS L +  Y GN FTWWNGR  ++ 
Sbjct  3    WLVGGDFNVVMHEDEKIGGLPVHPPEYEDFAFCVNSSGLFDLGYKGNPFTWWNGRPNAEC  62

Query  39   VWERLDRVLVN  7
            +++RLDR+ VN
Sbjct  63   MFKRLDRIFVN  73



>ref|XP_008779976.1| PREDICTED: uncharacterized protein LOC103699749, partial [Phoenix 
dactylifera]
Length=601

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 96/218 (44%), Gaps = 30/218 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKI--LCLLEPFKDLSHLGQFSVSLGFENRC-  430
            M+ + WN R  A    +   + LV+   P+I  LC      D     +  +   +E    
Sbjct  1    MRILAWNCRGAAKPAFMSSFKRLVQLHCPEICFLCKTRLSGDGLGRLRRRLGRDWETYAV  60

Query  429  --------------SGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASC  292
                           G A+I VF          +  Q V M V+ P     +L  VYAS 
Sbjct  61   ESQGLSGGLLILWRRGVARIDVF---------HNCSQQVVMVVSEPEADPWVLCGVYAST  111

Query  291  ERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCID  115
            + RVR+ LW  I  + A+ +       +GDFNCI   +EK+GG P+ ++   REF++ + 
Sbjct  112  DYRVRRTLWQEITNLLAQGIPT---VAVGDFNCIQSADEKRGGAPFTDRIDRREFRDFVQ  168

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             + L +  + G  FTW N + G   VWERLDR   + +
Sbjct  169  LNGLVDLGFSGPRFTWCNNQPGGARVWERLDRAFASPD  206



>ref|XP_009590368.1| PREDICTED: uncharacterized protein LOC104087564 [Nicotiana tomentosiformis]
Length=781

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = -1

Query  366  YQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCI  190
            +Q V++ +  P IG ++M S VYA C    R ELWD +  +A+    +  W + GDFN +
Sbjct  4    HQQVTINLFHPDIGQHIMYSFVYAKCSSLERLELWDNLYFLASDM--ELPWMVGGDFNVL  61

Query  189  LRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLV  10
            L  +EK GG   +  +  +F  C++S  L +  +    FTWWNG   +Q +++RLDR+ V
Sbjct  62   LHEDEKIGGLTVHPPEYDDFTLCVNSYGLFDLGFKVIPFTWWNGSPNTQCIFKRLDRIFV  121

Query  9    N  7
            N
Sbjct  122  N  122



>ref|XP_007010205.1| Uncharacterized protein TCM_043617 [Theobroma cacao]
 gb|EOY19015.1| Uncharacterized protein TCM_043617 [Theobroma cacao]
Length=554

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 84/172 (49%), Gaps = 10/172 (6%)
 Frame = -1

Query  513  KILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DR-CLS*PLGHGYQIVSMRVT  340
            K+L +LEP      +  F   LGFE   S  + KIW+F         L    Q + +++ 
Sbjct  218  KVLAILEPMAKEDRMEFFRRRLGFERVVSNCSQKIWLFHSHEVYCEVLVDHVQCLHVKIN  277

Query  339  LPVIGNLM-LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGG  163
            LP   NL+ ++++YA C R  R++LW  + ++++    +G W   GDFN I    E+  G
Sbjct  278  LPWFSNLLFVTIIYAKCTRLERKDLWTYLRSLSSDM--EGPWLAGGDFNSIFSRYERLYG  335

Query  162  QPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
               +     +F N +    L ++ + GN FTW N       + +RLDRVL N
Sbjct  336  ATLHHVSIEDFANTLLDCGLLDAGFEGNSFTWTNDH-----MLQRLDRVLYN  382



>ref|XP_011101880.1| PREDICTED: uncharacterized protein LOC105179919 [Sesamum indicum]
Length=216

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 101/207 (49%), Gaps = 20/207 (10%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVR-QFKPKILCLLEPFKDLSHLGQFSVS-LGFENRCS  427
            MK +  NVR + +  +  RV N VR Q     L ++EP   L   G+F V  LGF    S
Sbjct  1    MKGLFLNVRGIGNDPT-QRVLNRVRKQHHLDFLAIMEPMISLE--GRFMVRRLGFHEVIS  57

Query  426  GTA-KIWVF*D---RCLS*PLGHGYQIVSMRV-TLPVIGNLMLSVVYASCERRVRQELWD  262
                +IW F     RC    L    Q + +R+ +        ++VVY  C+   R++LWD
Sbjct  58   NCVNQIWFFWGPEVRCQV--LLDHEQFLHLRLESNKWPKPFFVTVVYTKCDVVERRDLWD  115

Query  261  LIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYG  82
             +  ++   +G  RW + GDFN +L  EE+ GG   N     +F   I    L ++ Y G
Sbjct  116  GLRLIS---IGSSRWIVGGDFNTVLCPEERSGGAAPNGIAMSDFHETIADCALIDAGYTG  172

Query  81   NDFTWWNGRRGSQAVWERLDRVLVNEN  1
            + +TW+     S+ + +RLDRVLV ++
Sbjct  173  SPYTWY-----SRQLRQRLDRVLVTDS  194



>ref|XP_009759375.1| PREDICTED: uncharacterized protein LOC104211932 [Nicotiana sylvestris]
Length=396

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 4/139 (3%)
 Frame = -1

Query  420  AKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLIEAM  247
             KIW+F D  +   L     Q +++RV    +G  +M++ VYA C    R ELWD +  +
Sbjct  10   GKIWLFFDSVVEWDLLIDTEQQMTIRVYHQDLGKYIMMTFVYAKCCALERLELWDNLYYL  69

Query  246  AAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTW  67
            A+    +  W I  DFN +L  EEK GG P   ++   F  C++S  L +  Y G+ FTW
Sbjct  70   ASD--MELPWLIGSDFNVVLGEEEKIGGLPVYPSEYEYFAFCVNSCGLFDLGYKGSPFTW  127

Query  66   WNGRRGSQAVWERLDRVLV  10
            WNGR   + +++RL   L+
Sbjct  128  WNGRPNEECIFKRLVEHLI  146



>ref|XP_008779917.1| PREDICTED: uncharacterized protein LOC103699694, partial [Phoenix 
dactylifera]
Length=400

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 96/204 (47%), Gaps = 14/204 (7%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQ----FSVSLGF---  442
            MK + WN R           R  V Q +P+I  L E       L +       S GF   
Sbjct  1    MKVLLWNCRGAGKPSFAPAFRRFVLQNRPEICILFETRLSGRSLQKARRVLPRSWGFYAV  60

Query  441  ENR--CSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQEL  268
            E+R    G    W   + C   P     Q V + ++       +L+ VYAS + R R+ L
Sbjct  61   ESRGLSGGIIVTWRL-ESCRLDPFHVCGQEVILVISEGTDDPWVLAAVYASTDFRERRRL  119

Query  267  WDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCIDSSRLRESV  91
            W+    + A+      + + GDFNCI+  +EK GG+P+ ++ K +EF++ + ++ L +  
Sbjct  120  WEEASQLVAQGFP---FLMAGDFNCIVDPQEKMGGKPFSHERKVKEFEDFLTTNGLIDLG  176

Query  90   YYGNDFTWWNGRRGSQAVWERLDR  19
            + G  FTW N ++G   VWERLDR
Sbjct  177  FTGPRFTWCNNQQGPARVWERLDR  200



>ref|XP_006358721.1| PREDICTED: uncharacterized protein LOC102596481 [Solanum tuberosum]
Length=1135

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
            ++ +YA C    R ELW+ +E +A        W + GDFN I    EK GG P  + ++ 
Sbjct  47   VTAIYARCSALERFELWESLEDIAGSM--QKPWLVGGDFNTIRNDSEKLGGLPVTQMETI  104

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            +F  CI S  L E  + G+ +TWWNGR  ++ ++ERLD V  NE
Sbjct  105  DFNQCISSCALNEFSFKGSSYTWWNGRVETECIFERLDMVFGNE  148



>ref|XP_009772930.1| PREDICTED: uncharacterized protein LOC104223235 [Nicotiana sylvestris]
Length=272

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -1

Query  234  VGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGR  55
            V D  W + GDFN I+   EK GG+P+   ++ EFQ CI++  L +  Y G+++TW N R
Sbjct  2    VVDVPWCVRGDFNIIMDPNEKLGGKPHRMYRTLEFQTCINNCGLIDIGYNGSNYTWCNNR  61

Query  54   RGSQAVWERLDRVLVNEN  1
            R  + +W+RLDR+ VN++
Sbjct  62   RHGKRIWKRLDRIFVNDH  79



>ref|XP_010551659.1| PREDICTED: uncharacterized protein LOC104822217 [Tarenaya hassleriana]
Length=549

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 99/214 (46%), Gaps = 17/214 (8%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP-FKDLSHLGQFSVSLG----FEN  436
            MK  CWN+R V        VR+++R  +PKI  L+E   +D S   + + S+     F +
Sbjct  1    MKLFCWNIRGVNGAAKQQAVRDIIRTHRPKIGSLIETRVRDQSTASRIARSIAPSWNFAH  60

Query  435  RCSGT--AKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQEL  268
              +     +IW+  D  L   +     + V+  V  P +G+ L ++ VY       R+ L
Sbjct  61   NYTTAELGRIWILWDPALVVNIYSASAEAVTCGVFDPALGSYLTVTFVYGLNTSSERRHL  120

Query  267  WDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQ----PYNKAKSREFQNCIDSSRL  103
            W  I  +A+  +   + W +MGDFN +LR +E         P+      +FQNC+ S+ L
Sbjct  121  WQEISLIASHPLVPAKPWVLMGDFNQVLRPQEHASPTARFLPHQGMV--DFQNCLLSTGL  178

Query  102  RESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             +    G  FTW N       +  +LDR LVN+ 
Sbjct  179  FDLPSKGAYFTWTNCSM-ENPIARKLDRALVNDT  211



>ref|XP_009793107.1| PREDICTED: uncharacterized protein LOC104240027 [Nicotiana sylvestris]
Length=709

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 2/107 (2%)
 Frame = -1

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            N  ++ VYA      R++LW  I ++      +G W I+ DFN I    EKKGG PY   
Sbjct  161  NFWITRVYAKSTIEKRRKLWRKIRSV--HHYINGPWTILRDFNVITNAAEKKGGTPYTLN  218

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            +SR+F +C++   + +  + G  FTW NG+     + ERLDRV++NE
Sbjct  219  ESRDFLSCMEDCGMCDLGFNGYPFTWCNGKGRRNRISERLDRVMINE  265



>ref|XP_010412393.1| PREDICTED: uncharacterized protein LOC104698678 [Camelina sativa]
Length=323

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 94/204 (46%), Gaps = 10/204 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-  424
            M+   WN R + +  ++ R++ + + F P I+CL+E  +    +      LG+++  +  
Sbjct  1    MRTAAWNCRGLGNDLAVRRLKEIKKTFSPDIICLMETKQGNDVVRSVGAELGYDHVFTVP  60

Query  423  ----TAKIWVF*DRCLS*P-LGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDL  259
                +  + +F +  LS   L H   +V   V +   G   LS VY +    +R  + + 
Sbjct  61   PIGLSGGVALFWNSSLSVSVLYHSLNLVDTYVKINGFG-FYLSCVYGNPNPSLRHLVRER  119

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            +E       G   W  +GDFN I    EKKGG P +++   +F+N +      E  + GN
Sbjct  120  LERTTLNRTGP--WMAIGDFNEIKSNSEKKGGPPRHESSFADFRNMLQVCDFHEPKFKGN  177

Query  78   DFTWWNGRRGSQAVWERLDRVLVN  7
             F+ W G+R S  +   LD+ L N
Sbjct  178  PFS-WTGKRYSHDIACCLDKTLAN  200



>ref|XP_009607655.1| PREDICTED: uncharacterized protein LOC104101836 [Nicotiana tomentosiformis]
Length=322

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 84/189 (44%), Gaps = 41/189 (22%)
 Frame = -1

Query  570  VASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT-AKIWVF*DR  394
            V +Q +  RV N+ R+    I+ L+EPF++  H+ ++ + LG +   S    KIW+  D 
Sbjct  3    VNTQQAFQRVINMQREHGFFIVALMEPFQNCRHIQRYRIRLGMDAVMSNINGKIWLLFD-  61

Query  393  CLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWA  214
                                V+     S+ Y + +  +                    W 
Sbjct  62   --------------------VVIEWEDSLYYLASDMELP-------------------WI  82

Query  213  IMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVW  34
            + GDFN ++   EK GG P    +  +F  C++S RL +  Y G  FTWWNG+  S+ ++
Sbjct  83   VGGDFNFVMSEAEKLGGLPVYLPEYEDFVFCVNSCRLFDLGYKGIPFTWWNGKPNSECIF  142

Query  33   ERLDRVLVN  7
            + LDR+ ++
Sbjct  143  KSLDRIFID  151



>ref|XP_008780361.1| PREDICTED: uncharacterized protein LOC103700181, partial [Phoenix 
dactylifera]
Length=124

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = -1

Query  351  MRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEK  172
            M V+ P     +L  VYAS    VR+ LW  I  +AA+ +      ++GDFNCI    EK
Sbjct  1    MIVSKPDAAPWVLCDVYASKNHSVRRVLWQEITNLAAQGIPT---VVVGDFNCIQSESEK  57

Query  171  KGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            +GG  + ++   R+F++ +  + L +  + G  FTW N + GS  VWERLDR   + +
Sbjct  58   RGGAAFTDRVDRRKFRDFVSRNDLVDLGFSGPQFTWCNNQLGSARVWERLDRTFASPD  115



>ref|XP_006577509.1| PREDICTED: uncharacterized protein LOC102660778 [Glycine max]
Length=550

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 98/210 (47%), Gaps = 22/210 (10%)
 Frame = -1

Query  594  FICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENR------  433
             + WNVR +   G L  + + + + +P+I  L++     +   +    L           
Sbjct  2    IVSWNVRGLNKAGKLREISSRLLELQPEIAILIKTRVKENKAAKVREKLRLNGNYLDNYT  61

Query  432  CSGTAKIWVF*D------RCLS*PLGHGYQIVSMRVTLPVIGNLM--LSVVYASCERRVR  277
            C    ++W+  D      +C+S       Q++   V   V GN    L+ +YAS     R
Sbjct  62   CHANGRLWIHWDLNRVDVKCVS----RTSQLIHCGV-YDVTGNFKFWLTAIYASNALDRR  116

Query  276  QELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRE  97
            + LW  IE +   E   G W ++GD+N + + +++ GG+   +A+  + QN +D + L E
Sbjct  117  KILWKDIEKI--HETHQGAWCVVGDYNNVAKAQDRIGGKMVTEAEFVDLQNMMDVTGLSE  174

Query  96   SVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
                G+ FTW N +R +  ++ R+DRVL N
Sbjct  175  MDSIGDFFTWSN-KRSADPIYSRIDRVLAN  203



>ref|XP_008791119.1| PREDICTED: uncharacterized protein LOC103708118 [Phoenix dactylifera]
Length=1071

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 100/210 (48%), Gaps = 22/210 (10%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPF---KDLSHL----GQFSVSLGF  442
            M+ + WN R  A    +   + LV+   P+I  + E     + L HL    G+   S  F
Sbjct  1    MRVLAWNYRGAAKPSFMSSFKRLVQVHCPEICFISETRLSGEGLVHLRRRLGRDWESYTF  60

Query  441  ENR--CSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQEL  268
            ++R    G   +W           G     V M V+ P +   +L  VY S + RVR+ L
Sbjct  61   DSRGLSGGILLLWR---------RGVATFDVVMVVSAPDVAPWVLCGVYTSTDYRVRRVL  111

Query  267  WDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCIDSSRLRESV  91
            W  I ++ A+ V      ++GDFNCIL   +K+GG  + ++A  REF++ +  + L +  
Sbjct  112  WQEITSLTAQGVPT---VVVGDFNCILSLGDKRGGAAFMDRADRREFRDFVSRTGLVDLG  168

Query  90   YYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            + G  FTW N + G+  V ERLDR   + +
Sbjct  169  FSGPQFTWCNNQLGNARVSERLDRAFASPD  198



>ref|XP_009603118.1| PREDICTED: uncharacterized protein LOC104098156 [Nicotiana tomentosiformis]
Length=731

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 4/104 (4%)
 Frame = -1

Query  315  LSVVYASCERRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS  139
             S VYA C   +R+ELW +L+    + +   G WAI+GDFN I   E+  GG PY   KS
Sbjct  116  FSTVYAKCRSNLRKELWANLVNFSVSLK---GPWAIIGDFNVISDPEKIIGGNPYRIDKS  172

Query  138  REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             +F  C+    L+++ + GN  TW   R     VW+RLDR++ N
Sbjct  173  FDFLECLTEWGLQDAGFLGNIVTWCKNRGALDTVWKRLDRIVYN  216



>ref|XP_010644016.1| PREDICTED: uncharacterized protein LOC104877459 [Vitis vinifera]
Length=793

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 12/208 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            M  + WN R +    ++  + NLVR+ KP+++ L+E F   + + + +  L +E      
Sbjct  1    MSCLSWNCRGLGGLETVRLLTNLVREKKPEVIFLIETFCTSARISEIANKLNYEGSYGVN  60

Query  435  ---RCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
                 +G   IW   D+     LG   + +   VTL       L+  Y    R  R   W
Sbjct  61   CRGHSAGLGLIWRCKDKVTI--LGSHDRYIDAIVTLENQRMFRLTGFYGLANRSQRSSSW  118

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
            +++  + A       W ++GDFN ++   EK G  P+  +    F+  + +  L +  Y 
Sbjct  119  EILRNLHAAH--SLPWCVIGDFNELMHQSEKCGNHPHPGSLIEAFRQVVTNCGLSDLGYV  176

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            G  +TW  GR  ++ V ERLDR LV+ +
Sbjct  177  GYAYTWERGRGTTRWVEERLDRALVSAD  204



>ref|XP_011013113.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105117228 
[Populus euphratica]
Length=2627

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 63/213 (30%), Positives = 98/213 (46%), Gaps = 30/213 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            MK  CWNVR + S    H V +L+++ K  + CL+E  K  S    F   L  +N     
Sbjct  1    MKIYCWNVRGLNSPLKQHEVASLMKKNKLDVCCLVET-KLSSSAVSFKHRLRLKNWRFLS  59

Query  435  --RCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVT-LPVIGNLML-------SVVYASCER  286
                S TA+I V  +     P     ++V +    L V  N ++       + VY     
Sbjct  60   NVAASNTARILVLWN-----PSTVLVELVDLSSQGLHVTINSLVHHYSFTSTFVYGYNTI  114

Query  285  RVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSR  106
              R+ LW  ++    R      W IMGDFN +L  E+K  G+P +  +  +F++C     
Sbjct  115  IARRALWQDLQ----RWNSTSPWIIMGDFNSLLSQEDKHNGEPVSSYEVADFRSCCSMLG  170

Query  105  LRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            L +  + G+ FTW NG+     +W ++DRVL+N
Sbjct  171  LSDLNFTGSHFTWTNGK-----IWSKIDRVLIN  198


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 52/103 (50%), Gaps = 9/103 (9%)
 Frame = -1

Query  315   LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
             ++ VY       R+ LW+ +     R      W +MGDFN +L   +K  G+P +  ++ 
Sbjct  1617  VTFVYGFHSVSARKPLWEDLR----RWNSSCSWMVMGDFNSMLSPSDKHNGEPVSSYETS  1672

Query  135   EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             +F+ C     L++  Y G  ++W NG      VW +LDRV++N
Sbjct  1673  DFRECCHDLGLQDVNYSGCHYSWTNG-----TVWSKLDRVMIN  1710



>ref|XP_008779726.1| PREDICTED: uncharacterized protein LOC103699482, partial [Phoenix 
dactylifera]
Length=230

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 93/210 (44%), Gaps = 24/210 (11%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLG--------  445
            M+ + WN R           R LV+Q KP+I  L E       L +   ++         
Sbjct  1    MRALLWNCRGAGKPSFAPAFRRLVQQHKPEICVLFETRLSGQSLQKARAAIPRSWDFYAV  60

Query  444  -FENRCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVI----GNLMLSVVYASCERRV  280
              +    G    W   D  +       + +    V L +        +L+ VYAS + RV
Sbjct  61   ESQGLSGGIIVTWAQGDYQID-----VFNVCKQEVILVISEDNRSPWVLAAVYASTDYRV  115

Query  279  RQELWDLIEAMAAREVGDG-RWAIMGDFNCILRGEEKKGGQPYN-KAKSREFQNCIDSSR  106
            R+ LW    A A++ +  G    + GDFNCI   +EK GG+ +  K + REFQ+ I S+ 
Sbjct  116  RRRLW----AEASQLITQGYPMLVAGDFNCITDPQEKMGGRAFTYKREIREFQDFIASNG  171

Query  105  LRESVYYGNDFTWWNGRRGSQAVWERLDRV  16
            L +  + G  FTW N ++    VWERLDRV
Sbjct  172  LIDLGFSGPTFTWCNNQQEQARVWERLDRV  201



>ref|XP_010507041.1| PREDICTED: uncharacterized protein LOC104783602 [Camelina sativa]
Length=235

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 63/122 (52%), Gaps = 3/122 (2%)
 Frame = -1

Query  360  IVSMRVTLPVIGNLMLSVVYASCERRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCIL-  187
            I  + V L     L++S VYA  E  VR+ LW +L+       V    W+++GDFN  L 
Sbjct  18   ITCLAVLLDDQSELVVSFVYALNEESVRRHLWAELLSVATDPRVSGKPWSVLGDFNQTLD  77

Query  186  RGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              +      P     +R F +C+  + L +  Y G  FTWWN +R +  + ++LDR+LVN
Sbjct  78   HSDSSISPNPNTDLPTRLFWDCLLHAELADLTYRGCSFTWWN-KRSTNPIAKKLDRILVN  136

Query  6    EN  1
            E+
Sbjct  137  ED  138



>ref|XP_008779909.1| PREDICTED: uncharacterized protein LOC103699684, partial [Phoenix 
dactylifera]
Length=590

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 4/122 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q V M +T P     +L  VYAS + R R+ LWD I  +  +        ++GDFNCIL 
Sbjct  203  QQVIMIITEPDAAPWVLCGVYASTDYRNRRVLWDEITNLVVQGFPT---MVIGDFNCILS  259

Query  183  GEEKKGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              EK+GG+P+ +    REF++ +  + L +  + G  FTW N +     VWER+DR + +
Sbjct  260  ASEKRGGRPFTDTVDRREFRDFVSQNGLVDLGFSGPRFTWCNNQSSMTRVWERIDRAMAS  319

Query  6    EN  1
             +
Sbjct  320  PD  321



>ref|XP_008231741.1| PREDICTED: uncharacterized protein LOC103330914 [Prunus mume]
Length=836

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 92/201 (46%), Gaps = 12/201 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFE-----N  436
            M  + WNVR V        +R+L + +   +  +LE     S     + SLGF      +
Sbjct  1    MIIVSWNVRGVGKVECASTIRDLKKAYGIDVFAVLELRIGGSRALSVAKSLGFSHYHIVD  60

Query  435  RCSGTAKIWVF*DRCLS*--PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWD  262
                +  +W+  D        + H  Q ++  VT+      +L+VVYAS    VR  LW 
Sbjct  61   PIGFSGGVWLLWDGNFVSLHVVAHSSQTITALVTMDA-KRWLLTVVYASPCSNVRTSLWK  119

Query  261  LIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYG  82
              + +AA  V +  W ++GDFN I+ G+EK GG        + F   +D + L +  + G
Sbjct  120  YFDGLAA--VCNLPWLLLGDFNDIVCGDEKLGGN--FDVGGQHFIEWLDRNHLIDLGFSG  175

Query  81   NDFTWWNGRRGSQAVWERLDR  19
             +FTW N R     +W+RLDR
Sbjct  176  TNFTWCNKRGEEDIIWKRLDR  196



>ref|XP_006354967.1| PREDICTED: uncharacterized protein LOC102599840 [Solanum tuberosum]
Length=288

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/226 (28%), Positives = 101/226 (45%), Gaps = 16/226 (7%)
 Frame = -1

Query  648  KMAKTKGGGA-SISDC*MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP-FKDLS  475
            +MA T GG + S     MK   WN R   +   ++ +R L+    P IL L E   +DL 
Sbjct  14   EMALTPGGSSNSPESPLMKIFLWNCRGANNAKFMNNIRALIDSHNPTILALTETRMEDLD  73

Query  474  HLGQF-----SVSLGFENRCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLS  310
             + Q       + +       G A +W   +  +  P     Q   + VT+ V  +    
Sbjct  74   KILQALDYTDVIQVPAFGYSGGIALLWRNSEINVE-PFVITEQ--EIHVTIKVSSSFPKF  130

Query  309  ---VVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS  139
               V+YA     +R+ LW+ ++ + AR    G W + GDFN +    EK GG+P N  K 
Sbjct  131  FFSVIYAKNTYGLRKILWENLKNLTARI--KGPWLVCGDFNEVTNASEKLGGRPINNTKC  188

Query  138  REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA-VWERLDRVLVNE  4
             +F +C+D   + +  + G  +TW N  + +   + ER+DR L N 
Sbjct  189  AKFISCLDDMDMIDLGFTGQKYTWSNKHKNNNTLIMERIDRFLSNH  234



>ref|XP_009789074.1| PREDICTED: uncharacterized protein LOC104236765 [Nicotiana sylvestris]
Length=222

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 87/185 (47%), Gaps = 21/185 (11%)
 Frame = -1

Query  528  RQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*DRCLS*PLGHGYQIVS  352
            RQ K + + L+EP +    L ++   + F    S  + KIW F            +++  
Sbjct  3    RQHKFQFIGLMEPKQQRKKLEKYRRKIDFPLAISNMSNKIWAF--------FSERFEVTV  54

Query  351  M-----RVTLPVIG-----NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGD  202
            +     ++TL V          L+ VYA C+   R ELWD + A+ +    +  W + GD
Sbjct  55   VMDMVKQLTLKVFDIEYQQEFYLTRVYAKCDAIERTELWDSLYALGSD--MNLPWIVGGD  112

Query  201  FNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLD  22
            +N I   EEK GG      +  +F+  I++S L    + G+ +TWWNGR     +++RLD
Sbjct  113  YNVIWDEEEKFGGLTVYINEVDDFRYYINTSNLFYLGFKGSIYTWWNGRAEENCIFKRLD  172

Query  21   RVLVN  7
            R L N
Sbjct  173  RCLAN  177



>ref|XP_008803836.1| PREDICTED: uncharacterized protein LOC103717291 [Phoenix dactylifera]
Length=495

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 93/206 (45%), Gaps = 16/206 (8%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQ----FSVSLGF---  442
            MK I WN R           R LV Q    I  LLE     + L +       S GF   
Sbjct  1    MKVILWNCRRAGKPSFAPVFRRLVHQHNLDICILLETRLSGNSLQKARRTVPRSWGFYAV  60

Query  441  --ENRCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQEL  268
              +    G    W    +C         Q V M ++       + + +YAS + R R+ L
Sbjct  61   ESQGLSGGIIVTWAQ-SKCRVDIFNVCTQEVIMVISEGSGDPWIFAAMYASTDFRERRIL  119

Query  267  WDLIEAMAAREVGDGRWAIM-GDFNCILRGEEKKGGQPYNKA-KSREFQNCIDSSRLRES  94
            W+     A++ +  G   ++ GDFNCI+  +EK GG+P+    K +EFQ+ +DS+ L + 
Sbjct  120  WE----EASQLISQGHPMLVAGDFNCIVGPQEKMGGKPFTYTRKIKEFQDFLDSNGLVDL  175

Query  93   VYYGNDFTWWNGRRGSQAVWERLDRV  16
             + G  FTW N + G   VWERLDRV
Sbjct  176  GFLGPQFTWCNNQLGRTRVWERLDRV  201



>ref|XP_009794363.1| PREDICTED: uncharacterized protein LOC104241142, partial [Nicotiana 
sylvestris]
Length=256

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 75/142 (53%), Gaps = 10/142 (7%)
 Frame = -1

Query  417  KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDLIE  253
            KIW F D      + +    ++ ++TL ++       L+L++ YA C+R  R ELWD + 
Sbjct  20   KIWAFIDENFEVTILYN---MTQQLTLRLMHTETHVELILTLFYAKCDRIERIELWDTLY  76

Query  252  AMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDF  73
            AM +       W + GDFN I   +EK GG P +  +  +F++ I++  L +  + G+ F
Sbjct  77   AMESDMTVP--WLVGGDFNVIWEEKEKYGGLPVSLLEVDDFRHYINTCNLTDLGFKGSIF  134

Query  72   TWWNGRRGSQAVWERLDRVLVN  7
            T WNGR     +++RLD+   N
Sbjct  135  TLWNGRSEEDCIFKRLDKCFGN  156



>ref|XP_009144152.1| PREDICTED: uncharacterized protein LOC103867818 [Brassica rapa]
Length=1717

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = -1

Query  378  LGHGYQIVSMRVTLPVI-GNLMLSVVYASCERRVRQELWDLIEAMA-AREVGDGRWAIMG  205
            L    Q++++ V+ P     +M+SV+YAS +   R  LW  I ++A   ++ +  W ++G
Sbjct  589  LSKSLQMITVEVSWPSCQAKVMISVIYASNDPDERSALWVEITSLADLLDLHNKPWLLLG  648

Query  204  DFNCILRGEEKKGGQPYN-KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWER  28
            DFN I    E    +  N   K R+F +C+  ++L +  Y G  FTWWN R+ S  + ++
Sbjct  649  DFNQIRDPSEHSIPRSLNLDKKMRDFNDCLSEAQLEDLNYRGTSFTWWNKRKSS-PIAKK  707

Query  27   LDRVLVNEN  1
            LDR LVN++
Sbjct  708  LDRCLVNDD  716



>ref|XP_010687131.1| PREDICTED: uncharacterized protein LOC104901277 [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 96/207 (46%), Gaps = 12/207 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            +K + WNV+ V ++  +  +R LVR  KP ++ L+E         +    +GF  +    
Sbjct  79   IKILVWNVQGVGNKVPV--IRELVRINKPSVVVLVETHMSGDQAQKICDKIGFSGQQRVE  136

Query  420  AK-----IWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN--LMLSVVYASCERRVRQELWD  262
            A+     IW+F D  L     +G     + V +  +G    + S VYAS +  +R+ELW 
Sbjct  137  AQGFSGGIWLFWDISLVSVTSYGSHSQHLTVEISKVGEDPWLFSAVYASPDSTLRKELWR  196

Query  261  LIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS-REFQNCIDSSRLRESVYY  85
             +E +  +E   G W + GDFN  +   E+ G +     +  R F N ++++ L +    
Sbjct  197  ELEKI--KEDYAGPWLLAGDFNKTMTMSERNGVESSEMVRRCRSFSNWVNNNELIDLDCS  254

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNE  4
            G   TW+ G         RLDR LVNE
Sbjct  255  GPSHTWFRGNSSETFKSARLDRGLVNE  281



>ref|XP_008791350.1| PREDICTED: uncharacterized protein LOC103708283 [Phoenix dactylifera]
Length=288

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 98/220 (45%), Gaps = 34/220 (15%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQF-----------SV  454
            M+ + WN R  A    +   R LV+   P+I  L E    LS  G             S 
Sbjct  1    MRILAWNCRGAAKPAFMSSFRRLVQIHSPEICLLYE--TRLSGRGFSRVLRRLEVDWESY  58

Query  453  SLGFENRCSGTAKIW--------VF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYA  298
            ++  +    G   +W        VF          +  Q V M ++ P     +L  VYA
Sbjct  59   AVDSQGLLGGIVALWKRGVATVDVF---------HNCSQQVIMIISEPNAAPWVLCGVYA  109

Query  297  SCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK-AKSREFQNC  121
            S   R R+ LWD +  + A+ +    +A++GDFN IL   EK+GG+ +      REF++ 
Sbjct  110  STNHRTRRVLWDELTHLIAQGLP---FAMVGDFNFILEECEKRGGRAFTDFVDRREFRDF  166

Query  120  IDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            +  + L +  + G  FTW N + G   VWERLDRV+ + +
Sbjct  167  LSRNGLVDLGFSGPRFTWCNNQSGRARVWERLDRVVASTD  206



>ref|XP_011093956.1| PREDICTED: uncharacterized protein LOC105173776 [Sesamum indicum]
Length=400

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 96/203 (47%), Gaps = 9/203 (4%)
 Frame = -1

Query  585  WNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLG-----FENRCSGT  421
            WNV  +  +     V++LV +F+   L LLE    L++  Q    L      F +  +  
Sbjct  4    WNVHGLNKRDHQLEVKDLVAEFRLHFLGLLETRVRLNNAPQIQSFLLLQWKWFVDYVTTG  63

Query  420  AKIWVF*DRCL--S*PLGHGYQIVSMRVTLPVIGNLM-LSVVYASCERRVRQELWDLIEA  250
             +IW+  D  +     +  G Q +   +T+  +   + ++++Y + E   R+ELWD I  
Sbjct  64   NRIWIAWDDNVINVDVVELGTQFIHCHLTIRALQEFVHVTIIYGANELADRRELWDYITT  123

Query  249  MAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFT  70
            ++ + V D  W + GDFN +    E  G     +    EF NCI ++ L      G  +T
Sbjct  124  LSIQCV-DTPWLVGGDFNAVRDLSEVCGASGDIRLAMEEFNNCIQNAGLLPLPMQGEWYT  182

Query  69   WWNGRRGSQAVWERLDRVLVNEN  1
            W N   G + +W+RLDR+L+N+ 
Sbjct  183  WHNCSVGPRNLWKRLDRILINDT  205



>ref|XP_002450418.1| hypothetical protein SORBIDRAFT_05g005061 [Sorghum bicolor]
 gb|EES09406.1| hypothetical protein SORBIDRAFT_05g005061 [Sorghum bicolor]
Length=753

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 92/208 (44%), Gaps = 12/208 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            MK +CWN R + +  ++  +R+L + + P ++ ++E       +     +L F+N     
Sbjct  1    MKTLCWNCRGIGNPATVKELRDLAKDYAPSVMFIMETQISKYRVENLRYTLSFDNSFAVN  60

Query  435  ---RCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
               R  G    W   D  LS      Y I ++ ++        +S +Y    R  R   W
Sbjct  61   SSGRSGGLGLFWNN-DVLLSIQKYSNYHIDTI-ISEHGKEPRRMSFIYGEPNRSFRYRTW  118

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
            D+++ M  R   D  W  MGDFN ILR EE+ G     +      ++ +D  +LR+  Y 
Sbjct  119  DIMKQM--RSDTDLPWVCMGDFNEILRREEQLGPNEREEYLMEGVRDAVDMCQLRDIGYI  176

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            G D+T+     G   V  RLDR L + N
Sbjct  177  GLDWTFEKKVAGGHFVRVRLDRALASVN  204



>ref|XP_008383872.1| PREDICTED: uncharacterized protein LOC103446515 [Malus domestica]
Length=502

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 92/206 (45%), Gaps = 11/206 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP---FKDLSHLGQFSVSLG---FE  439
            MK + WN+R + +  S   + N+ R   P ++C+ EP   F  +S     S++L    F 
Sbjct  1    MKVLFWNIRGIGNDDSRTELSNICRLHHPDLVCIAEPMVTFNSISAAYWDSLNLSALTFN  60

Query  438  NRCSGTAKIWVF*DRCLS*PL--GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
            +R +    +W+      + PL      Q V++R T   I +   + VYAS     R++LW
Sbjct  61   SRGTLAPNLWLLTSSACADPLVISISDQQVTVRCTFDHIPS-QFTFVYASTSPIKRRDLW  119

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
               + ++ R      W  +GDFN IL   E+ GG   ++A   +F N  D+         
Sbjct  120  --ADFISLRPQTXVPWMAIGDFNAILGAHEQMGGGRPSQASCAQFXNMSDTCNFTHLNTS  177

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVN  7
            G  FT  NG R       RLDR L +
Sbjct  178  GAAFTXSNGWRSRGRTERRLDRSLCD  203



>gb|KFK28834.1| hypothetical protein AALP_AA7G055000 [Arabis alpina]
Length=1002

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = -1

Query  363  QIVSMRVTLP-VIGNLMLSVVYASCERRVRQELWDLIEAMAARE-VGDGRWAIMGDFNCI  190
            QIVS  V LP     +++S VYA   +  R+ LW+ IE +     VG   WAI+GDFN  
Sbjct  291  QIVSCLVELPHSAKEMVISFVYAFNTKEQRRVLWEEIEHLGTSSLVGPRPWAILGDFNQT  350

Query  189  LR-GEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
            L   +  KGG    +    EF+ C+  + + +  + GN  TWWN + G   + ++LDR+L
Sbjct  351  LNPSDSSKGGSRITRG-IEEFRQCLLQAGVSDLTFRGNTHTWWNKQIGD-PITKKLDRIL  408

Query  12   VNEN  1
            VN+N
Sbjct  409  VNDN  412



>ref|XP_010669076.1| PREDICTED: uncharacterized protein LOC104886313, partial [Beta 
vulgaris subsp. vulgaris]
Length=249

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 3/120 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q++  R+T         S VYA      R+ LW  ++A++  +     W +MGDFNCIL 
Sbjct  27   QLIHCRITPQHGEEFECSFVYAHNIASEREVLWKDVDALS--KGIHKPWILMGDFNCILN  84

Query  183  GEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             EE+ GG    K + ++FQ C+    L E+   GN FTW N ++G+   + RLDRVLVN+
Sbjct  85   LEERIGGNVRLK-EMQDFQECVSRCDLVEAKVSGNFFTWNNKQQGTNRKFSRLDRVLVND  143



>ref|XP_008797555.1| PREDICTED: putative rRNA methyltransferase [Phoenix dactylifera]
Length=573

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 95/216 (44%), Gaps = 30/216 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKI--LCLLEPFKDLSHLGQFSVSLGFENRC-  430
            M+ + WN R  A    +   + LV+   P+I  LC      D     +  +   +E    
Sbjct  1    MRILAWNCRGAAKPAFMSSFKRLVQLHCPEICFLCETRLSGDGLGRLRRRLGRDWETYAV  60

Query  429  --------------SGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASC  292
                           G A+I VF          +  Q V M V+ P     +L  VYAS 
Sbjct  61   ESQGLSGGLLILWRRGVARIDVF---------HNCSQQVVMVVSEPEADPWVLCGVYAST  111

Query  291  ERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCID  115
            + RVR+ LW  I  + A+ +       +GDFNCI   +EK+GG P+ ++   REF++ + 
Sbjct  112  DYRVRRILWQEITNLLAQGIP---TVAVGDFNCIQSADEKRGGAPFTDRIDRREFRDFVQ  168

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             + L +  + G  FTW N + G   VWERLDR   +
Sbjct  169  LNGLVDLGFSGPRFTWCNNQPGGARVWERLDRAFAS  204



>ref|XP_008805704.1| PREDICTED: uncharacterized protein LOC103718591 [Phoenix dactylifera]
Length=206

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = -1

Query  318  MLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN-KAK  142
            +L+ VYAS + R R+ LW   E  +   +      + GDFNCI   +EK GG+P++ + K
Sbjct  103  VLAAVYASTDFRERRRLW---EEASQLIIQGCPMMVAGDFNCIADPQEKMGGKPFSYERK  159

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDR  19
             REFQ+ + S+ L +  + G+ FTW N ++G   VWERLDR
Sbjct  160  VREFQDFLTSNGLIDLGFSGSRFTWCNNQQGQARVWERLDR  200



>ref|XP_008782101.1| PREDICTED: uncharacterized protein LOC103701716 [Phoenix dactylifera]
Length=335

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 94/212 (44%), Gaps = 30/212 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHL-----------GQFSV  454
            MK + WN R           R +V+Q  P I  +LE       L           G +SV
Sbjct  1    MKVLLWNCRGAGKPSFAPAFRRVVQQHNPDICVVLETRLSGQSLQKARRAVPRSWGFYSV  60

Query  453  -SLGFENR-----CSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASC  292
             S G           G  K+ +F   C         Q V M ++   +   + + VYAS 
Sbjct  61   ESQGLSGGIIVTWAQGPCKVDIF-HVCT--------QEVIMVISEGSMRPWVFAAVYAST  111

Query  291  ERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN-KAKSREFQNCID  115
            + RVR+ LW+ +  + +    D    + GDFNCI    EK GG+P+  + K  EFQ+ + 
Sbjct  112  DFRVRRILWEEVSQLISL---DYPMLVAGDFNCITDPSEKMGGRPFTYERKITEFQDFLT  168

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDR  19
            S+ L +  + G  +TW N ++G   VWERLDR
Sbjct  169  STGLIDLGFLGPRYTWCNNQQGRARVWERLDR  200



>ref|XP_009803225.1| PREDICTED: uncharacterized protein LOC104248620 [Nicotiana sylvestris]
Length=670

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 90/189 (48%), Gaps = 26/189 (14%)
 Frame = -1

Query  555  SLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*DRCLS*P  379
            +  ++  + R+   + + +LEP +    + ++   +G        + KIW F D      
Sbjct  3    AFEKLITMHRKHHFEFIGILEPMQQSHKMERYRARIGLAQAMVNVSNKIWAFIDEIFEVT  62

Query  378  LGHGYQIVSMRVTLPVIGN-----LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWA  214
            + +    ++ ++TL ++       L+L++VYA C+R  R ELWD + AMA+         
Sbjct  63   ILYN---MTQQLTLRLMHTETHVELILTLVYAKCDRIERIELWDTLYAMASD--------  111

Query  213  IMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVW  34
                       EEK GG P +  +  +F++CI++  L +  +  + FTWWNGR     ++
Sbjct  112  ---------MTEEKYGGLPVSLLEVYDFRHCINTCNLTDLGFKRSIFTWWNGRSEEDCIF  162

Query  33   ERLDRVLVN  7
            +RLDR   N
Sbjct  163  KRLDRYFGN  171



>ref|XP_008780512.1| PREDICTED: uncharacterized protein LOC103700340, partial [Phoenix 
dactylifera]
Length=276

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            Q V M ++ P     +L  VYAS + R R+ LW  +  + ++ V      ++GDFNCIL 
Sbjct  41   QQVVMVISEPNEPPWVLCEVYASTDYRTRRLLWGELSRLLSQGVPT---MVVGDFNCILA  97

Query  183  GEEKKGGQPYNKA-KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              EK+GG+ Y+ +   REF+  ++ + L +  + G  FTW N + G   VWERLDR + +
Sbjct  98   PSEKRGGRAYSDSVDRREFREFMNGAGLVDLGFTGPRFTWCNNQTGRSRVWERLDRAIAS  157

Query  6    EN  1
             +
Sbjct  158  PD  159



>ref|XP_009758321.1| PREDICTED: uncharacterized protein LOC104211025 [Nicotiana sylvestris]
Length=679

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 87/192 (45%), Gaps = 33/192 (17%)
 Frame = -1

Query  573  EVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*D  397
            +V +Q +  R+  + RQ     + L+EP +    L ++   +G     S  + KIW F D
Sbjct  32   KVNTQQAFERLTKMHRQNHYDFVGLMEPKQQAKKLERYRNKIGLAQAISNVSNKIWAFID  91

Query  396  RCLS*PLGHGY-QIVSMRV-TLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDG  223
                  + +   Q +++R+         +L+++YA C+   R ELWD + AM AR++ D 
Sbjct  92   EVFEVTVMYNMVQQLTLRLFHTETHVEFVLTLIYAKCDAIERIELWDSLYAM-ARDM-DA  149

Query  222  RWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQ  43
             W + GDFN I   EEK                            +G+ FTWWNGR    
Sbjct  150  SWLVGGDFNVIWDEEEK----------------------------FGSIFTWWNGRAEED  181

Query  42   AVWERLDRVLVN  7
             +++RLDR L N
Sbjct  182  CIFKRLDRCLAN  193



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 93/187 (50%), Gaps = 10/187 (5%)
 Frame = -1

Query  558  GSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*  382
            G   R++ L      K+L +LEP  + +    F    GF+   S  + KIW+F    ++ 
Sbjct  604  GIQRRLKKLKIMHNIKLLVILEPMVNPNRADYFRRRFGFDRVISNCSQKIWIFSSMEVNC  663

Query  381  P-LGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIM  208
              L    Q + +R++LP + + +  + VYA C R+ R ELW+ + ++++     G W + 
Sbjct  664  EVLMDHIQCLHVRLSLPWLPHPISATFVYAKCTRQERLELWNCLRSLSSDM--QGPWMVG  721

Query  207  GDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWER  28
            GDFN I+   E+  G P +     +F   +    L ++ + GN FTW N       +++R
Sbjct  722  GDFNTIVSCAERLNGAPPHGGSMEDFVATLFDCGLIDAGFEGNSFTWTNNH-----MFQR  776

Query  27   LDRVLVN  7
            LDRV+ N
Sbjct  777  LDRVVYN  783



>ref|XP_008775925.1| PREDICTED: uncharacterized protein LOC103696163 [Phoenix dactylifera]
Length=345

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 95/218 (44%), Gaps = 30/218 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKI--LCLLEPFKDLSHLGQFSVSLGFENRC-  430
            M+ + WN R  A    +   + LV+   P+I  LC      D     +  +   +E    
Sbjct  1    MRILAWNCRGAAKPAFMPSFKRLVQLHCPEICFLCETRLSGDGLGRLRRRLGRDWETYAV  60

Query  429  --------------SGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASC  292
                           G A+I VF          +  Q V M V+ P     +L  VYAS 
Sbjct  61   ESQGLSGGLLVLWRRGVARIDVF---------HNCSQQVVMVVSEPEADPWVLCGVYAST  111

Query  291  ERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCID  115
            + RVR+ LW  +  + A+ +       +GDFNCI   +EK+GG  + ++   REF++ + 
Sbjct  112  DYRVRRTLWREVTNLVAQGIPT---VAVGDFNCIRSADEKRGGALFTDRIDRREFRDFVQ  168

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             + L +  + G  FTW N + G   VWERLDR   + +
Sbjct  169  LNGLVDLGFSGPRFTWCNNQPGGARVWERLDRAFASPD  206



>ref|XP_010489852.1| PREDICTED: uncharacterized protein LOC104767537 [Camelina sativa]
Length=850

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = -1

Query  378  LGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELW-DLIEAMAAREVGDGRWAIMG  205
            L    Q+++  V LP     +++SVVYA+ E   R  LW DL +  A+  +G+  W ++G
Sbjct  135  LAKSLQMITCEVLLPDAHQWIVVSVVYAANEVDTRVHLWEDLKQLSASPIIGNRAWLVLG  194

Query  204  DFNCILRGEEKKGGQPYN-KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWER  28
            DFN  L   +       N   ++R+F+ C+  + L +  Y G+ FTWWN +  ++ V ++
Sbjct  195  DFNQTLHPTDHFDPVTLNVDRRTRDFRECLLDAELSDLRYQGSKFTWWN-KSKTRPVAKK  253

Query  27   LDRVLVNEN  1
            LDRVL NE+
Sbjct  254  LDRVLANES  262



>ref|XP_008777729.1| PREDICTED: uncharacterized protein LOC103697602 [Phoenix dactylifera]
Length=612

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -1

Query  372  HGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNC  193
            H  Q V M ++ P   + +L  VYAS + R R+  W  +  +  + V      ++GDFNC
Sbjct  133  HCSQQVVMVISEPNEPSWVLCGVYASTDYRTRRVFWGELSCLLTQGVPT---MVVGDFNC  189

Query  192  ILRGEEKKGGQPYNKA-KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRV  16
            +L   EK+GG+ Y+ +   REF+  +D + L +  + G+ FTW N + G   VWERLDR 
Sbjct  190  VLGPNEKRGGRIYSDSVDRREFREFLDVTGLVDLGFTGSRFTWCNNQSGRARVWERLDRA  249

Query  15   LVNEN  1
            + + +
Sbjct  250  IASPD  254



>ref|XP_009784545.1| PREDICTED: uncharacterized protein LOC104232966 [Nicotiana sylvestris]
Length=372

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAK  142
            L +++VY   E+  R++LWD +  +  +   DG WA+M DFNC+L  EE+ G +    A+
Sbjct  269  LNVTLVYGFNEQTTRRKLWDGVNQIRVK--MDGPWAVMRDFNCVLNREERIGSK-VTMAE  325

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +R+F+ CI+   L+E       FTW N + G   V+ R+DRVLVN
Sbjct  326  TRDFRQCIEVCGLKELRSSRAFFTWNNKQGGDSRVYIRIDRVLVN  370



>ref|XP_008778148.1| PREDICTED: uncharacterized protein LOC103697979 [Phoenix dactylifera]
Length=678

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 4/120 (3%)
 Frame = -1

Query  357  VSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGE  178
            V M V+ P     +L  VYAS + RVR+ LW  I  + A+ +      ++GD NCI   +
Sbjct  126  VVMVVSEPEADPWVLCGVYASTDYRVRRILWQEITNLLAQGIPT---MVVGDLNCIQSAD  182

Query  177  EKKGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            EK+GG P+ ++   REF++ +  + L +  + G  FTW N + G   VWERLDR   + +
Sbjct  183  EKRGGVPFTDRIDRREFRDFVQLNGLVDLGFSGPRFTWCNNQPGGARVWERLDRAFASPD  242



>ref|XP_008779968.1| PREDICTED: uncharacterized protein LOC103699741, partial [Phoenix 
dactylifera]
Length=581

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = -1

Query  318  MLSVVYASCERRVRQELWDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYN-KA  145
            + S VYAS + R R+ LW+     A++ V  G+   I GDFNCI   +EK GG+P++ + 
Sbjct  216  IFSAVYASTDFRARRLLWE----EASKLVDQGQPLLIAGDFNCIDDPQEKMGGRPFSYQR  271

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            K REFQ  I ++ L +  + G  FTW N ++G   VWERLDR    
Sbjct  272  KVREFQEFIFTNGLIDLGFTGPRFTWCNNQQGPARVWERLDRAFAT  317



>gb|AAD21778.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1715

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 103/215 (48%), Gaps = 10/215 (5%)
 Frame = -1

Query  627  GGASISDC*MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSL  448
            GGA  +   M+   WN + +    ++ R+  + R +   +L L+E  +  ++     V +
Sbjct  354  GGAGTTTSPMRVGFWNCQGLGQPLTVRRLEEVQRVYFLDMLFLIETKQQDNYTRDLGVKM  413

Query  447  GFENRCSGTAK-----IWVF*DRCLS*P-LGHGYQIVSMRVTLPVIGNLMLSVVYASCER  286
            GFE+ C  + +     + V+  + LS   + H  ++V + V      N  LS +Y     
Sbjct  414  GFEDMCIISPRGLSGGLVVYWKKHLSIQVISHDVRLVDLYVEYKNF-NFYLSCIYGHPIP  472

Query  285  RVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSR  106
              R  LW+ ++ ++A     G W + GDFN IL   EKKGG+  +    + F N I+   
Sbjct  473  SERHHLWEKLQRVSAHR--SGPWMMCGDFNEILNLNEKKGGRRRSIGSLQNFTNMINCCN  530

Query  105  LRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            +++    GN ++ W G+R ++ +   LDRV +N +
Sbjct  531  MKDLKSKGNPYS-WVGKRQNETIESCLDRVFINSD  564



>ref|XP_010313000.1| PREDICTED: uncharacterized protein LOC104644619 [Solanum lycopersicum]
Length=1070

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  219  WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            W+I+GDFN I    EK GG+ YN  KS EF + I++  L +  YYG D+TW N RR    
Sbjct  4    WSILGDFNVITSTSEKLGGKDYNINKSLEFISIIEACGLVDMGYYGQDYTWCNHRRDGAR  63

Query  39   VWERLDRVLVNE  4
            +W+RLDR + N+
Sbjct  64   IWKRLDRGMTND  75



>ref|XP_009588715.1| PREDICTED: uncharacterized protein LOC104086215 [Nicotiana tomentosiformis]
Length=369

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 61/103 (59%), Gaps = 3/103 (3%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
            +S +YA  +  +R  LW+ +  +A+    +G W ++GDFN ++  EEKKGG+P+    S 
Sbjct  62   ISAIYAKYDETLRYRLWEELRDLASW--VNGPWGVVGDFN-VVSCEEKKGGRPFRVEDSL  118

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +F  C+    L+++ Y  + FTW + R     +WERLDR++ N
Sbjct  119  DFLACLSDCGLQDAGYCCSQFTWSDNRDPPNTIWERLDRLVYN  161



>ref|XP_008231245.1| PREDICTED: uncharacterized protein LOC103330439 [Prunus mume]
Length=289

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 97/223 (43%), Gaps = 29/223 (13%)
 Frame = -1

Query  600  MKFICWNVREVASQGS-----LHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN  436
            MK + WNVR    +G+        +++L + +   +  +LEP   +      + SLGF +
Sbjct  1    MKIVAWNVRGAGKRGAGKESCAMTIKDLKKAYAIDVFAILEPRISVPRALIIAQSLGFSH  60

Query  435  RCSGTAK----------------IWVF*D--RCLS*PLGHGYQIVSMRVTLPVIGNLMLS  310
                 A                 IW+  +        + H  Q ++  VT       +L+
Sbjct  61   HHIIDATGFSLGVGGGGGGGGGGIWLLWNGNSVSLHVVAHSSQFITALVT-SRNKRWLLT  119

Query  309  VVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREF  130
            VVYA+    +R+ LW   + +A   +    W ++GDFN I   +EK GG   +  KS  F
Sbjct  120  VVYANPYPMIREALWKYFDDLA---LVSSLWLVLGDFNDIASADEKCGGNLNHGGKS--F  174

Query  129  QNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             + ID + L +  ++G  FTW N R     +W+RLDR L   N
Sbjct  175  VDWIDRNHLVDLGFFGAQFTWCNKRNVESIIWKRLDRGLCTIN  217



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 92/211 (44%), Gaps = 30/211 (14%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTAK-  415
            + WNVR    +      ++LVR  K  I  +LEP        +    LGF N     A  
Sbjct  1    MVWNVRGAGGKPFSVTAKDLVRLNKVNIFAILEPRISGERAIEVIKGLGFSNYYVVDANG  60

Query  414  ----IWVF*DRCLS*PLGHGYQIVSMRV------TLPVI---GNL--MLSVVYASCERRV  280
                +W+  +           ++V + V      T+  +   G +  ML+VVYAS   RV
Sbjct  61   FSGGVWLLWNN----------EVVKLTVVACSSQTITAVVMDGQIQWMLTVVYASPCPRV  110

Query  279  RQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLR  100
            R  LW  ++ ++A    +  W I GDFN ++   EKKGG+P NK       N    + L 
Sbjct  111  RSHLWPYLDGVSA--ASNMPWLIAGDFNELMHSSEKKGGRPVNKNSG--LGNWSARNSLV  166

Query  99   ESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +  + G  FTW       + VWERLDR L N
Sbjct  167  DLGFIGAKFTWSKKNEHGEIVWERLDRGLCN  197



>ref|XP_008354730.1| PREDICTED: uncharacterized protein LOC103418377 [Malus domestica]
Length=596

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 56/104 (54%), Gaps = 4/104 (4%)
 Frame = -1

Query  318  MLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS  139
            ML+VVYAS   RVR  LW  ++ ++A    +  W I GDFN ++   EKKGG+P N  K+
Sbjct  98   MLTVVYASPCPRVRSHLWPYLDGVSA--ASNMPWLIAGDFNELIHSSEKKGGRPVN--KN  153

Query  138  REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
                N I  + L +  + G  FTW         VWERLDR L N
Sbjct  154  SGLGNWISRNSLVDLGFIGAKFTWSKKNEYGDIVWERLDRGLCN  197



>ref|XP_010682308.1| PREDICTED: uncharacterized protein LOC104897183 [Beta vulgaris 
subsp. vulgaris]
Length=273

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 88/204 (43%), Gaps = 13/204 (6%)
 Frame = -1

Query  591  ICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTAK-  415
            + WNV+   S+  +  +R +VR  KP +L L+E      H  + +  LG+       A+ 
Sbjct  64   LVWNVQGAGSREFMAVLREVVRVHKPTVLALVETHMGGDHAQRVASILGYSGHTREDAQG  123

Query  414  ----IWVF*--DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIE  253
                IW++   D     P+    Q +++ +T         S +YAS +   RQ+LW  + 
Sbjct  124  FSGGIWLYWRSDLVTVGPIARSNQYITVEITRNGEDPWFFSAIYASPDSTKRQDLWRELS  183

Query  252  AMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDF  73
            A+A+       W + GDFN      E+         +S  F   ++ S+L E  + G   
Sbjct  184  AVASN--NQKPWLLAGDFNDTRYNWERNSSCAETSRRSARFNQWVEDSQLIEVEFSGPSH  241

Query  72   TWWNGRRGSQAVWE--RLDRVLVN  7
            TW   R  S   W+  RLDR L N
Sbjct  242  TW--SRGNSVETWKSARLDRALCN  263



>emb|CAN63032.1| hypothetical protein VITISV_024672 [Vitis vinifera]
Length=1413

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 92/205 (45%), Gaps = 15/205 (7%)
 Frame = -1

Query  582  NVREVASQGSLHRVR---NLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN--------  436
            N+    S G L  VR   NLVR+ KP+++ L+E F   + + + +  L +E         
Sbjct  345  NLELAGSVGGLETVRLLTNLVREKKPEVIFLIETFCTSARISEIANKLNYEGSYGVNCRG  404

Query  435  RCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLI  256
              +G   IW   D+     LG   + +   VTL       L+  Y    R  R   W+++
Sbjct  405  HSAGLGLIWRCKDKVTI--LGSHDRYIDAIVTLENQRMFRLTGFYGLANRSQRSSSWEIL  462

Query  255  EAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGND  76
              + A       W ++GDFN ++   EK G  P+  +    F+  + +  L +  Y G  
Sbjct  463  RNLHA--AHSLPWCVIGDFNELMHQSEKCGNHPHPGSLIEAFRQVVTNCGLSDLGYVGYA  520

Query  75   FTWWNGRRGSQAVWERLDRVLVNEN  1
            +TW  GR  ++ V ERLDR LV+ +
Sbjct  521  YTWERGRGTTRWVEERLDRALVSAD  545



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 55/104 (53%), Gaps = 4/104 (4%)
 Frame = -1

Query  318  MLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS  139
            ML+VVYAS   RVR  LW  ++ ++A    +  W I GDFN ++   EKKGG+P NK   
Sbjct  226  MLTVVYASPCPRVRSHLWPYLDGVSA--ASNMPWLIAGDFNELIHSSEKKGGRPVNKNSG  283

Query  138  REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
                N I  + L +  + G  FTW         VWERLDR L N
Sbjct  284  --LGNWISRNSLVDLGFIGAKFTWSKKNEYGDIVWERLDRGLCN  325



>ref|XP_010532354.1| PREDICTED: uncharacterized protein LOC104808378 [Tarenaya hassleriana]
Length=507

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 93/211 (44%), Gaps = 13/211 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP-FKDLSHLGQFSVSLG------F  442
            MK  CWN R +        V+ L+R  +P I  L+E   +D S + +   ++        
Sbjct  1    MKIFCWNTRGLNGSPKHRAVKELLRAKEPLIGALIETRVRDESSVTRIMQTIAPSWRVIH  60

Query  441  ENRCSGTAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQEL  268
              R +   +IWV  D  LS  +     Q+++  V LP  G     S VYA      R+ L
Sbjct  61   NYRYAALGRIWVLWDPSLSVTVYASSSQMITCGVLLPASGLYFTASFVYALNTPSERRAL  120

Query  267  WDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYNKAKS--REFQNCIDSSRLRE  97
            W  I  + +  +   R W ++GDFN IL   E      +   +S   EFQ+C+ S+ L +
Sbjct  121  WQEIIDLGSNSLVAARPWILLGDFNQILHPSEHASPTAHFLPQSGMSEFQDCLYSAGLMD  180

Query  96   SVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
                G  FTW N       +  +LDR LVN+
Sbjct  181  LSARGCFFTWTNSSM-ENPIARKLDRALVND  210



>gb|KFK28833.1| hypothetical protein AALP_AA7G055000 [Arabis alpina]
Length=1415

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = -1

Query  363  QIVSMRVTLP-VIGNLMLSVVYASCERRVRQELWDLIEAMAARE-VGDGRWAIMGDFNCI  190
            QIVS  V LP     +++S VYA   +  R+ LW+ IE +     VG   WAI+GDFN  
Sbjct  291  QIVSCLVELPHSAKEMVISFVYAFNTKEQRRVLWEEIEHLGTSSLVGPRPWAILGDFNQT  350

Query  189  LR-GEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
            L   +  KGG    +    EF+ C+  + + +  + GN  TWWN + G   + ++LDR+L
Sbjct  351  LNPSDSSKGGSRITRG-IEEFRQCLLQAGVSDLTFRGNTHTWWNKQIGD-PITKKLDRIL  408

Query  12   VNEN  1
            VN+N
Sbjct  409  VNDN  412



>ref|XP_010529057.1| PREDICTED: uncharacterized protein LOC104806035 [Tarenaya hassleriana]
Length=360

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 95/215 (44%), Gaps = 23/215 (11%)
 Frame = -1

Query  597  KFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENR-----  433
            +  CWNVR +        V+N + + KP I CL+E     + +   +V++    R     
Sbjct  3    RIFCWNVRGLNDSAKQRNVKNWIDEQKPIIGCLIE-----TRVRSEAVAVSISQRLFPGW  57

Query  432  -------CSGTAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIG-NLMLSVVYASCERRV  280
                    +   +IWV  D  +S  +     Q ++  V +PV G    +S +YA      
Sbjct  58   AFTHNYHSADLGRIWVTWDPSISVVVYSASEQCITCGVFIPVSGVYATISFIYAKNTPGE  117

Query  279  RQELWDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQ-PYNKAKSR-EFQNCIDSS  109
            R+ LW  I  +A   +   R W + GDFN ILR +E      P+N      + Q+CI S+
Sbjct  118  RRSLWTEISGLATNGLIMSRPWLLAGDFNQILRPQEHASPTVPFNPTSGMFDLQDCIFSN  177

Query  108  RLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             L +    G+ FTW N       +  +LDR +VNE
Sbjct  178  GLFDLTTRGHFFTWINN-NSDNPIARKLDRAIVNE  211



>ref|XP_009781794.1| PREDICTED: uncharacterized protein LOC104230633 [Nicotiana sylvestris]
Length=368

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 4/105 (4%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAK  142
            L+L++VYA C+R  R ELWD + AM++  +    W + GDFN I   EEK GG   +  +
Sbjct  54   LILTLVYAKCDRIERIELWDTLYAMSSDMIV--LWLVGGDFNVIWGKEEKYGGLLVSLLE  111

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              +F++CI++  L +  + G    WWNGR     +++RLDR   N
Sbjct  112  VDDFRHCINTRNLTDLGFKGR--RWWNGRSEEDCIFKRLDRCFGN  154



>ref|XP_010669917.1| PREDICTED: uncharacterized protein LOC104887033 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (61%), Gaps = 4/104 (4%)
 Frame = -1

Query  315  LSVVYASCERRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS  139
            LS+VY   ++  R ELW DLI+   +R+V + +W +MGDFN IL   E+ G QP   ++ 
Sbjct  240  LSMVYGHNDKEKRSELWNDLIKC--SRDVMNTQWVVMGDFNNILNLNERIG-QPVLFSEI  296

Query  138  REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              F+NC+DS  L ++   G  +TW N ++    V  ++DRVLVN
Sbjct  297  ERFRNCVDSCGLGDAKMTGPFYTWSNKQQEDDYVTTKIDRVLVN  340



>ref|XP_009600115.1| PREDICTED: uncharacterized protein LOC104095652 [Nicotiana tomentosiformis]
Length=238

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (54%), Gaps = 2/108 (2%)
 Frame = -1

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
             + L+++YA C+  +R  LW+ +  ++   + +  W ++ DFN I    EK GG PY   
Sbjct  13   TIQLTIMYAKCKPTLRSPLWENLRHIST--ICNTPWCVIRDFNVIASIGEKIGGIPYQMN  70

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            KS +F + I +  L +  +YG  +TW N       VW+R DR L N+N
Sbjct  71   KSIDFLSMIKNCGLIDLGFYGPRYTWSNRMGTCSIVWKRSDRGLANDN  118



>ref|XP_010666673.1| PREDICTED: uncharacterized protein LOC104883809 [Beta vulgaris 
subsp. vulgaris]
Length=455

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 96/208 (46%), Gaps = 12/208 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            +K + WNV+   ++  +  ++ LVR  KP ++ L+E         +    +GF+ +    
Sbjct  45   IKILVWNVQGAGNKVPI--IKELVRINKPSVVVLVETHLSGEQAQKICDKIGFQGQQRVE  102

Query  420  AK-----IWVF*DRCLS*PLGHGYQIVSMRVTLPVIGN--LMLSVVYASCERRVRQELWD  262
            A+     IW+  D        +G     + V +  +G    + S VYAS +  +R+ELW 
Sbjct  103  AQGFSGGIWLLWDTSFVSITSYGSHTQHLTVEIRKLGEDLWLFSAVYASPDSTLRKELWR  162

Query  261  LIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS-REFQNCIDSSRLRESVYY  85
             +E +  ++   G W + GDFN  +   E+ G +    ++  REF N + ++ L +    
Sbjct  163  ELEKI--KDSYFGPWLLAGDFNETMTMNERNGSESSEMSRRCREFSNWVSNNELIDLGCS  220

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            G   TW+ G         RLDR LVNE+
Sbjct  221  GPSHTWFRGNSSQTFKSARLDRGLVNED  248



>ref|XP_009102111.1| PREDICTED: uncharacterized protein LOC103828248 [Brassica rapa]
Length=381

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = -1

Query  363  QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWD-LIEAMAAREVGDGRWAIMGDFNCIL  187
            Q ++  V  P +    +S +YA      R+ LWD L++  A+  + +  W I GDFN I+
Sbjct  40   QEITCEVVYPGLPTFTMSAIYADNTVDERKILWDTLLDVKASLSLHNSPWIIGGDFNEII  99

Query  186  RGEEKKGGQPYNKAKSR--EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
               E      +N    +  EF++CID   +R+  ++G  FTW N ++ S  + ++LDRV+
Sbjct  100  HCAEHSSPA-FNSITPQMIEFKDCIDELEVRDLRFHGPPFTWSN-KQPSDPISKKLDRVM  157

Query  12   VNE  4
            +NE
Sbjct  158  INE  160



>ref|XP_011101582.1| PREDICTED: uncharacterized protein LOC105179641 [Sesamum indicum]
Length=520

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 98/207 (47%), Gaps = 9/207 (4%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLG-----FEN  436
            +    WNVR +  +     +++LV +F+   L +LE    L+++      L      F +
Sbjct  2    LNLAVWNVRGLNKRDHRLALKDLVSEFRLYFLGILETRVQLNNVMHIQSYLLPQWKWFAD  61

Query  435  RCSGTAKIWVF*DRCL--S*PLGHGYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELW  265
              S   +IW+  D        L  G Q V  R+T   +  +++++VVY++ E    Q LW
Sbjct  62   YNSNGNRIWLAWDENFIDVHVLDLGEQFVQCRITSRAVNESVIVTVVYSATEVTDHQILW  121

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
              +E +A ++  D  W + GDFN +    E  G     +  + EF N I  + L      
Sbjct  122  TALETLA-QQCSDVPWLVGGDFNAVRDLNEVCGISGDIRMATAEFNNGILEAGLIPLPMQ  180

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNE  4
            G  FTW N    ++++W+RLDR+L+N+
Sbjct  181  GEWFTWHNCSTTARSLWKRLDRILIND  207



>ref|XP_004298219.1| PREDICTED: uncharacterized protein LOC101304768 [Fragaria vesca 
subsp. vesca]
Length=1687

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 98/210 (47%), Gaps = 23/210 (11%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCS--  427
            M  + WNVR + +  +   ++  +R   P ++ L+E  K    +      LGFE  CS  
Sbjct  1    MIGVSWNVRGLGNPHTFRALKKFLRAKDPDLVFLMETKKKKQEMANICFDLGFEG-CSVV  59

Query  426  --------GTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLM-LSVVYASCERRVRQ  274
                    G A  W   ++    P+G     + + V     G ++ ++  Y + + ++R 
Sbjct  60   GKVGFSSGGLAMCWK--NKMEVRPVGSSQGHIDVAVLFK--GQVIRVTGFYGNPDSQLRH  115

Query  273  ELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRES  94
              WDL+  +A      G W + GDFN +L   +K+GG    +A+ R F+  +D   L+E 
Sbjct  116  FSWDLLRRIAKSV--RGPWIVFGDFNELLCIGDKRGGGERPEAQIRRFREAVDECGLQEV  173

Query  93   VYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             + G  FTW   +RG+  + ERLDR  +NE
Sbjct  174  EFSGPTFTW---KRGT--LLERLDRCFINE  198



>ref|XP_008362180.1| PREDICTED: uncharacterized protein LOC103425857 [Malus domestica]
Length=1384

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 88/208 (42%), Gaps = 11/208 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFS------VSLGFE  439
            MK + WN+R + +  S   + N+ R   P ++C+ EP    + +           +L F 
Sbjct  1    MKVLFWNIRGIGNDDSRXELSNICRLHHPDLVCIAEPMVTFNSISAXYWDSLNLXALTFN  60

Query  438  NRCSGTAKIWVF*DRCLS*PL--GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
            +R +    +W+      + PL      Q V++R T   I +   + VYAS     R++LW
Sbjct  61   SRGTLAPNLWLLTXXACADPLVISISDQQVTVRCTFDHIPS-QFTFVYASTSPIKRRDLW  119

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
               + ++ R      W  +GDFN IL   E  GG   ++    +F N  D+         
Sbjct  120  --ADFISLRPQTXVPWMAIGDFNAILGAHEXMGGGXPSQXSCAZFXNXSDTCNFTXLNTS  177

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            G  FT  NG R       RLDR L + +
Sbjct  178  GAXFTXSNGWRSRGRTERRLDRSLCDXS  205



>ref|XP_009616379.1| PREDICTED: uncharacterized protein LOC104108929 [Nicotiana tomentosiformis]
Length=865

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  219  WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            W + GDFN +L  +EK GG P    +  +F  C++S  L +  Y G+ FTWWNGR   Q 
Sbjct  3    WIVGGDFNVVLHEDEKIGGLPVYPPEYEDFALCVNSCGLFDIGYNGSPFTWWNGRPNDQC  62

Query  39   VWERLDRVLVN  7
            +++RLDR+ VN
Sbjct  63   IFKRLDRIFVN  73



>ref|XP_009758093.1| PREDICTED: uncharacterized protein LOC104210819 [Nicotiana sylvestris]
Length=357

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 7/91 (8%)
 Frame = -1

Query  267  WDLI----EAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLR  100
            WDL+    + M  R    G   + GDFN +L  EEK GG P    +  +F  C++S  L 
Sbjct  40   WDLLIDTEQQMTIRVYHQG---LGGDFNVVLGEEEKIGGLPVYPLEYEDFAFCVNSCGLF  96

Query  99   ESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +  Y G+ FTWWNGR   + +++RLDR+LVN
Sbjct  97   DLGYKGSPFTWWNGRPNEECIFKRLDRILVN  127



>gb|KEH41477.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=738

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 51/200 (26%), Positives = 88/200 (44%), Gaps = 20/200 (10%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGT  421
            M  I WN R + +  ++  +++LVR +KP I+ L+E       + +   SL F     G 
Sbjct  158  MNIISWNCRGLGNVKAVPEIKDLVRVYKPDIVILIETL-----VNEAVASLSF-----GE  207

Query  420  AKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAA  241
              + V         +      +++ +   VIG   L+  Y   +   R+E WDL+  +++
Sbjct  208  ILLTVL--------INFSQNFINLLIKDSVIGTWRLTAFYGYSDSGRRRESWDLLRYLSS  259

Query  240  REVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWN  61
                +  W I+GDFN  L  E+K+GG        R FQ+ +    L +   +   FTW+ 
Sbjct  260  HS--NDPWCIIGDFNDQLSSEDKRGGPDRPSWLIRGFQDAVKDCNLFDMPLHSYQFTWFK  317

Query  60   GRRGSQAVWERLDRVLVNEN  1
                  +   R+DR LV  +
Sbjct  318  SIGTPSSKEARIDRALVTSS  337



>ref|XP_008349387.1| PREDICTED: uncharacterized protein LOC103412619 [Malus domestica]
Length=695

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 86/206 (42%), Gaps = 11/206 (5%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFS------VSLGFE  439
            MK + WN+R + +  S   + N+ R   P ++C+ EP    + +           +L F 
Sbjct  1    MKVLFWNIRGIGNDDSRXELSNICRLHHPBLVCIXEPMVTFNSISAXYWDSLNLXALTFN  60

Query  438  NRCSGTAKIWVF*DRCLS*PLGHGYQI--VSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
            +R +    +W+        PL        V++R T   I +     VYAS     R++LW
Sbjct  61   SRGTLAXNLWLLTXXXCXXPLVISIXDXQVTVRCTFDHIPS-QFXFVYASTSXIKRRDLW  119

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
               + ++ R      W  +GDFN IL   E+ GG   ++A   +F N  D+         
Sbjct  120  --ADFISLRPQTXVPWMAIGDFNAILGAHEQMGGGXPSQASCAZFXNMSDTCNFTHLNTS  177

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVN  7
            G  FT  NG R       RLDR L +
Sbjct  178  GAXFTXSNGWRSRGRTERRLDRSLCD  203



>ref|XP_010684022.1| PREDICTED: uncharacterized protein LOC104898625 [Beta vulgaris 
subsp. vulgaris]
Length=386

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 97/211 (46%), Gaps = 21/211 (10%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            M  + WNVR +A        R L++   P ++ L E +            LGF++     
Sbjct  1    MNVLFWNVRGLARPSFKPNFRLLMQHHYPSLVILAETWVGREKTNDIVADLGFDSWHLLE  60

Query  435  ---RCSGTAKIWVF*DRCLS*P-LGHG----YQIVSMRVTLPVIGNLMLSVVYASCERRV  280
                  G   +W      L    +G G    Y +V +R T     + +L+ +YAS +  V
Sbjct  61   PDGFVGGILLLWK--SHILDFHVIGEGAQGVYGVVEVRST---NTSFVLTAIYASPKLHV  115

Query  279  RQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLR  100
            RQ LW  +E  A + +G   W ++GDFN ++   EK GG+P  + ++  F + +D  +L 
Sbjct  116  RQTLWHELECFA-QNLGKP-WLVIGDFNDVVNQCEKFGGRPVGRRRADMFASTMDMCQLI  173

Query  99   ESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            +  + G  FTW N R+ +  + ERLDR   N
Sbjct  174  DLGFNGPKFTWTNKRKAN-PILERLDRGWAN  203



>ref|XP_009108843.1| PREDICTED: uncharacterized protein LOC103834526 [Brassica rapa]
Length=1084

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/208 (27%), Positives = 102/208 (49%), Gaps = 18/208 (9%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENR----  433
            M+   WN R +  + ++ R+R L R + P +L L+E  +   ++    VSLG+++     
Sbjct  1    MRVEVWNCRGLGQRLTVRRLRELQRVYSPDLLFLVETKQGNDYVRDVGVSLGYDSMELVP  60

Query  432  ----CSGTAKIW--VF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQE  271
                  G A +W       C+S       ++V + V      +  LS +Y +   + R  
Sbjct  61   PRGLSGGLAVLWKSYVSVSCIS----SDERLVDLFVDYKNF-SFYLSCIYGNPVPKFRSH  115

Query  270  LWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESV  91
            LW+ ++ +A   VG   W + GD N I    EKKGG+  +++  ++F+  ++   +++  
Sbjct  116  LWEKLQRIAVNRVGP--WMLCGDMNEISDPAEKKGGRIRSESSVKDFKTMLEICDMKDLQ  173

Query  90   YYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              GN+F+W  GRR ++ +   LDRV VN
Sbjct  174  AKGNNFSW-VGRRRNEVIECCLDRVFVN  200



>ref|XP_010689810.1| PREDICTED: uncharacterized protein LOC104903471 [Beta vulgaris 
subsp. vulgaris]
Length=405

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 97/207 (47%), Gaps = 14/207 (7%)
 Frame = -1

Query  597  KFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCSGTA  418
            K + WNV  + SQ     V+ ++   K  ++ LLE      ++G+  +SL F+  C  T 
Sbjct  3    KILIWNVWGLNSQQKKKDVKVMLNNQKAGLVGLLETKVKAHNMGEVYLSL-FKGWCFTTN  61

Query  417  KIWVF*DRCLS*PLGHGYQIVSMRVTLPVIG----------NLMLSVVYASCERRVRQEL  268
              +   DR +       +QI  ++ T  +I               S+VYAS +   R+ L
Sbjct  62   SAFHKGDRIVLAWNPSSFQITILQCTSQLIHCMVKPVGSQYTFQCSIVYASNDANEREML  121

Query  267  WDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVY  88
            W ++E++         W + GD+NCIL+ +E+ G     +   R  Q  ++   L++   
Sbjct  122  WQVLESLG--NFIHTPWIVAGDYNCILKPDERIGANVRQQELER-LQIMVNRCNLQDMTS  178

Query  87   YGNDFTWWNGRRGSQAVWERLDRVLVN  7
             G+ +TW N ++G   V+ +LDR +VN
Sbjct  179  TGSRYTWNNKQQGENRVFCKLDRAMVN  205



>ref|XP_009615867.1| PREDICTED: uncharacterized protein LOC104108513 [Nicotiana tomentosiformis]
Length=212

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  219  WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            W I+GDFN I    EK GG PY  +KS +F + ++   L +  +YG+ +TW NG+     
Sbjct  20   WCIIGDFNVIASTGEKIGGVPYQMSKSFDFLSMMEDCGLVDLGFYGSRYTWSNGKGPGAI  79

Query  39   VWERLDRVLVNEN  1
            VW+RLDR L N+N
Sbjct  80   VWKRLDRGLANDN  92



>ref|XP_010506876.1| PREDICTED: uncharacterized protein LOC104783414 [Camelina sativa]
Length=300

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = -1

Query  321  LMLSVVYA-SCERRVRQELWDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYNK  148
            ++ S +YA +C+ R R +LWD IE +A     +G+ W  MGDFN  L   E   G     
Sbjct  8    VVFSFIYAVNCKYR-RHQLWDEIEKLAMDPTINGKPWVAMGDFNQTLNPSESSAGSTRIN  66

Query  147  AKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
                +F+ C+ +    +  Y GNDF WWN +  +  + ++LDR+L+N+N
Sbjct  67   KCMVDFRQCLLNVGFSDLSYRGNDFIWWNNQEAN-PLAKKLDRILINDN  114



>ref|XP_007026457.1| Uncharacterized protein TCM_021521 [Theobroma cacao]
 gb|EOY06959.1| Uncharacterized protein TCM_021521 [Theobroma cacao]
Length=1951

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 79/153 (52%), Gaps = 12/153 (8%)
 Frame = -1

Query  450   LGFENRCSGTA-KIWVF*DRCLS*P--LGHGYQIVSMRVTLPVIGNLMLS-VVYASCERR  283
             LGFE   S  + KIW+F    +     L H  Q + +++T+P + + + S +VYA C R+
Sbjct  905   LGFETVISNVSHKIWIFCSEEIGCEILLDH-VQYLHVKITVPWLSHPIFSSLVYAKCTRQ  963

Query  282   VRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRL  103
              R ELW+ + +++      G W + GDFN IL   E+  G   +     +F   +    L
Sbjct  964   ERLELWNCLRSISWDM--QGPWMVGGDFNSILSSAERLHGAHPHSGSMEDFATMLLDCGL  1021

Query  102   RESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
              ++ Y GN+FTW N       +++RLDRV+ N 
Sbjct  1022  LDAGYEGNNFTWTNNH-----MFQRLDRVVYNH  1049



>ref|XP_010468589.1| PREDICTED: uncharacterized protein LOC104748682 [Camelina sativa]
Length=203

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 58/107 (54%), Gaps = 2/107 (2%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMA-AREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
             ++S VYA   +   QELW+ I A++    V    W ++GDFN  L   +   G    K 
Sbjct  14   FVVSFVYAVNHQTGHQELWEEICALSRDHSVNSRPWVLLGDFNQTLNPADHSSGGTKIKK  73

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
               EF++C+  + L++    GN FTWWN ++ +  + ++LDRVL N+
Sbjct  74   GMEEFRDCLAYANLQDLTIRGNQFTWWN-KQETNPIAKKLDRVLAND  119



>ref|XP_008794416.1| PREDICTED: uncharacterized protein LOC103710479 [Phoenix dactylifera]
Length=1252

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -1

Query  318  MLSVVYASCERRVRQELWDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYN-KA  145
            + + VYAS + R R+ LW+     A++ V  G+   I GDFNCI   +EK GG+ ++ + 
Sbjct  12   IFAAVYASTDFRARRSLWE----EASKLVDQGQPMLIAGDFNCIDDPQEKMGGRSFSYQR  67

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            K REFQ  I ++ L +  + G  FTW N ++G   VWERLDR    
Sbjct  68   KVREFQEFISTNGLIDLGFTGPRFTWCNNQQGPARVWERLDRAFAT  113



>ref|XP_008798235.1| PREDICTED: uncharacterized protein LOC103713184 [Phoenix dactylifera]
Length=183

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 87/187 (47%), Gaps = 14/187 (7%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQF---------SVSL  448
            M+ + WN R  A    +   R LV+   P+I  L E       LG+          S ++
Sbjct  1    MRILAWNCRGAAKPAFMSSFRRLVQIHSPEICLLYETRLSGRGLGRAIRRFEVDWESYAV  60

Query  447  GFENRCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQEL  268
              +    G   +W      +     +  Q V M ++ P     +LS VYAS + R R+ L
Sbjct  61   DSQGLSGGIVALWKRGVATVD-VFHNCSQQVLMIISEPNAAPWVLSGVYASTDYRTRRVL  119

Query  267  WDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCIDSSRLRESV  91
            WD +  + A+ +     A++GDFNCIL G EK+GG+ + + A  REF++ +  + L +  
Sbjct  120  WDELTHLIAQGLPT---AMVGDFNCILAGSEKRGGRAFTDTADKREFRDFLLRNGLVDLG  176

Query  90   YYGNDFT  70
            + G  FT
Sbjct  177  FSGPQFT  183



>ref|XP_010681482.1| PREDICTED: uncharacterized protein LOC104896429 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 61/101 (60%), Gaps = 3/101 (3%)
 Frame = -1

Query  306  VYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQ  127
            VYA  ER  R+ELW  ++ MA R++ +G W + GDFNC+L  +E+ G Q  +       +
Sbjct  65   VYAFNERNRREELWQGLKEMA-RKI-NGPWLMGGDFNCVLHMDERIGAQ-VSSWDIEPIK  121

Query  126  NCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            +C+D   L +    GN FTW N + G+  V+ +LDRVL+N+
Sbjct  122  SCLDECDLYDMKCSGNRFTWNNKQEGNDRVFAKLDRVLIND  162



>ref|XP_011072308.1| PREDICTED: uncharacterized protein LOC105157594 [Sesamum indicum]
Length=437

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 2/126 (2%)
 Frame = -1

Query  378  LGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGD  202
            L  G Q +  R+T   + N ++++++Y + E   R++LW  +EA+A   V D  W + GD
Sbjct  26   LSSGSQFIHARITFRALHNPVIITIIYGANEVAARRDLWGTLEALALNCV-DSPWMVGGD  84

Query  201  FNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLD  22
            F+ +    E  G     +    EF +CI +S L      G  FTW N       +W+RLD
Sbjct  85   FDAVRDLSEVCGTSGDIRMAMEEFNSCIQNSGLLPLPMQGEWFTWHNYSASPCNLWKRLD  144

Query  21   RVLVNE  4
            R+L N+
Sbjct  145  RILTND  150



>gb|AAM82604.1|AF525305_2 putative AP endonuclease/reverse transcriptase [Brassica napus]
Length=1214

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 74/146 (51%), Gaps = 4/146 (3%)
 Frame = -1

Query  429  SGTAKIWVF*DRCLS*P-LGHGYQIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLI  256
            +   +IWV  D  +    L    Q +S  V LP I    +++ VYA   R  R+ LW  +
Sbjct  65   AALGRIWVVWDPAVEVTVLSKSDQTISCTVKLPHISTEFVVTFVYAVNCRYGRRRLWSEL  124

Query  255  EAMAAREV-GDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            E +AA +   D  W I+GDFN  L   +   G         EF+ C+ +S + +  + GN
Sbjct  125  ELLAANQTTSDKPWIILGDFNQSLDPVDASTGGSRITRGMEEFRECLLTSNISDLPFRGN  184

Query  78   DFTWWNGRRGSQAVWERLDRVLVNEN  1
             +TWWN +  +  + +++DR+LVN++
Sbjct  185  HYTWWNNQE-NNPIAKKIDRILVNDS  209



>ref|XP_008348238.1| PREDICTED: uncharacterized protein LOC103411380 [Malus domestica]
Length=1384

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 88/207 (43%), Gaps = 13/207 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP---FKDLSHLGQFSVSLG---FE  439
            MK + WN+R + +  S   + N+ R   P ++C+ EP   F  +S     S++L    F 
Sbjct  1    MKVLFWNIRGIGNDDSRXELSNICRLHHPBLVCIXEPMVXFNSISAAYWDSLNLSXLTFN  60

Query  438  NRCSGTAKIWVF*DRCLS*PL--GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
            +R +    +W+      + PL      Q V++R T   I +     VYAS     R++LW
Sbjct  61   SRGTLAPNLWLLTXSACADPLVISISDQQVTVRCTFDHIPS-QFXFVYASTSPIKRRDLW  119

Query  264  -DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVY  88
             D I       V       +GDFN IL   E  GG   ++    +F N  D+        
Sbjct  120  ADFISLXPQTXVXX---MAIGDFNAILGAHEXXGGGRPSQXSXXQFXNXSDTCNFTHLNT  176

Query  87   YGNDFTWWNGRRGSQAVWERLDRVLVN  7
             G  FTW NG R       RL+R L +
Sbjct  177  SGAAFTWSNGWRSRGRTERRLBRSLCD  203



>ref|XP_010683802.1| PREDICTED: uncharacterized protein LOC104898414 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 96/209 (46%), Gaps = 17/209 (8%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            M  + WNVR +A        R L++   P ++ L E +            LGF++     
Sbjct  1    MNVLFWNVRGLARPSFKPNFRLLMQHHYPSLVVLAEAWVGREKTDAIIADLGFDSWHLLE  60

Query  435  ---RCSGTAKIWV--F*DRCLS*PLGHGYQIVSMRVTL-PVIGNLMLSVVYASCERRVRQ  274
                  G   +W     D  +   +G G Q V   V +     + + + +YAS +  +RQ
Sbjct  61   PDGFVGGILLLWKSHIMDFHV---IGEGAQGVYGVVEVHSTKTSFVFTSIYASPKFHIRQ  117

Query  273  ELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRES  94
             LW  +E  A   +G   W ++GDFN ++   EK GG+P ++ K+  F + +D+ +L + 
Sbjct  118  NLWHELENFA-NNLGKP-WYVIGDFNDVVNQSEKLGGRPVSRRKADLFASTMDNCQLVDL  175

Query  93   VYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             + G  FTW N +R    ++ERLDR   N
Sbjct  176  GFNGPKFTWTN-KRKVNPIFERLDRGWAN  203



>ref|XP_010690182.1| PREDICTED: uncharacterized protein LOC104903769 [Beta vulgaris 
subsp. vulgaris]
Length=336

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 94/205 (46%), Gaps = 17/205 (8%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFE------  439
            M  + WNVR ++    +   R L++Q  P ++ L+E +            LG +      
Sbjct  1    MTVLFWNVRGISRPSFIPNFRMLMQQHNPSVVVLVETWVSRVRTASIVEGLGMDAWHLVE  60

Query  438  --NRCSGTAKIW---VF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQ  274
                  G   +W   +   + +       + ++ +R T     + + S +YAS   R+R+
Sbjct  61   PIGFTGGILLLWKSDIVDFQVIEDCAQGVHGVMEVRAT---SKSFVFSAIYASPRFRMRK  117

Query  273  ELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRES  94
             LW+  E ++     D  W ++GDFN I+   EK GG+  +  +S+ F + I++  L + 
Sbjct  118  MLWE--ELLSLSSNLDKSWLLLGDFNDIINENEKMGGRKISYRRSKLFSDAINNCNLIDM  175

Query  93   VYYGNDFTWWNGRRGSQAVWERLDR  19
             + G  FTW N  R +  +++RLDR
Sbjct  176  GFIGPRFTWTNN-RSTNPIYQRLDR  199



>ref|XP_009136057.1| PREDICTED: uncharacterized protein LOC103860217 [Brassica rapa]
Length=1312

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 72/125 (58%), Gaps = 4/125 (3%)
 Frame = -1

Query  366  YQIVSMRVTLP-VIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGR-WAIMGDFNC  193
            ++++++ +T P    NL++SV+YA  +   R   W  I ++A+ +V D + W I+GDFN 
Sbjct  312  FEMITVEITWPHSQSNLIISVIYAFNDVDERAIFWAEISSLASLQVLDSKPWMILGDFNQ  371

Query  192  ILRGEEKKGGQPYNKAKS-REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRV  16
            +    E    +  N  K  R+F  C+ ++ + +  + G  FTWWN ++ S  + ++LDR 
Sbjct  372  VREPAEHSKPKSLNLDKRMRDFNQCLLNANVDDLNFRGTSFTWWNKQKNS-PIAKKLDRC  430

Query  15   LVNEN  1
            LVN++
Sbjct  431  LVNDD  435



>ref|XP_009594094.1| PREDICTED: uncharacterized protein LOC104090648 [Nicotiana tomentosiformis]
Length=179

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  219  WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            W + G FN +L  EEK GG      +  +F  C++S  L ++ Y G+ FTWWNGR  ++ 
Sbjct  5    WLVGGYFNVVLNEEEKIGGLLVYLPEYEDFAFCVNSCGLFDTGYKGSPFTWWNGRSNAEC  64

Query  39   VWERLDRVLVNE  4
            +++RLDR+ VN+
Sbjct  65   IFKRLDRIFVNQ  76



>ref|XP_009600461.1| PREDICTED: uncharacterized protein LOC104095915 [Nicotiana tomentosiformis]
Length=423

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 4/128 (3%)
 Frame = -1

Query  381  PLGHGYQIVSMRVT-LPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMG  205
            PL    Q++S  V  +P+     +S VYA   +  R+ LW+ +E   AR      W ++G
Sbjct  83   PLSMNAQVLSFEVYYIPLQVTFGVSFVYAFNTKEERRGLWEYLEEHVAR--CKRPWLVIG  140

Query  204  DFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERL  25
            DFN +L  E++ GG P + A+  EF  CI++  L E    G  ++ WN R   Q ++ ++
Sbjct  141  DFNSVLNMEDRIGGNPVSWAEVVEFNKCIEACGLIELPNQGCRYS-WNDRHSDQRIYSKI  199

Query  24   DRVLVNEN  1
            D  LVN +
Sbjct  200  DWALVNND  207



>ref|XP_007017130.1| Uncharacterized protein TCM_042329 [Theobroma cacao]
 gb|EOY34749.1| Uncharacterized protein TCM_042329 [Theobroma cacao]
Length=2606

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 79/152 (52%), Gaps = 12/152 (8%)
 Frame = -1

Query  450   LGFENRCSGTA-KIWVF*DRCLS*P--LGHGYQIVSMRVTLPVIGNLMLS-VVYASCERR  283
             LGFE   S  + KIW+F    +     L H  Q + +++T+P + + + S +VYA C R+
Sbjct  905   LGFETVISNVSHKIWIFCSEEIGCEILLDH-VQYLHVKITVPWLSHPIFSSLVYAKCTRQ  963

Query  282   VRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRL  103
              R ELW+ + +++      G W + GDFN IL   E+  G   +     +F   +    L
Sbjct  964   ERLELWNCLRSISWDM--QGPWMVGGDFNSILSSAERLHGAHPHSGSMEDFATMLLDCGL  1021

Query  102   RESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              ++ Y GN+FTW N       +++RLDRV+ N
Sbjct  1022  LDAGYEGNNFTWTNNH-----MFQRLDRVVYN  1048



>ref|XP_009619303.1| PREDICTED: uncharacterized protein LOC104111332 [Nicotiana tomentosiformis]
Length=187

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  219  WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            W + G+FN IL  +EK GG P       +F  CI+SS L +  Y G  FTWWNGR  ++ 
Sbjct  5    WMVGGNFNVILHEDEKIGGLPVYPPVYEDFAFCINSSGLFDLGYNGIPFTWWNGRSNAEY  64

Query  39   VWERLDRVLV  10
            +++RLD +L+
Sbjct  65   IFKRLDMILL  74



>ref|XP_010436877.1| PREDICTED: uncharacterized protein LOC104720698 [Camelina sativa]
Length=881

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 65/109 (60%), Gaps = 3/109 (3%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            +++S+VYAS E R R+E W +L++   ++ V +  W +MGDFN +L   +       N  
Sbjct  59   VVVSIVYASNEVRQRKEFWAELVDLSTSQHVANRAWLVMGDFNQVLDPTDHPQPVTLNAD  118

Query  144  KS-REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            +  REF+ C+ S+ L +  + GN FTW N +   + V ++LDRVLVN +
Sbjct  119  RRIREFRECLISADLADLTFRGNSFTWSN-KSKLRPVAKKLDRVLVNSH  166



>ref|XP_009628669.1| PREDICTED: uncharacterized protein LOC104118986 [Nicotiana tomentosiformis]
Length=380

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 2/105 (2%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAK  142
             +L++VYA C+   R ELWD +  +A R++    W +  DFN I   EEK GG P +  +
Sbjct  18   FILTLVYAKCDHIERIELWDSLYYLA-RDMTIP-WLVEDDFNVIWDEEEKFGGLPVSLNE  75

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              +F +C+D+  L +     + + WWN R     +++RLDRV  N
Sbjct  76   VDDFMHCMDTCNLTDMGLKESIYNWWNERAEEDCIFKRLDRVFAN  120



>ref|XP_008788892.1| PREDICTED: uncharacterized protein LOC103706536 [Phoenix dactylifera]
Length=407

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 93/213 (44%), Gaps = 30/213 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHL-----------GQFSV  454
            MK + WN R           R LV    P +  LLE     S L           G ++V
Sbjct  1    MKVLLWNCRGAGKPSFRSAFRRLVSLHDPDVCVLLETRLSGSSLERARRAIPRSWGTYAV  60

Query  453  -SLGFENRCS-----GTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASC  292
             S G           G   I VF  +C         Q V + ++  V    +L   YAS 
Sbjct  61   DSRGLSGGIIVLWRLGGVGIDVF-HKC--------NQQVILVISEGVGPPWVLLATYAST  111

Query  291  ERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPY-NKAKSREFQNCID  115
              R R+ LW+  EA    ++G     + GDFNCI   E+K+GG+ + N  + REFQ+ I 
Sbjct  112  NYRERRVLWE--EATNLIQLGHPV-MMAGDFNCIDSPEDKRGGKVFSNNIEVREFQDFIQ  168

Query  114  SSRLRESVYYGNDFTWWNGRRGSQAVWERLDRV  16
            S+ L +  + G  FTW N R G   VWER+DRV
Sbjct  169  SNGLADLGFTGPRFTWCNNRLGMARVWERIDRV  201



>ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica]
 gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica]
Length=1499

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 96/211 (45%), Gaps = 22/211 (10%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDL-----------SHLGQ--F  460
            MK I WN+R + S+     V+  +R+ KP I+ LLE  K++           S   +  F
Sbjct  323  MKIISWNIRGLGSRRKRLLVKEQLRRLKPDIVILLETKKEIVDRQLVAGVWGSRFKEWVF  382

Query  459  SVSLGFENRCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRV  280
            S SLG   R  G A +W      +   +   +  VS+R+   +  +  LS +Y  C +R 
Sbjct  383  SPSLG---RSGGIAVLWNSQSVSVIDSMVGEFS-VSIRIEENIGTDWWLSGIYGPCRQRE  438

Query  279  RQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLR  100
            R   W+ +  +     GD  W + GDFN +    EK       K+  R+F + I  + LR
Sbjct  439  RNSFWEELADLYGY-CGD-MWCLGGDFNVVRFSAEKSNEGRVTKSM-RDFNDFIQETNLR  495

Query  99   ESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            + +     FTW N R    AV  RLDR LV+
Sbjct  496  DPILLNASFTWSNLRE--NAVCRRLDRFLVS  524



>ref|XP_010669053.1| PREDICTED: uncharacterized protein LOC104886290, partial [Beta 
vulgaris subsp. vulgaris]
Length=360

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAK  142
            ++ + VY       R+ LW+ I  +    + D  W +MGDFN +L  +++  G P + A+
Sbjct  104  MLFTAVYGMHSIDDRKPLWNTIHNLDNNVMID--WIVMGDFNSVLCSDDRINGIPISNAE  161

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
            + +F + +D++ L E    G+ FTW N R+G + ++ R+DR L N
Sbjct  162  TSDFCHLLDTTTLLEVKGIGDFFTWSNKRQGEERIYSRIDRCLCN  206



>emb|CCA66020.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1365

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 93/213 (44%), Gaps = 18/213 (8%)
 Frame = -1

Query  600  MKFICWNVREV--ASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCS  427
            MK + WN R +  A   ++  +  LVRQ  P+IL L E   D S + + ++ LGF N  +
Sbjct  1    MKVLAWNCRGLRSADSPTIPFLGWLVRQCLPQILFLSETKSDSSLISKLAMYLGFPNVAT  60

Query  426  --------GTAKIW---VF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRV  280
                    G A  W   V  D  +S        I  +      I NL+L  +Y S     
Sbjct  61   VDSINNAGGLALFWSNDVNLDLKVSSTNYFACNINDLVDEDVYIWNLIL--LYGSPYLDN  118

Query  279  RQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLR  100
            R E+W+ I    +R   D    IMGDFN I    +K GG  Y   K   F    D   L 
Sbjct  119  RGEVWERIADYISRNPLDS--VIMGDFNQIEFLNQKMGGSTYIPGK-ETFSQWRDQLGLS  175

Query  99   ESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            E  + G +FTW N R   + V+ERLDR    E+
Sbjct  176  EINFQGQNFTWCNNRSEPERVYERLDRAYATED  208



>ref|XP_010501556.1| PREDICTED: uncharacterized protein LOC104778826 [Camelina sativa]
Length=900

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -1

Query  363  QIVSMRVTLP-VIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGR-WAIMGDFNCI  190
            Q+++  V +P     ++ S +YA   +  RQ+LWD IE +A   +   + W  MGDFN  
Sbjct  558  QMITCIVRMPNSPKEVVYSFIYAVNCKYGRQQLWDEIEELAKDPIISLKPWVAMGDFNQT  617

Query  189  LRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLV  10
            L   E   G         EF++C+ ++ L +    GN  TWWN R  +  V ++LDR+LV
Sbjct  618  LNPSESSIGSTKVTKGMLEFRSCLLNAGLFDLTTRGNSLTWWNKREANPIV-KKLDRILV  676

Query  9    NEN  1
            N+N
Sbjct  677  NDN  679



>ref|XP_009624266.1| PREDICTED: uncharacterized protein LOC104115358 [Nicotiana tomentosiformis]
Length=132

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -1

Query  228  DGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRG  49
            D  W + G FN IL  EEK GG   +  K  +F  C++S  L +  Y  + FTWWNGR  
Sbjct  2    DLPWVVGGYFNVILSEEEKIGGLSVHPPKYEDFSFCVNSCGLFDLGYTSSLFTWWNGRAN  61

Query  48   SQAVWERLDRVLVNE  4
            ++ +++ LDR+ +N+
Sbjct  62   AECIFKWLDRIFINQ  76



>ref|XP_009788999.1| PREDICTED: uncharacterized protein LOC104236712 [Nicotiana sylvestris]
Length=321

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 72/146 (49%), Gaps = 5/146 (3%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PLGHGY-QIVSMRVTLPVIG  325
            +EPF+    + ++   L  E   +    +IW+F D  +   LG    Q V++RV     G
Sbjct  1    MEPFQKKRLIDRYRRRLNMETAYANINGQIWLFFDAMVEWELGEDTEQQVTVRVLHHEQG  60

Query  324  -NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNK  148
             ++M++ VYA C    R ELWD +  +A+       W + GDFN IL  EEK  G   + 
Sbjct  61   QHMMMTFVYAKCSAMERLELWDHLYYLASD--MKLEWLVGGDFNVILHEEEKTRGLLVHP  118

Query  147  AKSREFQNCIDSSRLRESVYYGNDFT  70
             K  +F  C++S  L E  Y G+ FT
Sbjct  119  PKYEDFAFCVNSCGLFEQGYKGSPFT  144



>ref|XP_006591584.1| PREDICTED: uncharacterized protein LOC102666004 [Glycine max]
Length=314

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 101/207 (49%), Gaps = 16/207 (8%)
 Frame = -1

Query  594  FICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLG--------FE  439
             + WNVR +        V + +R F   I+ LLE    + +  +    +G        ++
Sbjct  1    MVSWNVRGINKVARNKEVSSYLRTFHVPIVALLETRVKMKNANRIRNKIGGRWNYMDNYD  60

Query  438  NRCSGTAKIWVF*D-RCLS*PLGH-GYQIVSMRV-TLPVIGNLMLSVVYASCERRVRQEL  268
               +G  +IW+  D R ++  L   G Q + + V +L      +  V+YA  +   R+EL
Sbjct  61   KHENG--RIWLLWDHREVNLKLIQTGEQFIHVEVYSLDQSLMYVALVIYAFNQLDRRKEL  118

Query  267  WDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVY  88
            W+ IE +      +G W ++GDFN IL  ++K GG    +A+ R+ +N + +  L E+  
Sbjct  119  WNKIEDIGINL--NGPWIVIGDFNNILAYQDKIGGNHVVEAEFRDLKNMMSNMGLFEADM  176

Query  87   YGNDFTWWNGRRGSQAVWERLDRVLVN  7
             GN +TW N +  +  ++ R+DRV+ N
Sbjct  177  KGNHYTWSN-KHIADVIYSRIDRVIGN  202



>gb|AAC28221.1| similar to reverse transcriptases (PFam: rvt.hmm, score: 60.13) 
[Arabidopsis thaliana]
Length=1164

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 3/108 (3%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAARE-VGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            ++LS VYAS +   RQ LW+ I   +    V D  W ++GDFN IL   E      +N  
Sbjct  1    MVLSFVYASTDEVTRQILWNEIVDFSNDPCVIDKPWTVLGDFNQILHPSEHSTSDGFNVD  60

Query  144  K-SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            + +R F+  I  + L +  + GN FTWWN +R    V ++LDR+LVN+
Sbjct  61   RPTRIFRETILLASLTDLSFRGNTFTWWN-KRSRAPVAKKLDRILVND  107



>ref|XP_010677721.1| PREDICTED: uncharacterized protein LOC104893322 [Beta vulgaris 
subsp. vulgaris]
Length=710

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 7/121 (6%)
 Frame = -1

Query  366  YQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCI  190
            Y +VS + +        LS+VY   ++  R ELW DLI+   +R+V + +W +MGDFN +
Sbjct  104  YGVVSHKASR---AQFCLSLVYGHNDKEKRSELWNDLIKC--SRDVMNTQWVVMGDFNNV  158

Query  189  LRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLV  10
            L   E+ G QP   ++   F+NC+DS  L +    G  +TW N ++    V    DRVLV
Sbjct  159  LNLNERIG-QPNLFSEIERFRNCVDSCGLDDVKMTGPFYTWSNKQQEEDYVATEFDRVLV  217

Query  9    N  7
            N
Sbjct  218  N  218



>ref|XP_007220765.1| hypothetical protein PRUPE_ppa026078mg, partial [Prunus persica]
 gb|EMJ21964.1| hypothetical protein PRUPE_ppa026078mg, partial [Prunus persica]
Length=400

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 53/104 (51%), Gaps = 2/104 (2%)
 Frame = -1

Query  312  SVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSRE  133
            + VYA  ++  +++LW  I+ +  +      W +MGDFN +    EK GG     +   +
Sbjct  206  TFVYAYPQKHKQKQLW--IDILGLKPTASEAWILMGDFNNVCTPSEKLGGSISLPSAMAD  263

Query  132  FQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            F   I+ S        G  FTW NG R +  ++ERLDRVL+N N
Sbjct  264  FNGFINDSETISLNAAGIPFTWCNGHRDNSVIYERLDRVLLNPN  307



>ref|XP_011081473.1| PREDICTED: uncharacterized protein LOC105164519 [Sesamum indicum]
Length=431

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 84/174 (48%), Gaps = 16/174 (9%)
 Frame = -1

Query  510  ILCLLEPFKDLSHLGQFSVSLGFENRCSGTA-KIWVF*DRCLS*PLGHGY-QIVSMRV--  343
            +L LLEPF  L  +  F+    F +  S +  KIW F    +   +   + Q + ++V  
Sbjct  1    MLILLEPFVQLDAV-YFTRKFAFHSVFSNSNNKIWCFAKLGVDIQIIQDHTQFLHVKVNS  59

Query  342  -TLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKG  166
              LP   ++  + +YA C R  R+ LWD +  ++ + V    W I GDFN IL   E +G
Sbjct  60   GALP--EDIFCTFIYAKCYRTPRRILWDELTRISHQTVP---WLIGGDFNAILLPNENQG  114

Query  165  GQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            G         +F + +  + L ++ + G  FTW N R     VW RLDRVL ++
Sbjct  115  GDMRRIGSMDDFNDMMFDTGLIDAGFEGEPFTWTNNR-----VWRRLDRVLYSK  163



>ref|XP_009778879.1| PREDICTED: uncharacterized protein LOC104228170 [Nicotiana sylvestris]
Length=273

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -1

Query  246  AAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTW  67
            AA  + +G WA+MGDFNCIL   +K+ G P   ++ R+F+ C++   L++     + FTW
Sbjct  48   AALNLCNGPWAVMGDFNCILH-RDKRIGIPVTMSEIRKFKQCVEECTLQDMKSSRSFFTW  106

Query  66   WNGRRGSQAVWERLDRVLVN  7
             N + G+  V+ R+DRVLVN
Sbjct  107  NNKQGGADRVYSRIDRVLVN  126



>ref|XP_010424048.1| PREDICTED: uncharacterized protein LOC104709079 [Camelina sativa]
Length=356

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 2/106 (2%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAARE-VGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            ++ S +YA   +  RQ+LW  IE +A    +    W +MGDFN  L  +E   G      
Sbjct  8    VVYSYIYAVNCKYGRQQLWREIEELAKDTMICSKPWVVMGDFNQTLSPQESYVGCTRITK  67

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              REF+ CI+++ L +    GN  TWWN +R +  + ++LDRVLVN
Sbjct  68   GMREFRQCIENAELTDLAIRGNALTWWN-KREANPIAKKLDRVLVN  112



>ref|XP_009613071.1| PREDICTED: uncharacterized protein LOC104106272 [Nicotiana tomentosiformis]
Length=372

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 4/122 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVI-GNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCIL  187
            Q+V+  VT   +    M+++VYA   +  R+ LW  ++ ++ R +G   W +MGDFN +L
Sbjct  89   QVVTCEVTHNSLQATFMMTIVYAFNTKEDRRSLWSYLDVVS-RSMGSP-WIVMGDFNSVL  146

Query  186  RGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              E+  GG     A+  EF  CI+   L E    G+ +T WN R G   +  ++D V +N
Sbjct  147  HIEDGVGGNFITMAEIAEFHQCIEECALVELPTSGSRYT-WNDRHGDSRILSKIDWVFIN  205

Query  6    EN  1
             +
Sbjct  206  TD  207



>gb|KEH36675.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=230

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 85/206 (41%), Gaps = 12/206 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            M  I  N R + S  ++  ++ LVR +KP IL L E     + + +F   LGF N     
Sbjct  1    MSVISLNCRGLGSPSAVPNLKYLVRFYKPSILFLSETLVYRNKIEEFHYVLGFSNCFAVD  60

Query  435  ---RCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
               R  G A  W     C    + +    + + +     G   L+  Y       R+  W
Sbjct  61   RVGRSGGLAFYWNSSLNCQI--INYSQNHIIVEIIDNEKGPWRLTGYYGYPNGGRRRASW  118

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
            D I  ++ +      W I GDFN I+   EK+G   ++      F+  +  S L +    
Sbjct  119  DFIRQLSCQS--PLPWCIFGDFNDIMDASEKRGRTTHSNWLINGFRLTVIDSGLSDVRMD  176

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVN  7
            G  FTW+      +AV ERLDR L N
Sbjct  177  GYPFTWFKSLGTPRAVEERLDRALAN  202



>ref|XP_009762468.1| PREDICTED: uncharacterized protein LOC104214497 [Nicotiana sylvestris]
Length=439

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 63/110 (57%), Gaps = 7/110 (6%)
 Frame = -1

Query  327  GNLML---SVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQP  157
            GN M+   ++VY   +  +R+ LW+ I+ +   E   G WA+MG FNC+L  E+   G  
Sbjct  299  GNRMVFAVTIVYGFNDAALRKSLWEEIKKI--NEQMRGPWAVMGYFNCVLNREDM--GSQ  354

Query  156  YNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
               ++ R+F+NC++   L+E    G  +TW N +R    V+ R+DRVL+N
Sbjct  355  VRMSEIRDFKNCVEECELQEMKSSGAFYTWNNKQRSEDRVYSRIDRVLIN  404



>ref|XP_007026458.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
 gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
Length=3503

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 8/120 (7%)
 Frame = -1

Query  363   QIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCIL  187
             Q + +R+T+P +   +  + VYA C R  R  LWD +  +AA    +G W + GDFN IL
Sbjct  2557  QCLHVRLTIPWLDFPIFTTFVYAKCTRSERTPLWDSLRGLAADM--EGPWLVGGDFNVIL  2614

Query  186   RGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             + EE+  G   ++    +F + +    L +  + GN FTW N R     +++RLDR++ N
Sbjct  2615  KREERLYGADPHEGSMEDFASALLDCGLLDGGFEGNPFTWTNNR-----MFQRLDRMVFN  2669


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 10/116 (9%)
 Frame = -1

Query  348  RVTLPVIGN-LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEK  172
            + TLP + + +  S VYA C R+ R ELW+ + +++    G   W + GDFN IL   E+
Sbjct  780  KFTLPWLSHPIFSSFVYAKCTRQERIELWNFLRSVSWDMYGP--WMVGGDFNSILSSAER  837

Query  171  -KGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              G  P+N     +F   +    L ++ Y GN+FTW N       +++RLDRV+ N
Sbjct  838  LHGANPHN-GSMEDFATMLLDCGLHDAGYEGNNFTWTNNH-----MFQRLDRVVYN  887



>ref|XP_008780097.1| PREDICTED: uncharacterized protein LOC103699880, partial [Phoenix 
dactylifera]
Length=205

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 4/102 (4%)
 Frame = -1

Query  318  MLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN-KAK  142
            +L+ VYAS +   R+ LW+    + ++        + GDFNCI    EK GG+ +  K +
Sbjct  103  VLAAVYASTKFIERRILWEETSQLISQGY---PMLVAGDFNCIAHPHEKMGGRAFTYKRE  159

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRV  16
             REFQ+ I  + L +  + G  FTW N ++G   VWERLDRV
Sbjct  160  IREFQDFIMENGLIDLGFSGPKFTWCNNQQGQPRVWERLDRV  201



>ref|XP_011074610.1| PREDICTED: uncharacterized protein LOC105159297 [Sesamum indicum]
Length=347

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 97/207 (47%), Gaps = 9/207 (4%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP---FKDLSHLGQFSVSLGFENRC  430
            M    WNVR +  +     V++++ +F+ + L LLE    F +++ +  F +        
Sbjct  1    MNAAIWNVRGLNKRDHQLAVKDIIAEFRLQFLGLLETRVRFNNVAAIQSFLLPQWKWFMD  60

Query  429  SGTAKIWVF*---DRCLS*PLGH-GYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELW  265
             G    WV+    D  L   +   G Q +   V +  +  ++ L+V+Y + E   R+ELW
Sbjct  61   YGLVGNWVWIAWDDNFLDVDVVECGTQFIQCLVFIRSLHESVALTVIYGASEVADRRELW  120

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
              +E +A + V D  W I GDFN +    E  G     +    EF  CI ++RL      
Sbjct  121  GALETIAMQNV-DVPWLIGGDFNAVRDLSEVCGASGDIRMAMEEFNCCIQNARLLPLPMQ  179

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNE  4
            G  +TW N     + +W+RLDR+L+N+
Sbjct  180  GEWYTWHNCSTNPRNLWKRLDRILIND  206



>ref|XP_010490225.1| PREDICTED: uncharacterized protein LOC104767965 [Camelina sativa]
Length=259

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 95/211 (45%), Gaps = 22/211 (10%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            M+ I WN + V ++ +  R+R L R + P  L L E   D  +L    V LGF+N     
Sbjct  1    MRTIAWNCQGVGAKLTRRRLRELCRIYSPGFLFLSETKNDNFYLQDVQVELGFDNLRTVE  60

Query  435  ---RCSGTAKIWVF*DRCLS*PLGHGYQIVSMR-VTLPVIGN---LMLSVVYASCERRVR  277
                  G A ++       S      + ++  R + +  I N   + ++ +Y       R
Sbjct  61   PDGSSGGLALLY-------SNDFPVKFLLLDDRLIDIETIINGTRVFMTFIYGDPVPANR  113

Query  276  QELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRE  97
              +W+ +  +         W I+GDFN I    EK+GG+  +++    F+  IDS  L +
Sbjct  114  DYVWERLMRIGVARCEP--WFIIGDFNEITGNHEKRGGKKRSESSFLPFRVMIDSCGLID  171

Query  96   SVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
              Y GN F+W  G+R +  +  RLDR + NE
Sbjct  172  FSYQGNQFSWI-GQRSNGKIRCRLDRAMGNE  201



>ref|XP_010683368.1| PREDICTED: uncharacterized protein LOC104898060 [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 94/206 (46%), Gaps = 12/206 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRC---  430
            MK + WN + + +  +++ +R    + +P ++ L+E   D S L +     GF N     
Sbjct  1    MKILSWNCQGLGNPWTVNALREWCWRERPNVVFLMETMIDASKLERIRNICGFVNGVCVS  60

Query  429  ----SGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSV-VYASCERRVRQELW  265
                SG    W + D  LS P  +     S  +       +  +V VY   E   + + W
Sbjct  61   SDGRSGGMGFW-WRDVNLS-PANYSAHHFSADIRDHNNNIVWRAVGVYGWPESEHKHKTW  118

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
             ++E +  +   D    + GDFN I+   EK+GG P ++     F+N ID   LR+  Y 
Sbjct  119  TMMETI--KHSSDVPCVMFGDFNEIVCQSEKEGGVPRSERAMDAFRNAIDGCGLRDLGYK  176

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVN  7
            G+ FTW  G   +  V ERLDRVL +
Sbjct  177  GSRFTWKRGNNPNTFVRERLDRVLAD  202



>emb|CDX94387.1| BnaC01g17970D [Brassica napus]
Length=787

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/143 (30%), Positives = 71/143 (50%), Gaps = 5/143 (3%)
 Frame = -1

Query  420  AKIWVF*DRCLS*PLGH-GYQIVSMRVTLPVIG-NLMLSVVYASCERRVRQELWDLIEAM  247
             KIW+     +S  + H   Q +S  V LP++  +   ++VY S  R VR++LW  +  +
Sbjct  600  GKIWLLWHPSVSVSVCHKSLQSISCIVKLPLVSSDFAATMVYGSNIRIVRKQLWSDLRFL  659

Query  246  AAREVGDGR-WAIMGDFNCILRGEEKKGGQPYNKAKS-REFQNCIDSSRLRESVYYGNDF  73
            A       R W ++GDFN  L   E      ++     REF  C+ S+ L      GN  
Sbjct  660  AVSSHTRNRPWTVLGDFNQTLFPSEHSSADQFSSPLGMREFSKCVTSAELSHMPCIGNSS  719

Query  72   TWWNGRRGSQAVWERLDRVLVNE  4
            TW N ++G   + ++LDR+++N+
Sbjct  720  TWSN-KQGDTLISKKLDRIMIND  741



>ref|XP_002445372.1| hypothetical protein SORBIDRAFT_07g013775 [Sorghum bicolor]
 gb|EES14867.1| hypothetical protein SORBIDRAFT_07g013775 [Sorghum bicolor]
Length=589

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 82/187 (44%), Gaps = 13/187 (7%)
 Frame = -1

Query  537  NLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN--------RCSGTAKIWVF*DRCLS*  382
            N  R   P ++ L E   D   +    + LGFEN        +  G A +W    R +  
Sbjct  268  NCQRSVSPDMMLLSETKSDEKRMRVLRMKLGFENMEVVDCVGKGGGLAVLW---RRGVDV  324

Query  381  PL-GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMG  205
             L       + M V+         + +Y   +  ++ + W L++ +AA+   +  W   G
Sbjct  325  VLRSKSKNHIDMEVSETRGNPWRFTGIYGEPQEAMKWKTWQLLQDLAAQHQNNQAWLCAG  384

Query  204  DFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGR-RGSQAVWER  28
            DFN +L   EK+GG P  +     F+  ++ S L +  + GN FTW N + +G   + ER
Sbjct  385  DFNEVLYQHEKEGGVPRPQNSMDRFKQALEVSELHDLGFEGNVFTWRNKQSKGESHIRER  444

Query  27   LDRVLVN  7
            LDR + N
Sbjct  445  LDRAVAN  451



>ref|XP_008776718.1| PREDICTED: uncharacterized protein LOC103696782, partial [Phoenix 
dactylifera]
Length=261

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 67/126 (53%), Gaps = 5/126 (4%)
 Frame = -1

Query  372  HGY-QIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFN  196
            H Y Q V++ V+       +LSVVYAS + R R+ +W+ +  +  +        + GDFN
Sbjct  115  HNYNQQVTLVVSEGTEPPWVLSVVYASIDYRERRMVWEEMTRLVQQGYPT---LVAGDFN  171

Query  195  CILRGEEKKGGQPY-NKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDR  19
             I   EEK G + + NK + REFQ+ +  S + +  Y G+ FTW N R G   VWER+DR
Sbjct  172  YIDGLEEKCGRKAFTNKIEVREFQDFLLGSGMVDLGYSGSRFTWCNNRAGRARVWERIDR  231

Query  18   VLVNEN  1
                 N
Sbjct  232  AFATSN  237



>ref|XP_010039464.1| PREDICTED: uncharacterized protein LOC104428159 [Eucalyptus grandis]
Length=813

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 95/208 (46%), Gaps = 15/208 (7%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            MK + WN + + S  ++  +R LV   +P+++ L+E     + + +    L F+      
Sbjct  1    MKVLSWNCQGLGSALTVQHLRALVALDRPELVFLMETKNRKAVVDRVRQQLKFKESFIID  60

Query  435  ---RCSGTAKIWVF*DRCLS*PLG-HGYQIVSMRVTLPVIGNLM-LSVVYASCERRVRQE  271
                  G   +W   +  L   +  H  +++ +    P  G LM +S ++AS + + R  
Sbjct  61   PIGTAGGLTAMW---NEDLKVEVKEHSNELIDIICRDPTSGTLMRISFLHASTDFQKRIC  117

Query  270  LWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESV  91
            LW  + A+         W  MGDFN +L   EK+GGQ  +  +   F+  ++   L +  
Sbjct  118  LWQKLRAI--HHSNSLPWICMGDFNEVLNFWEKEGGQGMDHYRMVAFREVLNDCALMDIE  175

Query  90   YYGNDFTWWNGRRGSQAVWERLDRVLVN  7
              G  +TW N R G   V ERLDRVL N
Sbjct  176  SKGCAYTWSNNRGGENLVRERLDRVLCN  203



>gb|KEH19175.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=493

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 2/102 (2%)
 Frame = -1

Query  306  VYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQ  127
            VYAS     R++LWD ++ +  ++  +  W  MGDFN IL   E++     ++   ++FQ
Sbjct  52   VYASNCLTKRRQLWDTLKNI--QDTINLPWCCMGDFNTILGAHEQRSNYRPSQVAMQDFQ  109

Query  126  NCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            N  DS+ L      G D+TW NGRRG   +  RLDR + N++
Sbjct  110  NWTDSNNLIHIHTRGADYTWLNGRRGRFNIQRRLDRAICNQD  151



>ref|XP_009112993.1| PREDICTED: uncharacterized protein LOC103838310 [Brassica rapa]
Length=1625

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -1

Query  363  QIVSMRVTLP-VIGNLMLSVVYASCERRVRQELWDLIEAMAAREVGD-GRWAIMGDFNCI  190
            Q+++  V LP     +++SVVYA+     R +LW  IE ++         W ++GDFN  
Sbjct  502  QMITCEVLLPDATSWILVSVVYAANFEDTRLQLWHEIEEVSVYNCNRLAPWIVLGDFNQT  561

Query  189  LRGEEKKGGQPYN-KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
                E       N   K+REF+ C+ S+ L +  Y GN +TWWN +   + V ++LDR+L
Sbjct  562  RHPNEHSTAASQNIDRKTREFRECLLSAGLDDLNYRGNLYTWWN-KNPVKPVAKKLDRIL  620

Query  12   VNE  4
            +NE
Sbjct  621  LNE  623



>ref|XP_009123480.1| PREDICTED: uncharacterized protein LOC103848300 [Brassica rapa]
Length=672

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 84/164 (51%), Gaps = 9/164 (5%)
 Frame = -1

Query  468  GQFSV-SLGFE---NRCSGTAKIW-VF*DRCLS*PLGHGYQIVSMRVTLPVI-GNLMLSV  307
            G+FS   L F+   N+   + KIW V+    +   +    Q++++ VT P I   +++S 
Sbjct  92   GEFSKHELDFQVVRNKKKFSGKIWIVWHPSIVVTTISTSLQMITVEVTWPSIQSKIIISA  151

Query  306  VYASCERRVRQELW-DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR-E  133
            +YAS     R  LW ++ + ++A  +    W I+GDFN I    E       +  K   +
Sbjct  152  IYASNAIEDRIGLWKEIADLVSAHGLDSKPWLILGDFNQIRAATEHSKPASLSMDKRMCD  211

Query  132  FQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            F  C+ ++ + +  Y GN FTWWN +R    + ++LD+ LVNE+
Sbjct  212  FNQCLIAASVDDLNYRGNTFTWWN-KRKLDPIAKKLDQALVNED  254



>ref|XP_009144617.1| PREDICTED: uncharacterized protein LOC103868259 [Brassica rapa]
Length=1740

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 4/122 (3%)
 Frame = -1

Query  363  QIVSMRVTLPVI-GNLMLSVVYASCERRVRQELWDLIEAMAAREVGDGR-WAIMGDFNCI  190
            Q++   VT P       +S++YAS +   R  LW+ I ++AA    D + W ++GDFN I
Sbjct  635  QMIMAEVTWPSCQSKFFISIIYASNDVDERVGLWEEIASLAATYDLDTKPWILLGDFNQI  694

Query  189  LRGEEKKGGQPYNKAKS-REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
                E       N  K  R+F NC+ +  L +  + G  FTWWN ++ S  V ++LDR L
Sbjct  695  RDPVEHSSPPSLNMDKRIRDFNNCLINESLDDLNFRGTTFTWWN-KQKSAPVAKKLDRCL  753

Query  12   VN  7
            VN
Sbjct  754  VN  755



>ref|XP_010484758.1| PREDICTED: uncharacterized protein LOC104763036 [Camelina sativa]
Length=824

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGR-WAIMGDFNCILRGEEKKGGQPYNKA  145
            +++S VYA   R  RQ LW+ + A++       R W +MGDFN  L   E   G    K 
Sbjct  1    MVVSFVYAVNCRSGRQLLWEDLCALSRDSAVCARPWVVMGDFNQTLNPAEHSSGGTRIKK  60

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
               EF +C+  + L++    GN FTWWN +     + + LDRVL+N+
Sbjct  61   GMEEFHDCLSYANLQDLTIRGNQFTWWNNQE-LNPIAKNLDRVLIND  106



>ref|XP_010507014.1| PREDICTED: uncharacterized protein LOC104783570 [Camelina sativa]
Length=867

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 9/133 (7%)
 Frame = -1

Query  381  PLGHGYQIVSMRVTLPVIGNLM---LSVVYASCERRVRQELW-DLIEAMAAREVGDGRWA  214
            P+    Q+V+  + LP  GN M   +S VYA      R+ELW DL     +    +  W 
Sbjct  477  PVFKSGQVVTCSILLP--GNTMEFFVSFVYAYNLAEERKELWEDLKSHFDSPLFTNQPWV  534

Query  213  IMGDFNCILRGEEKK--GGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            I+GDFN IL G E       P+  +  R+FQ+ I    L +   +G  FTW N +R    
Sbjct  535  IVGDFNEILDGVEHSTYDDNPFVTSGMRDFQDVIRHCSLTDMPSHGPLFTWEN-KRAEGL  593

Query  39   VWERLDRVLVNEN  1
            + ++LDR+LVNE+
Sbjct  594  ICKKLDRILVNED  606



>ref|XP_010312970.1| PREDICTED: uncharacterized protein LOC104644590 [Solanum lycopersicum]
Length=563

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
             SV+Y       R+ LW  +  MA   +    W I+GDFN +L  ++++ G P N+++ R
Sbjct  58   FSVIYGFNTIEQRKSLWTDLNKMAQNVISP--WLIIGDFNAVLSPQDRQAGAPVNESEIR  115

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
            +F +C+ +  + E  + G+ +TW N + G+  V  R+DR   N+
Sbjct  116  DFADCVKTMGIHELQWKGSYYTWRNKQIGNTRVLSRIDRAFGND  159



>ref|XP_010693313.1| PREDICTED: uncharacterized protein LOC104906276, partial [Beta 
vulgaris subsp. vulgaris]
Length=358

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = -1

Query  306  VYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQ  127
            VYA  ER  R+ELW  ++ MA +   +G W + GDFNC+L  +E+ G Q  +       +
Sbjct  65   VYAFNERNRREELWQGLKEMAGQI--NGPWLVGGDFNCVLHMDERIGAQ-VSSWDIEPIR  121

Query  126  NCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             C D   L +    GN FTW N + G+  V+ +LDRVL+N
Sbjct  122  ACFDECGLYDMKCSGNRFTWNNKQEGNDRVFAKLDRVLIN  161



>ref|XP_009604419.1| PREDICTED: uncharacterized protein LOC104099205 [Nicotiana tomentosiformis]
Length=295

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (53%), Gaps = 21/119 (18%)
 Frame = -1

Query  348  RVTLPVIGN-----LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILR  184
            R+TL ++ +     ++L++VYA C+   R ++WD + A+A+                 + 
Sbjct  49   RMTLRLVDSNSQQEVILTLVYAKCDAIQRIKMWDTLYALASD----------------MD  92

Query  183  GEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
             EE  GG P +  +   F++C+ +  L +  + G+ FTWWNGR     +++RLDRVL N
Sbjct  93   EEENFGGLPVHLNEIDNFRHCVTTCNLHDIGFKGSIFTWWNGRTEEDCIFKRLDRVLAN  151



>ref|XP_009144061.1| PREDICTED: uncharacterized protein LOC103867715 [Brassica rapa]
Length=1512

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 70/124 (56%), Gaps = 8/124 (6%)
 Frame = -1

Query  363  QIVSMRVTLPVIGN-LMLSVVYASCERRVRQELWDLIE-AMAAREVGDGRWAIMGDFNCI  190
            Q+V+  V LP     + +S VY S  R+ R+ LWD +E A  + ++    W ++GDFN I
Sbjct  543  QMVTCTVKLPFHSTEIGVSFVYGSNCRKERRLLWDELESASTSSQLCGLPWIVLGDFNEI  602

Query  189  LRGEEKKGGQPYNKAKS-REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVL  13
            +   E      ++ ++  R+F+ C++ S L +  + G++FTW N      +V ++LDR+L
Sbjct  603  ISPTEHSSADQFSSSRGMRDFRECLERSSLADLQFSGHNFTWTN-----HSVSKKLDRIL  657

Query  12   VNEN  1
             NE+
Sbjct  658  CNED  661



>gb|EMT09703.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=740

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 89/205 (43%), Gaps = 7/205 (3%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRC---  430
            MK I WN R + +  ++  +  L R   P +L L E       LG+F  SLG  N     
Sbjct  1    MKIISWNCRGLGNGPAVRSLLELGRVEVPDVLFLCETRLTEKKLGRFRWSLGLANMVAWK  60

Query  429  --SGTAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELWDL  259
              S    + +F  R L   L  +G + V + +         L+ VY       ++E W L
Sbjct  61   DESSGRGVALFWRRGLDVSLRSYGRRHVDVDIVREDGMIWRLTGVYGESAMERKKETWKL  120

Query  258  IEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGN  79
            +  +  +      W  +GDFN +L   EK GG    +    +F+  +D+  LR+  + G+
Sbjct  121  MRILKQQHQNGRPWLCLGDFNEVLTSSEKLGGADRPQHYLDDFRQALDACELRDIGFEGD  180

Query  78   DFTWWNGRRGSQA-VWERLDRVLVN  7
             +TW N  R  +  + ERLDR   N
Sbjct  181  MYTWRNHSRELRTYICERLDRATAN  205



>ref|XP_010042087.1| PREDICTED: uncharacterized protein LOC104431099 [Eucalyptus grandis]
Length=704

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 97/205 (47%), Gaps = 9/205 (4%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENR----  433
            MKF+ WN + + +  ++  +++LV   +P +L L+E     S L +    L +++     
Sbjct  1    MKFVSWNCQGLGNPLTVQALKDLVVHDRPDLLFLMESKNQDSFLSRVQRRLHYQHSFLVS  60

Query  432  -CSGTAKIWVF*DRCLS*PL-GHGYQIVSMRVTLPVIGNLM-LSVVYASCERRVRQELWD  262
                   + VF +  LS  +       + +    P  G+ M L+ ++A    + RQ+LW 
Sbjct  61   PVGLAGGLAVFWNDPLSVSVEDSSAHYIDLICFGPHEGSPMRLTCIHAPTSFQQRQQLWT  120

Query  261  LIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYG  82
             ++ ++   V    W  +GDFN IL   EK G +     + R F++ ++   L E    G
Sbjct  121  GLKHIS--RVITMPWVCIGDFNEILNHWEKVGKRFTPSYRLRSFRDFLNDCSLMEVESKG  178

Query  81   NDFTWWNGRRGSQAVWERLDRVLVN  7
              +TW N R G + + E+LDRVL N
Sbjct  179  CAYTWVNNRDGDELIKEKLDRVLCN  203



>gb|KEH21061.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=374

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/219 (23%), Positives = 93/219 (42%), Gaps = 30/219 (14%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEP--------------FKDLSHLGQ  463
            M  +CWNVR +        ++NL+ + K +I  LLE               F+D S +  
Sbjct  1    MTLVCWNVRGINKPFKQKEIKNLLHKNKFEICVLLETRVKAEKFKKVSGLMFRDWSLINN  60

Query  462  FSVSLGFENRCSGTAKIWV-----F*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYA  298
            + +        +   +IW+     F D               + +   +  NL+   VYA
Sbjct  61   YGMD-------AANGRIWIGWNPKFWDVKFDASCVQAIHCEVIHLNSNICFNLV--AVYA  111

Query  297  SCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCI  118
               +  R+ LW  I  +  +  G+    I GDFN +L  +++  G    + + ++F +C+
Sbjct  112  FKTQEQRKGLWKFINDICNKTSGN--LLIGGDFNSVLLVDDRLNGNLVTQQEIQDFADCM  169

Query  117  DSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
             ++ L E    G+ +TW N +  +  ++ ++DR L N N
Sbjct  170  LTNNLSEVRTIGDYYTWCNNQASNDGIYSKIDRFLANTN  208



>emb|CDY24720.1| BnaC04g13250D [Brassica napus]
Length=331

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 95/207 (46%), Gaps = 14/207 (7%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFENRCS--  427
            M  + WN R   S  ++  ++ + R++ P  L L+E  + LS++      LG+++  +  
Sbjct  1    MSILSWNGRGAGSTETVQELQEIRRKYFPDFLFLMETKQKLSYMEGLKKDLGYDDLVTVE  60

Query  426  ------GTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVIGNLMLSVVYASCERRVRQELW  265
                  G A +W    +     L    +IV  +V +  + +  L+ VY       R+ +W
Sbjct  61   PEGLSGGLAVMWKKNFKVE--ILVCDKRIVDCKVGMGSL-SFFLTCVYGDPVVARRRVVW  117

Query  264  DLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYY  85
            D +  +A     D  W ++GDFN +L  EEK GG    ++   +F +   S +LRE   +
Sbjct  118  DRLMVLAVTR--DEAWVLVGDFNELLNNEEKSGGAVRVESSFWDFWHMTSSCKLRELRSF  175

Query  84   GNDFTWWNGRRGSQAVWERLDRVLVNE  4
            GN  + W G R    V  RLDR   N+
Sbjct  176  GNSLS-WAGWRDRVWVQCRLDRSFGND  201



>ref|XP_010696413.1| PREDICTED: uncharacterized protein LOC104908941 [Beta vulgaris 
subsp. vulgaris]
Length=425

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/208 (27%), Positives = 97/208 (47%), Gaps = 13/208 (6%)
 Frame = -1

Query  600  MKFICWNVREVASQGSLHRVRNLVRQFKPKILCLLEPFKDLSHLGQFSVSLGFEN-----  436
            M  + WNVR +     +   + LV Q  P ++ L+E +   +        LG ++     
Sbjct  83   MNILFWNVRGLGRPSFVTNFQLLVNQHSPSMVVLVETWVTRARTADIVEGLGMDSWFLVE  142

Query  435  ---RCSGTAKIWVF*DRCLS*PLGHGYQIVSMRVTLPVI-GNLMLSVVYASCERRVRQEL  268
                  G   +W         PLG G Q V   V +  I  +L+ S +YAS ++ VR++L
Sbjct  143  PIGFVGGILLLWNS-SVIDCHPLGDGAQGVHGIVQVRNIHTSLLFSAIYASPKKHVRRKL  201

Query  267  WDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVY  88
            W+ ++  A   V +  W ++GDFN +    EK GG+  + ++   F   ++   L +   
Sbjct  202  WEELKVFAG-SVSEP-WLVVGDFNEVTCQSEKFGGRRISLSREALFSTTMNDCNLIDIGC  259

Query  87   YGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             G  +TW N +R + +++ERLDR   N+
Sbjct  260  NGPKYTWTN-KRKNNSIYERLDRGWAND  286



>ref|XP_007010390.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
 gb|EOY19200.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
Length=1368

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 75/166 (45%), Gaps = 10/166 (6%)
 Frame = -1

Query  495  EPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*DRCLS*PLGHGY-QIVSMRVTLPVIG-  325
            +P    S L      LGF    S  + KIW+F    +   +   + Q + +R+  P +  
Sbjct  36   KPMVHASKLEYIRRKLGFTGAVSNCSQKIWMFWAEEVGCTVQRDHHQCLHVRIAFPWLPF  95

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            +   S +YA C +  R+ LWD +  +A        W + GDFN IL  EE+  G   N  
Sbjct  96   SFQTSFIYAKCTKTERRHLWDCLRNVATDM--QEPWLVGGDFNTILSREERLFGAEPNAG  153

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
               EF   +    L ++ + GN FTW N       +++RLDRV+ N
Sbjct  154  SMEEFATALFDCGLMDAGFEGNKFTWTNTH-----MFQRLDRVVYN  194



>gb|KEH17749.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=207

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (51%), Gaps = 2/106 (2%)
 Frame = -1

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            N+ ++ VYAS     R++LW  +     R  G   W  +G+FN IL   EK+G +P    
Sbjct  62   NVYVAAVYASTNYLTRRDLWADLTLEIGRHTGP--WLFLGNFNAILGAHEKRGRRPPPPL  119

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
               +F +  +++ L     + + FTW NGR G + V  RLDR + N
Sbjct  120  SCMDFLHWSNANLLSHLPSFDSFFTWSNGRLGLENVALRLDRAICN  165



>ref|XP_007028332.1| Uncharacterized protein TCM_024073 [Theobroma cacao]
 gb|EOY08834.1| Uncharacterized protein TCM_024073 [Theobroma cacao]
Length=660

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 2/105 (2%)
 Frame = -1

Query  318  MLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKS  139
            +L+ +Y S   + R+ LWD ++  +  +  D  W ++GDFN I+  +EK G    N  + 
Sbjct  239  LLTEIYGSPLVKERKHLWDSLKLASNDQ--DIPWMVIGDFNQIISPDEKHGRNSVNLTQC  296

Query  138  REFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNE  4
             +  NC+    L +    G  FTWWN + G      RLDRV VN+
Sbjct  297  NQLLNCMSYCNLYDFEASGFKFTWWNKKEGLDYTQVRLDRVFVND  341



>ref|XP_009605862.1| PREDICTED: uncharacterized protein LOC104100355 [Nicotiana tomentosiformis]
Length=299

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  219  WAIMGDFNCILRGEEKKGGQPYNKAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQA  40
            W I+GDFN I   EEK  G PY   KS +F + I+   L +  +YG  +TW NGR     
Sbjct  20   WCIIGDFNGIASVEEKIDGLPYQMKKSIDFLSMIEDCGLVDLAFYGPRYTWSNGRGPCLI  79

Query  39   VWERLDRVLVNEN  1
             W+RLDR +VN+N
Sbjct  80   GWKRLDRGIVNDN  92



>ref|XP_009617971.1| PREDICTED: uncharacterized protein LOC104110223 [Nicotiana tomentosiformis]
Length=362

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 2/105 (2%)
 Frame = -1

Query  315  LSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAKSR  136
            +S++ A C+  +R  LW+ ++  +        W ++GDFN I    EK GG PY   KS 
Sbjct  51   ISIIDAKCKLSMRIPLWENLKLKSTTSTV--CWCVIGDFNVITFMGEKIGGIPYQMKKSI  108

Query  135  EFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVNEN  1
            +F N I+   L +  +YG  +TW NG      V++R D  + N+N
Sbjct  109  DFINMIEECVLIDLDFYGPRYTWSNGIGPGSIVYKRPDMGMANDN  153



>ref|XP_010666276.1| PREDICTED: uncharacterized protein LOC104883442 [Beta vulgaris 
subsp. vulgaris]
Length=1944

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 3/105 (3%)
 Frame = -1

Query  321  LMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKAK  142
             + S +YAS + +VR +LWD +   AA    +  W I GDFN +    EK GG+P  K +
Sbjct  612  FVFSAIYASPKYKVRNQLWDELIMFAANM--NYPWIIAGDFNEVTCQSEKFGGRPIIKKR  669

Query  141  SREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
               +   +D  +L +  Y G+ FTW N RR    V ERLDR   N
Sbjct  670  VEMYVETMDLCKLVDLGYVGSKFTWTNKRR-RNPVLERLDRGWAN  713



>ref|XP_009761020.1| PREDICTED: uncharacterized protein LOC104213256 [Nicotiana sylvestris]
Length=223

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = -1

Query  324  NLMLSVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYNKA  145
            + ++++V+A C+   R ELWD + A+A        W + GDFN I   EEK GG+P +  
Sbjct  11   SFIVTLVHAKCDSIERIELWDSLHALAGNMTL--PWIVEGDFNVIWDEEEKFGGRPVSLN  68

Query  144  KSREFQNCIDSSRLRESVYYGNDFTWWNG  58
            +  +F+ CI++  L +  + G+ +TWWN 
Sbjct  69   ELNDFRYCINNYNLFDLGFKGSIYTWWNA  97



>ref|XP_007028079.1| Uncharacterized protein TCM_023221 [Theobroma cacao]
 gb|EOY08581.1| Uncharacterized protein TCM_023221 [Theobroma cacao]
Length=450

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 85/168 (51%), Gaps = 12/168 (7%)
 Frame = -1

Query  498  LEPFKDLSHLGQFSVSLGFENRCSG-TAKIWVF*--DRCLS*PLGHGYQIVSMRVTLPVI  328
            LEP  ++S    F + L F+   S  + KIWVF   + C    L H  Q + ++++LP +
Sbjct  231  LEPVVNISRAQYFRMRLDFDKVVSNCSHKIWVFSSVEVCNEVLLDH-IQCLHVKLSLPWL  289

Query  327  GNLML-SVVYASCERRVRQELWDLIEAMAAREVGDGRWAIMGDFNCILRGEEKKGGQPYN  151
             +L+  S +YA C R+ R ELW+ +  ++      G   + G+FN I+   E+  G P +
Sbjct  290  PHLLFTSFIYAKCTRQKRMELWNSLRLLSLD--MQGPCMVGGNFNAIVSCAERLNGAPPH  347

Query  150  KAKSREFQNCIDSSRLRESVYYGNDFTWWNGRRGSQAVWERLDRVLVN  7
                 +F   +    L ++ +  N+FTW N       +++RL+RV+ N
Sbjct  348  GGSMEDFAAMLLDCGLLDTSFERNNFTWTNND-----MFQRLNRVVYN  390



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 910113435382