BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26324_g1_i1 len=1654 path=[1:0-1653]

Length=1654
                                                                      Score     E

ref|XP_009792045.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    658   0.0      
ref|XP_009595344.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    654   0.0      
ref|XP_004237474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    653   0.0      
emb|CDP12875.1|  unnamed protein product                                622   0.0      
gb|EYU31104.1|  hypothetical protein MIMGU_mgv1a006003mg                609   0.0      
ref|XP_010261306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    597   0.0      
gb|EPS64137.1|  hypothetical protein M569_10642                         594   0.0      
ref|XP_010027756.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      593   0.0      
ref|XP_010086919.1|  Glucan endo-1,3-beta-glucosidase 8                 592   0.0      
gb|KCW54346.1|  hypothetical protein EUGRSUZ_I00311                     583   0.0      
ref|XP_006580871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    572   0.0      
gb|KHN38236.1|  Glucan endo-1,3-beta-glucosidase 8                      572   0.0      
ref|XP_002275701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      562   0.0      Vitis vinifera
emb|CAN62816.1|  hypothetical protein VITISV_031885                     562   0.0      Vitis vinifera
ref|XP_010242326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    559   0.0      
ref|XP_002530257.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    559   0.0      Ricinus communis
gb|AFK43211.1|  unknown                                                 553   0.0      
ref|XP_011025580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    553   0.0      
ref|XP_009402192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    548   0.0      
gb|KFK28168.1|  hypothetical protein AALP_AA8G481200                    549   0.0      
ref|XP_004170594.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    547   0.0      
ref|XP_006367414.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    543   0.0      
ref|XP_004149714.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    547   0.0      
ref|XP_002310612.1|  glycosyl hydrolase family 17 family protein        546   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006281667.1|  hypothetical protein CARUB_v10027803mg             545   0.0      
ref|XP_009130473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    543   0.0      
ref|XP_006394112.1|  hypothetical protein EUTSA_v10004092mg             543   0.0      
ref|XP_009393970.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    543   0.0      
ref|XP_002864921.1|  glycosyl hydrolase family 17 protein               543   0.0      
emb|CDY46823.1|  BnaC02g43310D                                          543   0.0      
ref|XP_008457953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    542   0.0      
ref|XP_006837787.1|  hypothetical protein AMTR_s00104p00085600          541   0.0      
ref|XP_010520102.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      541   0.0      
ref|XP_010444426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    540   0.0      
ref|NP_201284.1|  O-Glycosyl hydrolases family 17 protein               540   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001183732.1|  uncharacterized protein LOC100502325 precursor     540   0.0      
ref|XP_010462737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    538   0.0      
ref|XP_004504006.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    537   0.0      
ref|XP_010484272.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    536   0.0      
gb|KDP35276.1|  hypothetical protein JCGZ_09435                         535   0.0      
ref|XP_009336373.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    535   0.0      
ref|XP_002438620.1|  hypothetical protein SORBIDRAFT_10g022940          535   0.0      Sorghum bicolor [broomcorn]
ref|XP_007048158.1|  O-Glycosyl hydrolases family 17 protein, put...    533   0.0      
ref|XP_009112157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    533   0.0      
ref|XP_003528028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    532   0.0      
ref|XP_004142041.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    531   0.0      
ref|XP_004164948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    530   1e-180   
ref|XP_003630124.1|  Glucan endo-1,3-beta-glucosidase                   532   4e-180   
ref|XP_004502874.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    529   4e-180   
ref|XP_010928419.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    526   5e-179   
ref|XP_007137587.1|  hypothetical protein PHAVU_009G138800g             525   1e-178   
ref|XP_008361509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    525   1e-178   
ref|XP_008338651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    525   1e-178   
ref|XP_008440124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      525   2e-178   
ref|XP_006656196.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    524   2e-178   
ref|XP_008778100.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    521   1e-177   
ref|XP_010681060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    521   3e-177   
ref|XP_006826313.1|  hypothetical protein AMTR_s00004p00082670          521   4e-177   
ref|XP_008793474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    521   4e-177   
ref|XP_008232375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    519   2e-176   
ref|XP_009786014.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    517   1e-175   
ref|XP_008465328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    515   5e-175   
ref|XP_004966001.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    515   6e-175   
ref|XP_007207576.1|  hypothetical protein PRUPE_ppa018453mg             513   2e-174   
ref|XP_008392630.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    513   3e-174   
ref|XP_009610199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    513   6e-174   
gb|KDP39719.1|  hypothetical protein JCGZ_02739                         513   7e-174   
ref|XP_004141142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    511   4e-173   
ref|XP_009605785.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    510   5e-173   
ref|XP_010257709.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    509   9e-173   
ref|XP_010276412.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    509   1e-172   
ref|XP_010915073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    509   1e-172   
ref|NP_001057968.1|  Os06g0590600                                       509   1e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011078775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      509   2e-172   
ref|XP_002440138.1|  hypothetical protein SORBIDRAFT_09g026690          509   2e-172   Sorghum bicolor [broomcorn]
ref|NP_001152213.1|  glucan endo-1,3-beta-glucosidase 5 precursor       508   3e-172   Zea mays [maize]
gb|EAZ37505.1|  hypothetical protein OsJ_21839                          508   4e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      508   5e-172   
ref|XP_002319699.1|  glycosyl hydrolase family 17 family protein        508   6e-172   Populus trichocarpa [western balsam poplar]
ref|XP_011034355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    508   6e-172   
ref|XP_011010121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      508   6e-172   
gb|KHN00669.1|  Glucan endo-1,3-beta-glucosidase 8                      507   8e-172   
ref|XP_006574750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    507   1e-171   
ref|XP_010909077.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    506   2e-171   
ref|XP_010496623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    506   3e-171   
ref|XP_003548760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    506   3e-171   
ref|XP_002888279.1|  glycosyl hydrolase family 17 protein               506   3e-171   
ref|XP_004288531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    506   4e-171   
gb|KHN32753.1|  Glucan endo-1,3-beta-glucosidase 8                      504   6e-171   
ref|XP_010314012.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    504   1e-170   
ref|XP_002277003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      504   1e-170   Vitis vinifera
emb|CDP18694.1|  unnamed protein product                                504   2e-170   
ref|XP_010470322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    504   2e-170   
ref|NP_176656.1|  O-glycosyl hydrolases family 17 protein               504   2e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      504   2e-170   
gb|AFU52646.1|  beta-1,3-glucanase 11                                   503   3e-170   
dbj|BAK06743.1|  predicted protein                                      504   3e-170   
ref|XP_006362259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    503   3e-170   
ref|XP_008806060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    503   3e-170   
ref|XP_002525445.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    503   5e-170   Ricinus communis
ref|XP_006348032.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    502   6e-170   
ref|XP_004288532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    502   8e-170   
ref|XP_004249143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    502   1e-169   
ref|XP_004493147.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    501   2e-169   
ref|XP_007159772.1|  hypothetical protein PHAVU_002G266100g             501   6e-169   
gb|AAQ90287.1|  beta-1,3-glucanase, acidic                              499   8e-169   Coffea arabica [arabica coffee]
ref|XP_010672074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    499   1e-168   
ref|XP_007151834.1|  hypothetical protein PHAVU_004G079100g             499   1e-168   
ref|XP_006599436.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    499   1e-168   
ref|XP_004961391.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    498   2e-168   
ref|XP_003560627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    498   3e-168   
ref|XP_003565994.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    498   3e-168   
ref|XP_006297514.1|  hypothetical protein CARUB_v10013538mg             499   3e-168   
ref|XP_003624610.1|  Glucan endo-1,3-beta-glucosidase                   498   4e-168   
gb|AAS99718.1|  At1g64760                                               498   4e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      498   5e-168   
ref|NP_179534.1|  O-Glycosyl hydrolases family 17 protein               497   7e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011100192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    493   2e-167   
emb|CDY03359.1|  BnaC09g09890D                                          496   3e-167   
ref|XP_002884423.1|  glycosyl hydrolase family 17 protein               496   3e-167   
ref|XP_010467891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    496   3e-167   
gb|EPS74227.1|  beta-1,3-glucanase, acidic                              494   3e-167   
gb|EMS57703.1|  Glucan endo-1,3-beta-glucosidase 8                      494   3e-167   
ref|XP_010553811.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    496   4e-167   
ref|XP_008240488.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    495   5e-167   
ref|XP_010415342.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    494   1e-166   
ref|XP_010549610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    494   1e-166   
ref|XP_004981482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    494   2e-166   
ref|XP_009793269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    494   2e-166   
emb|CDY48710.1|  BnaA09g09850D                                          493   2e-166   
ref|XP_010086599.1|  Glucan endo-1,3-beta-glucosidase 8                 494   2e-166   
ref|XP_010517383.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    494   3e-166   
ref|XP_006297581.1|  hypothetical protein CARUB_v10013602mg             493   4e-166   
ref|NP_001056153.1|  Os05g0535100                                       493   5e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009353157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    492   6e-166   
ref|XP_010485770.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    492   1e-165   
ref|XP_010463871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    492   1e-165   
ref|XP_009336372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    491   1e-165   
ref|XP_006409040.1|  hypothetical protein EUTSA_v10022665mg             491   2e-165   
ref|NP_187051.3|  O-glycosyl hydrolases family 17 protein               491   2e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002459388.1|  hypothetical protein SORBIDRAFT_02g003910          490   9e-165   Sorghum bicolor [broomcorn]
gb|EEE64491.1|  hypothetical protein OsJ_19341                          489   9e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130411.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      489   1e-164   
ref|XP_002873877.1|  predicted protein                                  489   1e-164   
ref|XP_009418954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    489   1e-164   
gb|EMS57429.1|  Glucan endo-1,3-beta-glucosidase 8                      489   1e-164   
ref|XP_006408232.1|  hypothetical protein EUTSA_v10020592mg             489   1e-164   
ref|XP_007030700.1|  O-Glycosyl hydrolases family 17 protein            489   2e-164   
ref|XP_008391677.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      489   2e-164   
emb|CDY42897.1|  BnaC05g47540D                                          489   3e-164   
ref|XP_003602499.1|  Glucan endo-1,3-beta-glucosidase                   488   3e-164   
ref|XP_007161926.1|  hypothetical protein PHAVU_001G109400g             487   5e-164   
ref|XP_004955566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    487   7e-164   
ref|XP_010036190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    487   7e-164   
ref|XP_006655526.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    486   2e-163   
gb|AAO37977.1|  putative beta-1,3 glucanase                             486   4e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008338633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    485   4e-163   
ref|NP_197323.1|  O-Glycosyl hydrolases family 17 protein               485   6e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208233.1|  hypothetical protein PRUPE_ppa017706mg             484   7e-163   
ref|XP_002325410.1|  hypothetical protein POPTR_0019s04850g             485   1e-162   Populus trichocarpa [western balsam poplar]
ref|XP_006657484.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    483   2e-162   
ref|XP_009412333.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    482   2e-162   
ref|XP_006650710.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    483   3e-162   
dbj|BAD31779.1|  putative 3-glucanase                                   483   4e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010495273.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    483   4e-162   
gb|KDO50472.1|  hypothetical protein CISIN_1g045344mg                   487   6e-162   
ref|XP_008232612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    481   1e-161   
ref|XP_010454046.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    481   1e-161   
ref|XP_009388996.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    481   2e-161   
ref|XP_006289696.1|  hypothetical protein CARUB_v10003257mg             481   2e-161   
gb|AIR93903.1|  glucanase                                               481   2e-161   
ref|XP_009121000.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      481   2e-161   
gb|KDO55075.1|  hypothetical protein CISIN_1g011532mg                   480   3e-161   
ref|XP_006443393.1|  hypothetical protein CICLE_v10019922mg             480   3e-161   
gb|AAD38251.1|AC006193_7  Similar to glucan endo-1,3-beta-glucosi...    479   3e-161   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ98060.1|  predicted protein                                      481   3e-161   
ref|XP_003619009.1|  Glucan endo-1,3-beta-glucosidase                   479   4e-161   
dbj|BAJ90806.1|  predicted protein                                      480   4e-161   
emb|CBI21529.3|  unnamed protein product                                499   5e-161   
ref|XP_011082117.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      479   7e-161   
dbj|BAK05853.1|  predicted protein                                      479   8e-161   
ref|XP_004289257.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    478   1e-160   
ref|XP_003557824.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    479   2e-160   
ref|XP_010528707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    478   2e-160   
gb|KFK37837.1|  hypothetical protein AALP_AA3G035600                    481   3e-160   
gb|KEH32093.1|  glucan endo-1,3-beta-glucosidase-like protein           479   4e-160   
ref|NP_001058984.2|  Os07g0168600                                       480   4e-160   Oryza sativa Japonica Group [Japonica rice]
gb|KHN10411.1|  Glucan endo-1,3-beta-glucosidase 8                      477   4e-160   
ref|XP_010420566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    478   4e-160   
ref|XP_006400369.1|  hypothetical protein EUTSA_v10015448mg             478   4e-160   
ref|XP_009366428.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      478   5e-160   
ref|XP_007204344.1|  hypothetical protein PRUPE_ppa005641mg             476   6e-160   
ref|XP_003550844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    477   7e-160   
ref|XP_010528719.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    477   8e-160   
ref|XP_010669627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      477   9e-160   
gb|KFK26060.1|  hypothetical protein AALP_AA8G198000                    476   2e-159   
gb|KHN46790.1|  Glucan endo-1,3-beta-glucosidase 8                      474   2e-159   
ref|XP_010257791.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      475   4e-159   
ref|XP_010088872.1|  Glucan endo-1,3-beta-glucosidase 8                 475   6e-159   
gb|ABK25447.1|  unknown                                                 474   1e-158   Picea sitchensis
gb|ACG29689.1|  glucan endo-1,3-beta-glucosidase 5 precursor            474   1e-158   Zea mays [maize]
emb|CDM83452.1|  unnamed protein product                                474   2e-158   
ref|XP_003559620.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    473   2e-158   
gb|KDO55074.1|  hypothetical protein CISIN_1g048257mg                   474   3e-158   
ref|XP_008787369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      472   3e-158   
ref|NP_001130924.1|  putative O-Glycosyl hydrolase superfamily pr...    473   3e-158   Zea mays [maize]
ref|XP_008386810.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    473   4e-158   
emb|CCH47219.1|  similar to glucan endo-1,3-beta-glucosidase            473   4e-158   
gb|KDO67128.1|  hypothetical protein CISIN_1g010789mg                   473   6e-158   
ref|XP_010688142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      471   1e-157   
ref|XP_009376335.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      472   1e-157   
ref|XP_002530371.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    471   1e-157   Ricinus communis
ref|XP_004498612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   1e-157   
ref|XP_009418582.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   2e-157   
ref|XP_006474357.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    470   3e-157   
ref|XP_006443394.1|  hypothetical protein CICLE_v10023781mg             471   5e-157   
gb|EYU37424.1|  hypothetical protein MIMGU_mgv1a005873mg                469   7e-157   
ref|XP_006476105.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   7e-157   
ref|XP_002463758.1|  hypothetical protein SORBIDRAFT_01g005610          469   7e-157   Sorghum bicolor [broomcorn]
ref|XP_010672072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      469   8e-157   
ref|XP_010048510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      469   8e-157   
ref|XP_006851012.1|  hypothetical protein AMTR_s00025p00220320          469   9e-157   
ref|XP_004288682.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   1e-156   
ref|XP_006450066.1|  hypothetical protein CICLE_v10008079mg             469   1e-156   
ref|XP_006483661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   1e-156   
ref|XP_008380615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      469   1e-156   
gb|KDO80436.1|  hypothetical protein CISIN_1g047337mg                   469   2e-156   
gb|KDO73371.1|  hypothetical protein CISIN_1g011636mg                   468   2e-156   
ref|XP_010536989.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      467   5e-156   
ref|XP_009623324.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    467   6e-156   
ref|XP_004289256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   7e-156   
ref|XP_009797292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   8e-156   
ref|XP_010929423.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    467   9e-156   
gb|AES75227.2|  O-glycosyl hydrolase family 17 protein                  464   1e-155   
gb|KDP39750.1|  hypothetical protein JCGZ_02770                         466   1e-155   
ref|XP_010913808.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   1e-155   
ref|XP_004508564.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   1e-155   
ref|XP_004296615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   1e-155   
ref|XP_009390478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   1e-155   
ref|XP_011003008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   3e-155   
ref|XP_004982257.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   3e-155   
gb|KDP32321.1|  hypothetical protein JCGZ_13246                         465   3e-155   
ref|XP_010928748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    465   3e-155   
ref|XP_007013263.1|  O-Glycosyl hydrolases family 17 protein            465   3e-155   
ref|XP_008458070.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      465   4e-155   
ref|XP_008776624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    464   5e-155   
gb|EPS71987.1|  hypothetical protein M569_02770                         464   6e-155   
ref|XP_010252157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    464   7e-155   
ref|XP_008466353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      464   8e-155   
ref|XP_002281500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      464   9e-155   Vitis vinifera
ref|XP_008443646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      464   9e-155   
ref|XP_011097609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   1e-154   
gb|KEH39797.1|  glucan endo-1,3-beta-glucosidase-like protein           463   2e-154   
ref|XP_008242583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      463   2e-154   
ref|XP_002449743.1|  hypothetical protein SORBIDRAFT_05g022490          463   3e-154   Sorghum bicolor [broomcorn]
ref|XP_004154666.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    462   4e-154   
ref|XP_010099734.1|  Glucan endo-1,3-beta-glucosidase 6                 462   5e-154   
ref|XP_009781628.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    462   6e-154   
ref|XP_004139090.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    462   7e-154   
ref|XP_002515573.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    462   7e-154   Ricinus communis
ref|XP_009336879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   1e-153   
gb|KEH41651.1|  O-glycosyl hydrolase family 17 protein                  461   1e-153   
ref|XP_004136331.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   1e-153   
ref|XP_010914019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      460   1e-153   
ref|XP_008781699.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   2e-153   
gb|KHG25475.1|  hypothetical protein F383_09937                         459   2e-153   
ref|XP_007155137.1|  hypothetical protein PHAVU_003G176600g             478   2e-153   
ref|XP_010655026.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      460   2e-153   
gb|ACG41694.1|  glucan endo-1,3-beta-glucosidase 5 precursor            460   2e-153   Zea mays [maize]
gb|AAT42176.1|  putative 3-glucanase                                    461   3e-153   Zea mays [maize]
ref|XP_011009207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      460   3e-153   
ref|XP_009626950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   3e-153   
ref|XP_008362938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   4e-153   
ref|XP_004513603.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   7e-153   
ref|XP_006382223.1|  hypothetical protein POPTR_0006s29500g             460   7e-153   
ref|XP_006596135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    458   1e-152   
emb|CDM86682.1|  unnamed protein product                                459   1e-152   
emb|CDP14258.1|  unnamed protein product                                458   1e-152   
emb|CDY02795.1|  BnaC02g10940D                                          458   2e-152   
ref|XP_011078347.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      458   2e-152   
ref|XP_009769717.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      457   2e-152   
ref|XP_007204529.1|  hypothetical protein PRUPE_ppa017632mg             458   2e-152   
ref|XP_011017570.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      457   4e-152   
gb|KFK29702.1|  hypothetical protein AALP_AA7G168000                    457   4e-152   
gb|KGN60639.1|  hypothetical protein Csa_2G005360                       457   5e-152   
ref|XP_002324967.2|  hypothetical protein POPTR_0018s06250g             457   6e-152   
ref|NP_001147672.1|  glucan endo-1,3-beta-glucosidase 5                 457   7e-152   
ref|XP_004951931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   7e-152   
ref|NP_001140660.1|  putative O-Glycosyl hydrolase superfamily pr...    456   8e-152   
ref|XP_009352686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   8e-152   
ref|XP_002869343.1|  glycosyl hydrolase family 17 protein               456   9e-152   
emb|CDY43882.1|  BnaC09g33610D                                          456   1e-151   
emb|CDP03371.1|  unnamed protein product                                456   1e-151   
ref|XP_002528007.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    456   1e-151   
ref|XP_010438078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      456   1e-151   
ref|XP_003523713.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   1e-151   
ref|XP_010447615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   1e-151   
gb|KHN10282.1|  Glucan endo-1,3-beta-glucosidase 5                      456   1e-151   
ref|NP_001050810.1|  Os03g0656800                                       456   2e-151   
ref|XP_004239309.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      455   2e-151   
ref|XP_003561381.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    456   2e-151   
ref|XP_006648298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   2e-151   
gb|EMS47593.1|  Glucan endo-1,3-beta-glucosidase 8                      455   2e-151   
ref|XP_010278473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      455   2e-151   
ref|XP_006372260.1|  hypothetical protein POPTR_0018s14730g             455   3e-151   
ref|XP_002324127.1|  hypothetical protein POPTR_0018s04200g             456   3e-151   
ref|XP_004163604.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    454   3e-151   
ref|XP_010049931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      455   4e-151   
ref|XP_008224566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      454   4e-151   
gb|EYU24024.1|  hypothetical protein MIMGU_mgv1a004416mg                456   5e-151   
ref|XP_006412625.1|  hypothetical protein EUTSA_v10025047mg             454   5e-151   
ref|XP_010525845.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   8e-151   
ref|XP_010432901.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   8e-151   
gb|EYU24023.1|  hypothetical protein MIMGU_mgv1a004416mg                455   8e-151   
ref|XP_004250551.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      454   1e-150   
emb|CDY13412.1|  BnaA03g51300D                                          454   1e-150   
ref|XP_006283637.1|  hypothetical protein CARUB_v10004695mg             453   1e-150   
emb|CDX68724.1|  BnaC01g07290D                                          453   1e-150   
gb|KHN05785.1|  Glucan endo-1,3-beta-glucosidase 8                      453   1e-150   
ref|XP_002466725.1|  hypothetical protein SORBIDRAFT_01g012900          453   1e-150   
ref|XP_009126789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   2e-150   
ref|XP_006451059.1|  hypothetical protein CICLE_v10007363mg             468   2e-150   
emb|CDY62695.1|  BnaA10g29270D                                          452   2e-150   
ref|XP_006401129.1|  hypothetical protein EUTSA_v10013422mg             452   3e-150   
ref|XP_009395879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   3e-150   
ref|XP_004982258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   3e-150   
ref|XP_009407893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      452   3e-150   
ref|NP_194843.1|  glucan endo-1,3-beta-glucosidase 5                    452   3e-150   
ref|XP_006578454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   3e-150   
gb|KCW82758.1|  hypothetical protein EUGRSUZ_C04137                     455   3e-150   
ref|XP_009601131.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   3e-150   
ref|XP_006352469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    452   4e-150   
ref|NP_001151032.1|  glucan endo-1,3-beta-glucosidase 6 precursor       452   8e-150   
ref|NP_001045844.1|  Os02g0139300                                       451   1e-149   
ref|XP_009120323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      451   1e-149   
gb|KFK27342.1|  hypothetical protein AALP_AA8G370600                    451   1e-149   
gb|EAY84415.1|  hypothetical protein OsI_05789                          451   1e-149   
emb|CDY66442.1|  BnaCnng50870D                                          451   1e-149   
ref|XP_009137993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    451   1e-149   
ref|XP_003526446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   2e-149   
ref|NP_001068140.2|  Os11g0577800                                       451   2e-149   
gb|EAZ18823.1|  hypothetical protein OsJ_34360                          451   2e-149   
ref|XP_009392760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   2e-149   
ref|XP_010483379.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      450   2e-149   
ref|XP_009127212.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      450   2e-149   
emb|CDX77431.1|  BnaA07g05690D                                          450   2e-149   
ref|XP_006299509.1|  hypothetical protein CARUB_v10015679mg             450   3e-149   
ref|XP_006280397.1|  hypothetical protein CARUB_v10026324mg             449   3e-149   
gb|EEC79587.1|  hypothetical protein OsI_20766                          448   4e-149   
ref|XP_010453200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   4e-149   
ref|XP_010095481.1|  Glucan endo-1,3-beta-glucosidase 5                 449   5e-149   
emb|CDY28246.1|  BnaA01g06030D                                          449   5e-149   
ref|XP_006338109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   5e-149   
ref|XP_009102513.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      449   7e-149   
ref|XP_010526287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   7e-149   
gb|AFU52650.1|  beta-1,3-glucanase 16                                   449   8e-149   
dbj|BAJ85378.1|  predicted protein                                      449   9e-149   
ref|XP_010443524.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   1e-148   
ref|XP_007222660.1|  hypothetical protein PRUPE_ppa004964mg             448   1e-148   
emb|CDX72294.1|  BnaC07g43160D                                          449   1e-148   
dbj|BAG88662.1|  unnamed protein product                                446   1e-148   
dbj|BAJ94415.1|  predicted protein                                      448   2e-148   
gb|KHN16471.1|  Glucan endo-1,3-beta-glucosidase 5                      448   2e-148   
gb|EAY81406.1|  hypothetical protein OsI_36575                          448   2e-148   
ref|XP_009792149.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   1e-147   
ref|NP_200617.2|  glucan endo-1,3-beta-glucosidase 6                    445   1e-147   
ref|NP_189076.1|  O-Glycosyl hydrolases family 17 protein               446   2e-147   
ref|XP_009776006.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    445   3e-147   
ref|XP_002866250.1|  glycosyl hydrolase family 17 protein               444   3e-147   
ref|XP_008373974.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      444   7e-147   
ref|XP_004303439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    444   7e-147   
gb|AAL24251.1|  AT5g58090/k21l19_70                                     443   7e-147   
ref|XP_009393986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      441   9e-147   
ref|XP_010513396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    444   1e-146   
ref|XP_003575938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    443   2e-146   
ref|XP_009363574.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   2e-146   
emb|CDX81254.1|  BnaC09g06650D                                          438   4e-146   
ref|XP_010048500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      442   5e-146   
ref|XP_006601109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    441   5e-146   
ref|XP_004979540.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   6e-146   
ref|XP_007222346.1|  hypothetical protein PRUPE_ppa004814mg             441   6e-146   
ref|XP_004246072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      441   6e-146   
gb|KHG29709.1|  hypothetical protein F383_09866                         441   8e-146   
gb|EPS65796.1|  hypothetical protein M569_08979                         441   9e-146   
gb|KHG03269.1|  hypothetical protein F383_27500                         441   1e-145   
ref|XP_008219823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   2e-145   
ref|XP_007138338.1|  hypothetical protein PHAVU_009G200400g             440   3e-145   
ref|XP_004972550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   3e-145   
gb|AFU52639.1|  beta-1,3-glucanase 4                                    439   4e-145   
gb|EMT12727.1|  Glucan endo-1,3-beta-glucosidase 8                      435   5e-145   
gb|EYU23029.1|  hypothetical protein MIMGU_mgv1a006384mg                437   6e-145   
dbj|BAJ95993.1|  predicted protein                                      439   6e-145   
gb|KHN20653.1|  Glucan endo-1,3-beta-glucosidase 8                      438   1e-144   
ref|XP_010488537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    438   2e-144   
ref|XP_003528268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    437   3e-144   
ref|XP_010687609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    437   3e-144   
ref|XP_010415358.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    434   3e-144   
ref|XP_006836569.1|  hypothetical protein AMTR_s00131p00072670          437   4e-144   
ref|XP_006850025.1|  hypothetical protein AMTR_s00022p00188990          437   6e-144   
ref|XP_006418767.1|  hypothetical protein EUTSA_v10002822mg             438   9e-144   
ref|XP_003574453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      436   9e-144   
ref|XP_004239361.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   1e-143   
ref|XP_006355222.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-143   
gb|ACN32122.1|  unknown                                                 436   2e-143   
ref|XP_002883518.1|  glycosyl hydrolase family 17 protein               433   4e-143   
ref|XP_006355982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    434   6e-143   
ref|XP_007161283.1|  hypothetical protein PHAVU_001G057100g             433   8e-143   
ref|XP_003550587.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   2e-142   
emb|CDY50874.1|  BnaA05g37350D                                          429   3e-142   
ref|XP_010273788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    432   3e-142   
gb|EAZ06041.1|  hypothetical protein OsI_28283                          431   7e-142   
ref|XP_003541322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   1e-141   
ref|XP_004508054.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   2e-141   
ref|NP_001061277.1|  Os08g0224500                                       430   2e-141   
ref|XP_010669543.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      430   3e-141   
gb|KFK39737.1|  hypothetical protein AALP_AA3G281400                    428   4e-141   
ref|XP_009388760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    429   6e-141   
ref|XP_002970933.1|  hypothetical protein SELMODRAFT_267465             428   6e-141   
ref|XP_010418908.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      424   2e-140   
ref|XP_008347693.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   5e-140   
ref|XP_007154528.1|  hypothetical protein PHAVU_003G126100g             427   5e-140   
ref|XP_002445228.1|  hypothetical protein SORBIDRAFT_07g006340          426   5e-140   
ref|XP_008678187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   5e-140   
ref|XP_009369739.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   6e-140   
ref|XP_002874019.1|  glycosyl hydrolase family 17 protein               426   6e-140   
ref|XP_009783390.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   8e-140   
ref|XP_003573567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   9e-140   
emb|CDY54044.1|  BnaC09g54160D                                          422   1e-139   
ref|XP_002982430.1|  hypothetical protein SELMODRAFT_155115             424   2e-139   
gb|AAS75228.1|  unknown protein                                         431   3e-139   
dbj|BAK03700.1|  predicted protein                                      424   4e-139   
ref|XP_009610855.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    423   4e-139   
ref|XP_002966594.1|  hypothetical protein SELMODRAFT_86140              423   8e-139   
ref|XP_011093909.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    423   8e-139   
ref|XP_002991155.1|  hypothetical protein SELMODRAFT_132967             423   1e-138   
ref|XP_007012497.1|  O-Glycosyl hydrolases family 17 protein            422   3e-138   
gb|EMT08496.1|  Glucan endo-1,3-beta-glucosidase 5                      422   4e-138   
dbj|BAK03448.1|  predicted protein                                      421   5e-138   
gb|AES73764.2|  glucan endo-1,3-beta-glucosidase-like protein           420   6e-138   
ref|XP_009338848.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      421   6e-138   
ref|XP_003603513.1|  Glucan endo-1 3-beta-glucosidase                   420   6e-138   
emb|CDY38496.1|  BnaA10g16620D                                          417   1e-137   
ref|XP_011019284.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      420   2e-137   
ref|NP_197587.1|  O-Glycosyl hydrolases family 17 protein               420   2e-137   
ref|XP_009618025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    420   3e-137   
ref|XP_006287555.1|  hypothetical protein CARUB_v10000767mg             420   3e-137   
ref|XP_002309443.2|  hypothetical protein POPTR_0006s23330g             419   5e-137   
emb|CBI28113.3|  unnamed protein product                                434   5e-137   
gb|EMS53489.1|  Glucan endo-1,3-beta-glucosidase 6                      420   5e-137   
ref|XP_007011483.1|  O-Glycosyl hydrolases family 17 protein isof...    417   6e-137   
ref|XP_010939839.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    418   1e-136   
gb|KHM99319.1|  Glucan endo-1,3-beta-glucosidase 5                      416   1e-136   
gb|EMS60021.1|  Glucan endo-1,3-beta-glucosidase 8                      422   1e-136   
ref|XP_009786880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    418   1e-136   
emb|CDP18693.1|  unnamed protein product                                418   2e-136   
emb|CDP19937.1|  unnamed protein product                                417   2e-136   
ref|XP_002516181.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    417   2e-136   
gb|AES92122.2|  glucan endo-1,3-beta-glucosidase-like protein           417   2e-136   
emb|CDX88836.1|  BnaA03g08130D                                          417   3e-136   
gb|EYU25788.1|  hypothetical protein MIMGU_mgv1a027166mg                416   3e-136   
gb|EMT31300.1|  hypothetical protein F775_52596                         419   3e-136   
ref|XP_010454396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    417   3e-136   
gb|KDP33989.1|  hypothetical protein JCGZ_07560                         416   4e-136   
ref|XP_009126486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   6e-136   
gb|KFK26298.1|  hypothetical protein AALP_AA8G229900                    416   6e-136   
ref|XP_008800518.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   8e-136   
ref|XP_010420932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   9e-136   
ref|XP_009131821.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   1e-135   
ref|XP_010493199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    415   2e-135   
ref|XP_009359672.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    415   2e-135   
ref|XP_006474550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   2e-135   
ref|XP_008391995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    415   2e-135   
ref|XP_010049299.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      414   2e-135   
ref|XP_002277217.3|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      414   2e-135   
emb|CDX70948.1|  BnaC03g10320D                                          414   3e-135   
ref|XP_006400652.1|  hypothetical protein EUTSA_v10013340mg             414   3e-135   
ref|XP_004242904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   5e-135   
gb|KDO73724.1|  hypothetical protein CISIN_1g011391mg                   413   5e-135   
ref|XP_011078161.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   5e-135   
gb|EMT04543.1|  Glucan endo-1,3-beta-glucosidase 8                      412   6e-135   
ref|XP_006452923.1|  hypothetical protein CICLE_v10008127mg             413   7e-135   
ref|XP_010496624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    409   1e-134   
ref|XP_002968123.1|  hypothetical protein SELMODRAFT_231117             411   2e-134   
gb|KHN17772.1|  Glucan endo-1,3-beta-glucosidase 5                      410   2e-134   
ref|XP_008379681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    412   2e-134   
ref|XP_002968207.1|  hypothetical protein SELMODRAFT_89756              414   2e-134   
ref|XP_002976170.1|  hypothetical protein SELMODRAFT_104523             414   3e-134   
ref|XP_003609925.1|  Glucan endo-1 3-beta-glucosidase                   415   3e-134   
ref|XP_002970359.1|  hypothetical protein SELMODRAFT_231628             409   1e-133   
ref|XP_002467735.1|  hypothetical protein SORBIDRAFT_01g033200          410   2e-133   
ref|XP_006371155.1|  hypothetical protein POPTR_0019s04850g             405   3e-133   
ref|XP_006344579.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    409   3e-133   
ref|XP_004517299.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   4e-133   
gb|EYU20663.1|  hypothetical protein MIMGU_mgv1a018565mg                405   6e-133   
gb|ADN34155.1|  glucan endo-13-beta-glucosidase                         407   1e-132   
ref|NP_001147933.1|  glucan endo-1,3-beta-glucosidase 5 precursor       407   2e-132   
ref|XP_008467025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      407   3e-132   
ref|XP_004139424.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   6e-132   
ref|XP_006659939.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   6e-132   
ref|XP_008782991.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      405   8e-132   



>ref|XP_009792045.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=477

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/475 (66%), Positives = 381/475 (80%), Gaps = 4/475 (1%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             +++ IW    + L  S  +GLGVNWGTQAAQ L+P+ IVQMLKDN IDK+KLFDSDHWTV
Sbjct  4     IKMLIWVC-CLALSTSFANGLGVNWGTQAAQTLHPTTIVQMLKDNKIDKIKLFDSDHWTV  62

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
              +FAGTGIEV+ GIPNNQL +FADD D AKDWVK N+S H++DGGV IK+VAVGNEPFLK
Sbjct  63    KYFAGTGIEVMLGIPNNQLGKFADDYDFAKDWVKNNVSIHLYDGGVNIKYVAVGNEPFLK  122

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDL  669
             +YN SF    FPAL+N+QKAL+ AGLG+KIKATIPQNADVY SG  GPS+G+FRSDIRDL
Sbjct  123   SYNSSFMKSTFPALQNVQKALNSAGLGDKIKATIPQNADVYESGNSGPSQGDFRSDIRDL  182

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M KICR+ +D+ APF+VNIYPFLSL+ENKNFP+EFAFFD +AK V D G +YTNMFDANL
Sbjct  183   MQKICRFFKDNNAPFLVNIYPFLSLHENKNFPIEFAFFDDKAKLVRDNGISYTNMFDANL  242

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+ SL+KA    V VI+GEIGWPTDG+  AN+ +A+KFY GF +KMA K+GTP++ G 
Sbjct  243   DTLVVSLKKAGSPGVKVIIGEIGWPTDGDLYANVTLAKKFYSGFFKKMASKKGTPLYPGY  302

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             +E+YLFSLTDEN KSIAPG FERHWG+F YDG+PKFP+DFTG+G++ MPVGAKN+ YL  
Sbjct  303   IEYYLFSLTDENQKSIAPGSFERHWGVFKYDGQPKFPMDFTGQGHESMPVGAKNIKYLEN  362

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             +WCVL+   +D   + S++ YACS SDC+AL  G SCN LD     SYAFNMY+Q+NNQD
Sbjct  363   KWCVLNKYAEDIGKLPSSVQYACSRSDCTALSYGGSCNKLDADGNVSYAFNMYYQMNNQD  422

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVALESAATRSG--GITAVFAGIFFFCLALL  1548
             VE+C F+GLA+IV+ NAST  CLFP+ LESA  R G   +  + AG F F LA+L
Sbjct  423   VESCVFDGLAQIVEKNASTGSCLFPIGLESAGVRIGLDAMLHILAGFFIF-LAIL  476



>ref|XP_009595344.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=477

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/475 (65%), Positives = 380/475 (80%), Gaps = 4/475 (1%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             +++ IW    + L  S  +GLGVNWGTQAAQ L+P+ IVQMLKDN IDK+KLFDSDHWTV
Sbjct  4     IKMLIWAC-CLALSTSFAYGLGVNWGTQAAQTLHPTTIVQMLKDNKIDKIKLFDSDHWTV  62

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
              +FAGTGIEV+ GIPNNQL +FADD D AKDWVK N+S+H++DGGV IK+VAVGNEPFLK
Sbjct  63    KYFAGTGIEVMLGIPNNQLRKFADDYDFAKDWVKNNVSTHLYDGGVNIKYVAVGNEPFLK  122

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDL  669
             +YNGSF    FPAL+N+QKAL+ AGLG+KIKATIPQNADVY SG  GPS+G+FRSDIRDL
Sbjct  123   SYNGSFMKSTFPALQNVQKALNSAGLGDKIKATIPQNADVYESGNSGPSQGDFRSDIRDL  182

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M KICR+ +D+ APF+VNIYPFLSL+EN NFP+EFAFFD +AK V D G +YTNMFDANL
Sbjct  183   MQKICRFFKDNNAPFLVNIYPFLSLHENNNFPIEFAFFDEKAKPVRDNGISYTNMFDANL  242

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+ SL+KA    V VIVGEIGWPTDG+   N+ +A+KFY GF +KMA K+GTP++ G 
Sbjct  243   DTLVVSLKKAGSPGVKVIVGEIGWPTDGDLYGNVTLAKKFYSGFFKKMATKKGTPLYPGY  302

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             +E+YLFSLTDEN KSIAPG FERHWG+F YDG+ KFP+DFTG+G++ MPVGAKN+ YL  
Sbjct  303   IEYYLFSLTDENQKSIAPGSFERHWGVFKYDGQAKFPMDFTGQGHESMPVGAKNIKYLEN  362

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             +WCVL+   +D   + S++ YACS SDC+AL  G SCN LD     SYAFNMY+Q+N+QD
Sbjct  363   KWCVLNKYAEDIGRLPSSVQYACSRSDCTALSYGGSCNKLDADGNVSYAFNMYYQMNSQD  422

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVALESAATRSG--GITAVFAGIFFFCLALL  1548
             VE+C F+GLA+IV+ NAST  CLFP+ LE+A  R G   +  + AG F F LA+L
Sbjct  423   VESCVFDGLAQIVEKNASTGSCLFPIGLENAGVRIGLDAMLHILAGFFIF-LAIL  476



>ref|XP_004237474.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=476

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/474 (65%), Positives = 375/474 (79%), Gaps = 3/474 (1%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             ++L IW    + L  S  +GLGVNWGTQAAQ L PS IVQMLKDN IDKVKLFDSDHWTV
Sbjct  4     IKLLIWAC-CLALSTSFAYGLGVNWGTQAAQTLPPSTIVQMLKDNKIDKVKLFDSDHWTV  62

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
              +FAGTGIEV+ G+PNNQLE+FA+D D AK+WVK N+S+H+++GGV IK VAVGNEPFLK
Sbjct  63    KYFAGTGIEVMLGLPNNQLEKFANDYDFAKEWVKNNVSAHLYNGGVDIKFVAVGNEPFLK  122

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDL  669
             AYNGSF    FPAL+N+QKAL+ AGLG+KIKATIPQNADVY SG  GPS+G+FRSDIRDL
Sbjct  123   AYNGSFLKTTFPALQNVQKALNSAGLGDKIKATIPQNADVYESGNSGPSQGDFRSDIRDL  182

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M KICR+ +D+ APF+VNIYPFLSL+ENK+FP+EFAFFDG+ K+V D G +YTNMFDANL
Sbjct  183   MQKICRFFKDNNAPFLVNIYPFLSLHENKHFPLEFAFFDGQTKAVRDNGISYTNMFDANL  242

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+ SL+KA C  V +IVGEIGWPTDG+   N+ +A++FY GF +KMA K+GTP++ G 
Sbjct  243   DTLVVSLKKASCSGVKIIVGEIGWPTDGDLYGNVTLAKRFYSGFFKKMATKKGTPLYPGF  302

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             +E+YLFSLTDEN KSI PG FERHWGIF YDGKPKFP+D TG+G++ MP+GAKNV YL  
Sbjct  303   IEYYLFSLTDENQKSILPGSFERHWGIFRYDGKPKFPMDITGQGHETMPIGAKNVKYLEN  362

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             +WCVL+   +D   + S++ YACS SDC+A+  G SCN LD     SYAFNMYFQ+N QD
Sbjct  363   KWCVLNKYAEDIGKLPSSVQYACSRSDCTAVDYGGSCNKLDGDGNVSYAFNMYFQMNGQD  422

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVALESAATRSG--GITAVFAGIFFFCLAL  1545
             VE+C F+GLAKIV+ NAS + CLFP+ LES   R G   I  +  G F F   L
Sbjct  423   VESCVFDGLAKIVEKNASVDSCLFPIGLESVGVRIGVDAILNILVGFFLFLTLL  476



>emb|CDP12875.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/470 (63%), Positives = 368/470 (78%), Gaps = 9/470 (2%)
 Frame = +1

Query  145   WTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAG  324
             W  F +++ A+    +GVNWGTQAAQ L+PS++VQML+DN I KVKLFDSDHWTV FFAG
Sbjct  12    WAIFVLLVTANFAECIGVNWGTQAAQPLDPSMVVQMLQDNKIHKVKLFDSDHWTVKFFAG  71

Query  325   TGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGS  504
             TGIEV+ GIPN+QL + +    NAKDWVK N+S+HI+DGGV IKHVAVGNEPFLK+YNGS
Sbjct  72    TGIEVMLGIPNDQLSKLSH-YRNAKDWVKQNVSTHIYDGGVDIKHVAVGNEPFLKSYNGS  130

Query  505   FKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKIC  684
             F   VFPALKN+Q+ALDEAGLG+KIKA+IPQNADVY SG+GGPSEGNFRSD+R LMI+I 
Sbjct  131   FTHTVFPALKNVQRALDEAGLGDKIKASIPQNADVYDSGSGGPSEGNFRSDVRGLMIEIV  190

Query  685   RYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIW  864
              +L+++++PF+VNIYPFLSLYEN +FP+ FAFFDG A+ + D    YTNMFDANLDTL+ 
Sbjct  191   NFLKENKSPFLVNIYPFLSLYENPDFPIGFAFFDGNAQPIRDHNVQYTNMFDANLDTLVS  250

Query  865   SLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKM-AKKEGTPVHKGVVEFY  1041
             SLRKA   ++ +IVGEIGWPTDG+   N  MA+KFY G  +K+   K+G+P+    VE Y
Sbjct  251   SLRKAGAPNLEIIVGEIGWPTDGDVYGNATMAKKFYDGLFKKLVGSKKGSPLRPEPVEVY  310

Query  1042  LFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCV  1221
             LFSLTDEN KSIAPG FERHWGIF YDG+PKF +DF+G+GN++MP+GAKNV Y P+QWCV
Sbjct  311   LFSLTDENLKSIAPGYFERHWGIFRYDGQPKFALDFSGQGNNKMPIGAKNVRYYPSQWCV  370

Query  1222  LDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEAC  1401
                  KD + V  NL YAC  SDCSA++ G SC+ LD     SYAFNMYFQ+NNQD EAC
Sbjct  371   FAGA-KDMNMVIPNLDYACQRSDCSAMIAGGSCSKLDKNKHVSYAFNMYFQMNNQDFEAC  429

Query  1402  NFEGLAKIVKHNASTNGCLFPVALESAATR------SGGITAVFAGIFFF  1533
             NF+G+AKI++ NAST+ CLFP+A+ESA  R      +  + A+   + FF
Sbjct  430   NFQGMAKIIEGNASTSECLFPIAIESAGGRLENGIGASILVAILISLVFF  479



>gb|EYU31104.1| hypothetical protein MIMGU_mgv1a006003mg [Erythranthe guttata]
Length=461

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/454 (63%), Positives = 360/454 (79%), Gaps = 1/454 (0%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
             G+GVNWGTQA+Q L+PSIIVQMLKDN+I+K+KLFDSD W V +FAGTGI+V+ GIPNNQL
Sbjct  6     GMGVNWGTQASQNLHPSIIVQMLKDNNINKIKLFDSDSWVVKYFAGTGIDVMLGIPNNQL  65

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
                A D DNAKDWVK N++ H++DGGV I++VAVGNEPFLK+YNGS     FPALKNIQ+
Sbjct  66    ASLAKDYDNAKDWVKQNLTKHLYDGGVNIRYVAVGNEPFLKSYNGSNLATTFPALKNIQR  125

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNI  726
             A++E GLG+K+KATIPQNADVY SGT GPS GNFRSDIRDLM +I  + +++ +PF+VNI
Sbjct  126   AINEHGLGDKVKATIPQNADVYDSGTDGPSAGNFRSDIRDLMTQIVSFFQENGSPFLVNI  185

Query  727   YPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             YPFLSLY N +FPVEFAFFDG A  V D G +YTNM DANLDTL+WSL+KA    V VI+
Sbjct  186   YPFLSLYGNPDFPVEFAFFDGGAAPVVDGGISYTNMLDANLDTLVWSLKKAGATGVKVII  245

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GEIGWPTDG+ +A + +A++FY G  +KMA K+GTP+++  +E+YLFSLTDEN KS+APG
Sbjct  246   GEIGWPTDGDGSATVDLAKRFYDGLFKKMATKKGTPLYQEDIEYYLFSLTDENQKSVAPG  305

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
             +FERHWG+F YDGKPKFP+DF G GND+MP+ AKNVPY+ ++WCV + + K+   +  N+
Sbjct  306   DFERHWGVFQYDGKPKFPMDFKGTGNDKMPIAAKNVPYMESKWCVYNTDVKNLDKLPGNM  365

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YACS +DC++L     C+ LD  SR SYAFN++FQ+N QDVE+C F+G+A+IV+ NAST
Sbjct  366   DYACSRADCTSLNHVGPCSKLDQASRISYAFNIFFQMNAQDVESCEFDGMARIVEANAST  425

Query  1447  NGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
               CLFP+ALE +A    G   V+     F LALL
Sbjct  426   GNCLFPLALEDSAGWKLG-ARVWPATVLFGLALL  458



>ref|XP_010261306.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=481

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/452 (62%), Positives = 349/452 (77%), Gaps = 0/452 (0%)
 Frame = +1

Query  136   LAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNF  315
             L IW    V+L A+P  G+GVNWG   +  L P+ +V+MLKDN I KVKLFDSD WTVN 
Sbjct  8     LMIWVFCLVLLSANPAQGIGVNWGIIMSHPLLPATVVRMLKDNGIKKVKLFDSDSWTVNS  67

Query  316   FAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAY  495
              AG+GI+V+  IPN+QLERF+DD DNAKDWV  NI+SH++ GGV IK+VA+GNEPFLK+Y
Sbjct  68    LAGSGIQVMVAIPNDQLERFSDDYDNAKDWVHDNITSHLYKGGVDIKYVAIGNEPFLKSY  127

Query  496   NGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMI  675
             NG F +  FPALKNIQ+ALDEAGLG+KIKAT P NADVY S TG PS GNFR DIR+LMI
Sbjct  128   NGRFTNHTFPALKNIQRALDEAGLGDKIKATTPLNADVYDSSTGTPSGGNFRKDIRELMI  187

Query  676   KICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDT  855
             KI ++L  + APF+VNIYPFLSLY+N +FP+EFAFFD  +  + D G  YTN+ DAN DT
Sbjct  188   KIVKFLNANNAPFVVNIYPFLSLYQNDDFPMEFAFFDSDSSPIVDNGIKYTNVLDANHDT  247

Query  856   LIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVE  1035
             L+WSL+KA   ++ +I+GEIGWPTDG+K AN+  A++FY G  +K+A  +GTP+  G ++
Sbjct  248   LVWSLKKAGVPNLKIIIGEIGWPTDGHKKANVHYAKRFYDGLFKKLASDKGTPLRPGKMD  307

Query  1036  FYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQW  1215
              YLF L DEN KSI PG FERHWGIF YDGKPKFP+DF+G+G+D++PVGAK V YLPAQW
Sbjct  308   VYLFGLFDENMKSILPGFFERHWGIFRYDGKPKFPMDFSGQGHDKLPVGAKGVQYLPAQW  367

Query  1216  CVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVE  1395
             C+LD + K+ + V +N+ YAC+ +DCSALV G SCN +D+    SYAFNMYFQ+ NQDV+
Sbjct  368   CILDRKIKNVNLVPANMDYACTYADCSALVYGGSCNGMDIYGNVSYAFNMYFQMQNQDVQ  427

Query  1396  ACNFEGLAKIVKHNASTNGCLFPVALESAATR  1491
             AC+F+GLA +   NAS   CLFP+ + SA  R
Sbjct  428   ACDFQGLAVLTTKNASRGSCLFPIEIVSAGER  459



>gb|EPS64137.1| hypothetical protein M569_10642, partial [Genlisea aurea]
Length=474

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/472 (59%), Positives = 363/472 (77%), Gaps = 10/472 (2%)
 Frame = +1

Query  145   WTGFAVILLA----SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             W+  A ++L     +   G+GVNWGTQAAQ L P+ +VQ+LKDN IDK+KLFD D + V+
Sbjct  4     WSSAAAVILTLFAYNAAEGIGVNWGTQAAQNLQPATVVQLLKDNKIDKIKLFDYDPFVVS  63

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
               AGTGI+V+  IPNN+L+ +A++ D A DWV+ N+  ++ DG VK+++VAVGNEPFLK+
Sbjct  64    SLAGTGIDVMIAIPNNELQDYANNYDAAADWVQENVLLNLQDG-VKMRYVAVGNEPFLKS  122

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLM  672
             YNG+F+++VFPALKNIQKAL+  G+G+K+KATIPQNADVY + +G PS GNFRSDIRD M
Sbjct  123   YNGTFENIVFPALKNIQKALNAQGIGDKVKATIPQNADVYDTNSGSPSSGNFRSDIRDTM  182

Query  673   IKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLD  852
             ++I ++LRD+ +PF+VNIYPFLSLYEN NFP+ +AFF+G A+ + DKG TYTNM DAN D
Sbjct  183   VQIVQFLRDNNSPFLVNIYPFLSLYENPNFPIAYAFFEGGAQPIRDKGTTYTNMVDANFD  242

Query  853   TLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVV  1032
             +L+WSLRKA  G V +I+GEIGWPTDG+ +A   MA+KFY G+ +KMA K+GTP++ G +
Sbjct  243   SLVWSLRKANSGKVKIIIGEIGWPTDGHDDATADMAKKFYDGWFKKMASKKGTPMYPGEI  302

Query  1033  EFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQ  1212
             E+YLFSLTDEN KSIAPG+FERHWG+F YDG+PKFP+DFTG+GNDR PV AKNV Y  AQ
Sbjct  303   EYYLFSLTDENLKSIAPGDFERHWGMFQYDGQPKFPMDFTGKGNDRWPVPAKNVTYRVAQ  362

Query  1213  WCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDV  1392
             WCVLD E   +  VG N+ +ACS  DC+ L     C  ++   +ASYAFN+Y+Q+NNQ  
Sbjct  363   WCVLDPEMYGAENVGDNMNFACSFGDCTPLNHANPCAKMNQTRKASYAFNIYYQMNNQAG  422

Query  1393  EACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             ++C+FEGL KIV  NAST+ C FP+AL+SAAT   G      GI F   AL+
Sbjct  423   DSCDFEGLGKIVVLNASTDQCDFPIALKSAATAVHG-----GGILFLAAALV  469



>ref|XP_010027756.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
Length=478

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/445 (62%), Positives = 343/445 (77%), Gaps = 0/445 (0%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             + L+S  HG+GVNWG   +  L+PSI+V MLKDNHI+KVKLFD+D WTV+  AGT +EV+
Sbjct  16    VALSSVAHGIGVNWGAMMSHPLSPSIVVGMLKDNHINKVKLFDADSWTVSALAGTNMEVI  75

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
              GIPN+QL++ AD  D+AKDWVK N++ H++DGGV I++VAVGNEPFLK+YNGS      
Sbjct  76    VGIPNDQLKKLADSYDHAKDWVKENVTKHLYDGGVDIRYVAVGNEPFLKSYNGSNTKTTL  135

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDH  702
             PAL+NIQKALD AGLG+KIKAT+P NADVY S +  PS+  FR DIR +MI + ++LRD+
Sbjct  136   PALENIQKALDAAGLGDKIKATVPNNADVYESPSNKPSDAVFRKDIRGIMIDMVKFLRDN  195

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
             +APFMVNIYPFLSLY N +FP +FAF DG AKS+HDKG  YTN+FDAN DTL+W+L+KA 
Sbjct  196   KAPFMVNIYPFLSLYLNSDFPFDFAFCDGNAKSIHDKGTEYTNVFDANYDTLVWALKKAG  255

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
               D+ +IVGE+GWPTDG KNA+ K+A++FY GF++KMA  +GTP+  G ++ YLF L DE
Sbjct  256   APDLKIIVGEVGWPTDGGKNADAKLAQRFYDGFMKKMAANKGTPLRPGHLDVYLFGLLDE  315

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             + KSI PG FERHWGIF YDG+PKFP+DFTG+GND+MPV AK V YLP+QWCV +    D
Sbjct  316   DTKSIEPGMFERHWGIFRYDGQPKFPVDFTGKGNDKMPVAAKGVQYLPSQWCVFNGNNTD  375

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
               AV + L YAC+ +DCS L  GASCN+LD     SYAFNMYFQ+ +QDVE+C F G A+
Sbjct  376   KDAVVNELSYACANADCSILGYGASCNNLDANGNVSYAFNMYFQVRDQDVESCTFNGFAE  435

Query  1423  IVKHNASTNGCLFPVALESAATRSG  1497
             IV  N S   CLFPV + SA  R G
Sbjct  436   IVTRNFSKGSCLFPVQILSAGDRLG  460



>ref|XP_010086919.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB24800.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=483

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/462 (60%), Positives = 357/462 (77%), Gaps = 2/462 (0%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             V  A+     +++ A    GLGVNWGT A+  L+P+I+V +LKDN I KVKLFD+D WTV
Sbjct  9     VVCAVSAVIMIVVSADHAQGLGVNWGTMASHPLHPTIVVNLLKDNGIKKVKLFDADDWTV  68

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHD-GGVKIKHVAVGNEPFL  486
             +  AG+GIEV+  IPN+QL + A   ++AKDWVK N++ H+ D GGV I++V VGNEPFL
Sbjct  69    SSLAGSGIEVMVAIPNDQLNKLASSYNHAKDWVKENVTKHLRDNGGVDIRYVGVGNEPFL  128

Query  487   KAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRD  666
              +YNGSF    FPALKN+QKAL++AG+G+KIKATIP NAD+Y S +  PS+GNFR DIRD
Sbjct  129   SSYNGSFLKPTFPALKNVQKALNKAGVGDKIKATIPLNADIYDSSSNTPSDGNFRDDIRD  188

Query  667   LMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDAN  846
             LMI+I R+L D+++PFMVNIYPFLSLY+N NFP EFAFFDG +K+++DK   Y N+FDAN
Sbjct  189   LMIQIVRFLNDNKSPFMVNIYPFLSLYQNSNFPQEFAFFDG-SKTINDKNTQYDNVFDAN  247

Query  847   LDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG  1026
              DTL+WSLRKA   D+ ++VGE+GWPTDG+KNAN+ +A+KFY G L+K+AK +GTP+  G
Sbjct  248   HDTLVWSLRKAGVPDLKILVGEVGWPTDGDKNANVGLAKKFYDGLLKKLAKNKGTPLRPG  307

Query  1027  VVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLP  1206
              +E YLFSL DE+ KS+APG FERHWGIF YDG+PKF +DFTG+G D+M V AK V YL 
Sbjct  308   RIETYLFSLLDEDIKSVAPGHFERHWGIFRYDGQPKFAMDFTGQGQDKMLVVAKGVQYLE  367

Query  1207  AQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQ  1386
              +WCVL ++ K+  AVGS + YACSMSDC++L PG SC +L+    ASYAFNMYFQ+N+Q
Sbjct  368   KKWCVLGSDVKNMSAVGSEVNYACSMSDCTSLGPGTSCGELNEKQTASYAFNMYFQMNDQ  427

Query  1387  DVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAV  1512
              VEAC+F G+AKIV  NAS   CLFP+ +ES A R G  +AV
Sbjct  428   SVEACDFSGMAKIVTQNASHGNCLFPIQIESCAERLGFRSAV  469



>gb|KCW54346.1| hypothetical protein EUGRSUZ_I00311, partial [Eucalyptus grandis]
Length=449

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/434 (62%), Positives = 337/434 (78%), Gaps = 0/434 (0%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             + L+S  HG+GVNWG   +  L+PSI+V MLKDNHI+KVKLFD+D WTV+  AGT +EV+
Sbjct  16    VALSSVAHGIGVNWGAMMSHPLSPSIVVGMLKDNHINKVKLFDADSWTVSALAGTNMEVI  75

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
              GIPN+QL++ AD  D+AKDWVK N++ H++DGGV I++VAVGNEPFLK+YNGS      
Sbjct  76    VGIPNDQLKKLADSYDHAKDWVKENVTKHLYDGGVDIRYVAVGNEPFLKSYNGSNTKTTL  135

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDH  702
             PAL+NIQKALD AGLG+KIKAT+P NADVY S +  PS+  FR DIR +MI + ++LRD+
Sbjct  136   PALENIQKALDAAGLGDKIKATVPNNADVYESPSNKPSDAVFRKDIRGIMIDMVKFLRDN  195

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
             +APFMVNIYPFLSLY N +FP +FAF DG AKS+HDKG  YTN+FDAN DTL+W+L+KA 
Sbjct  196   KAPFMVNIYPFLSLYLNSDFPFDFAFCDGNAKSIHDKGTEYTNVFDANYDTLVWALKKAG  255

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
               D+ +IVGE+GWPTDG KNA+ K+A++FY GF++KMA  +GTP+  G ++ YLF L DE
Sbjct  256   APDLKIIVGEVGWPTDGGKNADAKLAQRFYDGFMKKMAANKGTPLRPGHLDVYLFGLLDE  315

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             + KSI PG FERHWGIF YDG+PKFP+DFTG+GND+MPV AK V YLP+QWCV +    D
Sbjct  316   DTKSIEPGMFERHWGIFRYDGQPKFPVDFTGKGNDKMPVAAKGVQYLPSQWCVFNGNNTD  375

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
               AV + L YAC+ +DCS L  GASCN+LD     SYAFNMYFQ+ +QDVE+C F G A+
Sbjct  376   KDAVVNELSYACANADCSILGYGASCNNLDANGNVSYAFNMYFQVRDQDVESCTFNGFAE  435

Query  1423  IVKHNASTNGCLFP  1464
             IV  N S   CLFP
Sbjct  436   IVTRNFSKGSCLFP  449



>ref|XP_006580871.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=462

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/451 (60%), Positives = 344/451 (76%), Gaps = 5/451 (1%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             A  V G+GVNWG  A+  ++P I+V +LKDN I KVKLFD+D WTV+ F+GT IEV+ GI
Sbjct  16    AEAVSGIGVNWGAIASHPMDPPIVVNLLKDNGIKKVKLFDADSWTVSAFSGTDIEVMVGI  75

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN+QL+  + D DNA+DWVK N+S H+HDGGV I++V+VGNEPFLK+YNGSF  + FPA+
Sbjct  76    PNDQLKELSKDQDNAEDWVKQNVSKHVHDGGVNIRYVSVGNEPFLKSYNGSFVGITFPAM  135

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +N+QKA+D+AGLG+KIK T   NADVY S +  PS+GNFR DI  +M +I ++L + ++P
Sbjct  136   ENVQKAIDKAGLGDKIKVTTALNADVYESNSNKPSDGNFRKDIYGVMKQIVKFLDEKKSP  195

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F+VNIYPFLSLY+N++FP ++AFF+G  KS  DK A YTNMFDANLDTL+WSL+K    +
Sbjct  196   FLVNIYPFLSLYQNEDFPEDYAFFEGHGKSTDDKNAHYTNMFDANLDTLVWSLKKIGHPN  255

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             V++ VGEIGWPTDG+KNAN K A +FY+GFL+KMA K+GTP+H G V  YLFSL DEN K
Sbjct  256   VSICVGEIGWPTDGDKNANDKNANRFYQGFLKKMASKKGTPLHPGPVNTYLFSLFDENMK  315

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             S+APG+FERHWGIF YDGKPKFPIDF+G+G D+MP+GAK V Y   +WCVL N    S A
Sbjct  316   SVAPGDFERHWGIFRYDGKPKFPIDFSGKGEDKMPIGAKGVRYQEHKWCVLKNNANKS-A  374

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +G +L YAC+  DC++L PG SC +LD    ASYAFN YFQIN+Q VEAC+FEGLA IV 
Sbjct  375   LGGSLSYACAGGDCTSLCPGCSCGNLDASGNASYAFNQYFQINDQSVEACDFEGLATIVS  434

Query  1432  HNASTNGCLFPVALESAATRSGGITAVFAGI  1524
              + S   C FP+A+ S    SG I  V   +
Sbjct  435   KDPSKGDCYFPIAIIS----SGNILRVMQNV  461



>gb|KHN38236.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=481

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/451 (60%), Positives = 344/451 (76%), Gaps = 5/451 (1%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             A  V G+GVNWG  A+  ++P I+V +LKDN I KVKLFD+D WTV+ F+GT IEV+ GI
Sbjct  21    AEAVSGIGVNWGAIASHPMDPPIVVNLLKDNGIKKVKLFDADSWTVSAFSGTDIEVMVGI  80

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN+QL+  + D DNA+DWVK N+S H+HDGGV I++V+VGNEPFLK+YNGSF  + FPA+
Sbjct  81    PNDQLKELSKDQDNAEDWVKQNVSKHVHDGGVNIRYVSVGNEPFLKSYNGSFVGITFPAM  140

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +N+QKA+D+AGLG+KIK T   NADVY S +  PS+GNFR DI  +M +I ++L + ++P
Sbjct  141   ENVQKAIDKAGLGDKIKVTTALNADVYESNSNKPSDGNFRKDIYGVMKQIVKFLDEKKSP  200

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F+VNIYPFLSLY+N++FP ++AFF+G  KS  DK A YTNMFDANLDTL+WSL+K    +
Sbjct  201   FLVNIYPFLSLYQNEDFPEDYAFFEGHGKSTDDKNAHYTNMFDANLDTLVWSLKKIGHPN  260

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             V++ VGEIGWPTDG+KNAN K A +FY+GFL+KMA K+GTP+H G V  YLFSL DEN K
Sbjct  261   VSICVGEIGWPTDGDKNANDKNANRFYQGFLKKMASKKGTPLHPGPVNTYLFSLFDENMK  320

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             S+APG+FERHWGIF YDGKPKFPIDF+G+G D+MP+GAK V Y   +WCVL N    S A
Sbjct  321   SVAPGDFERHWGIFRYDGKPKFPIDFSGKGEDKMPIGAKGVRYQEHKWCVLKNNANKS-A  379

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +G +L YAC+  DC++L PG SC +LD    ASYAFN YFQIN+Q VEAC+FEGLA IV 
Sbjct  380   LGGSLSYACAGGDCTSLCPGCSCGNLDASGNASYAFNQYFQINDQSVEACDFEGLATIVS  439

Query  1432  HNASTNGCLFPVALESAATRSGGITAVFAGI  1524
              + S   C FP+A+ S    SG I  V   +
Sbjct  440   KDPSKGDCYFPIAIIS----SGNILRVMQNV  466



>ref|XP_002275701.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
Length=481

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 350/473 (74%), Gaps = 8/473 (2%)
 Frame = +1

Query  142   IWTGFAVILLA-SPVHG--LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             +W   +V+LLA +  HG  LGVNWGTQA+  L PSI+V++LKDN I+KVKLFD+D WTVN
Sbjct  8     VWAFLSVVLLAFNTSHGDALGVNWGTQASHILQPSIVVRLLKDNGINKVKLFDADSWTVN  67

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
               AG+GIEV+ GIPN  L+R+ +    AK WV+ N++ H++DGGV I++VAVGNEPFL +
Sbjct  68    ALAGSGIEVMVGIPNKDLQRY-NSYKKAKHWVEKNVTKHLYDGGVDIRYVAVGNEPFLTS  126

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLM  672
             YNGSF +  FPAL NIQKALDEAG G+KIKATIP NADVY S T  PS+G FR DI+DLM
Sbjct  127   YNGSFLNTTFPALSNIQKALDEAGHGDKIKATIPLNADVYESATNKPSDGQFRKDIKDLM  186

Query  673   IKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLD  852
             IKI + L + ++ F+VNIYPFLSLY+N +FP++FAFF+G      DKG  YTN+FDAN D
Sbjct  187   IKIVKLLHEKKSAFVVNIYPFLSLYQNPDFPLDFAFFNGGGNPTEDKGVQYTNVFDANHD  246

Query  853   TLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVV  1032
             TL+W+LRKA   D+ ++VGEIGWPTDG+KNAN+K+A +FY G L+K+A  +GTP+  G +
Sbjct  247   TLVWALRKAGVPDLKILVGEIGWPTDGDKNANLKLARRFYDGLLKKLADGKGTPLRPGRL  306

Query  1033  EFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQ  1212
             + YLF L DEN KS+APG FERHWGIF +DGKPKFP+DF+G+G D+    AK V YL  +
Sbjct  307   DVYLFGLIDENMKSVAPGSFERHWGIFFFDGKPKFPMDFSGKGLDKFLEPAKGVIYLEPK  366

Query  1213  WCVLDNEQ-KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             WCVL+ +  K+   V   + YACS SDC++L  G+SCN+LD     SYAFNMYFQ+ NQD
Sbjct  367   WCVLNRDAVKNMTQVEPFVNYACSNSDCTSLGYGSSCNNLDQNGNVSYAFNMYFQMQNQD  426

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVALESAATR--SGGITAV-FAGIFFFCL  1539
             VEACNF G+ KI   NAST  CLFPV + SA  +    G++   F G+  F L
Sbjct  427   VEACNFNGMGKITTKNASTGTCLFPVQMMSAGEKLIGYGVSVTGFMGLVLFGL  479



>emb|CAN62816.1| hypothetical protein VITISV_031885 [Vitis vinifera]
Length=481

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 348/473 (74%), Gaps = 8/473 (2%)
 Frame = +1

Query  142   IWTGFAVILLA-SPVHG--LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             +W   +V+LLA +  HG  LGVNWGTQA+  L PSI+V++LKDN I+KVKLFD+D WTVN
Sbjct  8     VWAFLSVVLLAFNTSHGDALGVNWGTQASHILQPSIVVRLLKDNGINKVKLFDADSWTVN  67

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
               AG+GIEV+ GIPN  L+R+ +    AK WV+ N++ H++DGGV I++VAVGNEPFL +
Sbjct  68    ALAGSGIEVMVGIPNKDLQRY-NSYKKAKHWVEKNVTKHLYDGGVDIRYVAVGNEPFLTS  126

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLM  672
             YNGSF +  FPAL NIQKALDEAG G+KIKATIP NADVY S T  PS+G FR DI+DLM
Sbjct  127   YNGSFLNTTFPALSNIQKALDEAGHGDKIKATIPLNADVYESATNKPSDGQFRKDIKDLM  186

Query  673   IKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLD  852
             IKI + L + ++ F+VNIYPFLSLY+N +FP++FAFF+G      DKG  YTN+FDAN D
Sbjct  187   IKIVKLLHEKKSAFVVNIYPFLSLYQNPDFPLDFAFFNGGGNPTEDKGVQYTNVFDANHD  246

Query  853   TLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVV  1032
             TL+W+LRKA   D+ ++VGEIGWPTDG+KNAN+K+A +FY G L+K+A  +GTP+  G +
Sbjct  247   TLVWALRKAGVPDLKILVGEIGWPTDGDKNANLKLARRFYDGLLKKLADGKGTPLRPGRL  306

Query  1033  EFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQ  1212
             + YLF L DEN KS+APG FERHWGIF +DGKPKFP+DF+G+G D+    AK V YL  +
Sbjct  307   DVYLFGLIDENMKSVAPGSFERHWGIFFFDGKPKFPMDFSGKGLDKFLEPAKGVIYLEPK  366

Query  1213  WCVLDNEQ-KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             WCVL+ +  K+   V   + YACS SDC++L  G+SCN+LD     SYAFNMYFQ+ NQD
Sbjct  367   WCVLNRDAVKNMTQVXPFVNYACSNSDCTSLGYGSSCNNLDQNGNVSYAFNMYFQMQNQD  426

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGI---TAVFAGIFFFCL  1539
             VEACNF G+ KI   NAST  CLFPV + SA  +  G       F G+  F L
Sbjct  427   VEACNFNGMGKITTKNASTGTCLFPVQMMSAGEKLIGYGVSVTGFMGLVLFGL  479



>ref|XP_010242326.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=480

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/451 (58%), Positives = 344/451 (76%), Gaps = 1/451 (0%)
 Frame = +1

Query  142   IWTGFAVILLASPV-HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFF  318
             IW   +V+LL+  +  G+GVNWG   +Q L+P+ +V+MLKDN I KVKLFDSD+ TV+  
Sbjct  9     IWVSCSVLLLSGHLTQGIGVNWGNIMSQPLHPTTVVRMLKDNGIKKVKLFDSDYRTVSSL  68

Query  319   AGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYN  498
             AG+GI+V+  IPN+QL+ F++D D+AK WV+ NI+SH++ GGV IK+VA+GNEPFLK+Y+
Sbjct  69    AGSGIQVMVAIPNDQLQLFSNDYDSAKYWVEENITSHLYKGGVDIKYVAIGNEPFLKSYH  128

Query  499   GSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIK  678
             G F    FP LKNIQ+ALDEAG+GNKIKATIP NADVY S TG PS G+FR DIR++M K
Sbjct  129   GVFTRHTFPTLKNIQRALDEAGVGNKIKATIPLNADVYDSSTGKPSGGSFRKDIREVMTK  188

Query  679   ICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTL  858
             I ++L  ++APF+VNIYPFLSLY N NFP+EFAFF+G +K ++D G  YTN+ DAN DTL
Sbjct  189   IVKHLNKNKAPFVVNIYPFLSLYANDNFPMEFAFFEGGSKPIYDNGVKYTNVLDANHDTL  248

Query  859   IWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEF  1038
             +WSLRKA    + +I+GEIGWPTDG+KNAN++ A++FY G  +++A  +GTP+  G ++ 
Sbjct  249   VWSLRKAGVPKLKIIIGEIGWPTDGDKNANVRYAKRFYDGLFKRLASDKGTPLRAGRMDI  308

Query  1039  YLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWC  1218
             YLFSL DEN KS+ PG FERHWGIF YDGKPKF +DF+G G+D++ V AK V YLP QWC
Sbjct  309   YLFSLFDENQKSVLPGFFERHWGIFRYDGKPKFRMDFSGEGHDKLLVAAKGVKYLPRQWC  368

Query  1219  VLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             V D E K+   V +N+ +AC+ +DC+ LV G SC+ LD+  + SYAFN+YFQ+ NQ ++A
Sbjct  369   VFDREIKNMSRVPANMDFACNYADCTPLVNGGSCSGLDIKWKTSYAFNIYFQMQNQAMDA  428

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALESAATR  1491
             C+F+GLA +   N S   CLFPV + SA  R
Sbjct  429   CDFQGLAILTTKNVSRGSCLFPVQIVSAGER  459



>ref|XP_002530257.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32127.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=481

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/470 (56%), Positives = 349/470 (74%), Gaps = 11/470 (2%)
 Frame = +1

Query  136   LAIWTGFAVIL-----LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDH  300
             L +W GF +++     L++ + G+GVNWG  A+  L P I+V+MLKDN+I++VKLFD+D 
Sbjct  7     LLLW-GFCMVMVSTNVLSAVLPGIGVNWGNIASHPLPPDIVVKMLKDNNINRVKLFDADA  65

Query  301   WTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIH-DGGVKIKHVAVGNE  477
             WTVN  AG+GIEV+  IPNN L+  AD +DNAKDWVK N++ ++   GGV I++VAVGNE
Sbjct  66    WTVNALAGSGIEVMVAIPNNMLQYIADSVDNAKDWVKENVTEYLRGQGGVDIRYVAVGNE  125

Query  478   PFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSD  657
             PFL +YNGS+    FPAL+N+QKALDE G+G+KIKA++P NADVY      PS+GNFR D
Sbjct  126   PFLASYNGSYDKTTFPALQNVQKALDEEGVGDKIKASVPLNADVYEGNL--PSQGNFRKD  183

Query  658   IRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMF  837
             +RD+M KI  +L DH+APF+VNIYPF+SLY++ +FP E+AFFDG  K + DK  TYTN+F
Sbjct  184   VRDVMTKIVHHLHDHKAPFIVNIYPFISLYQSSSFPFEYAFFDGGGKKIQDKNVTYTNVF  243

Query  838   DANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPV  1017
             +AN DTL+WSL+KA   D+ ++VGE+GWPTDG+  AN  +A+KFY G L+ +A K+GTP+
Sbjct  244   EANYDTLVWSLKKAGVPDLKILVGEVGWPTDGHVYANANLAKKFYDGLLKTLAAKKGTPL  303

Query  1018  HKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVP  1197
               GV++ YLF L DE+ KS  PG FERHWGIF +DG+PKF +DF+G+GND+M + AK V 
Sbjct  304   RPGVLDVYLFGLLDEDMKSNLPGNFERHWGIFRFDGRPKFAMDFSGQGNDKMLIEAKGVQ  363

Query  1198  YLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQI  1377
             YLPA+WCVL+ E +    + + + YACS++DCS+L  G+SCN LD     SYAFNMYFQ+
Sbjct  364   YLPAKWCVLNKEVESKSMIPAEISYACSLADCSSLAYGSSCNKLDSDGNVSYAFNMYFQM  423

Query  1378  NNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATR--SGGITAVFAG  1521
             NNQDV+AC+F GLA IV  NAS   CLFP+ + S   R   G    +FAG
Sbjct  424   NNQDVQACDFSGLATIVTQNASRGTCLFPIQIVSHGDRLMLGYWVTIFAG  473



>gb|AFK43211.1| unknown [Lotus japonicus]
Length=485

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/455 (57%), Positives = 338/455 (74%), Gaps = 6/455 (1%)
 Frame = +1

Query  136   LAIWTGFAVILLASP------VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSD  297
               IW  F + +LA        + GLGVNWG  A+  L+PSI+V MLKDN I KVKLFD+D
Sbjct  6     FTIWALFLIQILAQGANGAEGIPGLGVNWGALASHSLDPSIVVAMLKDNGIKKVKLFDAD  65

Query  298   HWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNE  477
              WTV+ F+GT IEV+ GIPN+QL  FA    +A+DWV+ N++ H+H GGV I++V VGNE
Sbjct  66    SWTVSAFSGTDIEVMVGIPNDQLSNFAGSYGDAEDWVQENVTEHLHKGGVNIRYVVVGNE  125

Query  478   PFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSD  657
             PFL++YNGS+    FPA++NIQKA+D+AG+G+K+K T   NADVY S T  PSEG+FRS 
Sbjct  126   PFLESYNGSYIKATFPAMQNIQKAIDKAGVGDKVKVTTAMNADVYESATNQPSEGDFRSG  185

Query  658   IRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMF  837
             I DLM +I  +L +  +PF+VNIYPFLSLY+N+ FP EFAFFD ++ ++ DK A Y+NMF
Sbjct  186   IHDLMKQIVHFLHEKNSPFLVNIYPFLSLYQNEGFPQEFAFFDSQSSTISDKNAQYSNMF  245

Query  838   DANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPV  1017
             DANLDTL+W+L+KA   D+ ++VGE+GWPTDG+KNAN   A+KFY+GFL+KMA K+GTP+
Sbjct  246   DANLDTLVWALKKAGYPDLRIVVGEVGWPTDGDKNANPNNAKKFYQGFLKKMASKKGTPM  305

Query  1018  HKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVP  1197
               G ++ YLFSL DEN KSIAPG FERHWGIFGYDGKPKFPIDF+G+G ++ PV AK V 
Sbjct  306   RPGPMDVYLFSLFDENLKSIAPGNFERHWGIFGYDGKPKFPIDFSGQGQEKWPVAAKGVR  365

Query  1198  YLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQI  1377
             Y   +WCVL+ + K+   V   L YAC+ +DC++L  G SC +LD+   ASYAFN Y+Q 
Sbjct  366   YQEHKWCVLNRDVKNFSLVPDALSYACAGADCTSLGMGYSCGNLDVAGNASYAFNQYYQT  425

Query  1378  NNQDVEACNFEGLAKIVKHNASTNGCLFPVALESA  1482
              +Q VEAC+F G+A IV  + S   C+FP+ +ES+
Sbjct  426   RDQSVEACDFNGIANIVTEDPSKGSCVFPIEIESS  460



>ref|XP_011025580.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Populus euphratica]
Length=485

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/465 (55%), Positives = 350/465 (75%), Gaps = 5/465 (1%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             +L ++ + G+GVNWGT A+  L  +I+V MLKDN I KVKLFDSD  T+   AGTGIEV+
Sbjct  23    VLSSTVLPGIGVNWGTMASNTLPRNIVVNMLKDNGISKVKLFDSDSPTLKALAGTGIEVM  82

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
              GIPNNQ+   A D+++A+DWVK N+++++H+GGV IK+VAVGNEPFL +YN ++ ++ F
Sbjct  83    VGIPNNQMYIVAGDIEDAEDWVKENVTAYLHNGGVDIKYVAVGNEPFLSSYNNTYDNITF  142

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDH  702
             PAL+N+QKALD+AG+G+KIKAT+  NADVY S +  PS G+FR DI+ +MI+I ++L  +
Sbjct  143   PALQNVQKALDKAGVGDKIKATVALNADVYESLSDKPSGGDFRKDIKGIMIQIIKFLHQN  202

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
             +APF+VNIYPFLSLY+N  FP ++AFFDG  K++ DK  +Y+N+FDAN DTL+W+L+K  
Sbjct  203   KAPFVVNIYPFLSLYQNAGFPFDYAFFDG-GKTISDKNVSYSNVFDANYDTLVWTLKKNG  261

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
              GD+ +I+GE+GWPTDGN NAN K+A+KFY G L+K+  K+GTP+  G++E YLFSL DE
Sbjct  262   VGDLKIIIGEVGWPTDGNFNANNKLAKKFYDGLLKKLVAKKGTPLRPGLLELYLFSLIDE  321

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             N KSIAPG FERHWG+F YDGKPKFPID +G+GND+M + AK V Y+  +WCVL+ E K+
Sbjct  322   NQKSIAPGHFERHWGLFYYDGKPKFPIDLSGKGNDKMLIAAKGVQYMSPRWCVLNEENKN  381

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +   + YACS++DC++L  G+SC+ +D     SYAFNMYFQ+ +Q   ACNF GLA 
Sbjct  382   LSMIADEISYACSLADCTSLGYGSSCSKMDSDGNVSYAFNMYFQMQDQGDYACNFNGLAM  441

Query  1423  IVKHNASTNGCLFPVALESAATRSG---GITAVFAGIFFFCLALL  1548
             IVK NAS   CLFP+ L  A  R G   G++ + AG+     +L+
Sbjct  442   IVKKNASRGSCLFPLQLVGAGERLGLAYGVS-IIAGLMLAFFSLM  485



>ref|XP_009402192.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/420 (61%), Positives = 323/420 (77%), Gaps = 2/420 (0%)
 Frame = +1

Query  226   LNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDW  405
             L P+ +VQM+K N I KVKLFD+D WTV+ FAGTGIE++  IPN+ L+R + D  +A+DW
Sbjct  5     LLPTTVVQMIKSNGITKVKLFDADSWTVSAFAGTGIELMLAIPNDMLKRISSDYSHAQDW  64

Query  406   VKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKA  585
             VK N++ H +DGGV IK+VAVGNEPFL +YNGSF    FPALKNIQKALDEAG+GN+IKA
Sbjct  65    VKENVTKHDYDGGVNIKYVAVGNEPFLSSYNGSFMKTTFPALKNIQKALDEAGVGNRIKA  124

Query  586   TIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKN  759
             T+P NADVY S    P  S G+FR DI  LM+ + R++  + APF+VNIYPFLSLY+N +
Sbjct  125   TVPLNADVYNSPESNPVPSAGDFRGDIHSLMVDMVRFMHSNGAPFVVNIYPFLSLYQNPD  184

Query  760   FPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNK  939
             FP++FAFFDG  ++++DKG  YTN+FDAN DTL+WSL+KA   D+ +IVGE+GWPTDG+K
Sbjct  185   FPIDFAFFDGGGRNLNDKGHQYTNVFDANYDTLVWSLKKAGVSDMKIIVGEVGWPTDGDK  244

Query  940   NANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGY  1119
             NAN + A++FY GFL+KM + EGTP+  G ++ YLF L DE+ KS+ PG FERHWGIF Y
Sbjct  245   NANTENAKRFYDGFLKKMGQNEGTPMRPGHMDVYLFGLIDEDMKSVLPGNFERHWGIFTY  304

Query  1120  DGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSA  1299
             D +PKFP+D +G+GND+    A  V YLP QWCVL+ + K   A+G NL YACS+SDC+A
Sbjct  305   DCRPKFPMDLSGKGNDKYLKRATGVQYLPEQWCVLNPDVKQLSAMGPNLDYACSLSDCTA  364

Query  1300  LVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALES  1479
             L  G+SCNDLD    ASYAFNMYFQ+ +QDV ACNFEGLA I   NAS NGCLFPV + S
Sbjct  365   LGYGSSCNDLDRGGNASYAFNMYFQMQDQDVRACNFEGLAVITTKNASRNGCLFPVQIVS  424



>gb|KFK28168.1| hypothetical protein AALP_AA8G481200 [Arabis alpina]
Length=485

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/480 (56%), Positives = 337/480 (70%), Gaps = 4/480 (1%)
 Frame = +1

Query  118   VVGGVRLAIWTG---FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLF  288
             + GG  + +  G     V+ LAS V G GVNWG  A+  LNP I+V+MLK+N I+KVKLF
Sbjct  1     MAGGAAMLVNVGTVIMTVLTLASLVGGFGVNWGNIASHPLNPDIVVRMLKENKINKVKLF  60

Query  289   DSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAV  468
             D+D WT+N  AGTG+EV+ GIPNN LE  A+D DNAKDWVK N+++++  GGV IK+VAV
Sbjct  61    DADSWTMNALAGTGMEVMVGIPNNLLETLAEDYDNAKDWVKENVTAYLRKGGVDIKYVAV  120

Query  469   GNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNF  648
             GNEPFL AYNGSF    FPALKNI KAL EAG  N +KATIPQNA+VY S    PSEG+F
Sbjct  121   GNEPFLSAYNGSFLKTTFPALKNIHKALKEAGHTNILKATIPQNAEVYQSANDKPSEGDF  180

Query  649   RSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYT  828
             RSD++  M+ I  +  D+  PF VNIYPFLSLY N++FPVEFAF DG  K++ D G  Y 
Sbjct  181   RSDVKKTMLDIVNFFHDNDLPFTVNIYPFLSLYLNEHFPVEFAFLDGDGKTITDNGKNYD  240

Query  829   NMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEG  1008
             N+FDAN DTL++SLRKA   D+ +IVGE+GWPTDG+K A+ K+AEKFY G ++++A+  G
Sbjct  241   NVFDANYDTLVYSLRKAGIKDMKIIVGEVGWPTDGHKYASPKLAEKFYAGLMKRLAEDGG  300

Query  1009  TPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAK  1188
             TP     +E YLF L DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK
Sbjct  301   TPSRPERLEVYLFGLLDEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRKMVPVAAK  360

Query  1189  NVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMY  1368
              V YL  QWCV++ +  +   VG +L YAC   DC+A+  G++C++LD     SYAFNMY
Sbjct  361   GVQYLEKQWCVVNKDTVNLDEVGPDLDYACYHGDCTAMQGGSTCSNLDKIQNISYAFNMY  420

Query  1369  FQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             FQI +QDV AC+F+G A I K NAS   CLFPV + S +     I  VF  +  F L LL
Sbjct  421   FQIQDQDVRACDFKGAAMITKTNASVGSCLFPVQIVSGSDHV-RINFVFGRLVVFALVLL  479



>ref|XP_004170594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
Length=487

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/435 (59%), Positives = 323/435 (74%), Gaps = 1/435 (0%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             LG NWGT A+  LNP+I+V +L+DN I KVKLFDSD WTV+  AG+ IE + GIPN+QLE
Sbjct  30    LGANWGTMASHPLNPNIVVNLLEDNGIKKVKLFDSDSWTVSALAGSKIETIVGIPNDQLE  89

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               A D ++AKDWVK N+++HI+DGGV I++VAVGNEPFL AYNG++  L FPA++NIQKA
Sbjct  90    SLASDYNHAKDWVKENVTAHIYDGGVNIRYVAVGNEPFLTAYNGTYIKLTFPAMQNIQKA  149

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             LDEAG   KIK T P NADVY S T  PS+G FRSDI D M  I R+L  + A FMVNIY
Sbjct  150   LDEAGYSKKIKVTCPLNADVYESATNQPSDGQFRSDILDEMKDIVRFLSRNDAAFMVNIY  209

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVG  909
             PFLSLY N +FPV+FAFFD   KS++DKG  YTN+FDAN DTL+WSL+K   GD+ +IVG
Sbjct  210   PFLSLYLNSDFPVDFAFFDENGKSINDKGKKYTNVFDANFDTLVWSLKKIGLGDLKIIVG  269

Query  910   EIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV-VEFYLFSLTDENAKSIAPG  1086
             E+GWPTDGNK A +++A++FY G L+K+A K+GTP+     +E YLF L DE+ KSI PG
Sbjct  270   EVGWPTDGNKFATVELAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLLDEDLKSIQPG  329

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWG+F YDGKPKF +D TG+GND+  V AK V YL  +WCV+ N  KD   + S +
Sbjct  330   FFERHWGLFRYDGKPKFSLDLTGKGNDKRLVAAKGVQYLEHKWCVVKNSVKDLGTISSQI  389

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YACSMSDC++L  G+SCN+L+     SYA+NMYFQ+ +Q VEAC F   A+IV  NAS 
Sbjct  390   DYACSMSDCTSLGYGSSCNNLNSRGNISYAYNMYFQMQDQSVEACVFGESAEIVTRNASV  449

Query  1447  NGCLFPVALESAATR  1491
               CLFP+ ++S   R
Sbjct  450   GNCLFPIQIDSIGQR  464



>ref|XP_006367414.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=390

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/369 (69%), Positives = 305/369 (83%), Gaps = 1/369 (0%)
 Frame = +1

Query  136   LAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNF  315
             L IW    + L  S  +GLGVNWGTQAAQ L PS IVQMLKDN IDKVKLFDSDHWTV +
Sbjct  7     LLIWAC-CLALSTSFAYGLGVNWGTQAAQTLPPSTIVQMLKDNKIDKVKLFDSDHWTVKY  65

Query  316   FAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAY  495
             FAGTGIEV+ GIPNNQL +FADD D AK+WVK N+S+H+++GGV IK VAVGNEPFLK+Y
Sbjct  66    FAGTGIEVMLGIPNNQLAKFADDYDFAKEWVKNNVSTHLYNGGVDIKFVAVGNEPFLKSY  125

Query  496   NGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMI  675
             NGSF    FPAL+N+QKAL+ AGLG+KIKATIPQNADVY SG  GPS+G+FRSDIRDLM 
Sbjct  126   NGSFLKSTFPALQNVQKALNSAGLGDKIKATIPQNADVYESGNSGPSQGDFRSDIRDLMQ  185

Query  676   KICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDT  855
             KIC + +D+ APF+VNIYPFLSL+ENK+FP+EFAFFDG+ K+V D G +YTNMFDANLDT
Sbjct  186   KICSFFKDNTAPFLVNIYPFLSLHENKHFPIEFAFFDGQTKAVRDNGISYTNMFDANLDT  245

Query  856   LIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVE  1035
             L+ SL+KA C  V +IVGEIGWPTDG+   N+ +A++FY GF +KMA K+GTP++ G +E
Sbjct  246   LVVSLKKASCSGVKIIVGEIGWPTDGDLYGNVTLAKRFYSGFFKKMATKKGTPLYPGFIE  305

Query  1036  FYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQW  1215
             +YLFSLTDEN KSI PG FERHWGIF YDGKPKFP+D TG+G++ MP+GAKNV YL  +W
Sbjct  306   YYLFSLTDENEKSILPGSFERHWGIFRYDGKPKFPMDITGQGHEAMPIGAKNVKYLENKW  365

Query  1216  CVLDNEQKD  1242
             CVL+   +D
Sbjct  366   CVLNKYAED  374



>ref|XP_004149714.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN61959.1| hypothetical protein Csa_2G277010 [Cucumis sativus]
Length=487

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/435 (59%), Positives = 323/435 (74%), Gaps = 1/435 (0%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             LG NWGT A+  LNP+I+V +L+DN I KVKLFDSD WTV+  AG+ IE + GIPN+QLE
Sbjct  30    LGANWGTMASHPLNPNIVVNLLEDNGIKKVKLFDSDSWTVSALAGSKIETIVGIPNDQLE  89

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               A D ++AKDWVK N+++HI+DGGV I+++AVGNEPFL AYNG++  L FPA++NIQKA
Sbjct  90    SLASDYNHAKDWVKENVTAHIYDGGVNIRYIAVGNEPFLTAYNGTYIKLTFPAMQNIQKA  149

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             LDEAG   KIK T P NADVY S T  PS+G FRSDI D M  I R+L  + A FMVNIY
Sbjct  150   LDEAGYSKKIKVTCPLNADVYESATNQPSDGQFRSDILDEMKDIVRFLSRNDAAFMVNIY  209

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVG  909
             PFLSLY N +FPV+FAFFD   KS++DKG  YTN+FDAN DTL+WSL+K   GD+ +IVG
Sbjct  210   PFLSLYLNSDFPVDFAFFDENGKSINDKGKKYTNVFDANFDTLVWSLKKIGLGDLKIIVG  269

Query  910   EIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV-VEFYLFSLTDENAKSIAPG  1086
             E+GWPTDGNK A +++A++FY G L+K+A K+GTP+     +E YLF L DE+ KSI PG
Sbjct  270   EVGWPTDGNKFATVELAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLLDEDLKSIQPG  329

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWG+F YDGKPKF +D TG+GND+  V AK V YL  +WCV+ N  KD   + S +
Sbjct  330   FFERHWGLFRYDGKPKFSLDLTGKGNDKRLVAAKGVQYLEHKWCVVKNSVKDLGTISSQI  389

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YACSMSDC++L  G+SCN+L+     SYA+NMYFQ+ +Q VEAC F   A+IV  NAS 
Sbjct  390   DYACSMSDCTSLGYGSSCNNLNSRGNISYAYNMYFQMQDQSVEACVFGESAEIVTRNASV  449

Query  1447  NGCLFPVALESAATR  1491
               CLFP+ ++S   R
Sbjct  450   GSCLFPIQIDSIGQR  464



>ref|XP_002310612.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE91062.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=485

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/443 (57%), Positives = 338/443 (76%), Gaps = 1/443 (0%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             +L ++ + G+GVNWGT A+  L  +I+V MLKDN I KVKLFDSD  T+   AGTGIEV+
Sbjct  23    VLSSTVLPGIGVNWGTMASNPLPRNIVVNMLKDNGITKVKLFDSDSPTLKALAGTGIEVM  82

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
              GIPNNQ+   A D+++A+DWVK NI++++H+GGV IK+VAVGNEPFL +YN ++ ++ F
Sbjct  83    VGIPNNQMSIVAGDIEDAEDWVKENITAYLHNGGVDIKYVAVGNEPFLSSYNNTYDNITF  142

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDH  702
             PAL+N+QKALD+AG+G+KIKAT+  NADVY S +  PS G+FR DI+D+MI+I ++L  +
Sbjct  143   PALQNVQKALDKAGVGDKIKATVALNADVYESLSDKPSGGDFRKDIKDIMIQIIKFLHQN  202

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
             +APF+VNIYPFLSLY+N  FP ++AFFDG  K++ DK  +Y+N+FDAN DTL+W+L+K  
Sbjct  203   KAPFVVNIYPFLSLYQNAGFPFDYAFFDG-GKTISDKNVSYSNVFDANYDTLVWTLKKNG  261

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
              GD+ +I+GE+GWPTDGN NAN K+A+KFY G L+K+  ++GTP+  G ++ YLF L DE
Sbjct  262   VGDLKIIIGEVGWPTDGNFNANNKLAKKFYDGLLKKLVAEKGTPLRPGQLDLYLFGLIDE  321

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             N KSIAPG FERHWG+F YDGKPKFPID +G+GND+M + AK V Y+  +WCVL+ E K+
Sbjct  322   NQKSIAPGHFERHWGLFYYDGKPKFPIDLSGKGNDKMLIAAKGVQYMSPRWCVLNEENKN  381

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +   + YACS +DC++L  G+SC+ +D+    SYAFNMYFQ+ +Q   ACNF GLA 
Sbjct  382   LSMIADEISYACSSADCTSLGYGSSCSKMDIDGNVSYAFNMYFQMQDQGDYACNFNGLAM  441

Query  1423  IVKHNASTNGCLFPVALESAATR  1491
             IVK NAS   CLFP+ L  A  R
Sbjct  442   IVKTNASRGNCLFPLQLVGAGER  464



>ref|XP_006281667.1| hypothetical protein CARUB_v10027803mg [Capsella rubella]
 gb|EOA14565.1| hypothetical protein CARUB_v10027803mg [Capsella rubella]
Length=485

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/465 (57%), Positives = 329/465 (71%), Gaps = 1/465 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               V+ LA+ V G GVNWG+ A+  LNP+I+VQMLKDN I+KVKLFD+D WT+N  AG+G+
Sbjct  16    MTVLTLATLVGGFGVNWGSIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGSGM  75

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  ADD DNAKDWVK N++ ++  GGV IK+VAVGNEPFL AYNGSF  
Sbjct  76    EVMVGIPNNLLESLADDYDNAKDWVKENVTHYMRKGGVDIKYVAVGNEPFLSAYNGSFLK  135

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPALKNI KAL EAG  +KIKATIPQNA+VY S    PSEG+FR D++  M+ I  Y 
Sbjct  136   TTFPALKNIHKALKEAGHTDKIKATIPQNAEVYQSANDKPSEGDFRKDVKQTMVDIVTYF  195

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
              D+  PF VNIYPFLSLY N++FPVEFAF DG  ++++DKG  Y N+FDAN DTL+++L+
Sbjct  196   HDNDLPFTVNIYPFLSLYLNEHFPVEFAFLDGDGQTINDKGKNYDNVFDANYDTLVFALK  255

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+ +IVGE+GWPTDG+K A  K+AEKFY G ++++AK  GTP     +E YLF  
Sbjct  256   KAGIHDMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDGGTPSRPERLEVYLFGF  315

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWCV++N+
Sbjct  316   LDEDMKSILPGPFERHWGIFRYDGTPKFVLDFTGQGRKMVPVAAKGVQYLEKQWCVVNND  375

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   +G +L YAC   DC+A+  G++C+ L      SYAFNMYFQI +QDV AC+F+G
Sbjct  376   TVNLDEIGPDLDYACYHGDCTAMEAGSTCSKLTKIQNISYAFNMYFQIQDQDVRACDFKG  435

Query  1414  LAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
              A I K NAS   CLFPV + S +     I +VF     F   L 
Sbjct  436   AAMISKVNASVGSCLFPVQIISGSDDV-RINSVFGRFILFGFVLF  479



>ref|XP_009130473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brassica 
rapa]
 emb|CDY31302.1| BnaA02g34390D [Brassica napus]
Length=485

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/464 (56%), Positives = 332/464 (72%), Gaps = 1/464 (0%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
               + LAS V G GVNWG  A+  LNP I+V+MLKDN I+KVKLFD+  WT+N  AGTG+E
Sbjct  17    TTLTLASLVRGFGVNWGNIASHPLNPDIVVRMLKDNKINKVKLFDAHSWTMNTLAGTGME  76

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+ GIPNN LE  A+D +NAKDWVK N+++++  GGV IK+VAVGNEPFL AYNGSF + 
Sbjct  77    VMVGIPNNLLESLAEDYENAKDWVKENVTAYMRKGGVNIKYVAVGNEPFLSAYNGSFLET  136

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLR  696
              FPALKNI KAL EAG  +K+KATIPQNA+VY S    PSEG+FRSD++  M+ I  +  
Sbjct  137   TFPALKNIHKALKEAGHTDKMKATIPQNAEVYQSANDKPSEGDFRSDVKKTMLDIVNFFH  196

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
             D+  PF VNIYPFLSLY N++FPVEFAFFDG+ +S+ DKG  Y N+FDAN DTL++SL+K
Sbjct  197   DNDLPFTVNIYPFLSLYLNEHFPVEFAFFDGKGESIPDKGKNYDNVFDANYDTLVYSLKK  256

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A   D+ +I+GEIGWPTDG+K+A  K+AEKFY G ++++A++EGTP+    +E YLF   
Sbjct  257   AGIKDMKIIIGEIGWPTDGHKHATPKLAEKFYAGLMKRLAEEEGTPLRPERLEVYLFGFL  316

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWC+++ + 
Sbjct  317   DEDMKSIMPGPFERHWGIFRYDGTPKFMLDFTGKGRKIVPVAAKGVKYLDKQWCIVNKDT  376

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
              +   V  +L YAC   DC+A+   + C+ LD     SYAFNMY+QI  QDV AC+F+G 
Sbjct  377   INLDKVAPDLEYACYHGDCTAMKGDSRCSKLDRIQNISYAFNMYYQIQGQDVRACDFKGT  436

Query  1417  AKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             A+I K NA+   CLFP+ + S +     I+ VF   F   L LL
Sbjct  437   ARITKDNATVGSCLFPIQIVSGSD-DFRISFVFGRFFVVGLVLL  479



>ref|XP_006394112.1| hypothetical protein EUTSA_v10004092mg [Eutrema salsugineum]
 gb|ESQ31398.1| hypothetical protein EUTSA_v10004092mg [Eutrema salsugineum]
Length=485

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 325/443 (73%), Gaps = 0/443 (0%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
              V+ LAS V G GVNWG  A+  LNP I+V+MLKDN I+KVKLFD+D WT+N  AGTG+E
Sbjct  17    TVLTLASLVGGFGVNWGNIASHPLNPDIVVRMLKDNKINKVKLFDADSWTMNALAGTGME  76

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+ GIPNN LE  A+D DNAKDWVK NI++++   GV IK+VAVGNEPFL AYNGSF   
Sbjct  77    VMVGIPNNLLETLAEDYDNAKDWVKENITAYMRKDGVNIKYVAVGNEPFLSAYNGSFLKT  136

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLR  696
              FPALKNI +AL EAG  +K+KATIPQNA+VY S    PSEG+FRSD++  M+ I ++ +
Sbjct  137   TFPALKNIHRALKEAGHTDKMKATIPQNAEVYQSANDKPSEGDFRSDVKQTMLDIVKFFK  196

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
             D+  PF VNIYPFLSLY N++FP EFAF DG  +++ D G  Y N+FDAN DTL+++LRK
Sbjct  197   DNDLPFTVNIYPFLSLYLNQHFPFEFAFLDGDGQTIPDNGKNYDNVFDANYDTLVYALRK  256

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A   D+ +IVGE+GWPTDG+K A  K+AEKFY G ++++AK  GTP+    +E YLF L 
Sbjct  257   AGIKDMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDGGTPLRPERLEVYLFGLL  316

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PVGAK V Y+  QWCV++ + 
Sbjct  317   DEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRKIVPVGAKGVQYMDKQWCVVNKDT  376

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
              +   VG +L YAC   DC+A+  G++C+ LD     SYAFNMYFQI  QDV AC+F+G 
Sbjct  377   INLEEVGPDLDYACYHGDCTAMEGGSTCSKLDKIQNISYAFNMYFQIQGQDVRACDFKGA  436

Query  1417  AKIVKHNASTNGCLFPVALESAA  1485
             A I K+NAS   CLFPV + SA+
Sbjct  437   AMITKNNASVGSCLFPVQIVSAS  459



>ref|XP_009393970.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=479

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/464 (57%), Positives = 339/464 (73%), Gaps = 11/464 (2%)
 Frame = +1

Query  145   WTGFAVILLASPV-------HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHW  303
             W  F V+++++ V        G+GVNWGT  +  + P+ +VQMLKDN I KVKLFD+D W
Sbjct  3     WAAFIVLVVSAAVLPSPATADGVGVNWGTMMSHPMLPTTVVQMLKDNGIRKVKLFDADPW  62

Query  304   TVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPF  483
             TV   AGT IEV+  IPN+QL+R      +A +WVK N++ + H+GGV IK+VAVGNEPF
Sbjct  63    TVGALAGTAIEVMLAIPNDQLQRMCKH-KHAAEWVKENVTQYDHEGGVHIKYVAVGNEPF  121

Query  484   LKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSD  657
             LK+YNGSF +  FPALKN+Q ALDEAG+G++IKA +P NADVY S    P  S G+FR D
Sbjct  122   LKSYNGSFINSTFPALKNVQSALDEAGVGDRIKAVVPLNADVYFSPANDPVPSAGSFRKD  181

Query  658   IRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMF  837
             I +LM+ I R+L  + APF+VNIYPFLSL +N NFPVEFAFFDG ++ V DKGA YTN+F
Sbjct  182   IEELMVDIVRFLNSNGAPFVVNIYPFLSLNQNPNFPVEFAFFDGGSQPVTDKGAQYTNVF  241

Query  838   DANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPV  1017
             DAN DTL+WS++KA   D+ + +GEIGWPTDG KNAN+  A++F+ GF RKMAKKEGTP+
Sbjct  242   DANYDTLVWSVKKAGVPDMKITIGEIGWPTDGVKNANVDYAKRFFDGFSRKMAKKEGTPL  301

Query  1018  HKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVP  1197
               G ++FYLF L DE+ KS+ PG FERHWGIF +DGKPKFP+D +G+G D   VGAK V 
Sbjct  302   RPGPLDFYLFGLLDEDMKSVLPGNFERHWGIFTFDGKPKFPMDLSGKGKDEYLVGAKGVQ  361

Query  1198  YLPAQWCVLDNEQKDS-HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQ  1374
             +LPAQWCVL+ E + +  ++ S++ YAC+ +DC+AL  G+SCN L      SYAFN YFQ
Sbjct  362   HLPAQWCVLNVEDRGNFRSIPSSVNYACANADCTALGYGSSCNGLSSEGNVSYAFNSYFQ  421

Query  1375  INNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGIT  1506
               +QDV ACNF+GLA IV  N ST  CLFPV + S A ++  ++
Sbjct  422   TMDQDVRACNFDGLATIVTTNMSTGSCLFPVQILSNAQKTAALS  465



>ref|XP_002864921.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41180.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/444 (58%), Positives = 321/444 (72%), Gaps = 0/444 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               V+ LAS V G GVNWG  A+  LNP+I+VQMLKDN I+KVKLFD+D WT+N  AGTG+
Sbjct  16    MTVLTLASLVGGFGVNWGNIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGTGM  75

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  ADD DNAKDWVK N++ ++  GGV IK+VAVGNEPFL AYNGSF  
Sbjct  76    EVMVGIPNNLLETLADDYDNAKDWVKENVTQYMRKGGVDIKYVAVGNEPFLSAYNGSFLK  135

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPALKNI +AL EAG  +K+KATIPQNA+VY S    PSEG+FR D++  M+ I  + 
Sbjct  136   TTFPALKNIHRALKEAGHTDKMKATIPQNAEVYQSANDKPSEGDFRKDVKQTMLDIVNFF  195

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
              D+  PF VNIYPFLSLY N++FPVEFAF DG  +++ DKG  Y N+FDAN DTL+++L+
Sbjct  196   HDNDLPFTVNIYPFLSLYLNEHFPVEFAFLDGNGQTMTDKGKNYDNVFDANYDTLVYALK  255

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+ +IVGE+GWPTDG+K A  K+AEKFY G ++++AK  GTP     +E YLF  
Sbjct  256   KAGIHDMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDGGTPTRPERLEVYLFGF  315

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWCV++N+
Sbjct  316   LDEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRQMVPVAAKGVQYLEKQWCVVNND  375

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   VG +L YAC   DC+A+  G++C+ L      SYAFNMYFQI +QDV AC+F+G
Sbjct  376   TVNLDEVGPDLDYACYHGDCTAMEAGSTCSKLTKVQNISYAFNMYFQIQDQDVRACDFKG  435

Query  1414  LAKIVKHNASTNGCLFPVALESAA  1485
              A I K NAS   CLFPV + S +
Sbjct  436   AAMITKVNASVGSCLFPVQIVSGS  459



>emb|CDY46823.1| BnaC02g43310D [Brassica napus]
Length=485

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/465 (56%), Positives = 331/465 (71%), Gaps = 1/465 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
                + LAS V G GVNWG  A+  LNP I+V+MLKDN I+KVKLFD+  WT+N  AGTG+
Sbjct  16    MTTLTLASLVRGFGVNWGNIASHPLNPDIVVRMLKDNKINKVKLFDAHSWTMNTLAGTGM  75

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  A+D +NAKDWVK N+++++  GGV IK+VAVGNEPFL AYNGSF +
Sbjct  76    EVMVGIPNNLLESLAEDYENAKDWVKENVTAYMRKGGVNIKYVAVGNEPFLSAYNGSFLE  135

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPALKNI KAL EAG  +K+KATIPQNA+VY S    PSEG+FRSD++  M+ I  + 
Sbjct  136   TTFPALKNIHKALKEAGHTDKMKATIPQNAEVYQSANDKPSEGDFRSDVKKTMLDIVNFF  195

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
              D+  PF VNIYPFLSLY N++FPVEFAFFDG+ +S+ DKG  Y N+FDAN DTL++SL+
Sbjct  196   HDNDLPFTVNIYPFLSLYLNEHFPVEFAFFDGKGESIPDKGKNYDNVFDANYDTLVYSLK  255

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+ +I+GEIGWPTDG+K+A  K+AEKFY G ++++AK+EGTP+    +E YLF  
Sbjct  256   KAGIKDMKIIIGEIGWPTDGHKHATPKLAEKFYAGLMKRLAKEEGTPLRPERLEVYLFGF  315

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWC+++ +
Sbjct  316   LDEDMKSIMPGPFERHWGIFRYDGTPKFMLDFTGKGRKIVPVAAKGVEYLDKQWCIVNKD  375

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   V  +L YAC   DC+A+   + C+ LD     SYAFNMY+QI  QDV+AC+F+G
Sbjct  376   TINLDKVAPDLEYACYHGDCTAMKGDSRCSKLDRIQNISYAFNMYYQIQGQDVKACDFKG  435

Query  1414  LAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
              A+I K NA+   CLFP+ + S +     I  VF       L LL
Sbjct  436   TARITKDNATVGSCLFPIQIVSGSD-DFSINFVFGRFIVVGLVLL  479



>ref|XP_008457953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis melo]
Length=487

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/435 (59%), Positives = 323/435 (74%), Gaps = 1/435 (0%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             LGVNWG+ A+  LNP+I+V +LKDN I KVKLFDSD WTVN  +G+ IE + GIPN+QLE
Sbjct  30    LGVNWGSMASHPLNPNIVVNLLKDNGIKKVKLFDSDSWTVNALSGSKIETIVGIPNDQLE  89

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               A + ++AKDWVK NI++HI+DGGV I++VAVGNEPFL AYNG++  L FPA++NIQKA
Sbjct  90    SLATNYNHAKDWVKENITAHIYDGGVNIRYVAVGNEPFLTAYNGTYVKLTFPAMQNIQKA  149

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             L+EAG   KIK T P NADVY S +  PS+G FRSDI D M +I ++L  + A FMVNIY
Sbjct  150   LNEAGYNKKIKVTCPLNADVYESASNHPSDGQFRSDILDEMKEIVQFLDRNNAAFMVNIY  209

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVG  909
             PFLSLY N +FPV+FAF D   +S++DKG TYTN+ DAN DTL+WSL+K   GD+ +IVG
Sbjct  210   PFLSLYLNPDFPVDFAFMDENGRSINDKGKTYTNVLDANYDTLVWSLKKIGHGDMKIIVG  269

Query  910   EIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV-VEFYLFSLTDENAKSIAPG  1086
             E+GWPTDGNK A + +A++FY G L+K+A K+GTP+     +E YLF L DE+ KSI PG
Sbjct  270   EVGWPTDGNKFATVGLAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLFDEDTKSIQPG  329

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWG+F YDGKPKFPIDFTG+ ND+M V AK V YL  +WCV+ N  KD   + S +
Sbjct  330   FFERHWGLFRYDGKPKFPIDFTGKDNDKMLVAAKGVQYLEHKWCVVKNSVKDLRTISSQV  389

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YACSMSDC+ L  G+SCN+L+     SYA+NMYFQ+ +Q VEAC F   A+IV  NAS 
Sbjct  390   DYACSMSDCTTLGYGSSCNNLNAKGNISYAYNMYFQMQDQSVEACVFGDSAEIVTKNASV  449

Query  1447  NGCLFPVALESAATR  1491
               CLFP+ + S   R
Sbjct  450   GNCLFPIQIVSVGQR  464



>ref|XP_006837787.1| hypothetical protein AMTR_s00104p00085600 [Amborella trichopoda]
 gb|ERN00356.1| hypothetical protein AMTR_s00104p00085600 [Amborella trichopoda]
Length=479

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/438 (58%), Positives = 328/438 (75%), Gaps = 2/438 (0%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
              GLGVNWG  A   L P I+VQMLKDN I KVKLFD+D WT++   G+GIEV   IPN+ 
Sbjct  21    EGLGVNWGNMATHPLKPDIVVQMLKDNGIKKVKLFDADAWTLSSLVGSGIEVTVAIPNDM  80

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L R A   ++AK+WVK N++ + ++GGV IK+VAVGNEPFL +YNGSF    FPAL+NIQ
Sbjct  81    LGRMAGKYEHAKEWVKKNVTRYNYEGGVNIKYVAVGNEPFLTSYNGSFMKSTFPALQNIQ  140

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFM  717
             KAL+EAG+G+KIKATIP NADVY S +  P  S G+FR+DIR LM +I  +L +H +PFM
Sbjct  141   KALNEAGIGDKIKATIPLNADVYNSPSDDPMPSSGDFRADIRSLMKEIVHFLNEHNSPFM  200

Query  718   VNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVN  897
             VNIYPFLSLY+NKNFPV+FAFFDG +K ++DKG +Y N+FDAN DTL+WSLRKA   ++N
Sbjct  201   VNIYPFLSLYQNKNFPVDFAFFDGGSKPLNDKGLSYLNVFDANFDTLVWSLRKAGVPNMN  260

Query  898   VIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSI  1077
             + VGE+GWPTDG+KN N+ +A++FY G ++ +A  +GTP+  G +E YLFSL DE+AKSI
Sbjct  261   IAVGEVGWPTDGDKNGNVMLAKRFYNGLIKNLANNKGTPLKPGHIETYLFSLLDEDAKSI  320

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
              PG+FERHWGIF +DGKPKF +D +G G ++  VGAKNV Y+P QWCV+     D   V 
Sbjct  321   LPGDFERHWGIFRFDGKPKFEMDLSGEGREKQLVGAKNVEYMPRQWCVMKPGHVDVAKVA  380

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
             +N+ YACS+SDC++L    SC  LD+    SYAFNMYFQ  +QDV+ACNF+GLA I   N
Sbjct  381   NNVDYACSLSDCTSLGFERSCGYLDLKGNVSYAFNMYFQTQDQDVQACNFQGLAMITTKN  440

Query  1438  ASTNGCLFPVALESAATR  1491
              + + CLFP+ + S + R
Sbjct  441   PAHDTCLFPIQIVSPSER  458



>ref|XP_010520102.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Tarenaya hassleriana]
Length=483

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/446 (57%), Positives = 329/446 (74%), Gaps = 0/446 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               ++ L   V G GVNWG  A+  LNP+ +V MLKDN+I+KVKLFD+D WT+   AGTGI
Sbjct  15    LTILPLTGLVQGFGVNWGNIASHPLNPNFVVGMLKDNNINKVKLFDADPWTMETLAGTGI  74

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  A D   A+DWVK N++ ++ DGGV IK+VAVGNEPFL AYNGSF  
Sbjct  75    EVMVGIPNNMLEDLAKDYGYAEDWVKENVTKYMRDGGVNIKYVAVGNEPFLSAYNGSFLK  134

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPA KNI KAL +AG G+K++ATIPQNA+VY S +  PS+G+FRSD+++LM+ I  + 
Sbjct  135   TTFPAFKNIHKALRKAGHGDKMQATIPQNAEVYHSDSDKPSDGDFRSDVKELMLDIVNFF  194

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
             +D+  PF VNIYPFLSLY+N++FPVEFAFF+G  +++ DKG TY ++FDAN DTL+W+L+
Sbjct  195   KDNGNPFTVNIYPFLSLYQNQHFPVEFAFFNGNGQAITDKGRTYDSVFDANYDTLVWALK  254

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   ++ +I+GE+GWPTDG+  A+  +AEKFY G ++K+A  EGTP+  G ++ YLF L
Sbjct  255   KAGISNMKIIIGEVGWPTDGHIYASPSLAEKFYSGLMKKLANDEGTPLRPGKLDVYLFGL  314

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG+PKF +DFTG+G   MPVGAK V Y+  QWCV++ E
Sbjct  315   LDEDMKSILPGPFERHWGIFRYDGQPKFVLDFTGQGRKIMPVGAKGVEYMEKQWCVVNKE  374

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   VG +L YAC   DC+AL+ G++CN LD     SYAFNMYFQ+ +QDV AC+F G
Sbjct  375   TINLDNVGPDLDYACYHGDCTALLYGSTCNKLDSIGNISYAFNMYFQMQSQDVRACDFRG  434

Query  1414  LAKIVKHNASTNGCLFPVALESAATR  1491
              A IVK NAS   CLFPV + S + +
Sbjct  435   AASIVKTNASVGTCLFPVQIVSGSGK  460



>ref|XP_010444426.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=485

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/444 (58%), Positives = 319/444 (72%), Gaps = 0/444 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               V+ L S V G GVNWG  A+  LNPSI+VQMLKDN I+KVKLFD+D WT+N  AGT +
Sbjct  16    MTVLTLGSLVGGFGVNWGNIASHPLNPSIVVQMLKDNKINKVKLFDADSWTMNALAGTNM  75

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  ADD DNAKDWVK N++ ++  GGV IK+VAVGNEPFL AYNGSF  
Sbjct  76    EVMVGIPNNLLESLADDYDNAKDWVKENVTHYMRKGGVDIKYVAVGNEPFLSAYNGSFLK  135

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPALKNI KAL EAG  +KIKATIPQNA+VY S    PSEG+FR D++  M+ I  Y 
Sbjct  136   TTFPALKNIHKALKEAGHTDKIKATIPQNAEVYQSANDKPSEGDFRKDVKQTMVDIVTYF  195

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
              D+  PF VNIYPFLSLY N++FPVEFAF DG  ++++DKG  Y N+FDAN DTL+++L+
Sbjct  196   HDNDLPFTVNIYPFLSLYLNEHFPVEFAFLDGDGQTINDKGKNYDNVFDANYDTLVYALK  255

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+ +IVGE+GWPT+G+K A  K+AEKFY G ++++AK  GTP     +E YLF  
Sbjct  256   KAGIHDMKIIVGEVGWPTEGHKYATPKLAEKFYAGLMKRLAKDGGTPTRPERLEVYLFGF  315

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWCV++ +
Sbjct  316   LDEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRQILPVAAKGVQYLEKQWCVVNKD  375

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   +G +L YAC   DC+A+  G++C+ L      SYAFNMYFQI +QDV AC+F+G
Sbjct  376   TANLDEIGPDLDYACYHGDCTAMEAGSTCSKLTKIQNISYAFNMYFQIQDQDVRACDFKG  435

Query  1414  LAKIVKHNASTNGCLFPVALESAA  1485
              A I K NAS   CLFPV + S +
Sbjct  436   AAMISKVNASVGSCLFPVQIVSGS  459



>ref|NP_201284.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAA97291.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AED97951.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=485

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/444 (58%), Positives = 320/444 (72%), Gaps = 0/444 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               V+ LAS V G GVNWG  A+  LNP+I+VQMLKDN I+KVKLFD+D WT+N  AGTG+
Sbjct  16    MTVLTLASLVGGFGVNWGNIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGTGM  75

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  ADD DNAKDWVK N++ +I  GGV IK+VAVGNEPFL AYNGSF  
Sbjct  76    EVMVGIPNNLLESLADDYDNAKDWVKENVTQYIRKGGVDIKYVAVGNEPFLSAYNGSFLK  135

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPALKNI KAL EAG  N +KATIPQNA+VY S    PSEG+FR D++  M+ I  + 
Sbjct  136   TTFPALKNIHKALKEAGHTNIMKATIPQNAEVYQSANDKPSEGDFRKDVKQTMLDIVNFF  195

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
              ++  PF VNIYPFLSLY N++FPVEFAF DG  +++ DKG  Y N+FDAN DTL+++L+
Sbjct  196   HENDLPFTVNIYPFLSLYLNEHFPVEFAFLDGDGQTMTDKGKNYDNVFDANYDTLVYALK  255

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+ +IVGE+GWPTDG+K A+ K+AEKFY G ++++AK  GTP     +E YLF  
Sbjct  256   KAGIHDMKIIVGEVGWPTDGHKYASPKLAEKFYAGLMKRLAKDGGTPTRPERLEVYLFGF  315

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWCV++ +
Sbjct  316   LDEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRQMVPVAAKGVQYLEKQWCVVNKD  375

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   VG +L YAC   DC+A+  G++C+ L      SYAFNMYFQI +QDV AC+F+G
Sbjct  376   TVNLDEVGPDLDYACYHGDCTAMEAGSTCSKLTKVQNISYAFNMYFQIQDQDVRACDFKG  435

Query  1414  LAKIVKHNASTNGCLFPVALESAA  1485
              A I K NAS   CLFPV + S +
Sbjct  436   AAMITKVNASVGSCLFPVQIVSGS  459



>ref|NP_001183732.1| uncharacterized protein LOC100502325 precursor [Zea mays]
 gb|ACR38156.1| unknown [Zea mays]
 gb|AFW87159.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=488

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/468 (57%), Positives = 333/468 (71%), Gaps = 11/468 (2%)
 Frame = +1

Query  112   QPVVGGVRLAIWTGFAVILLASP-------VHGLGVNWGTQAAQFLNPSIIVQMLKDNHI  270
             QP +      +  G AV+LL +P       +  +GVNWG+Q +  L P  +V+MLK N I
Sbjct  5     QPGMDRFLQLLAAGVAVLLLVAPPAMADDDIVEVGVNWGSQLSHPLLPGSVVKMLKANRI  64

Query  271   DKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVK  450
              +VK+FD+D W V     +GIEV+ GIPN+ LE  +    NA+DWVK N++++     +K
Sbjct  65    ARVKMFDADSWPVGALVDSGIEVMLGIPNDMLETMSSSYGNAQDWVKENVTAY--GDKLK  122

Query  451   IKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG  630
             +K+VAVGNEPFLKAYNGSF    FPALKNIQKALDEAG+GN +KA +P NADVY S    
Sbjct  123   LKYVAVGNEPFLKAYNGSFMKTTFPALKNIQKALDEAGVGNTVKAVVPLNADVYVSPDDK  182

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FR DI  LM  + ++L DH APF+VNIYPFLSLY++ NFP EFAFFDG  K++ D
Sbjct  183   PSSGAFRPDINGLMTDMVKFLHDHGAPFVVNIYPFLSLYQSDNFPFEFAFFDG-GKNIQD  241

Query  811   KGA-TYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLR  987
             KG  TY+N+FDAN DTL+ +L+KA   D+ VIVGE GWPTDGNK AN K+A +FY G LR
Sbjct  242   KGGVTYSNVFDANYDTLVHALKKAGVPDLKVIVGEAGWPTDGNKYANFKLARRFYDGLLR  301

Query  988   KMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGND  1167
             K+AK EGTPV KG +E YLF L DE+ KSIAPG FERHWGIF YDGKPKFPID TG+G++
Sbjct  302   KLAKNEGTPVRKGKMEVYLFGLFDEDMKSIAPGNFERHWGIFTYDGKPKFPIDLTGQGHE  361

Query  1168  RMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
             ++     +V YLP QWCV D+  +D   + SN+ YAC+  DC+AL  G SCN LD  S  
Sbjct  362   KLLSPVTDVKYLPNQWCVFDDGAEDKSKLPSNVQYACASGDCTALGYGCSCNGLDEKSNI  421

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATR  1491
             SYAFNMYFQ+ +QDV AC+FEGLAKI   NAST GCLFPV + SA+ R
Sbjct  422   SYAFNMYFQMQDQDVRACDFEGLAKITDKNASTRGCLFPVQIISASAR  469



>ref|XP_010462737.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=485

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/465 (56%), Positives = 325/465 (70%), Gaps = 1/465 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               V+ LAS V G GVNWG  A+  LNP+I+VQMLKDN I KVKLFD+D WT+N  AGT +
Sbjct  16    MTVLTLASLVGGFGVNWGNIASHPLNPNIVVQMLKDNKISKVKLFDADSWTMNALAGTNM  75

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  ADD  NAKDWVK N++ ++  GGV IK+VAVGNEPFL AYNGSF  
Sbjct  76    EVMVGIPNNLLESLADDYGNAKDWVKENVTHYMRKGGVDIKYVAVGNEPFLSAYNGSFLK  135

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPALKNI KAL EAG  +KIKATIPQNA+VY S    PSEG+FR D++  M+ I  Y 
Sbjct  136   TTFPALKNIHKALKEAGHTDKIKATIPQNAEVYQSANDKPSEGDFRKDVKQTMVDIVTYF  195

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
              D+  PF VNIYPFLSLY N++FPVEFAF DG  ++++DKG  Y N+FDAN DTL+++L+
Sbjct  196   HDNDLPFTVNIYPFLSLYLNEHFPVEFAFLDGDGQTINDKGKNYDNVFDANYDTLVYALK  255

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+ +IVGE+GWPT+G+K A  K+AEKFY G ++++AK  GTP     +E YLF  
Sbjct  256   KAGIHDMKIIVGEVGWPTEGHKYATPKLAEKFYAGLMKRLAKDGGTPTRPERLEVYLFGF  315

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWCV++ +
Sbjct  316   LDEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRQIVPVAAKGVQYLEKQWCVVNKD  375

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   +G +L YAC   DC+A+  G++C+ L      SYAFNMY+QI +QDV AC+F+G
Sbjct  376   TANLDEIGPDLDYACYHGDCTAMEAGSTCSKLTKIQNISYAFNMYYQIQDQDVRACDFKG  435

Query  1414  LAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
              A I K NAS   CLFPV + S +     I  VF     + L LL
Sbjct  436   AAMISKVNASVGSCLFPVQIVSGSDDV-RINFVFGRFVIYGLVLL  479



>ref|XP_004504006.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=490

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/456 (54%), Positives = 333/456 (73%), Gaps = 0/456 (0%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             +  V G+GVNWG  A   L+PSI+V MLKDN I +VK+FD+D W +  F GT IE++ GI
Sbjct  29    SETVSGVGVNWGLLATNPLDPSIVVNMLKDNGIKRVKIFDTDPWILGAFTGTDIELMVGI  88

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN+QL++ +  +D AKDWVK N+S H+HDGGVKI++V+VGNE FLK+YNGS+    FPA+
Sbjct  89    PNDQLKKLSHSMDFAKDWVKHNVSKHMHDGGVKIRYVSVGNEAFLKSYNGSYIKTTFPAM  148

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +NIQ ALD+AG G+KIK T   NADVY S +  PS GNFR+DI D+M +I ++L + ++P
Sbjct  149   QNIQTALDKAGFGDKIKVTTALNADVYESSSDKPSGGNFRADIHDVMKQIVQFLDERKSP  208

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F+VNIYPFLSLY+N++FP ++AFFD  +++++D    YTN+F+AN DTL+WSL+K    D
Sbjct  209   FLVNIYPFLSLYQNEDFPQDYAFFDSSSRTINDNNHQYTNVFEANFDTLVWSLKKVGHPD  268

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             V+++VGEIGWPTDG+K AN+  A++FY GFL+KMA K+G+P+  G +  YLFSL DEN K
Sbjct  269   VSIMVGEIGWPTDGDKRANLNNAKRFYNGFLKKMASKKGSPLRPGPMNVYLFSLVDENLK  328

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             S+ PG FERHWGIF YDGKPKF ID +GRG D+MP+GAK V YL  +WCVL  E K+   
Sbjct  329   SVLPGNFERHWGIFRYDGKPKFSIDLSGRGEDKMPIGAKGVRYLENKWCVLRKEVKNMSE  388

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             V   + YAC++ DC++L  G SC++LD+    S++FN +FQ+N Q VEAC+F GLA IV 
Sbjct  389   VYGAVSYACALGDCTSLGTGCSCSNLDVAGNTSFSFNQFFQMNEQSVEACDFNGLATIVT  448

Query  1432  HNASTNGCLFPVALESAATRSGGITAVFAGIFFFCL  1539
              + S  GC FP+ + S  T   G+  +     +F L
Sbjct  449   QDPSHKGCSFPIEIYSGGTMLKGVIHLGGLFIWFVL  484



>ref|XP_010484272.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=485

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/444 (58%), Positives = 319/444 (72%), Gaps = 0/444 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               V+ LAS V G GVN G  A+  LNP+I+VQMLKDN I+KVKLFD+D WT+N  AGTG+
Sbjct  16    MTVLTLASLVGGFGVNLGNIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGTGM  75

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+ GIPNN LE  ADD  NAKDWVK N++ ++  GGV IK+VAVGNEPFL AYNGSF  
Sbjct  76    EVMVGIPNNLLESLADDYGNAKDWVKENVTHYMRKGGVDIKYVAVGNEPFLSAYNGSFLK  135

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPALKNI KAL EAG  +KIKATIPQNA+VY S    PSEG+FR D++  M+ I  Y 
Sbjct  136   TTFPALKNIHKALKEAGHTDKIKATIPQNAEVYQSANDKPSEGDFRKDVKQTMVDIVTYF  195

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
              D+  PF VNIYPFLSLY N++FPVEFAF DG  ++++DKG  Y N+FDAN DTL+++L+
Sbjct  196   HDNDLPFTVNIYPFLSLYLNEHFPVEFAFLDGDGQTINDKGKNYDNVFDANYDTLVYALK  255

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+ +IVGE+GWPTDG+K A  K+AEKFY   ++++AK  GTP     +E YLF  
Sbjct  256   KAGIHDMKIIVGEVGWPTDGHKYATPKLAEKFYARLMKRLAKDGGTPTRPERLEVYLFGF  315

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWCV++N+
Sbjct  316   LDEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRQIVPVAAKGVQYLEKQWCVVNND  375

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +   +G +L YAC   DC+A+  G++C+ L      SYAFNMYFQI +QDV AC+F+G
Sbjct  376   TANLDEIGPDLDYACYHGDCTAMEAGSTCSKLTKIQNISYAFNMYFQIQDQDVRACDFKG  435

Query  1414  LAKIVKHNASTNGCLFPVALESAA  1485
              A I K NAS   CLFPV + S +
Sbjct  436   AAMISKVNASVGSCLFPVQIVSGS  459



>gb|KDP35276.1| hypothetical protein JCGZ_09435 [Jatropha curcas]
Length=468

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 328/444 (74%), Gaps = 5/444 (1%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
              +S V GLGVNWG  A+  LNP+I+VQMLKDN I +VKLFD D WT+N  AG+GIEV+  
Sbjct  4     FSSIVPGLGVNWGNIASHPLNPNIVVQMLKDNGIKRVKLFDFDSWTLNCLAGSGIEVMVA  63

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHD-GGVKIKHVAVGNEPFLKAYNGSFKDLVFP  525
             IPN  LE  A   D+AKDWVK N++ ++ D GGV I++VAVGNEPFLKAY+G +    FP
Sbjct  64    IPNKLLEDMATSYDHAKDWVKDNVAEYLKDKGGVDIRYVAVGNEPFLKAYDGEYLKTTFP  123

Query  526   ALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHR  705
             ALKNIQKAL+E  LG+KIKATIP NADVY      PSEGNFRSD+RD+M KI ++L  H+
Sbjct  124   ALKNIQKALNEHKLGDKIKATIPFNADVYDGNK--PSEGNFRSDVRDVMQKIVKFLHQHK  181

Query  706   APFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKC  885
             APF+VNIYPF+S+Y++  FP+++AFF+G ++ V DK  +Y+N+FDAN DTL+WSL KA  
Sbjct  182   APFVVNIYPFISVYQSSGFPLDYAFFEGSSRKVSDKNVSYSNVFDANYDTLVWSLEKAGV  241

Query  886   GDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDEN  1065
              ++ ++VGEIGWPTDG+  AN + A +FY G LR++A K+GTP+  G++  YLF L DE+
Sbjct  242   PNLEILVGEIGWPTDGSPYANTQYAGRFYDGLLRRLASKKGTPLRPGIIIVYLFGLLDED  301

Query  1066  AKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDS  1245
              KSI PG FERHWGI+ YDG+PKFPID +G+G ++M V AK V YLP QWCVL  +  D+
Sbjct  302   MKSIEPGNFERHWGIYRYDGQPKFPIDLSGQGKNKMLVAAKGVQYLPKQWCVLSEDVIDA  361

Query  1246  --HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLA  1419
               + + + L YACS SDC++L  G+SC  + + S  SYAFNMYFQ+N+QDV AC+F GL 
Sbjct  362   NNNLIPAGLTYACSRSDCTSLTYGSSCGSMQLRSNVSYAFNMYFQMNDQDVAACDFNGLG  421

Query  1420  KIVKHNASTNGCLFPVALESAATR  1491
              IV  NAS   CLFP+ + S   R
Sbjct  422   TIVTRNASQGTCLFPIQIVSEGER  445



>ref|XP_009336373.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=479

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/465 (54%), Positives = 338/465 (73%), Gaps = 3/465 (1%)
 Frame = +1

Query  142   IWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             +W    ++   +   GLGVNWGT ++  L P  +VQMLKDN I KVKLFD++  T+N  A
Sbjct  8     VWVLCVILATTNLAQGLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPSTLNALA  67

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
             G+GI+V+ GIPN++LE+ AD    A++WVK N++  +HDGGV I +V VGNEP+L +YNG
Sbjct  68    GSGIQVMVGIPNDKLEKLADSFSEAQEWVKENVTKWLHDGGVSISNVGVGNEPYLTSYNG  127

Query  502   SFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKI  681
             ++    +PALKNIQKALDE+G G+K+KAT+P NADVY S +  PS+G FR DI++ M++I
Sbjct  128   TYVKTTYPALKNIQKALDESGAGDKVKATVPFNADVYESSSNKPSDGCFRKDIKNNMVEI  187

Query  682   CRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLI  861
               +LRD +APF+VNIYPFLSLY+N NFP EFAFF+G +K V D    Y N+FDAN DTLI
Sbjct  188   LCHLRDSKAPFVVNIYPFLSLYQNANFPQEFAFFEGSSKPVRDNNIEYKNVFDANCDTLI  247

Query  862   WSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFY  1041
              +L+K   G++ +++GE+GWPTDG+KNAN+K A+KFY G L+K+ K+EGTP+ +G +E Y
Sbjct  248   NALKKEGFGNMEILIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRRGKIEVY  307

Query  1042  LFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLPAQWC  1218
             LF L DE+ KS+APG+FERHWGIF YDG+PKFP+D +G+G+ ++M    + V YL  QWC
Sbjct  308   LFGLFDEDQKSVAPGDFERHWGIFRYDGQPKFPMDLSGKGSGNQMLKAVQGVEYLDKQWC  367

Query  1219  VLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             VL++  K+     + L YAC+ SDC++L  G SCN LD    ASYAFN+YFQ  +QDV A
Sbjct  368   VLNSHVKNLSQTQAELNYACAESDCTSLGTGRSCN-LDQQGNASYAFNIYFQTRDQDVRA  426

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALESA-ATRSGGITAVFAGIFF  1530
             C+F G+A I K N S   CLFPV + SA A+R G + A +A   F
Sbjct  427   CDFNGMATITKSNPSVGDCLFPVQIVSAGASRHGAVGAAYALSIF  471



>ref|XP_002438620.1| hypothetical protein SORBIDRAFT_10g022940 [Sorghum bicolor]
 gb|EER89987.1| hypothetical protein SORBIDRAFT_10g022940 [Sorghum bicolor]
Length=492

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/435 (60%), Positives = 321/435 (74%), Gaps = 4/435 (1%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWG+Q +  L P  +V+MLK N I +VKLFD+D W V     +GIEV+ GIPN+ LE
Sbjct  41    VGVNWGSQLSHPLLPDSVVKMLKKNGIARVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  100

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               +    NA+DWV  N++S+     +K+K+VAVGNEPFLKAYNGSF    FPALKNIQKA
Sbjct  101   TMSSSYGNAQDWVNENVTSY--GDKLKLKYVAVGNEPFLKAYNGSFMKTTFPALKNIQKA  158

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             LDEAG+G+K+KA +P NADVY S    PS G FR DI DLM  + ++L DH APF+VNIY
Sbjct  159   LDEAGVGDKVKAVVPLNADVYVSPDDKPSSGAFRPDIDDLMTDMVKFLHDHGAPFVVNIY  218

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGAT-YTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             PFLSLY++ NFP EFAFFDG  K+++DKG   Y N+FDAN DTL+ +L+KA   ++ VIV
Sbjct  219   PFLSLYQSSNFPFEFAFFDG-GKNINDKGGVNYDNVFDANYDTLVHALKKAGVPNLKVIV  277

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE GWPTDGNKNAN+K+A +FY G L+K+AK EGTPV KG +E YLF L DE+ KSIAPG
Sbjct  278   GEAGWPTDGNKNANLKLARRFYDGLLKKLAKNEGTPVRKGKMEVYLFGLFDEDMKSIAPG  337

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWGIF YDGKPKFPID TG+G+D++     +V YLP+QWCV D+  KD   +  NL
Sbjct  338   NFERHWGIFTYDGKPKFPIDLTGQGHDKLLSPVTDVKYLPSQWCVFDDGAKDKSKLPGNL  397

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YAC+  DC+AL  G SCN LD  S  SYAFNMYFQ+ +QDV AC F+GLAKI   NAST
Sbjct  398   QYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACEFDGLAKITDKNAST  457

Query  1447  NGCLFPVALESAATR  1491
              GCLFPV + SA+ R
Sbjct  458   RGCLFPVQIISASGR  472



>ref|XP_007048158.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOX92315.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=478

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 333/465 (72%), Gaps = 2/465 (0%)
 Frame = +1

Query  142   IWTGFAVILLASPV-HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFF  318
             +W   ++++    V   +GVNWG  ++  L+PSI+V++LKDN + KVKLFD+D W V + 
Sbjct  8     LWACTSILVTTGVVADNIGVNWGLMSSHPLHPSIVVRLLKDNGMKKVKLFDADPWAVGYL  67

Query  319   AGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYN  498
             AGTGIEV+ GIPN+QL+  A+D   A+DWVK N++ H+HDGGV IK+VAVGNEPFL +YN
Sbjct  68    AGTGIEVMLGIPNDQLKTMANDYGAAEDWVKENLTRHLHDGGVNIKYVAVGNEPFLSSYN  127

Query  499   GSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIK  678
             GSF +  FPAL+N+QKAL++AG+G+KIKAT+P NADVY SG+  PSEG FRSDI+D + +
Sbjct  128   GSFTEYTFPALRNVQKALNDAGIGDKIKATVPLNADVYESGSNIPSEGAFRSDIKDPLTQ  187

Query  679   ICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTL  858
             I  + ++   PF++NIYPFLSLY+N NFP +FAFFDG    ++DK   Y N+FDAN DTL
Sbjct  188   IVHFYKEQGCPFVINIYPFLSLYQNTNFPRDFAFFDG-GHPLNDKNVQYDNVFDANHDTL  246

Query  859   IWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEF  1038
             +W+L+KA   D+ +IVGE+GWPTDGNK A    A+KFY G  +K+A  +GTP+  G +E 
Sbjct  247   VWALKKAGVPDLKIIVGEVGWPTDGNKFATKDNAKKFYDGLFKKLASNKGTPLRPGKMEV  306

Query  1039  YLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWC  1218
             Y+FSL DE+ KS+ PG FERHWGIF +DGKPKFP+DF+G G D+  V AK V YLP QWC
Sbjct  307   YVFSLFDEDMKSVQPGNFERHWGIFTFDGKPKFPMDFSGNGTDKPLVAAKGVQYLPKQWC  366

Query  1219  VLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             V D +  +  A+ S + +ACS +DC+ L  G+SC   +   + SYAFN Y+Q N+QDVEA
Sbjct  367   VYDEDAMNQQALPSQMSWACSHADCTCLQEGSSCFTGNTNFKISYAFNSYYQTNDQDVEA  426

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFF  1533
             CNFEGL KIV  + S   C FP+ ++SA  R        A + F 
Sbjct  427   CNFEGLGKIVNEDPSKGTCQFPIRIKSAGERLSLAYGAIAALVFL  471



>ref|XP_009112157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brassica 
rapa]
Length=485

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/443 (57%), Positives = 323/443 (73%), Gaps = 0/443 (0%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
              V+ LAS V G GVNWG  A+  LNP I+V+MLK+N I+KVKLFD+D WT+N  AG+G+E
Sbjct  17    TVLTLASFVEGFGVNWGNIASHPLNPDIVVRMLKENKINKVKLFDADSWTMNALAGSGME  76

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+ GIPNN LE  ADD  NAKDWVK NI++++   GV IK+VAVGNEPFL AYNGS+   
Sbjct  77    VMVGIPNNLLETLADDYGNAKDWVKENITAYMRKDGVNIKYVAVGNEPFLSAYNGSYLKT  136

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLR  696
              FPALKNI +AL EAG  + +KATIPQNA+VY S    PSEG+FRSD++ +M+ I ++  
Sbjct  137   TFPALKNIHRALKEAGHTDVMKATIPQNAEVYESANDKPSEGDFRSDVKQIMLDIVKFFH  196

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
             D+  PF VNIYPFLSLY N++FPVE+AFFDG  +++ D G  Y N+FDAN DTL+++L K
Sbjct  197   DNDLPFTVNIYPFLSLYLNQHFPVEYAFFDGNGQTIPDNGKNYDNVFDANYDTLVYALNK  256

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A   D+ +IVGE+GWPTDG+K A  K+AEKFY G ++++AK  GTP+    +E YLF L 
Sbjct  257   AGIKDMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDVGTPLRPEKLEVYLFGLL  316

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+ KSI PG FERHWGIF YDG PKF +DFTG+G   +PV AK V YL  QWCV++ + 
Sbjct  317   DEDMKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRKIVPVAAKGVQYLDKQWCVVNKDT  376

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
              +   VG +L YAC   DC+A++ G++C++LD     SYAFNM+FQI  QDV AC+F G 
Sbjct  377   INLDEVGPDLDYACYHGDCTAMLYGSTCSNLDKIQNISYAFNMFFQIQGQDVRACDFRGS  436

Query  1417  AKIVKHNASTNGCLFPVALESAA  1485
             A I K+NAS   CLFP+ + S +
Sbjct  437   AMITKNNASVGSCLFPIQIVSGS  459



>ref|XP_003528028.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
 gb|KHN09557.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=489

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/457 (56%), Positives = 335/457 (73%), Gaps = 7/457 (2%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             + GLG+NWG  A+  LNP+++V MLKDN I KVKLFD+D WT++  +GT IEV+ GIPN+
Sbjct  29    IPGLGINWGALASHTLNPNVVVNMLKDNGIKKVKLFDADSWTLSALSGTDIEVMVGIPND  88

Query  361   QLERFADDLDNAKDWVKANISSHIHD--GGVKIKHVAVGNEPFLKAYNGSFKDLVFPALK  534
             QL +FA    +A+ WV+ N++ HIH+  G V I+HV+VGNEPF+K Y G++    FPA++
Sbjct  89    QLSKFAGSSGDAEAWVRENLTKHIHNHHGSVNIRHVSVGNEPFMKGYKGAYVKTTFPAMQ  148

Query  535   NIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             NIQKA+D+AGLG+ +K T   NADVY S +  PS+G+FRSDI D + +I   L +  +PF
Sbjct  149   NIQKAIDKAGLGDTVKVTTALNADVYESASDKPSDGDFRSDIYDAIKQILSLLHERNSPF  208

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
             +VNIYPFLSLY+N NFP EFAFFDG+ +++ DK A Y+N++DANLDTL+WSLRKA   D+
Sbjct  209   LVNIYPFLSLYQNDNFPEEFAFFDGQGRTIQDKDAQYSNVYDANLDTLVWSLRKAGYPDL  268

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGEIGWPTDGNKNAN   A++FY+G L+KM  K+GTP+  G +E YLFSLTDEN KS
Sbjct  269   RIVVGEIGWPTDGNKNANNYNAKRFYQGLLKKMVHKKGTPLRPGAMEMYLFSLTDENLKS  328

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             I PG FERHWGIFGYDG+PKFPIDF+G+G D+ PV AK V Y   QWCVL ++ K+   V
Sbjct  329   IEPGNFERHWGIFGYDGRPKFPIDFSGQGQDKWPVAAKGVVYQERQWCVLSSDVKNLSLV  388

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
              S L YAC+ +DC++L  G SC+ LD+   AS+AFN YFQ  +Q VEAC+F G+  IVK 
Sbjct  389   PSALDYACAGADCTSLGFGCSCDKLDLAGNASFAFNQYFQTRDQSVEACDFNGMGTIVKQ  448

Query  1435  NASTNGCLFPVALESA-----ATRSGGITAVFAGIFF  1530
             + S   CLFP+ +ES+     A R+ G   +   +FF
Sbjct  449   DPSKGSCLFPIEIESSGDMVRAMRAIGSILIGLALFF  485



>ref|XP_004142041.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN48417.1| hypothetical protein Csa_6G486900 [Cucumis sativus]
Length=483

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/478 (54%), Positives = 335/478 (70%), Gaps = 5/478 (1%)
 Frame = +1

Query  115   PVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDS  294
             P V    + +   F+V+  A    G+GVNWG  ++  L P+I+V++LKDN I KVKLFDS
Sbjct  8     PAVWAAVMTLGAVFSVVEGA----GIGVNWGILSSHPLRPNIVVKLLKDNGIKKVKLFDS  63

Query  295   DHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGN  474
             D WTV+  +G+ IE + GIPN+QL++FA   D+AKDWVK N++SH+ +GGV +++V+VGN
Sbjct  64    DAWTVSSLSGSKIETIIGIPNDQLKKFAKSYDDAKDWVKENVTSHMFEGGVDLRYVSVGN  123

Query  475   EPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRS  654
             E FL AYNGSF  + FPA++NIQKA+D AG G KIK T   NADVY S T  PS+G FR 
Sbjct  124   EAFLTAYNGSFVKVTFPAMQNIQKAIDAAGHGKKIKVTTALNADVYESSTNLPSDGEFRP  183

Query  655   DIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNM  834
             DI   M  I  +L  ++APFMVNIYPFLSLY+N NFP+++AFFDG  K+ +DK  +YTN+
Sbjct  184   DIYSTMKDIVHFLDRNKAPFMVNIYPFLSLYQNPNFPLDYAFFDGGGKATNDKDKSYTNV  243

Query  835   FDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTP  1014
             FDAN DTLIWSL+K    D+ +IVGE+GWPTDGNK AN+ +A++FY G  +K+A  +GTP
Sbjct  244   FDANYDTLIWSLKKLGVSDMKIIVGEVGWPTDGNKFANVNLAKRFYDGLFKKLASGDGTP  303

Query  1015  VH-KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKN  1191
             +  K   E YLF L DE+ KS+ PG FERHWGIF +DGKPKFP+D +G+GND+M V AK 
Sbjct  304   MRPKEKFEVYLFGLLDEDMKSVLPGFFERHWGIFQFDGKPKFPMDSSGKGNDKMLVAAKG  363

Query  1192  VPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYF  1371
             V YL  +WCVL    K    +   + YACS+SDC++L  G+SCN+LD     SYAFNMY+
Sbjct  364   VQYLEKKWCVLKKNVKVFDNISPQVDYACSLSDCTSLGYGSSCNNLDRRGNISYAFNMYY  423

Query  1372  QINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLAL  1545
             Q+ +Q VEAC F G A+IVK+NAS   CLFP+ + SA  R     A   G+     AL
Sbjct  424   QMQDQSVEACVFNGSAEIVKNNASVGSCLFPIQIVSAGERLKAAAAAMVGLVLSLFAL  481



>ref|XP_004164948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
Length=483

 Score =   530 bits (1366),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/478 (54%), Positives = 335/478 (70%), Gaps = 5/478 (1%)
 Frame = +1

Query  115   PVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDS  294
             P V    + +   F+V+  A    G+GVNWG  ++  L P+I+V++LKDN I KVKLFDS
Sbjct  8     PAVWAAVMTLGAVFSVVEGA----GIGVNWGILSSHPLRPNIVVKLLKDNGIKKVKLFDS  63

Query  295   DHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGN  474
             D WTV+  +G+ IE + GIPN+QL++FA   D+AKDWVK N++SH+ +GGV +++V+VGN
Sbjct  64    DAWTVSSLSGSKIETIIGIPNDQLKKFAKSYDDAKDWVKENVTSHMFEGGVDLRYVSVGN  123

Query  475   EPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRS  654
             E FL AYNGSF  + FPA++NIQKA+D AG G KIK T   NADVY S T  PS+G FR 
Sbjct  124   EAFLTAYNGSFVKVTFPAMQNIQKAIDAAGHGKKIKVTTALNADVYESSTNLPSDGEFRP  183

Query  655   DIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNM  834
             DI   M  I  +L  ++APFMVNIYPFLSLY+N NFP+++AFFDG  K+ +DK  +YTN+
Sbjct  184   DIYSTMKDIVHFLDRNKAPFMVNIYPFLSLYQNPNFPLDYAFFDGGGKATNDKDKSYTNV  243

Query  835   FDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTP  1014
             FDAN DTLIWSL+K    D+ +IVGE+GWPTDGNK AN+ +A++FY G  +K+A  +GTP
Sbjct  244   FDANYDTLIWSLKKLGVSDMKIIVGEVGWPTDGNKFANVNLAKRFYDGLFKKLASGDGTP  303

Query  1015  VH-KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKN  1191
             +  K   E YLF L DE+ KS+ PG FERHWGIF +DGKPKFP+D +G+GND+M V AK 
Sbjct  304   MRPKEKFEVYLFGLLDEDMKSVLPGFFERHWGIFLFDGKPKFPMDSSGKGNDKMLVAAKG  363

Query  1192  VPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYF  1371
             V YL  +WCVL    K    +   + YACS+SDC++L  G+SCN+LD     SYAFNMY+
Sbjct  364   VQYLEKKWCVLKKNVKVFDDISPQVDYACSLSDCTSLGYGSSCNNLDRRGNISYAFNMYY  423

Query  1372  QINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLAL  1545
             Q+ +Q VEAC F G A+IVK+NAS   CLFP+ + SA  R     A   G+     AL
Sbjct  424   QMQDQSVEACVFNGSAEIVKNNASVGSCLFPIQIVSAGERLKAAAAAMVGLVLSLFAL  481



>ref|XP_003630124.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AET04600.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=581

 Score =   532 bits (1371),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 335/445 (75%), Gaps = 1/445 (0%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+GVNWG  A   ++P+I+V M+KDN I  VK+FD+D W +  F+GT IEV+ GIPN+
Sbjct  31    VPGVGVNWGLLATNPIDPNIVVNMIKDNGIKMVKIFDTDPWILGAFSGTDIEVMVGIPND  90

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL++ +  +D A+DWVK N+S H+HDGGV I++V+VGNE FLK+YNGS+    FPA++N+
Sbjct  91    QLKKLSKSMDEAEDWVKHNVSKHMHDGGVNIRYVSVGNEAFLKSYNGSYVGTTFPAMENV  150

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             QKA+++AG G+KIK T   NADVY + +  PS GNFR+DI D+M +I ++L ++ +PF+V
Sbjct  151   QKAINKAGFGDKIKVTTALNADVYDTNSEKPSGGNFRADIFDVMKQIVKFLDENNSPFLV  210

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY+N +FP ++AFFD  ++++ D    Y+N+FDAN DTL+WSL+KA    V++
Sbjct  211   NIYPFLSLYQNDDFPEDYAFFDSSSRTISDNDIHYSNVFDANFDTLVWSLKKAGHPKVSI  270

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             ++GE+GWPTDGN++AN   A++FY+GFL+KMA K+G+P+  G ++ YLFSL DEN KS+A
Sbjct  271   MIGEVGWPTDGNRHANPNTAKRFYQGFLKKMANKKGSPLRPGPMKVYLFSLVDENLKSVA  330

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGS  1260
             PG+FERHWGIF YDGKPKFPIDF+G+G D++P+GAK V YL  +WCVL  E K+  +V  
Sbjct  331   PGDFERHWGIFRYDGKPKFPIDFSGKGQDKLPIGAKGVRYLDHKWCVLSKEVKNLSSVYG  390

Query  1261  NLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNA  1440
              LGYAC++ DC++L  G SC +LD+    SYA+N YFQ+N Q VEAC+F+G A IV  + 
Sbjct  391   PLGYACAVGDCTSLCIGCSCGNLDVRGNTSYAYNQYFQMNEQSVEACSFDGTATIVTQDP  450

Query  1441  STNGCLFPVALESAATR-SGGITAV  1512
             S   CLFP+ + S  T   GGI  V
Sbjct  451   SNGTCLFPIEIYSGGTMLQGGIHTV  475



>ref|XP_004502874.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=488

 Score =   529 bits (1362),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 249/458 (54%), Positives = 333/458 (73%), Gaps = 3/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             +  +GVNWG  A+  ++P I+  MLKDN I KVKLFD+D WTV+ FAGT IE++ GIPN+
Sbjct  31    LSNVGVNWGALASHPMDPYIVTNMLKDNGIKKVKLFDADPWTVSAFAGTDIEIMVGIPND  90

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL +FA+ L +A+DWVK NI+ H+ +  V I++VAVGNEPFLK+Y  SF    FPA++NI
Sbjct  91    QLSKFANSLSDAEDWVKENITKHLQNNLVNIRYVAVGNEPFLKSYGASFVKTTFPAMQNI  150

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
              KA+D+AG G+K+K T   NADVY S +  PS+G+FR+DIRD+M +I ++L D  +PF+V
Sbjct  151   LKAIDKAGFGDKVKVTTALNADVYESNSNKPSDGDFRNDIRDVMNQILQFLHDRNSPFLV  210

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY+++ FP +FAFFD +++++ DK   Y+N+FDANLDTL+W+L+KA   ++ +
Sbjct  211   NIYPFLSLYQSEGFPEDFAFFDTQSRTIDDKNVQYSNVFDANLDTLVWALKKAGYPEMTI  270

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             +VGEIGWPTDG+KNAN K A++FY+GFL+KMA K+GTP+  G +  YLFSL DEN KSI 
Sbjct  271   VVGEIGWPTDGDKNANTKNAKRFYQGFLKKMATKKGTPMLPGPMNVYLFSLFDENLKSIE  330

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGS  1260
             PG FERHWGIF YDG+ KFPIDF+G G D+ P GAK V Y   +WCVL  E K+   V  
Sbjct  331   PGNFERHWGIFRYDGQSKFPIDFSGNGEDKWPEGAKGVRYQENKWCVLSKEVKNMSLVPE  390

Query  1261  NLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNA  1440
              L YAC+ +DC++L  G+SC +L +   ASYAFN YFQ  +Q VEAC+F GLA IV  + 
Sbjct  391   ALDYACAGADCTSLGYGSSCGNLGIAGNASYAFNQYFQTRDQSVEACDFNGLASIVTTDP  450

Query  1441  STNGCLFPVALESAA---TRSGGITAVFAGIFFFCLAL  1545
             S   C FP+ +ESA    T    +T+ F G+  F + L
Sbjct  451   SDGTCFFPIEIESAGDMITSMRLVTSFFIGLSIFFVTL  488



>ref|XP_010928419.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=485

 Score =   526 bits (1354),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 254/442 (57%), Positives = 321/442 (73%), Gaps = 5/442 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             + G+GVNWGT  +  ++P+++VQMLK N I++VKLFD+D W VN  AGTGIEV+  IPN+
Sbjct  27    IDGIGVNWGTLMSHPMDPAMVVQMLKGNRINQVKLFDADPWIVNALAGTGIEVMLAIPND  86

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L     + +NAK+WVK N+  + H  GV IK+VAVGNEPFLK+Y GSF    FPALKNI
Sbjct  87    HLGDMGSNYENAKEWVKQNVIKYDHKDGVHIKYVAVGNEPFLKSYKGSFTSTTFPALKNI  146

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             QKALDEAG+GN+IKATIPQNAD+Y+S      PS GNFR DIR LM KI RYL    +PF
Sbjct  147   QKALDEAGVGNRIKATIPQNADIYSSPVNNSVPSAGNFRKDIRALMTKIVRYLHSKGSPF  206

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA-TYTNMFDANLDTLIWSLRKAKCGD  891
             +VNIYP+LSLY++ NFPV+FAFFDG+++ V D+G   YTN+FDAN DTL+WSLRKA   +
Sbjct  207   VVNIYPYLSLYQDPNFPVDFAFFDGKSQPVVDEGLHNYTNVFDANYDTLVWSLRKAGVPN  266

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             + +IVGE+GWPTDG++NAN K+A++FY GFL+KMA + GTP+  G +E YLF L DE+ K
Sbjct  267   MKIIVGEVGWPTDGDENANTKLAKRFYDGFLKKMAGQVGTPLRPGKMEVYLFGLIDEDMK  326

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDN--EQKDS  1245
             S+ PG FERHWGIF YDG+PKF  DFTG+  +R  +GA  V YL  +WCVLD    +K  
Sbjct  327   SVVPGNFERHWGIFTYDGRPKFATDFTGKVTERYLIGATGVQYLAERWCVLDEKAAKKKL  386

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKI  1425
               + S++ YACS  DC+ L  G+SC  L +    SYAFN YFQ  +QDV AC+F+GL KI
Sbjct  387   KLIPSSVNYACSTGDCTPLGYGSSCEGLSLWGNISYAFNAYFQTMDQDVRACDFQGLGKI  446

Query  1426  VKHNASTNGCLFPVALESAATR  1491
                N S   CLFPV + SA  R
Sbjct  447   TTANLSQGRCLFPVQIVSAGER  468



>ref|XP_007137587.1| hypothetical protein PHAVU_009G138800g [Phaseolus vulgaris]
 gb|ESW09581.1| hypothetical protein PHAVU_009G138800g [Phaseolus vulgaris]
Length=491

 Score =   525 bits (1353),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 249/461 (54%), Positives = 327/461 (71%), Gaps = 4/461 (1%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             A  V GLG+NWG  A+  LNP+I+V MLKDN   KVKLFD+D WTV+  +GT IEV+ GI
Sbjct  28    AESVPGLGINWGALASHTLNPNIVVNMLKDNGFMKVKLFDADPWTVSTLSGTNIEVMVGI  87

Query  352   PNNQLERFADDLDNAKDWVKANISSHIH--DGGVKIKHVAVGNEPFLKAYNGSFKDLVFP  525
             PN+QL +FA    +A+DWVK NI+ H+      V I++V+VGNEPF+K Y G++    FP
Sbjct  88    PNDQLSKFAGSSSSAEDWVKENITKHLRGRHETVNIRYVSVGNEPFMKDYKGAYVQTTFP  147

Query  526   ALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHR  705
             A++NI +A+++AG G+ +K T   NADVY S +  PS+G+FRSDIRD + +I  +L +  
Sbjct  148   AMQNIYRAIEKAGFGDTVKVTTALNADVYESPSNKPSDGDFRSDIRDSIQQILSFLHETN  207

Query  706   APFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKC  885
             +PF+VNIYPFLSLY+N NFP EFAFFDG  ++V D    Y N +DANLDTL+WSL+KA  
Sbjct  208   SPFLVNIYPFLSLYQNDNFPEEFAFFDGEGRTVEDNNVQYNNAYDANLDTLVWSLKKAGY  267

Query  886   GDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDEN  1065
              D+ ++VGEIGWPTDGNK+AN K A++FY+G L+ MA K+GTP+  G +E YLFSLTDEN
Sbjct  268   PDMRIVVGEIGWPTDGNKHANNKNAKRFYQGLLKNMASKQGTPLRPGAMEMYLFSLTDEN  327

Query  1066  AKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDS  1245
              KSI PG+FERHWGIFGYDG  KFP+DF+G+G D+ P+ AK V Y    WCVL ++ ++ 
Sbjct  328   MKSIEPGKFERHWGIFGYDGSAKFPLDFSGQGQDKWPIAAKGVVYQDRVWCVLSSDVRNL  387

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKI  1425
               V S L YAC+ +DC++L  G SC++LD+ + ASYAFN YFQ  +Q VEACNF GLA I
Sbjct  388   SLVPSALDYACAGADCTSLGYGCSCDNLDLATNASYAFNQYFQTRDQSVEACNFNGLATI  447

Query  1426  VKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             V  + S   C+FPV +ES+      I  +  G     LAL 
Sbjct  448   VSQDPSKGSCIFPVEIESSGDVLRAIHTL--GTLLIGLALF  486



>ref|XP_008361509.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=479

 Score =   525 bits (1351),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 335/473 (71%), Gaps = 8/473 (2%)
 Frame = +1

Query  142   IWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             +W    ++   +   GLGVNWGT ++  L P  +VQMLKDN I KVKLFD++  T+N  A
Sbjct  8     VWALSVILATTNLAQGLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPXTLNALA  67

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
             G+GI+V+ GIPN +LE+ AD    A++WVK N++  + DGGV I +V VGNEP+L +YNG
Sbjct  68    GSGIQVMVGIPNEKLEKLADSYSEAQEWVKENVTEWLRDGGVSISNVGVGNEPYLTSYNG  127

Query  502   SFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKI  681
             ++    +PALKNIQKALDE+G G K+KAT+P NADVY S +  PS+G FR DI++ M++I
Sbjct  128   TYVKTTYPALKNIQKALDESGAGGKVKATVPFNADVYESTSNKPSDGCFRKDIKNNMVEI  187

Query  682   CRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLI  861
              R+LRD +APF+VNIYPFLSLY+N +FP EFAFF+G +K V D    Y N+FDAN DTLI
Sbjct  188   LRHLRDSKAPFVVNIYPFLSLYQNADFPQEFAFFEGGSKPVRDNNIEYKNVFDANCDTLI  247

Query  862   WSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFY  1041
              +L+K   G++ +++GE+GWPTDG+KNAN+K A+KFY G L+K+ K+EGTP+ KG +E Y
Sbjct  248   NALKKEGFGNMEIVIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRKGKIEVY  307

Query  1042  LFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLPAQWC  1218
             LF L DE+ KS+APG+FERHWGIF YDG+PK P+D +G+G+ ++M    + V YL  QWC
Sbjct  308   LFGLFDEDZKSVAPGDFERHWGIFRYDGQPKXPMDLSGKGSGNQMLKAVQGVEYLDKQWC  367

Query  1219  VLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             VL++  K+     + L YAC+ SDC++L  G SCN LD     SYAFN YFQ  +QDV A
Sbjct  368   VLNSSVKNLSQTQAELNYACAESDCTSLGSGRSCN-LDQQGNVSYAFNXYFQTRDQDVRA  426

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALESA-ATRSGGITA-----VFAGIFFFCL  1539
             C+F G A I K N S   CLFPV +  A A+R G + A     +FAG+ +  +
Sbjct  427   CDFNGTATITKSNPSVGDCLFPVQIVGAGASRHGAVGAAYALSIFAGLLWMMI  479



>ref|XP_008338651.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=479

 Score =   525 bits (1351),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 335/473 (71%), Gaps = 8/473 (2%)
 Frame = +1

Query  142   IWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             +W    ++   +   GLGVNWGT ++  L P  +VQMLKDN I KVKLFD++  T+N  A
Sbjct  8     VWALSVILATTNLAQGLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPXTLNALA  67

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
             G+GI+V+ GIPN +LE+ AD    A++WVK N++  + DGGV I +V VGNEP+L +YNG
Sbjct  68    GSGIQVMVGIPNEKLEKLADSYSEAQEWVKENVTEWLRDGGVSISNVGVGNEPYLTSYNG  127

Query  502   SFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKI  681
             ++    +PALKNIQKALDE+G G K+KAT+P NADVY S +  PS+G FR DI++ M++I
Sbjct  128   TYVKTTYPALKNIQKALDESGAGGKVKATVPFNADVYESXSNKPSDGCFRKDIKNNMVEI  187

Query  682   CRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLI  861
              R+LRD +APF+VNIYPFLSLY+N +FP EFAFF+G +K V D    Y N+FDAN DTLI
Sbjct  188   LRHLRDSKAPFVVNIYPFLSLYQNADFPQEFAFFEGGSKPVRDNNIEYKNVFDANCDTLI  247

Query  862   WSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFY  1041
              +L+K   G++ +++GE+GWPTDG+KNAN+K A+KFY G L+K+ K+EGTP+ KG +E Y
Sbjct  248   NALKKEGFGNMEIVIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRKGKIEVY  307

Query  1042  LFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLPAQWC  1218
             LF L DE+ KS+APG+FERHWGIF YDG+PK P+D +G+G+ ++M    + V YL  QWC
Sbjct  308   LFGLFDEDZKSVAPGDFERHWGIFRYDGQPKXPMDLSGKGSGNQMLKAVQGVEYLDKQWC  367

Query  1219  VLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             VL++  K+     + L YAC+ SDC++L  G SCN LD     SYAFN YFQ  +QDV A
Sbjct  368   VLNSSVKNLSQTQAELNYACAESDCTSLGSGRSCN-LDQQGNVSYAFNXYFQTRDQDVRA  426

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALESA-ATRSGGITA-----VFAGIFFFCL  1539
             C+F G A I K N S   CLFPV +  A A+R G + A     +FAG+ +  +
Sbjct  427   CDFNGTATITKSNPSVGDCLFPVQIVGAGASRHGAVGAAYALSIFAGLLWMMI  479



>ref|XP_008440124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Cucumis melo]
Length=484

 Score =   525 bits (1351),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 247/460 (54%), Positives = 329/460 (72%), Gaps = 5/460 (1%)
 Frame = +1

Query  115   PVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDS  294
             P V    + +   F+V+  A    G+G NWG  ++  L P+I+V++LKDN I KVKLFDS
Sbjct  8     PAVWAAVMTVAAVFSVVEGA----GIGANWGIMSSHPLRPNIVVKLLKDNGIKKVKLFDS  63

Query  295   DHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGN  474
             D WTV+  +G+ IE + GIPN+QL++FA+  D+AKDWVK N+++H+ +GGV +++V+VGN
Sbjct  64    DSWTVSALSGSKIETVIGIPNDQLKKFAESYDDAKDWVKENVTTHMFEGGVDLRYVSVGN  123

Query  475   EPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRS  654
             E FL AYNG++  + +PA++NIQKALD AG G K+K T   NADVY S T  PS+G FR 
Sbjct  124   EAFLSAYNGTYVKVTYPAMQNIQKALDAAGHGKKVKVTTALNADVYESSTNLPSDGQFRP  183

Query  655   DIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNM  834
             DI   M  I  +L  ++APFMVNIYPFLSLY+N NFP+++AFF G AK+ +DKG +YTN+
Sbjct  184   DIYKTMKDIVHFLDRNKAPFMVNIYPFLSLYQNPNFPLDYAFFGGGAKATNDKGKSYTNV  243

Query  835   FDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTP  1014
             FDAN DTLIWSL+K    D+ +IVGE+GWPTDGNK AN+++A++FY G  +K+A   GTP
Sbjct  244   FDANYDTLIWSLKKIGVTDMKIIVGEVGWPTDGNKFANVELAKRFYDGLFKKLASGNGTP  303

Query  1015  VH-KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKN  1191
             +  K   E YLF L DE+ KS+ PG FERHWGIF +DGKPKFP+D +G+GND+M V AK 
Sbjct  304   MRPKEKFEVYLFGLLDEDMKSVLPGFFERHWGIFQFDGKPKFPMDMSGKGNDKMLVAAKG  363

Query  1192  VPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYF  1371
             V YL  +WCVL    K+   +   + YAC +SDC++L  G+SCN+LD     SYAFNMY+
Sbjct  364   VQYLEKKWCVLKENVKNFDKISKEVDYACGLSDCTSLGYGSSCNNLDKRGNISYAFNMYY  423

Query  1372  QINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATR  1491
             Q+ +Q VEAC+F G A IVK NAS   CLFP+ + S   R
Sbjct  424   QMQDQSVEACDFSGSAHIVKKNASVGSCLFPIQIVSTGER  463



>ref|XP_006656196.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=481

 Score =   524 bits (1350),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 255/458 (56%), Positives = 329/458 (72%), Gaps = 6/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V  +GVNWG+Q +  L PS +V MLK+N I KVKLFD+D W +     +GIEV+ GIPNN
Sbjct  28    VIDVGVNWGSQLSHPLLPSSVVHMLKENGISKVKLFDADPWPIGALIDSGIEVMLGIPNN  87

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              LE   +   NAKDWVK N++S+     + IK+VAVGNEPFLKAYNGSF    FPALKNI
Sbjct  88    MLETM-NSYGNAKDWVKENVTSY--GDKLNIKYVAVGNEPFLKAYNGSFMKTTFPALKNI  144

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             QKAL+EAG+G K+KAT+P NADVY S    PS G FR DI DLM  + ++L D  APF+V
Sbjct  145   QKALNEAGIGGKVKATVPLNADVYVSPDNKPSSGVFRPDIEDLMTGMVKFLHDQGAPFVV  204

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA-TYTNMFDANLDTLIWSLRKAKCGDVN  897
             NIYPFLSLY++ +FP EFAF DG  K++ DKG  +Y+N+FDAN DTL+ +++KA   ++ 
Sbjct  205   NIYPFLSLYQSDDFPFEFAFIDG-GKTIQDKGGISYSNVFDANFDTLVTAMKKAGVPNIK  263

Query  898   VIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSI  1077
             V+VGE+GWPTDG+KNAN+K+A ++Y G L+K+AK+EGTP+  G ++ Y+F L DE+ KSI
Sbjct  264   VVVGEVGWPTDGDKNANIKLARRYYDGLLKKLAKEEGTPLRPGKMDVYMFGLFDEDMKSI  323

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
              PG FERHWGIF YDGKPKFP+D TG GND++      V YLP QWCV D+E KD   + 
Sbjct  324   LPGNFERHWGIFTYDGKPKFPMDLTGHGNDKLLAAVPAVQYLPKQWCVFDDEAKDKSKLP  383

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              N+ YAC+  DC+A+  G SCN LD  S  SYAFNMYFQ+ +QDV AC+F+GLAKI + N
Sbjct  384   GNIEYACASGDCTAIGYGCSCNSLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKITEKN  443

Query  1438  ASTNGCLFPVALESAATR-SGGITAVFAGIFFFCLALL  1548
             AS +GCLFP+ + SAA   +  +   FA +    + L+
Sbjct  444   ASAHGCLFPIQVISAANHIATPVVISFAALLAVLMVLV  481



>ref|XP_008778100.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=466

 Score =   521 bits (1343),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 249/426 (58%), Positives = 312/426 (73%), Gaps = 4/426 (1%)
 Frame = +1

Query  226   LNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDW  405
             ++P+++V+MLK N I+KVKLFD+D WTVN  AGT IEV+  IPN+ L   + + +NAKDW
Sbjct  5     MDPAMVVRMLKANGINKVKLFDADPWTVNALAGTRIEVMLAIPNDHLGDMSSNYENAKDW  64

Query  406   VKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKA  585
             VK N+  H    GV IK+VAVGNEPFL++Y GSF    FPALKNIQ+ALDEAG+G++IKA
Sbjct  65    VKQNVVKHDRKDGVNIKYVAVGNEPFLRSYKGSFASTAFPALKNIQRALDEAGVGDRIKA  124

Query  586   TIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKN  759
             TIPQNAD+Y+S      PS GNFR DIR LM KI RYL    +PF+VNIYP+LSLY++ N
Sbjct  125   TIPQNADIYSSPVNDSVPSAGNFRRDIRALMTKIVRYLDSKGSPFVVNIYPYLSLYQDPN  184

Query  760   FPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNK  939
             FPV+FAFFDG+++ V D+G  YTN+FDAN DTL+WSLRKA   ++ ++VGEIGWPTDG+K
Sbjct  185   FPVDFAFFDGKSQPVVDEGLRYTNVFDANYDTLVWSLRKAGVPNMKILVGEIGWPTDGDK  244

Query  940   NANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGY  1119
             NAN K A++FY G L+K+AK+ GTP+  G +E YLF L DE+ KS+ PG FERHWGIF Y
Sbjct  245   NANTKHAKRFYDGLLKKVAKEVGTPLRPGKMEVYLFGLIDEDMKSVEPGNFERHWGIFSY  304

Query  1120  DGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE--QKDSHAVGSNLGYACSMSDC  1293
             DG+PKFP DFTG+G DR  VGA  V YLP +WC LD    +K    + S++ YACS  DC
Sbjct  305   DGRPKFPTDFTGKGKDRYLVGATGVRYLPKRWCALDETAAKKKLKMIPSSVNYACSTGDC  364

Query  1294  SALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             + L  G+SC  L +    SYAFN YFQ  +QDV AC+FEGL K+   N S   CLFPV +
Sbjct  365   TPLGYGSSCQGLSLSGNISYAFNAYFQTMDQDVRACDFEGLGKVATTNLSQGTCLFPVQI  424

Query  1474  ESAATR  1491
              SA  R
Sbjct  425   VSAGER  430



>ref|XP_010681060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score =   521 bits (1343),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 252/435 (58%), Positives = 324/435 (74%), Gaps = 2/435 (0%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
             + +GVNWG+ A+  L PS +V MLKDN + KVKLFD+D  T+   AGTGI+V+  IPN+ 
Sbjct  26    YSIGVNWGSIASHPLPPSNVVGMLKDNGLKKVKLFDADASTLEALAGTGIDVMVAIPNDM  85

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             LER  +   +AKDWVK N++ H++DGGV IK+VAVGNEPFL +YN SFK   FPAL+NI 
Sbjct  86    LERM-NKYKHAKDWVKKNVTKHLYDGGVNIKYVAVGNEPFLASYNDSFKYTTFPALQNIV  144

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
             KAL+EAG G+ IKA+IP NADVY S +  PS G+FR DI+DLM+ I  +L+D  APF+VN
Sbjct  145   KALEEAGHGD-IKASIPLNADVYESSSTSPSSGDFRGDIKDLMLDIVAFLKDKGAPFIVN  203

Query  724   IYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVI  903
             IYPFLSLY+N +FP  FAFFDG  KS++D   +Y N+FDAN DTL+W+L+K   GD+ +I
Sbjct  204   IYPFLSLYQNPDFPENFAFFDGGGKSINDNSHSYNNVFDANFDTLVWALKKNGYGDLKII  263

Query  904   VGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAP  1083
             VGEIGWPTDG+  AN K A+KFY G L+K+A  +GTP+  G +E YLF L DEN KSIAP
Sbjct  264   VGEIGWPTDGHIQANTKNAKKFYDGLLKKLAANKGTPMRSGQLEVYLFGLLDENMKSIAP  323

Query  1084  GEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSN  1263
             G FERHWGIF YDG+PKF +D +G+GND+MP+GAK V YL ++WC+ + + K+   V  +
Sbjct  324   GNFERHWGIFRYDGQPKFQMDLSGKGNDKMPIGAKGVQYLESKWCIYNQDAKNQDKVQGS  383

Query  1264  LGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAS  1443
             + YACS SDC+AL  G+SCN+LD+    SYAFNM+FQ+N+Q VEAC F+GL  I   NAS
Sbjct  384   IEYACSRSDCTALEYGSSCNNLDVKGNISYAFNMFFQMNDQSVEACQFDGLGMISSTNAS  443

Query  1444  TNGCLFPVALESAAT  1488
               GCLFP+ +  A  
Sbjct  444   QQGCLFPIEVVGAGA  458



>ref|XP_006826313.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
 gb|ERM93550.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
Length=481

 Score =   521 bits (1342),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 253/477 (53%), Positives = 330/477 (69%), Gaps = 6/477 (1%)
 Frame = +1

Query  115   PVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDS  294
             P +G  RL IW  F V  +   + G+GVNWGT A + L P  +VQ+LKDN   KVKLFD+
Sbjct  2     PEMGIFRLLIWV-FMVGYVGCMIDGIGVNWGTMAIRRLPPDTVVQLLKDNGFQKVKLFDA  60

Query  295   DHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGN  474
             D  T++  AG+GIEV+  IPNNQLE   +D + AK WV  NI+ +  DGGV IK+VAVGN
Sbjct  61    DQSTMSSLAGSGIEVMVAIPNNQLEAM-NDYETAKRWVDRNITLYNFDGGVNIKYVAVGN  119

Query  475   EPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNF  648
             EPFLK+YNGSF +  FPAL+NIQ AL+EAG G+ IKAT+P NADVY S      PS G F
Sbjct  120   EPFLKSYNGSFLNTTFPALQNIQNALNEAGAGDTIKATVPLNADVYDSPKDNSVPSAGRF  179

Query  649   RSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYT  828
             RSDI DLM++I ++L +  APF VNIYP+LSLY N  FP+++AFFDG +K V D G  Y 
Sbjct  180   RSDINDLMVQIVQFLNNSNAPFTVNIYPYLSLYGNTGFPIDYAFFDGTSKPVDDNGVMYD  239

Query  829   NMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEG  1008
             N+FDAN DTL+ SLR A   D+ +++GE+GWPTDG+  A    A++FY G L+++A+ +G
Sbjct  240   NVFDANFDTLVSSLRAAGFPDLPILIGEVGWPTDGDMFATSLYAQRFYNGLLKRLAQNKG  299

Query  1009  TPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAK  1188
             +P+  G +  YLF L DE+AKSIAPG FERHWGIF YDG+PKFP+D +G+G   +P+GA 
Sbjct  300   SPLRPGHLVVYLFGLIDEDAKSIAPGNFERHWGIFSYDGQPKFPMDLSGQGQSSLPIGAN  359

Query  1189  NVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMY  1368
             NV YLPAQWCVL+   KD   +  N+ YAC+ SDC++L  G++CN LD    ASYAFNMY
Sbjct  360   NVKYLPAQWCVLNTNAKDMSTLPDNINYACTYSDCTSLGYGSTCNKLDAQGNASYAFNMY  419

Query  1369  FQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALE--SAATRSGGITAVFAGIFFF  1533
             +Q+     E+C+F GLA +   NAS + C FP+ +E  S+      + AV   + FF
Sbjct  420   YQVQGHKDESCDFGGLAVVTTQNASQDPCKFPIQIEVSSSGVLILSMRAVMVALLFF  476



>ref|XP_008793474.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=476

 Score =   521 bits (1341),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 250/457 (55%), Positives = 327/457 (72%), Gaps = 8/457 (2%)
 Frame = +1

Query  133   RLAIWTGFAVILL-ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             R  IW   A ++  A+    +GVNWGTQ +  + P I+VQMLKDN I KVKLFD++   +
Sbjct  7     RTMIWVLCAALVASAASTEAIGVNWGTQTSHPMPPKIVVQMLKDNGIQKVKLFDAESSVM  66

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
             +  A TGIEV+  IPN+QLE+      NAK WV  N++ +     V IK+VAVGNEPFLK
Sbjct  67    SALANTGIEVMVAIPNDQLEQMGT-YSNAKAWVHENVTGYRD---VNIKYVAVGNEPFLK  122

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIR  663
             +YNG+F    FPALKNIQKALDE G   +IKAT+P NAD+Y+S      PS G+FRS+IR
Sbjct  123   SYNGTFLKATFPALKNIQKALDEMG-SKQIKATVPMNADIYSSPEDNSVPSAGDFRSEIR  181

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
             DLM++I R+L  + +PF++NIYPFLSLYEN NFP +FAFFDG  +S++DKG  YTN+FDA
Sbjct  182   DLMVEIARFLSSNGSPFVINIYPFLSLYENPNFPADFAFFDGGGRSINDKGTKYTNVFDA  241

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+W+L+KA    + +IVGE+GWPTDG+KNA++  A++FY G ++KMA   GTPV  
Sbjct  242   NFDTLVWALKKAGISSMKIIVGEVGWPTDGSKNADVAGAKRFYDGLMKKMASNTGTPVRP  301

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
             G ++ YLF+  DE+ KSI PG FERHWGIF YDGKPKFP+D +G+GN +   GA  V YL
Sbjct  302   GPMDVYLFAFIDEDMKSIQPGYFERHWGIFTYDGKPKFPMDLSGKGNGKYLAGASGVEYL  361

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
               +WCV D   ++  AV  ++ +ACS  DC+AL+  + C+ LD   R SYAFNMYFQ+ +
Sbjct  362   SDEWCVYDPSARNQEAVPRSMDFACSNGDCTALMGSSPCSKLDRSGRVSYAFNMYFQMKD  421

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRS  1494
             QDV AC+F+GLAKI   NAS +GCLFP+ + +AA RS
Sbjct  422   QDVRACDFQGLAKITSRNASRDGCLFPIQIVNAAGRS  458



>ref|XP_008232375.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=478

 Score =   519 bits (1337),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/474 (52%), Positives = 337/474 (71%), Gaps = 4/474 (1%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             V L       +++  S   GLGVNWG+  +  L P  +VQMLKDN I KVKLFD++  T+
Sbjct  5     VFLVCLLSILMLVPTSLAQGLGVNWGSMGSHSLPPKNVVQMLKDNGIKKVKLFDAEPDTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
             +  AG+G++V+ GIPN +LE+ AD    A++WVK N++ ++ DGGV I++VAVGNEP+L 
Sbjct  65    DALAGSGMQVMVGIPNEKLEKLADSYKEAQEWVKQNVTKYLRDGGVNIRYVAVGNEPYLT  124

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDL  669
             +YNG++    +PALKNIQKALDEAG G K+KAT+P NADVY S +  PS+G FR DI++ 
Sbjct  125   SYNGTYVKTTYPALKNIQKALDEAGSGGKVKATVPFNADVYESPSNKPSDGRFRKDIKNN  184

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             +++I R L D+R PF+VNIYPFLSLY++ +FP EFAFF+G ++ V D    Y N+FDAN 
Sbjct  185   IVEILRVLNDNRTPFVVNIYPFLSLYQSSDFPKEFAFFEGGSEPVKDNNIEYKNVFDANC  244

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTLI +L+K   G++++I+GE+GWPTDG+KNAN K+A+KFY G L+K+A ++GTP+ K  
Sbjct  245   DTLISALKKVGFGNLDIIIGEVGWPTDGDKNANGKLAKKFYDGLLKKLATEDGTPLRKKK  304

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLP  1206
             +E YLF L DEN KSIAPG+FERHWGIF YDG+PKF +D +G+G  + +  G + V YL 
Sbjct  305   LEVYLFGLFDENQKSIAPGDFERHWGIFRYDGQPKFTMDLSGKGQGNNLLKGVQGVQYLD  364

Query  1207  AQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQ  1386
              QWCVL ++ ++       +GYACSMSDC++L  G SC DLD     SYAFN YFQ  +Q
Sbjct  365   QQWCVLKSDVRNLSNTQPEVGYACSMSDCTSLGVGRSC-DLDQHGNVSYAFNAYFQNKDQ  423

Query  1387  DVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             DV AC+F G+A IVK NAS   CLFP+ + +A  R     ++FAG+F   ++  
Sbjct  424   DVRACDFNGMANIVKQNASMGDCLFPIQILNAGVRPE--LSIFAGLFLILMSFF  475



>ref|XP_009786014.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=474

 Score =   517 bits (1331),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 315/443 (71%), Gaps = 4/443 (1%)
 Frame = +1

Query  154   FAVILL-ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTG  330
             F V LL  S V GLGVNWGT A   L P  +VQ+LKDN I KVKLFD+D  T++  AGT 
Sbjct  7     FVVCLLYLSEVEGLGVNWGTMAMHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGTD  66

Query  331   IEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFK  510
             IEV+  IPN+QL    +D D AKDWV+ N++ +   GGV IK+VAVGNEPFL +YN SF 
Sbjct  67    IEVMVAIPNDQLSAM-NDYDRAKDWVRRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFI  125

Query  511   DLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKIC  684
             +  FPAL+NIQ AL+EAGLGN IKAT+P NADVY S    P  S G FR DI DLM ++ 
Sbjct  126   NTTFPALQNIQNALNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMV  185

Query  685   RYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIW  864
             +++  + APF VNIYPFLSLY N++FPV+FAFFDG +  + DKG TYTN+FDAN DTL+ 
Sbjct  186   QFMNQNNAPFTVNIYPFLSLYANEHFPVDFAFFDGASSPILDKGVTYTNVFDANFDTLVS  245

Query  865   SLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYL  1044
             +LR A  G++ ++VGE+GWPTDG+KNAN+ +A +FYKG L ++A   GTP+  G +E YL
Sbjct  246   ALRAAGVGNMTILVGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGYIEVYL  305

Query  1045  FSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVL  1224
             F L DE+ KSIAPG FERHWGIF YDG+PKF +D TG+G D+  VGA+NV YLP +WC+L
Sbjct  306   FGLIDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLTGQGQDKFLVGAQNVEYLPKKWCML  365

Query  1225  DNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACN  1404
             +   KD   +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMY+Q  NQ   +C 
Sbjct  366   NPNAKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQGDFSCG  425

Query  1405  FEGLAKIVKHNASTNGCLFPVAL  1473
             F+GLA +   N S   C F + +
Sbjct  426   FQGLAMVTDQNISQANCNFTIQI  448



>ref|XP_008465328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis melo]
Length=479

 Score =   515 bits (1327),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 256/467 (55%), Positives = 321/467 (69%), Gaps = 5/467 (1%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             V +L S V GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D  ++   AGTGIEV
Sbjct  13    VGVLGSCVEGLGVNWGTMANHRLPPKTVVQMLKDNGIQKVKLFDADQSSMGALAGTGIEV  72

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             +  IPN+QL    D  + AK WV+ N++ +I DGGV IK+VAVGNEPFL +YNGSF ++ 
Sbjct  73    MVAIPNDQLSAMGD-YNRAKQWVQRNVTRYIFDGGVTIKYVAVGNEPFLSSYNGSFLNVT  131

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYL  693
             FPAL+NIQ AL+EAG G+ IKAT+P NADVY S    P  S G FRSDI  LM  I ++L
Sbjct  132   FPALQNIQNALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRSDINQLMNDIVQFL  191

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWS  867
               ++APF VNIYPFLSLY N NFP ++AFFDG +  V D   G  YTN+FDAN DTL+ S
Sbjct  192   NKNKAPFTVNIYPFLSLYGNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLVSS  251

Query  868   LRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLF  1047
             L+    GD+ ++VGE+GWPTDG+KNAN   A +FY G L ++A  +GTP+  G +E YLF
Sbjct  252   LKAVGLGDMPILVGEVGWPTDGDKNANDGNAYRFYNGLLPRLAANKGTPLRPGFIEVYLF  311

Query  1048  SLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD  1227
             S  DEN KSIAPG FERHWGIFGYDG+PKF +D +G+G +++ VGA+NV YLP +WC+ +
Sbjct  312   SFLDENGKSIAPGNFERHWGIFGYDGQPKFGMDLSGQGQNKLLVGAQNVEYLPQKWCMFN  371

Query  1228  NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
                KD   +  N+ YAC+ SDC++L  G+SCN+LD    ASYAFNMYFQ+ NQD  ACNF
Sbjct  372   PNAKDLSKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDELACNF  431

Query  1408  EGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             +GLA I   N S   C F + L S+           A +    +ALL
Sbjct  432   QGLATITSRNLSQGTCNFIIQLASSPPSHAASFVSLASMVLLFIALL  478



>ref|XP_004966001.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=479

 Score =   515 bits (1327),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 254/436 (58%), Positives = 320/436 (73%), Gaps = 5/436 (1%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWG+Q +  L P+ +V+MLK N I +VKLFD+D W V     +GIEV+ GIPN+ LE
Sbjct  29    VGVNWGSQLSHPLLPTSVVKMLKANGISRVKLFDADPWPVGALLDSGIEVMLGIPNDMLE  88

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
                +   NAKDWV  N++++     +K+K+VAVGNEPFLKAYNGSF    FPALKNIQKA
Sbjct  89    -MMNSYGNAKDWVSENVTAY--GDKLKLKYVAVGNEPFLKAYNGSFMRTTFPALKNIQKA  145

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             L+EAG+G+K+KA +P NADVY S    PS G+FR DI DLM  + ++L DH APF+VNIY
Sbjct  146   LNEAGVGDKVKAVVPLNADVYVSPDDKPSSGSFRPDINDLMTDMVKFLHDHGAPFVVNIY  205

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGA-TYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             PFLSLY++ +FP EFAFFDG  +++ DKG  +Y+N+FDAN DTL+ +L KA   ++ VIV
Sbjct  206   PFLSLYQSDDFPFEFAFFDG-GRNIQDKGGISYSNVFDANYDTLVNALEKAGVPNLKVIV  264

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE GWPTDGNKNAN+K+A +FY G L K++K EGTPV  G +E YLF L DE+ KSIAPG
Sbjct  265   GEAGWPTDGNKNANLKLARRFYDGLLEKLSKNEGTPVRPGKMEVYLFGLFDEDMKSIAPG  324

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWGIF YDGKPKFPID TG+ +D++     +V YLP QWCV D+  KD   +  N+
Sbjct  325   NFERHWGIFTYDGKPKFPIDLTGQRHDKLLSPVPDVEYLPHQWCVFDDGAKDKSKLPGNI  384

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YAC+  DC+AL  G SCN LD  S  SYAFNMYFQ+ +QDV AC+F+GLAKI   NAST
Sbjct  385   QYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKISDKNAST  444

Query  1447  NGCLFPVALESAATRS  1494
              GCLFP+ + SA  R+
Sbjct  445   RGCLFPIQVLSAGGRA  460



>ref|XP_007207576.1| hypothetical protein PRUPE_ppa018453mg, partial [Prunus persica]
 gb|EMJ08775.1| hypothetical protein PRUPE_ppa018453mg, partial [Prunus persica]
Length=456

 Score =   513 bits (1321),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/452 (55%), Positives = 328/452 (73%), Gaps = 9/452 (2%)
 Frame = +1

Query  154   FAVILLA-------SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             F V LL+       S   GLGVNWG+  +  L P  +VQMLK+N I KVKLFD++  T++
Sbjct  6     FLVCLLSIVMSVPTSLAQGLGVNWGSMGSHSLPPKNVVQMLKENGIKKVKLFDAEPDTMD  65

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
               AG+GI+V+ GIPN +L + AD    A++WVK N++S++ DGGV I++VAVGNEP+L +
Sbjct  66    ALAGSGIQVMVGIPNEKLAKLADSYKEAQEWVKQNVTSYLRDGGVNIRYVAVGNEPYLTS  125

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLM  672
             YNG++    +PALKNIQKALDEAG G KIKAT+P NADVY S +  PS+G FR DI++ +
Sbjct  126   YNGTYVKTTYPALKNIQKALDEAGSGGKIKATVPFNADVYESPSNKPSDGRFRKDIKNNI  185

Query  673   IKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLD  852
             ++I R L D+R PF+VNIYPFLSLY++ +FP EFAFF+G ++ V D    Y N+FDAN D
Sbjct  186   VEILRILNDNRTPFVVNIYPFLSLYQSSDFPKEFAFFEGGSEPVKDNNIDYKNVFDANCD  245

Query  853   TLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVV  1032
             TLI +L+K   G++++I+GE+GWPTDG+KNAN KMA+KFY G L+K+A ++GTP+ K  +
Sbjct  246   TLISALKKVGFGNLDIIIGEVGWPTDGDKNANGKMAKKFYDGLLKKLATEDGTPLRKKKL  305

Query  1033  EFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLPA  1209
             E YLF L DEN KSIAPG+FERHWGIF YDGKPKFP+D +G+G  + +  G + V YL  
Sbjct  306   EVYLFGLFDENQKSIAPGDFERHWGIFRYDGKPKFPMDLSGKGQGNNLLKGVQGVQYLDQ  365

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             QWC+L ++ ++       + YACSMSDC++L  G SC DLD     SYAFNMYFQ  +QD
Sbjct  366   QWCMLKSDVRNLSNTQPEVSYACSMSDCTSLGVGRSC-DLDQHGNVSYAFNMYFQNKDQD  424

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVALESAA  1485
             V AC+F G+A IVK NAS   CLFP+ + +A 
Sbjct  425   VRACDFNGMANIVKQNASRGDCLFPIQILNAG  456



>ref|XP_008392630.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=477

 Score =   513 bits (1322),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 249/468 (53%), Positives = 329/468 (70%), Gaps = 5/468 (1%)
 Frame = +1

Query  142   IWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             +W    ++   +   GLGVNWG  A+  L P  +VQMLKDN I KVKLFD++  T+N  A
Sbjct  8     VWVLSVILATTNLAQGLGVNWGAMASHQLPPKNVVQMLKDNGIKKVKLFDAEPSTLNALA  67

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
             G+GI+V+ GIPN +LE+ AD    A+ WVK N++  +  G V I +VAVGNEP+L +YNG
Sbjct  68    GSGIQVMVGIPNEKLEKLADSYSEAQQWVKENVTKWL--GSVSISYVAVGNEPYLTSYNG  125

Query  502   SFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKI  681
             S+    +PALKNIQKA+ E G G+K+KAT+P NADVY S +  PS+G FR DI++ M++I
Sbjct  126   SYVKTTYPALKNIQKAIREXGAGDKVKATVPFNADVYESSSSKPSDGRFRKDIKNNMVEI  185

Query  682   CRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLI  861
              R+LRD+++PF+VNIYPFLSLY++ +FP EFAFF+G +K V D    Y N+FDAN DTLI
Sbjct  186   LRHLRDNKSPFVVNIYPFLSLYQSPDFPKEFAFFEGGSKPVSDNNIEYKNVFDANCDTLI  245

Query  862   WSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFY  1041
              +L+K   G++ +I+GE GWPTDG+KNAN+K A+KFY G L+K+ K EGTP+ KG +E Y
Sbjct  246   NALKKEGFGNMEIIIGEAGWPTDGDKNANIKNAKKFYDGLLKKLGKXEGTPLRKGKLEVY  305

Query  1042  LFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLPAQWC  1218
             LF L DE+ KSIAPG+FERHWGIF YDG+PKFP+D +G+GN D+M    K V YL  QWC
Sbjct  306   LFGLFDEDQKSIAPGDFERHWGIFRYDGQPKFPMDLSGKGNGDQMLKAVKGVEYLEKQWC  365

Query  1219  VLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             VL+++ K+     + L YAC+ SDC++L  G SC DLD   + SYAFN YFQ  +QDV  
Sbjct  366   VLNSDVKNMSQTDAELNYACAGSDCTSLGTGRSC-DLDQHGKVSYAFNSYFQNRDQDVRT  424

Query  1399  CNFEGLAKIVKHNASTNGCLFPVAL-ESAATRSGGITAVFAGIFFFCL  1539
             CNF G+A I K+N S   CLFPV +  + A R G +   +A   F  L
Sbjct  425   CNFNGMATITKNNPSVGDCLFPVQIVNTGAPRHGAVGVAYAFSIFVGL  472



>ref|XP_009610199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   513 bits (1320),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 249/443 (56%), Positives = 314/443 (71%), Gaps = 4/443 (1%)
 Frame = +1

Query  154   FAVILL-ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTG  330
             F V LL  S V GLGVNWGT A   L P  +VQ+LKDN I KVKLFD+D  T++  AG+ 
Sbjct  7     FVVCLLYLSGVEGLGVNWGTMATHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGSD  66

Query  331   IEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFK  510
             IEV+  IPN+QL    +D   AKDWV+ N++ +   GGV IK+VAVGNEPFL +YN SF 
Sbjct  67    IEVMVAIPNDQLSAM-NDYHRAKDWVRRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFI  125

Query  511   DLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKIC  684
             +  FPAL+NIQ AL+EAGLGN IKAT+P NADVY S    P  S G FR DI DLM ++ 
Sbjct  126   NTTFPALENIQNALNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMV  185

Query  685   RYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIW  864
             +++  + APF VNIYPFLSLY N++FPV+FAFFDG +  + DKG TYTN+FDAN DTL+ 
Sbjct  186   QFMNQNNAPFTVNIYPFLSLYANEHFPVDFAFFDGASNPILDKGVTYTNVFDANFDTLVS  245

Query  865   SLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYL  1044
             +LR A  G++ ++VGE+GWPTDG+KNAN+ +A +FYKG L ++A   GTP+  G +E YL
Sbjct  246   ALRAAGVGNMTILVGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGYIEVYL  305

Query  1045  FSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVL  1224
             F L DE+ KSIAPG FERHWGIF YDG+PKF +D TG+G D+  VGA+NV YLP +WC+L
Sbjct  306   FGLIDEDGKSIAPGNFERHWGIFRYDGQPKFSMDLTGQGQDKFLVGAQNVEYLPKKWCML  365

Query  1225  DNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACN  1404
             +   KD   +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMYFQ  NQ   +C 
Sbjct  366   NPNAKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQAQNQGDFSCG  425

Query  1405  FEGLAKIVKHNASTNGCLFPVAL  1473
             F+GLA +   N S   C F + +
Sbjct  426   FQGLAMVTDQNISQANCNFTIQI  448



>gb|KDP39719.1| hypothetical protein JCGZ_02739 [Jatropha curcas]
Length=478

 Score =   513 bits (1320),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 248/440 (56%), Positives = 321/440 (73%), Gaps = 5/440 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V+GLGVNWGTQA   L P  +VQMLKDN I KVKLFD++  T+   AGTGIEV+  IPN+
Sbjct  20    VYGLGVNWGTQATHKLPPKTVVQMLKDNGIKKVKLFDTEASTMRALAGTGIEVMVAIPND  79

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D   AKD+VK+NIS +  +GGV IK+VAVGNEPFL +YNGSF +  FPAL+NI
Sbjct  80    QLLAM-NDYKRAKDFVKSNISIYNFNGGVNIKYVAVGNEPFLTSYNGSFINTTFPALQNI  138

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S TG   PS G FRSDI DLM +I ++L  + APF
Sbjct  139   QNALNEAGVGDSIKATVPLNADVYNSPTGQSYPSAGRFRSDINDLMTQIVQFLNKNNAPF  198

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKAKCG  888
              VNIYPFLSLY N NFP+++AFFDG +++V D G+   YTN+FDAN DTL+ +L+    G
Sbjct  199   TVNIYPFLSLYGNDNFPIDYAFFDGVSQTVVDVGSGIQYTNVFDANFDTLVSALKAVGFG  258

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             D+ VIVGE+GWPTDG+K+A +  A +FY G L ++A   GTP+  G +E YLF L DE+A
Sbjct  259   DMTVIVGEVGWPTDGDKSATVDYAYRFYNGLLPRLASNRGTPLRPGFIEVYLFGLLDEDA  318

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH  1248
             KSIAPG FERHWGIF YDG+PKF +D +G+G +++ +GA+NV YLP++WC  +   +D  
Sbjct  319   KSIAPGNFERHWGIFKYDGQPKFALDLSGQGQNKLLIGAQNVQYLPSKWCTFNPNAQDLS  378

Query  1249  AVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIV  1428
              +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ NQD  AC+F+GLA + 
Sbjct  379   KLADNIDYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVQNQDPMACDFQGLATVT  438

Query  1429  KHNASTNGCLFPVALESAAT  1488
               N S   C F + + S+++
Sbjct  439   NVNISQGKCNFIIQIASSSS  458



>ref|XP_004141142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 ref|XP_004171752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN59764.1| hypothetical protein Csa_3G843830 [Cucumis sativus]
Length=479

 Score =   511 bits (1315),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 251/467 (54%), Positives = 318/467 (68%), Gaps = 5/467 (1%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             V +L S V GLGVNWGT A   L P  +VQM KDN I KVKLFD+D  ++   AGTGIEV
Sbjct  13    VGVLGSCVEGLGVNWGTMANHRLPPKTVVQMFKDNGIQKVKLFDADQSSMGALAGTGIEV  72

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             +  IPN+QL    D  + AK WV+ N++ +  DGGV IK+VAVGNEPFL +YNGSF ++ 
Sbjct  73    MVAIPNDQLSAMGD-YNRAKQWVQRNVTRYTFDGGVTIKYVAVGNEPFLSSYNGSFLNVT  131

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYL  693
             FPAL NIQ AL+EAG G+ IKAT+P NADVY S    P  S G FR+DI  LM  I ++L
Sbjct  132   FPALLNIQNALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRNDINQLMTDIVQFL  191

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWS  867
               ++APF VNIYPFLSLY N NFP ++AFFDG +  V D   G  YTN+FDAN DTL+ S
Sbjct  192   NKNKAPFTVNIYPFLSLYGNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLVSS  251

Query  868   LRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLF  1047
             L+    GD+ ++VGE+GWPTDG+KN N+  A +FY G L ++A  +GTP+  G +E YLF
Sbjct  252   LKAVGLGDMPILVGEVGWPTDGDKNGNVGNAYRFYNGLLPRLAANKGTPLRPGFIEVYLF  311

Query  1048  SLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD  1227
             S  DEN KSIAPG FERHWGIFGYDG+PKF +D +G+G +++ VGA+NV YLP +WC+ +
Sbjct  312   SFLDENGKSIAPGNFERHWGIFGYDGQPKFGMDLSGQGQNKLLVGAQNVQYLPQKWCMFN  371

Query  1228  NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
                KD   +  N+ YAC+ SDC++L  G+SCN+LD    ASYAFNMYFQ+ NQD  ACNF
Sbjct  372   PNAKDLSKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDELACNF  431

Query  1408  EGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             +GLA +   N S   C F + L S+           A +    +ALL
Sbjct  432   QGLATVTSQNLSQGTCNFIIQLASSPPSHAASFVSLASMILLFIALL  478



>ref|XP_009605785.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   510 bits (1314),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 248/458 (54%), Positives = 321/458 (70%), Gaps = 6/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A+  L P I+VQMLKDN I KVKLFD+D  T+N  AGT IEV+  IPN+
Sbjct  24    VEGLGVNWGTMASHPLEPKIVVQMLKDNGIKKVKLFDADKTTMNALAGTDIEVMVAIPND  83

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    D  D AKDWV+ N++ +    GV IK+VAVGNEPFL AYN SF +L FPAL+NI
Sbjct  84    QLLTMTD-YDRAKDWVRRNVTRYNIKAGVNIKYVAVGNEPFLTAYNNSFVNLTFPALQNI  142

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI +LM +I +++  ++APF
Sbjct  143   QNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMNKNQAPF  202

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N++FP++FAFFDG +  V D G  YTN+FDAN DTL  +L+    G++
Sbjct  203   TVNIYPFLSLYSNEHFPIDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGYGNM  262

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
             N++VGE+GWPTDG+KNAN+  A +FYKG   ++A  +GTP+  G +E YLF L DE+AKS
Sbjct  263   NILVGEVGWPTDGDKNANLNYAYRFYKGLFSRLAANKGTPLRPGYIEVYLFGLIDEDAKS  322

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF YDG+PKFP+D +G+G D+  V AKNV YLP +WC+L+    +   +
Sbjct  323   IAPGNFERHWGIFRYDGQPKFPMDISGQGQDKHLVAAKNVQYLPKRWCMLNPNANNLSIL  382

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
              +N+ YAC+ SDC+AL  G+SCN+LD    ASYAFNMY+Q+ NQ   +C+F+GLA +   
Sbjct  383   ANNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLAMVTDK  442

Query  1435  NASTNGCLFPVALESAATRSG---GITAVFAGIFFFCL  1539
             N S   C F +     +  S    GI  + +G  F  L
Sbjct  443   NISQGTCNFIIQTGIYSVSSKVLPGIVVLLSGFTFLLL  480



>ref|XP_010257709.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=475

 Score =   509 bits (1312),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 328/466 (70%), Gaps = 6/466 (1%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
             F+V+L +  V GLGVNWGT A   L P+ +VQM+KDN I KVKLFD+D  T++  AGT I
Sbjct  11    FSVLLGSIAVEGLGVNWGTMATHKLPPNTVVQMMKDNGIKKVKLFDADQNTMSALAGTEI  70

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+  IPN+QL    +D   AKDWVK NI+ ++ +GGV IK+VAVGNEPFL +YN SF +
Sbjct  71    EVMVAIPNDQLA-VMNDYGRAKDWVKRNITRYLFNGGVNIKYVAVGNEPFLASYNNSFLN  129

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICR  687
             + FPAL+NIQ AL+EAG G+ IKAT+P NADVY S +    PS G FRSDI DLM +I +
Sbjct  130   VTFPALQNIQDALNEAGHGDSIKATVPLNADVYNSPSDNSVPSAGRFRSDISDLMTQIVQ  189

Query  688   YLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWS  867
             +L  + APF VNIYPFLSLY N+NFP++FAFFDG    + D G  Y N+FDAN DTL+ +
Sbjct  190   FLNKNNAPFTVNIYPFLSLYANENFPLDFAFFDGTPNPLLDNGIQYNNVFDANFDTLVSA  249

Query  868   LRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLF  1047
             L+    G++ ++VGE+GWPTDG+KNAN+ +A++FY G L ++A  +GTP+  G +E YLF
Sbjct  250   LKAVGFGEMPILVGEVGWPTDGDKNANVGLAQRFYNGLLPRLAANKGTPLRPGYLEVYLF  309

Query  1048  SLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD  1227
              L DE+AKSIAPG FERHWGIF YDG+PK+ +D +G+G +   V AKNV YLP +WCVL+
Sbjct  310   GLIDEDAKSIAPGNFERHWGIFRYDGQPKYQMDLSGQGQNTFLVAAKNVKYLPQRWCVLN  369

Query  1228  NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
                +D   +G N+ +AC+ SDC+AL  G+SC +LD    ASYAFNMY+Q  NQ   +CNF
Sbjct  370   PNAEDLSKLGENINFACTHSDCTALGYGSSCGNLDTQGNASYAFNMYYQAQNQQDLSCNF  429

Query  1408  EGLAKIVKHNASTNGCLFPVALESAATRSGGITA---VFAGIFFFC  1536
             +GLA +   NAS   C F + +  ++  +  + A   +   +FFF 
Sbjct  430   QGLAMVTTQNASQGNCNFTIQISPSSPLAPSLIASAILLVVVFFFV  475



>ref|XP_010276412.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=477

 Score =   509 bits (1312),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 255/474 (54%), Positives = 328/474 (69%), Gaps = 11/474 (2%)
 Frame = +1

Query  142   IWTGFAVI---LLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             +W  F V+   LL+  + GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D  T++
Sbjct  4     LWFLFLVLCFSLLSFTIEGLGVNWGTMATHKLPPDTVVQMLKDNGIKKVKLFDADQSTMS  63

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
               AGT IEV+  IPN+QL    +D D AKDWVK N++ +I +GGV IK+VAVGNEPFL++
Sbjct  64    ALAGTEIEVMVAIPNDQLA-VMNDYDRAKDWVKRNVTRYIFNGGVNIKYVAVGNEPFLQS  122

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRD  666
             YN SF ++  PAL+NIQ AL+EAG G+ IKAT+P NADVY S    P  S G FR+DI D
Sbjct  123   YNNSFLNITLPALQNIQNALNEAGHGDSIKATVPLNADVYNSPVSNPVPSAGRFRTDISD  182

Query  667   LMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKG--ATYTNMFD  840
             LM +I ++L  + APF VNIYPFLSLY ++NFPV+FAFFDG A    D G    Y+N+FD
Sbjct  183   LMTQIVQFLNKNNAPFTVNIYPFLSLYADQNFPVDFAFFDGTANPTTDTGNGIQYSNVFD  242

Query  841   ANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVH  1020
             AN DTL+ +L+    GD+ ++VGE+GWPTDG+KNAN+ +A++FY G L ++A  +GTP+ 
Sbjct  243   ANFDTLVSALKSVGFGDMPILVGEVGWPTDGDKNANVALAQRFYNGLLPRLAANKGTPLR  302

Query  1021  KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPY  1200
              G +E YLF L DE+AKSIAPG FERHWGIF YDG+PKF +D +G+G + + V AKNV Y
Sbjct  303   PGYLEVYLFGLIDEDAKSIAPGNFERHWGIFRYDGQPKFLLDISGQGQNTLLVAAKNVQY  362

Query  1201  LPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQIN  1380
             LP +WCV +   KD   +  N+ YAC+ SDC+ L   +SC +LD    ASYAFNMYFQ  
Sbjct  363   LPQRWCVFNPNAKDLSKLADNINYACTFSDCTTLGYQSSCGNLDTQGNASYAFNMYFQAQ  422

Query  1381  NQDVEACNFEGLAKIVKHNASTNGCLFP--VALESAATRSGGITA-VFAGIFFF  1533
             NQ   +CNFEGLA +   NAS   C F   +AL S+   S  ++A V   + FF
Sbjct  423   NQQDMSCNFEGLAMVTTQNASQGNCNFTIQIALSSSFRPSLMVSAFVLVLMLFF  476



>ref|XP_010915073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=468

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 250/470 (53%), Positives = 329/470 (70%), Gaps = 12/470 (3%)
 Frame = +1

Query  145   WTGFAVILL-ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             W  FA +++ A+    +GVNWGTQA+  L P I+V+ML DN I KVKLFD++   ++  A
Sbjct  3     WVLFAALVISAASTEAIGVNWGTQASHPLPPKIVVRMLTDNGIKKVKLFDTESSAMSALA  62

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
              TGIEV+ GIPN+QLE       NAK WV  N++ +     V IK+VAVGNEPFL++YNG
Sbjct  63    NTGIEVMVGIPNDQLEHMGT-FSNAKAWVHENVTGY---KDVNIKYVAVGNEPFLQSYNG  118

Query  502   SFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIRDLMI  675
             +F    FPALKNIQKALDE G   +IKATIP NAD+Y+S      PS G FRSDI DLM+
Sbjct  119   TFLKTTFPALKNIQKALDEMG-HKEIKATIPMNADIYSSPDDNAVPSAGKFRSDIHDLMV  177

Query  676   KICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDT  855
             +I R+L  H +PF++NIYPFLSLYEN NFPV+FAFF G   S++D+G  Y N+FDAN DT
Sbjct  178   EIARFLDSHGSPFVINIYPFLSLYENPNFPVDFAFFGGGGPSINDEGTQYNNVFDANFDT  237

Query  856   LIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVE  1035
             L+W+L+K    ++ +I+GE+GWPTDG+K+AN+  A++FY G L+KM    GTP+  G ++
Sbjct  238   LVWALKKVGLSNMKIIIGEVGWPTDGSKHANVADAKRFYDGLLKKMGSNTGTPLRPGPMD  297

Query  1036  FYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQW  1215
              YLF+  DE+ KSI PG FERHWGIF YDGKPKFP+D +G+GND+  VGA  V YL  +W
Sbjct  298   VYLFAFIDEDMKSIQPGFFERHWGIFAYDGKPKFPMDLSGKGNDKYLVGASGVEYLEDEW  357

Query  1216  CVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVE  1395
             CV D   K+   V S++ +AC   DC+AL+  + C+ LD   R SYAFNMYFQ+ +QDV 
Sbjct  358   CVFDPNAKNQEKVPSSMDFACFHGDCTALMGSSPCSKLDRNDRISYAFNMYFQMTDQDVR  417

Query  1396  ACNFEGLAKIVKHNASTNGCLFPVAL-ESAATRS---GGITAVFAGIFFF  1533
             AC+F+GLAKI   NAS +GCLFP+ +  +A TR    G +  ++  +F F
Sbjct  418   ACDFQGLAKITNKNASRDGCLFPIQIVNTAGTRPAELGLLMLLWIAVFLF  467



>ref|NP_001057968.1| Os06g0590600 [Oryza sativa Japonica Group]
 dbj|BAD32917.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF19882.1| Os06g0590600 [Oryza sativa Japonica Group]
 gb|EAZ01513.1| hypothetical protein OsI_23546 [Oryza sativa Indica Group]
Length=483

 Score =   509 bits (1311),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 316/431 (73%), Gaps = 5/431 (1%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWG+Q +  L P  +VQMLK+N I KVKLFD+D W V     +GIEV+ GIPN+ LE
Sbjct  33    VGVNWGSQLSHPLLPKSVVQMLKENGILKVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  92

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
                +   NA+DWVK N++S+     +KIK+VAVGNEPFLKAYNGSF    FPALKNIQKA
Sbjct  93    TM-NSYGNAQDWVKENVTSYGDK--LKIKYVAVGNEPFLKAYNGSFMKTTFPALKNIQKA  149

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             L+EAG+G+K+KAT+P NADVY S    PS G FR DI+ LM  + ++L +H +PF+VNIY
Sbjct  150   LNEAGVGDKVKATVPLNADVYVSPDNKPSSGAFRPDIQGLMTDMVKFLHEHGSPFVVNIY  209

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGA-TYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             PFLSLY++ +FP EFAF DG  K++ DKG  +Y+N+FDAN DTL+ +L+KA    + V+V
Sbjct  210   PFLSLYQSDDFPFEFAFVDG-GKTIQDKGGISYSNVFDANYDTLVTALKKAGVPSLKVVV  268

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE+GWPTDG+KNAN+K+A ++Y G L+K++KKEGTP+  G ++ Y+F L DE+ KSI PG
Sbjct  269   GEVGWPTDGDKNANLKLARRYYDGLLKKLSKKEGTPLRPGKMDVYMFGLFDEDMKSILPG  328

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWGIF YDGKPKFP+D +G GND+   G   V YLP QWCV D+  +D   +  N+
Sbjct  329   NFERHWGIFTYDGKPKFPMDLSGHGNDKPLAGVPGVEYLPKQWCVFDDGAEDKSKLPGNI  388

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YAC+  DC+AL  G SCN LD  S  SYAFNMYFQ+ +QDV AC+F+GLAKI   NAS 
Sbjct  389   QYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKITTKNASA  448

Query  1447  NGCLFPVALES  1479
              GC FP+ + S
Sbjct  449   RGCAFPIQIIS  459



>ref|XP_011078775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Sesamum indicum]
Length=478

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 318/448 (71%), Gaps = 4/448 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V  LGVNWGT A   L P ++VQML DN I KVKLFD+D  T++  AGTG+EV+  IPN+
Sbjct  23    VESLGVNWGTMATHKLPPKVVVQMLTDNGIKKVKLFDADQSTMSALAGTGVEVMVAIPND  82

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL       D AK+WVK NI+ +  +GGV IK+VAVGNEPFL +YN SF +  FPAL+NI
Sbjct  83    QLSAMGS-YDRAKEWVKRNITRYNFNGGVTIKYVAVGNEPFLTSYNNSFVNTTFPALQNI  141

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI D M +I ++L  ++APF
Sbjct  142   QNALNEAGVGDSIKATVPLNADVYGSPENNPVPSAGRFRTDISDQMSQIVKFLNQNKAPF  201

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N+NFPV++AFFDG +  + D G +Y+N+FDAN DTL+ +L+    GD+
Sbjct  202   TVNIYPFLSLYANENFPVDYAFFDGVSNPIVDNGISYSNVFDANFDTLVSALKALGYGDM  261

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              +IVGE+GWPTDG+KNAN+  A +FY+G L ++A  +GTP+  G +E YLF L DE+AKS
Sbjct  262   TIIVGEVGWPTDGDKNANINYALRFYRGLLPRLAGNKGTPLRPGYIEVYLFGLIDEDAKS  321

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF YDG+PKFP+D +G+ +D+  VGA+NV YLP +WC+L  +  D   +
Sbjct  322   IAPGNFERHWGIFRYDGQPKFPMDLSGQQSDKYLVGAQNVNYLPTKWCMLRPDANDLSKL  381

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ NQ    CNF+GLA +   
Sbjct  382   ADNINYACTFSDCTALGFGSSCNGLDANGNASYAFNMYFQVQNQRDLTCNFQGLAMVTDK  441

Query  1435  NASTNGCLFPVAL-ESAATRSGGITAVF  1515
             N S   C F + +  S+++R   ++  F
Sbjct  442   NISQGNCNFTIQIATSSSSRLAQVSLAF  469



>ref|XP_002440138.1| hypothetical protein SORBIDRAFT_09g026690 [Sorghum bicolor]
 gb|EES18568.1| hypothetical protein SORBIDRAFT_09g026690 [Sorghum bicolor]
Length=486

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 244/443 (55%), Positives = 321/443 (72%), Gaps = 8/443 (2%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             A+PV   GVNWGT  +  ++PS +V+ML+ N +D+VKLFD+D WTV   AG+G++ +   
Sbjct  28    AAPV---GVNWGTMMSHPIHPSAVVEMLRANGVDRVKLFDADPWTVAALAGSGVQAMLAA  84

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN+QL   A D   A++WV+ N+++++ + GV +++VAVGNEPFLK+YNGSF ++ FPAL
Sbjct  85    PNDQLASLARDPRRAREWVRHNVTANV-NAGVDVRYVAVGNEPFLKSYNGSFINITFPAL  143

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHR  705
             KN+Q+ALDEAG G +IK  +P NAD+Y+S    P  S G+FR DI  LM+ I  YL  + 
Sbjct  144   KNMQRALDEAGFGQRIKVVVPLNADIYSSPENKPVPSAGSFRKDINTLMVDIVNYLHAND  203

Query  706   APFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKC  885
             APF+VNIYPFLSLY+N NFP+ F+FFDG  K V D+G  YTN+FDAN DTL+WSLRKA  
Sbjct  204   APFVVNIYPFLSLYQNPNFPLNFSFFDGATKPVFDQGMVYTNVFDANFDTLVWSLRKAGV  263

Query  886   GDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDEN  1065
              D+ +IVGE+GWPTDG+KNAN+K A++FY GFLRK+AK  GTP+  G +E YLF+L DEN
Sbjct  264   PDMRIIVGEVGWPTDGDKNANIKYAQRFYNGFLRKVAKNIGTPLRPGRMEVYLFALIDEN  323

Query  1066  AKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDS  1245
              KS+ PG FERHWG+F YDGKPKF +D +G G   +    K V YLP+QWCV + + KD 
Sbjct  324   QKSVLPGRFERHWGLFTYDGKPKFSMDLSGNGKGNL-AEIKGVQYLPSQWCVFNKDTKDK  382

Query  1246  HA-VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
             +  + +++ YACS +DC+ L  GASCN L      SYAFN+YFQ  +QDV AC+F GLA 
Sbjct  383   YKDLPASVNYACSNADCTPLGYGASCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAM  442

Query  1423  IVKHNASTNGCLFPVALESAATR  1491
             I   NAS  GCLFPV + SA+ R
Sbjct  443   ITATNASQGGCLFPVQILSASGR  465



>ref|NP_001152213.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 gb|ACG46412.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 gb|ACN35266.1| unknown [Zea mays]
 gb|AFW78871.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=481

 Score =   508 bits (1309),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 242/455 (53%), Positives = 321/455 (71%), Gaps = 7/455 (2%)
 Frame = +1

Query  193   GVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLER  372
             GVNWGT  +  ++PS +V+ML+ N +D+VKLFD+D WTV+  AG+G++ +   PN+QL  
Sbjct  31    GVNWGTMMSHPIHPSAVVEMLRANGVDRVKLFDADPWTVSALAGSGVQAMLAAPNDQLAS  90

Query  373   FADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKAL  552
              A D   A+DWV+ N++++I + GV +++VAVGNEPFLK+YNGSF ++ FPALKN+Q+A+
Sbjct  91    LARDPRRARDWVRQNVTANI-NAGVDVRYVAVGNEPFLKSYNGSFINITFPALKNMQRAI  149

Query  553   DEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNI  726
             DEAG G  IK  +P NAD+Y+S    P  S G FR DI  LM+ I  YL  + APF+VNI
Sbjct  150   DEAGFGQHIKVVVPLNADIYSSPENKPVPSAGTFRKDINTLMVDIVNYLHANDAPFVVNI  209

Query  727   YPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             YPFLSLY+N NFP+ F+FFDG  K V+D+G  YTN+FDAN DTL+WSLRKA   D+ +IV
Sbjct  210   YPFLSLYQNPNFPLNFSFFDGATKPVYDQGMVYTNVFDANFDTLVWSLRKAGVPDMRIIV  269

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE+GWP+DG+KNAN K A++FY GFL+KM K  GTP+  G +E YLF+L DEN KS+ PG
Sbjct  270   GEVGWPSDGDKNANTKYAQRFYNGFLKKMTKNVGTPLRPGRMEVYLFALIDENQKSVLPG  329

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA-VGSN  1263
              FERHWG+F YDGKPKF +D +G G   +    K V YLP QWCV + + KD +  + ++
Sbjct  330   RFERHWGLFTYDGKPKFSMDLSGNGKGSV-AEVKGVQYLPPQWCVFNKDTKDKYKDLPAS  388

Query  1264  LGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAS  1443
             + YACS +DC+ L  G+SCN L      SYAFN+YFQ  +QDV AC+F GLAKI   NAS
Sbjct  389   VNYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAKITTTNAS  448

Query  1444  TNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
               GCLFPV + SA+     +  +F  +    + LL
Sbjct  449   QGGCLFPVQITSASVTV--VPLIFLPMLVSVITLL  481



>gb|EAZ37505.1| hypothetical protein OsJ_21839 [Oryza sativa Japonica Group]
Length=483

 Score =   508 bits (1309),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 245/431 (57%), Positives = 316/431 (73%), Gaps = 5/431 (1%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWG+Q +  L P  +VQMLK+N I KVKLFD+D W V     +GIEV+ GIPN+ LE
Sbjct  33    VGVNWGSQLSHPLLPKSVVQMLKENGILKVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  92

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
                +   NA+DWVK N++S+     +KIK+VAVGNEPFLKAYNGSF    FPALKNIQKA
Sbjct  93    TM-NSYGNAQDWVKENVTSYGDK--LKIKYVAVGNEPFLKAYNGSFMKTTFPALKNIQKA  149

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             L+EAG+G+K+KAT+P NADVY S    PS G FR DI+ LM  + ++L +H +PF+VNIY
Sbjct  150   LNEAGVGDKVKATVPLNADVYVSPDNKPSSGAFRPDIQGLMTDMVKFLHEHGSPFVVNIY  209

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGA-TYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             PFLSLY++ +FP EFAF DG  K++ DKG  +Y+N+FDAN DTL+ +L+KA    + V+V
Sbjct  210   PFLSLYQSDDFPFEFAFVDG-GKTIQDKGGISYSNVFDANYDTLVTALKKAGVPSLKVVV  268

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE+GWPTDG+KNAN+K+A ++Y G L+K++KKEGTP+  G ++ Y+F L DE+ KSI PG
Sbjct  269   GEVGWPTDGDKNANLKLARRYYDGLLKKLSKKEGTPLRPGKMDVYMFGLFDEDMKSILPG  328

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWGIF YDGKPKFP+D +G GND+   G   V YLP QWCV D+  +D   +  N+
Sbjct  329   NFERHWGIFTYDGKPKFPMDLSGHGNDKPLAGVPGVEYLPKQWCVFDDGAEDKSKLPGNI  388

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YAC+  DC+AL  G SCN LD  S  SYAFNMY+Q+ +QDV AC+F+GLAKI   NAS 
Sbjct  389   QYACASGDCTALGYGCSCNGLDEKSNISYAFNMYYQMQDQDVRACDFDGLAKITTKNASA  448

Query  1447  NGCLFPVALES  1479
              GC FP+ + S
Sbjct  449   RGCAFPIQIIS  459



>ref|XP_008812061.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Phoenix dactylifera]
Length=477

 Score =   508 bits (1307),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 317/456 (70%), Gaps = 6/456 (1%)
 Frame = +1

Query  121   VGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDH  300
             + G R+ +W  F +    S V GLGVNWGT A   L P I+VQ+LKDN I KVKLFD+D 
Sbjct  1     MAGCRVVVWLLF-IGFFCSMVEGLGVNWGTMATHPLPPEIVVQLLKDNGIKKVKLFDADA  59

Query  301   WTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEP  480
              T++  AG+GIEV+  IPNNQL    +D   AK WV  N++ +  DGGV IK+VAVGNEP
Sbjct  60    ATMSALAGSGIEVMVAIPNNQLGAM-NDYATAKKWVNRNVTRYNFDGGVNIKYVAVGNEP  118

Query  481   FLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRS  654
             FL +YNGSF ++ FPAL+NIQ AL+EAG G  IKAT+P NADVY S T  P  S G FRS
Sbjct  119   FLSSYNGSFLNVTFPALQNIQNALNEAGAGG-IKATVPLNADVYNSPTNNPVPSAGRFRS  177

Query  655   DIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNM  834
             DI DLM +I ++L    APF VNIYPFLSLY+N NFP++FAFFDG ++ V D G  Y N+
Sbjct  178   DINDLMTQIVQFLNQAGAPFTVNIYPFLSLYDNDNFPLDFAFFDGTSQPVVDNGIQYANV  237

Query  835   FDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTP  1014
             FDAN DTL+ +L+    GD+ VIVGE+GWPTDG+KNA    A++FY G L+++A   GTP
Sbjct  238   FDANFDTLVSALKAVGLGDLPVIVGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANSGTP  297

Query  1015  VHKG-VVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKN  1191
             +     +E YLFSL DE+AKSIAPG FERHWGI  YDG+PKFP+D +G+G ++M V AKN
Sbjct  298   LRPNQYLEVYLFSLIDEDAKSIAPGNFERHWGILKYDGQPKFPMDLSGQGQNKMLVAAKN  357

Query  1192  VPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYF  1371
             V YLP  WCV +   KD   +G N+ YAC+ SDC+ L  G++CN LD    ASYAFNMYF
Sbjct  358   VEYLPQTWCVFNPNAKDLSKLGDNINYACTFSDCTPLGYGSTCNQLDANGNASYAFNMYF  417

Query  1372  QINNQDVEACNFEGLAKIVKHNASTNGCLFPVALES  1479
             Q+ NQ   +C F+GLA     N ST  C F + +++
Sbjct  418   QVQNQKDMSCFFQGLAMQTTQNPSTAECNFTIQIKT  453



>ref|XP_002319699.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE95622.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=478

 Score =   508 bits (1307),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 313/438 (71%), Gaps = 5/438 (1%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
              S VHGLGVNWGT A + L+P  +VQMLKDN I KVKLFD+D  T+   AG+GIEV+  I
Sbjct  17    GSCVHGLGVNWGTMAIRKLSPETVVQMLKDNGILKVKLFDADQTTMTALAGSGIEVMVAI  76

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN+QL    D  + AKDWVK N++ +  +GG+ IK+VAVGNEPFL +YNGSF +  FPAL
Sbjct  77    PNDQLAVMGD-YNRAKDWVKRNVTRYNFNGGITIKYVAVGNEPFLTSYNGSFLNTTFPAL  135

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIRDLMIKICRYLRDHR  705
             +NIQ AL++AG+G+ IKAT+P NADVY S      PS G FRSDI D+M +I ++L  + 
Sbjct  136   RNIQNALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNG  195

Query  706   APFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKA  879
             APF VNIYPFLSLY N +FP ++AFFDG  + V DKG    YTN+FDAN DTL+ +L+ A
Sbjct  196   APFTVNIYPFLSLYGNDDFPFDYAFFDGAPQPVVDKGTGIQYTNVFDANFDTLVSALKAA  255

Query  880   KCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTD  1059
               GD+ ++VGE+GWPTDG+KNAN+  A +FY G + ++    GTP+  G +E YLF L D
Sbjct  256   GHGDMPIVVGEVGWPTDGDKNANIGYATRFYNGLIPRLVGNRGTPLRPGYIEVYLFGLLD  315

Query  1060  ENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK  1239
             E+AKSIAPG FERHWGIF YDG+PKFP+D +G+  ++   GA+NV YLPA+WC+ +   K
Sbjct  316   EDAKSIAPGNFERHWGIFRYDGQPKFPLDLSGQNQNKFLAGARNVQYLPAKWCMFNPNAK  375

Query  1240  DSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLA  1419
             D   +  N+ YACS SDC+AL  G+SCN LD    ASYAFNMY+Q+ NQD  ACNFEGLA
Sbjct  376   DLSKLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEGLA  435

Query  1420  KIVKHNASTNGCLFPVAL  1473
              +   N S   C F + +
Sbjct  436   TLTNQNISQGNCNFIIQI  453



>ref|XP_011034355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Populus euphratica]
Length=479

 Score =   508 bits (1307),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 246/435 (57%), Positives = 311/435 (71%), Gaps = 5/435 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             VHGLGVNWGT A + L P  +V+MLKDN I KVKLFD+D  T+N  AGTGIEV+  IPN+
Sbjct  20    VHGLGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPND  79

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    D  + AKDWVK N++ +  +GGV IK+VAVGNEPFL +YNGSF +  FPAL+NI
Sbjct  80    QLAVMGD-YNRAKDWVKRNVTRYNFNGGVTIKYVAVGNEPFLSSYNGSFLNTTFPALRNI  138

Query  541   QKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AG+G+ IKAT+P NADVY S      PS G FRSDI D+M +I ++L  + APF
Sbjct  139   QNALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNGAPF  198

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKAKCG  888
              VNIYPFLSLY N +FP ++AFFDG  + V D+G    YTN+FDAN DTL+ +L+ A  G
Sbjct  199   TVNIYPFLSLYGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAAGHG  258

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             D+ ++VGE+GWPTDG+KNAN   A +FY G + ++    GTP+  G +E YLF L DE+A
Sbjct  259   DMPIVVGEVGWPTDGDKNANTGYAIRFYNGLIPRLVGNRGTPLRPGYIEVYLFGLLDEDA  318

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH  1248
             KSIAPG FERHWGIF YDG+PKFP+D +G+  ++   GA+NV YLPA+WC+ +   KD  
Sbjct  319   KSIAPGNFERHWGIFRYDGQPKFPLDLSGQNQNKFLAGARNVQYLPAKWCMFNPNAKDLS  378

Query  1249  AVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIV  1428
              +  N+ YACS SDC+AL  G+SCN LD    ASYAFNMY+Q+ NQD  ACNFEGLA I 
Sbjct  379   KLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEGLATIT  438

Query  1429  KHNASTNGCLFPVAL  1473
               N S   C F + +
Sbjct  439   SQNISQGNCNFIIQI  453



>ref|XP_011010121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Populus euphratica]
Length=480

 Score =   508 bits (1307),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 248/435 (57%), Positives = 315/435 (72%), Gaps = 5/435 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A + L P  +V+MLKDN I KVKLFD+D  T+N  AGTGIEV+  IPN+
Sbjct  20    VDGLGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPND  79

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    D  + AKDWVK N++ +  +GGV IK+VAVGNEPFLK+YNGSF +  FPAL+NI
Sbjct  80    QLAVMGD-YNRAKDWVKRNVTRYNFNGGVTIKYVAVGNEPFLKSYNGSFLNTTFPALRNI  138

Query  541   QKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AG+G+ IKAT+P NADVY S      PS G FRSDI DLM +I ++L  + APF
Sbjct  139   QNALNDAGVGDSIKATVPLNADVYNSPDDQAYPSSGRFRSDINDLMTEIVQFLAQNNAPF  198

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKAKCG  888
              VNIYPFLSLY N +FP ++AFFDG  + V D+G    YTN+FDAN DTL+ +L+ A  G
Sbjct  199   TVNIYPFLSLYGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAAGHG  258

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             D+ ++VGE+GWPTDG+KNAN+  A +FY G L ++A   GTP+  G +E YLF L DE+A
Sbjct  259   DMPIVVGEVGWPTDGDKNANIGNAIRFYNGLLPRLAGNRGTPLRPGYIEVYLFGLLDEDA  318

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH  1248
             KSIAPG FERHWGIF YDG+PKFP+D +G+  ++  VGA+NV YLP++WC+ +   KD  
Sbjct  319   KSIAPGNFERHWGIFRYDGQPKFPMDLSGQVANKWLVGAQNVQYLPSRWCMFNPNAKDLS  378

Query  1249  AVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIV  1428
              +  N+ YACS SDC+AL  G+SCN LD    ASYAFNMY+Q+ NQD  ACNFEGLA + 
Sbjct  379   KLADNINYACSRSDCTALGYGSSCNGLDTNGNASYAFNMYYQVQNQDEFACNFEGLATVT  438

Query  1429  KHNASTNGCLFPVAL  1473
             + N S   C F + +
Sbjct  439   EQNISQGNCNFTIQI  453



>gb|KHN00669.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=468

 Score =   507 bits (1305),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 248/460 (54%), Positives = 326/460 (71%), Gaps = 6/460 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L    +V+MLKDN I KVKLFD+D  +++  +G+GIEV+  IPNN
Sbjct  10    VAGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  69

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D D A  WVK N++ +   GGV IK+VAVGNEPFLK+YNGSF ++  PAL+NI
Sbjct  70    QLAEM-NDYDRALQWVKKNVTRYNFRGGVNIKYVAVGNEPFLKSYNGSFLNITLPALQNI  128

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AGLG+ IKAT+P NADVY S    P  S G FR DI DLM +I ++L  ++APF
Sbjct  129   QNALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQFLAKNKAPF  188

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N NFP ++AFFDG A  + D G +YTN+FDAN DTL+ +L+K   G++
Sbjct  189   TVNIYPFLSLYGNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSALKKVGYGNM  248

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              V+VGE+GWPTDG+KNAN+  A +FY G L ++A  +GTP+  G +E YLF L DE+AK+
Sbjct  249   PVLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPGFIEVYLFGLIDEDAKN  308

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIFGYDGKPKFP+D +G+G  ++ VGA+NV YL   WC+ + + +D   +
Sbjct  309   IAPGNFERHWGIFGYDGKPKFPMDLSGKGQKKVLVGAQNVHYLEPNWCMFNPDAQDLSKL  368

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+++DC+AL  G+SCN+LD    ASYAFNMY+Q  +Q+  ACNFEGLA++   
Sbjct  369   ADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTTS  428

Query  1435  NASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLAL  1545
             N ST  C F V +    S++ R   +  +F  +  F L L
Sbjct  429   NISTPTCNFIVQINPSLSSSLRPQIVAFLFVTLLPFILFL  468



>ref|XP_006574750.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=484

 Score =   507 bits (1305),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 248/460 (54%), Positives = 326/460 (71%), Gaps = 6/460 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L    +V+MLKDN I KVKLFD+D  +++  +G+GIEV+  IPNN
Sbjct  26    VAGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  85

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D D A  WVK N++ +   GGV IK+VAVGNEPFLK+YNGSF ++  PAL+NI
Sbjct  86    QLAEM-NDYDRALQWVKKNVTRYNFRGGVNIKYVAVGNEPFLKSYNGSFLNITLPALQNI  144

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AGLG+ IKAT+P NADVY S    P  S G FR DI DLM +I ++L  ++APF
Sbjct  145   QNALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQFLAKNKAPF  204

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N NFP ++AFFDG A  + D G +YTN+FDAN DTL+ +L+K   G++
Sbjct  205   TVNIYPFLSLYGNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSALKKVGYGNM  264

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              V+VGE+GWPTDG+KNAN+  A +FY G L ++A  +GTP+  G +E YLF L DE+AK+
Sbjct  265   PVLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPGFIEVYLFGLIDEDAKN  324

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIFGYDGKPKFP+D +G+G  ++ VGA+NV YL   WC+ + + +D   +
Sbjct  325   IAPGNFERHWGIFGYDGKPKFPMDLSGKGQKKVLVGAQNVHYLEPNWCMFNPDAQDLSKL  384

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+++DC+AL  G+SCN+LD    ASYAFNMY+Q  +Q+  ACNFEGLA++   
Sbjct  385   ADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTTS  444

Query  1435  NASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLAL  1545
             N ST  C F V +    S++ R   +  +F  +  F L L
Sbjct  445   NISTPTCNFIVQINPSLSSSLRPQIVAFLFVTLLPFILFL  484



>ref|XP_010909077.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=478

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/459 (55%), Positives = 320/459 (70%), Gaps = 5/459 (1%)
 Frame = +1

Query  121   VGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDH  300
             + G RL +   F +    S V GLGVNWGT A   L P I+VQ+LKDN I KVKLFD+D 
Sbjct  1     MAGWRLVVCLLF-IGFYCSMVEGLGVNWGTMATHPLPPKIVVQLLKDNGIKKVKLFDADA  59

Query  301   WTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEP  480
              T++  AG+GIEV+  IPNNQL    +D D AK WV  N+S +  DGGV IK+VAVGNEP
Sbjct  60    ATMSALAGSGIEVMVAIPNNQLGAM-NDYDTAKKWVDRNVSRYHFDGGVTIKYVAVGNEP  118

Query  481   FLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRS  654
             FL +YNGSF ++ FPAL+NIQ AL+EAG G+ IKAT+P NADVY S T  P  S G FR+
Sbjct  119   FLSSYNGSFLNVTFPALQNIQNALNEAGFGDTIKATVPLNADVYNSPTNNPVPSAGRFRT  178

Query  655   DIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNM  834
             DI DLM +I ++     APF VNIYPFLSLY N NFP++FAFFDG ++ V D G  YTN+
Sbjct  179   DINDLMTQIVQFFNLSGAPFTVNIYPFLSLYGNDNFPLDFAFFDGTSQPVVDNGIQYTNV  238

Query  835   FDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTP  1014
             FDAN DTL+ +L+    G++ +IVGE+GWPTDG+KNA    A++FY G L+++A   GTP
Sbjct  239   FDANFDTLLSALKAVGLGNLPIIVGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANVGTP  298

Query  1015  VHKG-VVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKN  1191
             +     +E YLFSL DE+AKSIAPG FERHWGI  YDG+P+FP+D +G+G ++M V AKN
Sbjct  299   LRPNQYLEVYLFSLIDEDAKSIAPGNFERHWGILKYDGQPQFPMDLSGQGQNKMLVAAKN  358

Query  1192  VPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYF  1371
             V YLP  WCV +   KD   +G N+ YAC+ SDC++L  G++CN LD    ASYAFNMYF
Sbjct  359   VEYLPQTWCVFNPNAKDLSKLGDNINYACTFSDCTSLGYGSTCNQLDANGNASYAFNMYF  418

Query  1372  QINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAAT  1488
             Q  NQ   +C F+GLA     N ST  C F + ++++A+
Sbjct  419   QDQNQKDMSCFFQGLAMQTTQNPSTTECNFTIQIKTSAS  457



>ref|XP_010496623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
Length=482

 Score =   506 bits (1303),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 248/450 (55%), Positives = 318/450 (71%), Gaps = 6/450 (1%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             L I   FA+++  L S V+GLGVNWGT A   L P  +VQMLKDN+I+K KLFD+D  T+
Sbjct  5     LTIVVRFAIVIGNLGSTVNGLGVNWGTMATHKLPPKTVVQMLKDNNINKFKLFDADETTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                AG+GIEV+  IPN+QL +       AKDWV+ N++ +  DGGV I  VAVGNEPFLK
Sbjct  65    GALAGSGIEVMVAIPNDQL-KVMGSYHRAKDWVRKNVTRYNFDGGVNITFVAVGNEPFLK  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNGSF +L FPAL+NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI 
Sbjct  124   SYNGSFINLTFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDII  183

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ ++D G  YTN+FDA
Sbjct  184   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGVDYTNVFDA  242

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  243   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP  302

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPGEFERHWGIF +DG+PKFPID +G+G ++  +GA+NVPYL
Sbjct  303   TYIEVYLFGLLDEDAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKFLIGAQNVPYL  362

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WCV + E KD   + +N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ N
Sbjct  363   PNKWCVFNPEAKDLTKLAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKN  422

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             QD  AC F+GLA I   N S   C FP+ +
Sbjct  423   QDESACFFQGLATITTQNISQGQCSFPIQI  452



>ref|XP_003548760.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=478

 Score =   506 bits (1302),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 252/467 (54%), Positives = 324/467 (69%), Gaps = 4/467 (1%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
             F V L+   V G+GVNWGTQA   L P  +VQMLKDN I KVKLFDSD  T++  AGTGI
Sbjct  11    FVVGLMCLSVEGIGVNWGTQATHKLPPDTVVQMLKDNGIKKVKLFDSDDSTMSALAGTGI  70

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+  IPNNQL    +D   AK WVK N++ +  +GGV +K+VAVGNEPFLK+YN SF +
Sbjct  71    EVMVAIPNNQLAEM-NDYGRAKQWVKKNVTRYNFNGGVNVKYVAVGNEPFLKSYNNSFLN  129

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICR  687
             +  PAL+NIQ AL+EAGLG+KIKAT+P NADVY S    P  S G FR DI  LM +I +
Sbjct  130   ITLPALQNIQNALNEAGLGDKIKATVPLNADVYQSPESNPVPSAGIFRPDISGLMTQIVQ  189

Query  688   YLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWS  867
             +L  + APF VNIYPFLSLY N +FP  +AFFDG    V+D G  YTN+FDAN DTL+ +
Sbjct  190   FLSKNGAPFTVNIYPFLSLYGNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAA  249

Query  868   LRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLF  1047
             L+    GD+ ++VGE+GWPT+G+KNAN   A +FY G L ++A   GTP   G +E YLF
Sbjct  250   LKSVGFGDLPILVGEVGWPTEGDKNANAGNALRFYNGLLPRLAANRGTPRRPGYIEVYLF  309

Query  1048  SLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD  1227
              L DE+AKSIAPG FERHWGIF YDG+PKFP+D +G+  ++  +GA+NV YL  +WC+ +
Sbjct  310   GLIDEDAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQNQNKFLIGAQNVKYLAPRWCMFN  369

Query  1228  NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
              + KD   +  N+ YAC+  DC+AL  G+SCN+LD    ASYAFNMYFQ+ NQ+  ACNF
Sbjct  370   PDAKDLSKLPDNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNF  429

Query  1408  EGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             +GLAK+   N ST  C F V + +++  S  + ++ A I F  L L+
Sbjct  430   QGLAKLTTDNISTPTCNFIVQIVNSSASSLMMPSLVA-ILFVSLFLI  475



>ref|XP_002888279.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64538.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   506 bits (1302),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 247/450 (55%), Positives = 318/450 (71%), Gaps = 6/450 (1%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             LAI  GF +++  L   V+GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+
Sbjct  5     LAIVVGFVIVIGYLGILVNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                AG+G+EV+  IPN+QL +     D AKDWV+ N++ +  DGGV I  VAVGNEPFLK
Sbjct  65    GALAGSGLEVMVAIPNDQL-KVMTSYDRAKDWVRKNVTRYNFDGGVNITFVAVGNEPFLK  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNGSF +L FPAL NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI 
Sbjct  124   SYNGSFINLTFPALTNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDII  183

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ ++D G  YTN+FDA
Sbjct  184   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGIDYTNVFDA  242

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  243   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP  302

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPG FERHWGIF +DG+PKFPID +G+G +++ +GA+NVPYL
Sbjct  303   TYIEVYLFGLLDEDAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQGQNKLLIGAQNVPYL  362

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WC  + E KD   + +N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ N
Sbjct  363   PNKWCTFNPEAKDLTKLAANIDFACTFSDCTALGYGSSCNTLDANGNASYAFNMYFQVKN  422

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             QD  AC F+GLA I   N S   C FP+ +
Sbjct  423   QDESACFFQGLATITTQNISQGQCNFPIQI  452



>ref|XP_004288531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=486

 Score =   506 bits (1302),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 321/462 (69%), Gaps = 8/462 (2%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A   L P  +VQ+LKDN I KVKLFD++  T++  AGT IEV+  IPN+
Sbjct  26    VEGLGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPND  85

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL+        AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+NI
Sbjct  86    QLQAMTS-YPRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNITFPALQNI  144

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FRSDI  LM +I ++L  ++APF
Sbjct  145   QNALNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNKAPF  204

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWSLRKAKCG  888
              +NIYPFLSLY N +FP  +AFFDG A  + D   G  YTN+FDAN DTL+ SL+    G
Sbjct  205   TINIYPFLSLYGNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKAVGYG  264

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             D+ ++VGE+GWPTDG+KNAN+  A +FY G L ++A  +GTP+  G +E YLF L DE+A
Sbjct  265   DMAIVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPGFIEIYLFGLIDEDA  324

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH  1248
             KSIAPG FERHWGIF YDG+PKFPID +G+G +++ +GAKNV YL  +WC+ +   KD  
Sbjct  325   KSIAPGSFERHWGIFSYDGQPKFPIDVSGQGQNKLLMGAKNVQYLEKKWCMFNPNAKDLS  384

Query  1249  AVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIV  1428
              +  N+ YAC+ +DC+AL  G+SCN LD    ASYAFNMY+Q+ NQD  +CNFEGLA + 
Sbjct  385   KLADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFEGLATVT  444

Query  1429  KHNASTNGCLFPVALESAAT---RSGGITAVFAGIFFFCLAL  1545
               N S   C F + + S++T   R   +  +  G+ F  L L
Sbjct  445   TQNISQGTCNFIIQIASSSTFSLRPSPLVGIVLGVLFSILLL  486



>gb|KHN32753.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=466

 Score =   504 bits (1299),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 325/460 (71%), Gaps = 6/460 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L    +V+MLKDN I KVKLFD+D  +++  +G+GIEV+  IPNN
Sbjct  8     VEGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  67

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D D A  WVK N++ +   GG+ IK+VAVGNEPFLK+YNGSF ++  PAL+NI
Sbjct  68    QLAEM-NDYDRALQWVKKNVTRYNFRGGINIKYVAVGNEPFLKSYNGSFLNITLPALQNI  126

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AGLG+ IKAT+P NADVY S    P  S G FR DI DLM +I ++L  + APF
Sbjct  127   QNALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNAPF  186

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N NFP ++AFFDG A  ++D G +YTN+FDAN DTL+ +L K   G++
Sbjct  187   TVNIYPFLSLYGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGYGNM  246

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+KNAN+  A +FY G L ++A  +GTP+  G +E YLF L DE+AK+
Sbjct  247   PILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPGFIEVYLFGLIDEDAKT  306

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIFGYDGKPKFP+D +G+G +++ VGA+NV YL   WC+ + + +D   +
Sbjct  307   IAPGNFERHWGIFGYDGKPKFPMDLSGKGQNKLLVGAQNVHYLEPNWCMFNPDAQDLSKL  366

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+ +DC+AL  G+SCN+LD    ASYAFNMY+Q  +Q+  ACNFEGLA++   
Sbjct  367   ADNINYACTFADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTTS  426

Query  1435  NASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLAL  1545
             N ST  C F V +    S++ R   + ++F  +    L L
Sbjct  427   NISTPTCNFIVQINPSLSSSLRPPIVASLFVTLLPLILFL  466



>ref|XP_010314012.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=475

 Score =   504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 242/442 (55%), Positives = 312/442 (71%), Gaps = 3/442 (1%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             +L  S V GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D  T++  AG+ +EV+
Sbjct  14    LLFLSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVM  73

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
               IPN+QL    +D D AKDWVK N++ +   GGV IK+VAVGNEPFL +YN SF +  F
Sbjct  74    VAIPNDQLSAM-NDYDRAKDWVKRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFLNTTF  132

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLR  696
             PAL+NIQ AL+EAGLG+ IKAT+P NADVY S    P  S G FR DI DLM +I +++ 
Sbjct  133   PALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMS  192

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
              + APF VNIYPFLSLY N++FPV FAFFDG +  + D G +YTN+FDAN DTL+ +L+ 
Sbjct  193   QNNAPFTVNIYPFLSLYANEHFPVNFAFFDGASNPIVDNGLSYTNVFDANFDTLVSALKA  252

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A  G++ ++VGE+GWPTDG+KNAN+ +A +FYKG L ++A   GTP+  G +E YLF L 
Sbjct  253   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANVGTPLRPGFIEVYLFGLI  312

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+ KSIAPG FERHWGIF YDG+PKF +D TG+G D+  V A+NV YL  +WC+ +   
Sbjct  313   DEDGKSIAPGNFERHWGIFRYDGQPKFAMDLTGQGQDKFLVAAQNVEYLSKKWCMFNPNA  372

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
             KD   +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMY+Q  NQ+  +CNF+GL
Sbjct  373   KDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQGL  432

Query  1417  AKIVKHNASTNGCLFPVALESA  1482
             A +   N S   C F + + ++
Sbjct  433   ATLTDQNISQANCNFTIQIATS  454



>ref|XP_002277003.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 ref|XP_010653839.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 emb|CAN83571.1| hypothetical protein VITISV_041708 [Vitis vinifera]
 emb|CBI29926.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   504 bits (1298),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 314/446 (70%), Gaps = 3/446 (1%)
 Frame = +1

Query  145   WTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAG  324
             W     +   + V GLGVNWGT A+  L P ++VQMLKDN I KVKLFD+D  T++  AG
Sbjct  10    WVLLVGLFGCASVEGLGVNWGTMASHKLPPKVVVQMLKDNGIQKVKLFDADSVTMSALAG  69

Query  325   TGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGS  504
             +GIEV+  IPN+QL    +D D AK WV+ N++ +  +GGV IK+V VGNEPFL +YNGS
Sbjct  70    SGIEVMVAIPNDQLA-VMNDYDRAKAWVRRNVTRYNFNGGVTIKYVGVGNEPFLSSYNGS  128

Query  505   FKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIK  678
             F ++  PAL+NIQ AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI +LM +
Sbjct  129   FLNITLPALQNIQNALNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRTDISELMTQ  188

Query  679   ICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTL  858
             I ++L  + APF VNIYPFLSLY N NFP ++AFFDG +  + D G +YTN+FDAN DTL
Sbjct  189   IVQFLNKNNAPFTVNIYPFLSLYGNDNFPFDYAFFDGVSNPIVDNGISYTNVFDANFDTL  248

Query  859   IWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEF  1038
             + +L+    GD+ ++VGE+GWPTDG+KNAN   A +FY G L ++A   GTP+  G +E 
Sbjct  249   VSALKAVGLGDMTILVGEVGWPTDGDKNANSNNAYRFYNGLLPRLAGNIGTPLRPGYIEV  308

Query  1039  YLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWC  1218
             YLF L DE+AKSIAPG FERHWGIF YDG+PK+ +D +G+G +++ V AK+V YLP +WC
Sbjct  309   YLFGLIDEDAKSIAPGNFERHWGIFKYDGQPKYALDLSGQGQNKLLVAAKDVTYLPQKWC  368

Query  1219  VLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             + +    D   +G N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ NQD  +
Sbjct  369   MFNPNAGDLSKLGDNINYACTFSDCTALGYGSSCNGLDAQGNASYAFNMYFQVKNQDDLS  428

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALE  1476
             C F+GLAK+   N S   C F V +E
Sbjct  429   CYFQGLAKVTTQNISQGSCNFIVQIE  454



>emb|CDP18694.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 242/456 (53%), Positives = 321/456 (70%), Gaps = 4/456 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L P ++VQMLKDN I KVKLFD+D  T++  AG+ IEV+  IPN+
Sbjct  25    VEGLGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMVAIPND  84

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D D AK+WVK N++ ++ +GGV IK+VAVGNEPFL +YN SF +  FPAL+NI
Sbjct  85    QL-LVMNDYDRAKNWVKRNVTVYLFNGGVNIKYVAVGNEPFLASYNNSFVNTTFPALQNI  143

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AG G+ IKAT+P NADVY S  G P  S G FR+DI   M +I ++L  + APF
Sbjct  144   QNALNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFLNQNNAPF  203

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N +FPV++AFFDG A  + D G  YTN+FDAN DTL+ +L+    G +
Sbjct  204   TVNIYPFLSLYLNSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDTLVSALKGLGYGSM  263

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
             N++VGE+GWPTDG++NAN+  A +FY+G L ++A  +GTP+  G +E YLF L DE+ KS
Sbjct  264   NILVGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGYIEVYLFGLLDEDLKS  323

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             +APG FERHWGIF YDG+PKFP+D +G+  D+  VGA+NV YLPA+WC  +   KD   +
Sbjct  324   VAPGNFERHWGIFRYDGQPKFPMDLSGQLQDKYLVGAQNVQYLPAKWCQFNPNAKDLSKL  383

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+ +DC+AL  G+SCN LD    ASYAFNMYFQ+ NQ   +CNF+GLA + + 
Sbjct  384   AENINYACTFADCTALGYGSSCNGLDSNGNASYAFNMYFQVQNQGDLSCNFQGLAMVTEQ  443

Query  1435  NASTNGCLFPVAL-ESAATRSGGITAVFAGIFFFCL  1539
             N S   C F + +  S++ +   +  ++   F F L
Sbjct  444   NISQANCNFTIQIATSSSMKLLPVAGLYLAAFTFLL  479



>ref|XP_010470322.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=481

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 246/450 (55%), Positives = 318/450 (71%), Gaps = 6/450 (1%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             L +   FA+++  L   V+GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+
Sbjct  5     LTLVVRFAIVIFNLGITVNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                AG+G+EV+  IPN+QL +       AKDWV+ N++ +  DGGV I  VAVGNEPFLK
Sbjct  65    GALAGSGLEVMVAIPNDQL-KVMGSYHRAKDWVRKNVTRYNFDGGVNITFVAVGNEPFLK  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNGSF +L FPAL+NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI 
Sbjct  124   SYNGSFINLTFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDII  183

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ ++D G  YTN+FDA
Sbjct  184   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGVDYTNVFDA  242

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  243   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP  302

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPGEFERHWGIF +DG+PKFPID +G+G ++  +GA+NVPYL
Sbjct  303   TYIEVYLFGLLDEDAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKFLIGAQNVPYL  362

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WCV + E KD   + +N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ N
Sbjct  363   PNKWCVFNPEAKDLTKLAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKN  422

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             QD  AC F+GLA I   N S   C FP+ +
Sbjct  423   QDESACFFQGLATITTQNISQGQCSFPIQI  452



>ref|NP_176656.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 ref|NP_001031232.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|Q6NKW9.2|E138_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 8; AltName: Full=(1->3)-beta-glucan 
endohydrolase 8; Short=(1->3)-beta-glucanase 
8; AltName: Full=Beta-1,3-endoglucanase 8; Short=Beta-1,3-glucanase 
8; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAD43273.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44619.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34283.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEE34284.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=481

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 246/450 (55%), Positives = 316/450 (70%), Gaps = 6/450 (1%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             LA+  GF +++  L   V+GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+
Sbjct  5     LALVVGFVIVIGHLGILVNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                AG+G+EV+  IPN+QL +     D AKDWV+ N++ +  DGGV I  VAVGNEPFLK
Sbjct  65    GALAGSGLEVMVAIPNDQL-KVMTSYDRAKDWVRKNVTRYNFDGGVNITFVAVGNEPFLK  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNGSF +L FPAL NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI 
Sbjct  124   SYNGSFINLTFPALANIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDII  183

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ ++D G  YTN+FDA
Sbjct  184   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPLNYAFFDG-AEPINDNGIDYTNVFDA  242

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  243   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP  302

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPG FERHWGIF +DG+PKFPID +G+G  +  +GA+NVPYL
Sbjct  303   TYIEVYLFGLLDEDAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQGQSKFLIGAQNVPYL  362

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WC  + E KD   + +N+ YAC+ SDC+AL  G+SCN LD    ASYAFNM+FQ+ N
Sbjct  363   PNKWCTFNPEAKDLTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKN  422

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             QD  AC F+GLA I   N S   C FP+ +
Sbjct  423   QDESACYFQGLATITTQNISQGQCNFPIQI  452



>ref|XP_010054473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
 gb|KCW89851.1| hypothetical protein EUGRSUZ_A02084 [Eucalyptus grandis]
Length=478

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 321/458 (70%), Gaps = 11/458 (2%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D +T++  AG+ IEV+  IPN+
Sbjct  22    VEGLGVNWGTMATHELPPGTVVQMLKDNGIKKVKLFDADQYTLSALAGSNIEVMVAIPND  81

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL       + AK WV+ N++ +  +GGV IK+VAVGNEPFL AYNGSF ++ FPAL+NI
Sbjct  82    QLASMTS-YERAKQWVQRNVTRYNFNGGVSIKYVAVGNEPFLSAYNGSFLNVTFPALQNI  140

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+E G+G+ +KAT+P NADVY S    P  S G FR+DI DLM +I  +L  + AP 
Sbjct  141   QNALNEVGVGDTVKATVPVNADVYNSPVSNPVPSAGRFRTDISDLMTQIVEFLAKNSAPL  200

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N NFP+++AFFDG A  V D G  YTN+FDAN DTL+ +L+    GD+
Sbjct  201   TVNIYPFLSLYGNDNFPIDYAFFDG-ATPVVDNGIQYTNVFDANFDTLVSALKAVGHGDM  259

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+KNAN+  A +FY G + ++A   GTP+  G +E YLF L DE+AKS
Sbjct  260   TLMVGEVGWPTDGDKNANIASAVRFYNGLMPRLAANTGTPLRPGYIEVYLFGLIDEDAKS  319

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF YDG+PKFP+D +G+  ++  V AKNV YLP QWCVL+ +  D   +
Sbjct  320   IAPGSFERHWGIFRYDGQPKFPLDLSGQNQNKFLVAAKNVNYLPQQWCVLNPKANDLSKL  379

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
             G+N+ YAC+ +DC++L  G+SCN LD    ASYAFNMY+Q+ NQ+  +CNFEGLA +   
Sbjct  380   GTNINYACTFADCTSLGYGSSCNSLDANGNASYAFNMYYQVQNQNPLSCNFEGLATVTTQ  439

Query  1435  NASTNGCLFPVALESAATRSGG-------ITAVFAGIF  1527
             N S   C F + + ++ + S G       ++AVFA +F
Sbjct  440   NISQGTCNFIIQIAASPSSSLGPSLVALVLSAVFAFLF  477



>gb|AFU52646.1| beta-1,3-glucanase 11 [Solanum tuberosum]
Length=469

 Score =   503 bits (1295),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 311/442 (70%), Gaps = 3/442 (1%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             +L  S V GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D  T++  AG+ +EV+
Sbjct  8     LLFLSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVM  67

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
               IPN+QL    +D D AKDWVK N++ +   GGV IK+VAVGNEPFL +YN SF +  F
Sbjct  68    VAIPNDQLSAM-NDYDRAKDWVKRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFLNTTF  126

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLR  696
             PAL+NIQ AL+EAGLG+ IKAT+P NADVY S    P  S G FR DI DLM +I +++ 
Sbjct  127   PALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMS  186

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
              + APF VNIYPFLSLY N++FPV+FAFFDG +  + D G +YTN+FDAN DTL+ +L+ 
Sbjct  187   QNNAPFTVNIYPFLSLYANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKA  246

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A  G++ ++VGE+GWPTDG+KNAN+ +A +FYKG L ++A   GTP+  G +E YLF L 
Sbjct  247   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPGFIEVYLFGLI  306

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+ KSIAPG FERHWGIF YDG+PKF +D  G+G D+  V A+NV Y   +WC+ +   
Sbjct  307   DEDGKSIAPGNFERHWGIFRYDGQPKFAMDLMGQGQDKFLVAARNVEYFSKKWCMFNPNA  366

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
             KD   +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMY+Q  NQ+  +CNF+GL
Sbjct  367   KDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQGL  426

Query  1417  AKIVKHNASTNGCLFPVALESA  1482
             A +   N S   C F + + ++
Sbjct  427   ATLTDQNISQANCNFTIQIATS  448



>dbj|BAK06743.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   504 bits (1297),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 313/435 (72%), Gaps = 7/435 (2%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             LGVNWG+Q    L+PS +V+MLK+N I KVKLFD+D W V     +GIEV+ GIPN+ LE
Sbjct  33    LGVNWGSQCTHPLDPSAVVKMLKENGIMKVKLFDADPWPVGALLDSGIEVMLGIPNDMLE  92

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
                    NA+DWV  N +S+     +K+++VAVGNEPFLK+YNGSF +   PALKNIQKA
Sbjct  93    TMTS-YGNAEDWVAENATSY--GDRLKLRYVAVGNEPFLKSYNGSFMETTVPALKNIQKA  149

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             LDEAGLG+K+KAT+P NADVY      PSEG FR DI D+M  + +++ DH APF+VNIY
Sbjct  150   LDEAGLGDKVKATVPLNADVYVGDK--PSEGKFRPDIDDVMTDMVKFMHDHGAPFVVNIY  207

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVG  909
             PFLSLY++ +FP EFAFFDG      + G +Y+N+FDAN DTL+ +L+KA   ++ VIVG
Sbjct  208   PFLSLYQSDDFPFEFAFFDGGHSIQDNGGVSYSNVFDANYDTLVSALKKAGVANLKVIVG  267

Query  910   EIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGE  1089
             E+GWPTDGNKN N K+A +FY G L+K+AK EGT + +G ++ YLF L DE+ KSIAPG 
Sbjct  268   EVGWPTDGNKNGNAKLARRFYDGLLKKLAKNEGTHLRQGKMDVYLFGLFDEDMKSIAPGN  327

Query  1090  FERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE-QKDSHA-VGSN  1263
             FERHWGI  YDGKPKF +D +G+GNDR+      V YLP QWCV D +  KD    +  N
Sbjct  328   FERHWGILTYDGKPKFAMDLSGQGNDRLLAAVPGVEYLPKQWCVFDEDAAKDGKGKLPGN  387

Query  1264  LGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAS  1443
             + YAC+  DC+AL  G SCN LD  S  SYAFNMYFQ+ +QDV AC+F+GLAKI   NAS
Sbjct  388   IQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKISDKNAS  447

Query  1444  TNGCLFPVALESAAT  1488
             T  CLFPV + SAAT
Sbjct  448   TKTCLFPVQIISAAT  462



>ref|XP_006362259.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=479

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 314/458 (69%), Gaps = 6/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G GVNWGT A   L P I+VQMLKDN I+KVKLFD+D  T+N  AGT IEV+  IPN+
Sbjct  23    VEGFGVNWGTMATHMLEPKIVVQMLKDNGINKVKLFDADKSTMNALAGTDIEVMVAIPND  82

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    D  D AKDWV+ N++ +    GV IK+VAVGNEPFL AYN SF +L FPAL+NI
Sbjct  83    QLLTMTD-YDRAKDWVRRNVTRYNFKNGVNIKYVAVGNEPFLTAYNNSFLNLTFPALRNI  141

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI +LM +I  ++  ++APF
Sbjct  142   QNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVEFMSKNQAPF  201

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N++FP++FAFFDG    V D G  YTN+FDAN DTL  +L+    G++
Sbjct  202   TVNIYPFLSLYANEHFPIDFAFFDGTPSPVLDNGVEYTNVFDANFDTLYSALKAVGYGNM  261

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+KNAN+  A +FYKG   K+A   GTP+  G +E YLF L DE+AKS
Sbjct  262   AILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGYIEVYLFGLIDEDAKS  321

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF YDG+ KFP+D +G+G D+  V AKNV YLP +WC+L+    D   +
Sbjct  322   IAPGNFERHWGIFRYDGQSKFPMDISGQGQDKHLVAAKNVQYLPNRWCMLNPNATDLSKL  381

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
              +N+ YAC+ SDC++L  G+SCN+LD    ASYAFNM++Q+ NQ   +C+FEGLA +   
Sbjct  382   ANNIDYACTFSDCTSLGYGSSCNNLDAIGNASYAFNMFYQVQNQLDLSCDFEGLAMVTNR  441

Query  1435  NASTNGCLFPVALESAATRSG---GITAVFAGIFFFCL  1539
             N S   C F +     +       GI  + +G  F  L
Sbjct  442   NLSQGTCNFIIQTGKYSISHKVLPGIVVLLSGFIFLLL  479



>ref|XP_008806060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=460

 Score =   503 bits (1294),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 318/441 (72%), Gaps = 4/441 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A   L P+I+VQ+LKDN I+KVKLFD+D   ++  AG+GIEV+  IPNN
Sbjct  2     VEGLGVNWGTLATHPLPPNIVVQLLKDNGINKVKLFDADAKMMSALAGSGIEVMVAIPNN  61

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D   AK+WV+ N++ +  DGGV I +VAVGNEPFLK+YN SF ++ FPAL+NI
Sbjct  62    QLAAM-NDYTTAKEWVRKNVTRYHFDGGVNITYVAVGNEPFLKSYNDSFSNVTFPALQNI  120

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ +KAT+P NADVY S  G   PS G FRSDI D+M +I ++   + APF
Sbjct  121   QNALNEAGVGDSVKATVPLNADVYESPAGNAVPSAGRFRSDINDVMTQIVQFFNQNGAPF  180

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N NFP++FAFFDG +  V D G  YTN+FDAN DTL+ +L     G++
Sbjct  181   TVNIYPFLSLYGNDNFPLDFAFFDGTSPPVVDNGIEYTNVFDANFDTLVSALNAVGLGNL  240

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAK  1071
              +IVGE+GWPTDG+K+A    A++FY G L+++A  +GTP+     +E YLF L DE+AK
Sbjct  241   PIIVGEVGWPTDGDKSAEASYAQRFYNGLLKRLAAGQGTPLRPNQYLEVYLFGLLDEDAK  300

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             S+APG FERHWGIF YDG+PKFP+D +G+G ++M   AKNV YLP +WCV + + KD   
Sbjct  301   SVAPGNFERHWGIFRYDGQPKFPVDLSGQGQNKMLAAAKNVEYLPQKWCVFNPDAKDLSK  360

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +  N+ +AC+ SDC++L  G++C+DLD    ASYAFNMY+Q+ NQD  +C F+GLA    
Sbjct  361   LADNVNFACTFSDCTSLGSGSTCSDLDANGSASYAFNMYYQVQNQDDTSCFFQGLAMETA  420

Query  1432  HNASTNGCLFPVALESAATRS  1494
              + ST  C F V ++++A+ S
Sbjct  421   QDPSTADCKFTVQIKTSASAS  441



>ref|XP_002525445.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36935.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=480

 Score =   503 bits (1294),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 315/442 (71%), Gaps = 5/442 (1%)
 Frame = +1

Query  175   SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIP  354
             S V+GLGVNWGTQA   L P  +VQMLKDN I KVKLFDSD  T+   AG+G+EV+  IP
Sbjct  18    SCVYGLGVNWGTQATHKLPPKTVVQMLKDNGIQKVKLFDSDRNTMTALAGSGLEVMVAIP  77

Query  355   NNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALK  534
             N+QL    +D D AKDWVK N+S +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+
Sbjct  78    NDQLAAM-NDYDRAKDWVKRNVSIYNFNGGVNIKYVAVGNEPFLTSYNGSFINITFPALQ  136

Query  535   NIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRA  708
             NIQ AL+EAG+G+ +KAT+P NADVY S T  P  S G FR DI D+M  I ++L  + A
Sbjct  137   NIQNALNEAGVGDSVKATVPLNADVYNSPTDQPYPSAGRFRIDINDIMTNIVQFLHKNNA  196

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKAK  882
             PF VNIYPFLSLY N +FP ++AFFDG  + V D+G    YTN+FDAN DTL+ +L+   
Sbjct  197   PFTVNIYPFLSLYGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAVG  256

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
              GD+ +IVGE+GWPTDG+KNA +  A +FY G L ++A   GTP+  G +E YLF L DE
Sbjct  257   FGDMPIIVGEVGWPTDGDKNAKVDYAYRFYNGLLPRLAGNRGTPLRPGFIEVYLFGLLDE  316

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             +AKSIAPG FERHWGIF YDG+PKF +D +G+G +++ VGA+NV Y P++WC+ +   KD
Sbjct  317   DAKSIAPGNFERHWGIFRYDGQPKFALDLSGQGQNKLLVGAQNVQYQPSKWCMFNPNAKD  376

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMY+Q+  QD  ACNF+GLA 
Sbjct  377   LSKLADNIDYACTFSDCTALGYGSSCNGLDSNGNASYAFNMYYQVQKQDDMACNFQGLAM  436

Query  1423  IVKHNASTNGCLFPVALESAAT  1488
             +   N S   C F + + S+ +
Sbjct  437   VTTQNLSQGTCNFIIQIASSPS  458



>ref|XP_006348032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=475

 Score =   502 bits (1293),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 311/442 (70%), Gaps = 3/442 (1%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             +L  S V GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D  T++  AG+ +EV+
Sbjct  14    LLFLSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVM  73

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
               IPN+QL    +D D AKDWVK N++ +   GGV IK+VAVGNEPFL +YN SF +  F
Sbjct  74    VAIPNDQLSAM-NDYDRAKDWVKRNVTRYNFKGGVNIKYVAVGNEPFLTSYNNSFLNTTF  132

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLR  696
             PAL+NIQ AL+EAGLG+ IKAT+P NADVY S    P  S G FR DI DLM +I +++ 
Sbjct  133   PALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMS  192

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
              + APF VNIYPFLSLY N++FPV+FAFFDG +  + D G +YTN+FDAN DTL+ +L+ 
Sbjct  193   QNNAPFTVNIYPFLSLYANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKA  252

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A  G++ ++VGE+GWPTDG+KNAN+ +A +FYKG L ++A   GTP+  G +E YLF L 
Sbjct  253   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPGFIEVYLFGLI  312

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+ KSIAPG FERHWGIF YDG+PKF +D  G+G D+  V A+NV Y   +WC+ +   
Sbjct  313   DEDGKSIAPGNFERHWGIFRYDGQPKFAMDLMGQGQDKFLVAARNVEYFSKKWCMFNPNA  372

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
             KD   +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMY+Q  NQ+  +CNF+GL
Sbjct  373   KDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQGL  432

Query  1417  AKIVKHNASTNGCLFPVALESA  1482
             A +   N S   C F + + ++
Sbjct  433   ATLTDQNISQANCNFTIQIATS  454



>ref|XP_004288532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=474

 Score =   502 bits (1293),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 314/442 (71%), Gaps = 5/442 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A   L P  +VQ+LKDN I KVKLFD++  T++  AGT IEV+  IPN+
Sbjct  26    VEGLGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPND  85

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL+        AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+NI
Sbjct  86    QLQAMTS-YPRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNITFPALQNI  144

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FRSDI  LM +I ++L  ++APF
Sbjct  145   QNALNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNKAPF  204

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWSLRKAKCG  888
              +NIYPFLSLY N +FP  +AFFDG A  + D   G  YTN+FDAN DTL+ SL+    G
Sbjct  205   TINIYPFLSLYGNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKAVGYG  264

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             D+ ++VGE+GWPTDG+KNAN+  A +FY G L ++A  +GTP+  G +E YLF L DE+A
Sbjct  265   DMAIVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPGFIEIYLFGLIDEDA  324

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH  1248
             KSIAPG FERHWGIF YDG+PKFPID +G+G +++ +GAKNV YL  +WC+ +   KD  
Sbjct  325   KSIAPGSFERHWGIFSYDGQPKFPIDVSGQGQNKLLMGAKNVQYLEKKWCMFNPNAKDLS  384

Query  1249  AVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIV  1428
              +  N+ YAC+ +DC+AL  G+SCN LD    ASYAFNMY+Q+ NQD  +CNFEGLA + 
Sbjct  385   KLADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFEGLATVT  444

Query  1429  KHNASTNGCLFPVALESAATRS  1494
               N S   C F + + S++T S
Sbjct  445   TQNISQGTCNFIIQIASSSTFS  466



>ref|XP_004249143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=479

 Score =   502 bits (1292),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 317/458 (69%), Gaps = 6/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G GVNWGT A   L P I+VQML+DN I KVKLFD+D  T++  AGT IEV+  IPN+
Sbjct  23    VEGFGVNWGTMATHMLEPKILVQMLRDNGIKKVKLFDADKSTMDALAGTDIEVMVAIPND  82

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    D +D AKDWV+ N++ +    GV IK+VAVGNEPFL +YN SF +L FPAL+NI
Sbjct  83    QLLTMTD-IDRAKDWVRRNVTRYNFKNGVNIKYVAVGNEPFLTSYNNSFVNLTFPALQNI  141

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI +LM +I +++  ++APF
Sbjct  142   QNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMSKNQAPF  201

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N++FP++FAFFDG    V D G  YTN+FDAN DTL  +L+    G +
Sbjct  202   TVNIYPFLSLYANEHFPMDFAFFDGTPNPVLDNGVEYTNVFDANFDTLYSALKAVGYGHM  261

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+KNAN+  A +FYKG   K+A   GTP+  G +E YLF L DE+AKS
Sbjct  262   AILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGYIEVYLFGLIDEDAKS  321

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF YDG+PKFP+D +G+G D+  V AKNV YLP +WC+L+   KD   +
Sbjct  322   IAPGNFERHWGIFRYDGQPKFPMDISGQGQDKHLVAAKNVQYLPNRWCMLNPNAKDLSKL  381

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
              +N+ YAC+ SDC++L  G+SCN+LD    ASYAFNMY+Q+ NQ   +C+FEGLA +   
Sbjct  382   ANNIDYACTFSDCTSLGFGSSCNNLDAIGNASYAFNMYYQVQNQLDLSCDFEGLAMVTNK  441

Query  1435  NASTNGCLFPVALESAATRSG---GITAVFAGIFFFCL  1539
             N S   C F +     +  +    GI  + +G  F  L
Sbjct  442   NLSQGTCNFIIQTGKYSFSNKVLPGIVVLLSGFTFLLL  479



>ref|XP_004493147.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=477

 Score =   501 bits (1291),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/475 (52%), Positives = 324/475 (68%), Gaps = 9/475 (2%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             +R+ +  G    L+   V GLGVNWGTQA   L P  +VQMLKDN I KVKLFD+D  T+
Sbjct  7     LRVVLMVG----LMGLYVEGLGVNWGTQATHQLPPETVVQMLKDNGIQKVKLFDADDNTM  62

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
             +  AG+GIEV+  IPNNQL    +D   A+ WVK N++ +   GGV IK+VAVGNEPFLK
Sbjct  63    SALAGSGIEVMVAIPNNQLA-VMNDYKRAQQWVKKNVTRYNFHGGVNIKYVAVGNEPFLK  121

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YN SF ++  PAL+NIQ A++EAGLG+ +KAT+P NADVY S    P  S G FR DI 
Sbjct  122   SYNNSFLNITLPALQNIQNAINEAGLGDTVKATVPLNADVYQSPEDNPLPSAGTFRPDIS  181

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
              LM ++ ++L  + APF VNIYPFLSLY N +FP  +AFFDG    + D G  YTN+FDA
Sbjct  182   GLMTEMVQFLNKNSAPFTVNIYPFLSLYGNDDFPFNYAFFDGVDAPIMDNGIQYTNVFDA  241

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ +L+    GD  ++VGE+GWPT+G+KNAN   A +FY G L ++A  +GTP   
Sbjct  242   NFDTLVSALKSVGFGDTPILVGEVGWPTEGDKNANAGNALRFYNGLLSRLAANKGTPRRP  301

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
             G +E YLF L DE+AKSIAPG FERHWGIF YDG+PKFP+D TG+G ++  +GA+NV YL
Sbjct  302   GFIEVYLFGLIDEDAKSIAPGNFERHWGIFRYDGQPKFPMDLTGQGQNKFLIGAQNVKYL  361

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
                WC+++ + KD   +  NL +AC+  DC+AL  G+SCN+LD    ASYAFNMY+Q+ N
Sbjct  362   SPTWCMVNPDAKDLSKLADNLNFACAYGDCTALGYGSSCNNLDAIGNASYAFNMYYQVQN  421

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             Q+ +ACNF+GLAK+   N ST  C F + +  A + +  +   FA + F  L ++
Sbjct  422   QNRQACNFQGLAKLTTDNISTPTCNFTIQI--APSSASSLMPSFAALLFVALFMI  474



>ref|XP_007159772.1| hypothetical protein PHAVU_002G266100g [Phaseolus vulgaris]
 gb|ESW31766.1| hypothetical protein PHAVU_002G266100g [Phaseolus vulgaris]
Length=515

 Score =   501 bits (1291),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 233/431 (54%), Positives = 315/431 (73%), Gaps = 2/431 (0%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWG  ++  L+P I+V +LK+N I ++KLFD+D W V+ F+G+ IEV+ GIPN  L+
Sbjct  62    IGVNWGEISSHPLDPPIVVNLLKENGISRIKLFDADPWVVSAFSGSDIEVMVGIPNEMLK  121

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
             + +   D A+DWVK N++  + +GGV I++V+VGNEPFLK+YN SF     PA++NIQ+A
Sbjct  122   KLSKHKDKAEDWVKHNVTKQV-NGGVNIRYVSVGNEPFLKSYNNSFVGTTLPAMRNIQRA  180

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             L +AG G++IK T   NADVY S T  PS+G+FR DI DLM  I  +L ++++PF+VNIY
Sbjct  181   LSKAGFGDQIKVTTALNADVYESATDKPSDGSFRKDIADLMKDIVTFLEENKSPFLVNIY  240

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVG  909
             PFLSLY+N+ FP ++AFFDG AK   DK   Y+NMFDANLDTL+WSL+K    +V +++G
Sbjct  241   PFLSLYQNEGFPKDYAFFDGNAKGTDDKNTHYSNMFDANLDTLVWSLKKVGHPNVTIVIG  300

Query  910   EIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGE  1089
             E+GWPTDG+K+A  + A++FY+G+L+KMA K+G+P+H   V  YLFSLTDE+ KS+APG+
Sbjct  301   EVGWPTDGDKSATNENAKRFYQGYLKKMANKKGSPLHPQTVVTYLFSLTDEDQKSVAPGD  360

Query  1090  FERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLG  1269
             FERHWGIF YDGKPKF +DF+G+G D+MPV AK V Y   QWCVL       + +  +  
Sbjct  361   FERHWGIFTYDGKPKFSVDFSGKGQDQMPVAAKGVIYQQQQWCVLKRNSSKKN-LQPSFT  419

Query  1270  YACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTN  1449
             YAC   DC++L  G SC  LD    ASYAFN +FQIN+Q VEAC+F GLA+IV  + ST 
Sbjct  420   YACLHGDCTSLGAGRSCASLDEAGNASYAFNQFFQINDQSVEACDFNGLAQIVTEDPSTP  479

Query  1450  GCLFPVALESA  1482
              C FP+A+ S 
Sbjct  480   ACNFPLAILST  490



>gb|AAQ90287.1| beta-1,3-glucanase, acidic [Coffea arabica]
Length=480

 Score =   499 bits (1286),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 318/458 (69%), Gaps = 6/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L P ++VQMLKDN I KVKLFD+D  T++  AG+ IEV+  IPN+
Sbjct  25    VEGLGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMVAIPND  84

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D D AK+WVK N++ ++ +GGV IK+VAVGNEPFL +YN SF +  FPAL+NI
Sbjct  85    QL-LVMNDYDRAKNWVKRNVTVYLFNGGVNIKYVAVGNEPFLASYNNSFVNTTFPALQNI  143

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AG G+ IKAT+P NADVY S  G P  S G FR+DI   M +I ++L  + APF
Sbjct  144   QNALNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFLNQNNAPF  203

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N +FPV++AFFDG A  + D G  YTN+FDAN D L+ +L+    G +
Sbjct  204   TVNIYPFLSLYLNSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDALVSALKGLGYGSM  263

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
             N++VGE+GWPTDG++NAN+  A +FY+G L ++A  +GTP+  G +E YLF L DE+ KS
Sbjct  264   NILVGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGYIEVYLFGLLDEDLKS  323

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             +APG FERHWGIF YDG+PKFP+D +G+  D+  VGA+NV Y PA+WC  +   KD   +
Sbjct  324   VAPGNFERHWGIFRYDGQPKFPMDLSGQLQDKYLVGAQNVQYFPAKWCQFNPNAKDLSKL  383

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+ +DC+AL  G+SCN LD    ASYAFNMYFQ+ NQ   +CNF+GLA + + 
Sbjct  384   VENINYACTFADCTALGYGSSCNGLDANGNASYAFNMYFQVQNQGDLSCNFQGLAMVTEQ  443

Query  1435  NASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             N S   C F + +   AT S       AG++   L  L
Sbjct  444   NISQANCNFTIQI---ATSSSMKLLPVAGLYLAALTFL  478



>ref|XP_010672074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/461 (53%), Positives = 317/461 (69%), Gaps = 3/461 (1%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             +L +  V GLGVNWGTQA   L PS +VQMLKDN I KVKLFD+D  T++ F+GT IEV+
Sbjct  25    LLWSEIVEGLGVNWGTQAIHKLPPSTVVQMLKDNGIQKVKLFDADESTLSAFSGTNIEVM  84

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
               IPN  L    D  D A+ WV+ N++ +   GGV IK+VAVGNEPFLKAYNG+F++  F
Sbjct  85    VAIPNGDLVAMLD-YDRARKWVEKNVTRYNFKGGVNIKYVAVGNEPFLKAYNGTFENATF  143

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIRDLMIKICRYLR  696
             PALKNIQ AL+EAG+GN +KAT+P NADVY S  GT  PS G FR D+ DLM ++ ++L 
Sbjct  144   PALKNIQNALNEAGVGNTVKATVPLNADVYESPEGTPVPSAGRFRPDVADLMTQMVQFLS  203

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
              + APF VNIYPFLSLY N  FPV++AFFDG A  + D G  YTN+FDAN DTL+ +L+ 
Sbjct  204   QNNAPFSVNIYPFLSLYGNPGFPVDYAFFDGGAAPIADNGIEYTNVFDANFDTLVSALKA  263

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A  GD+ +IVGE+GWPT+G+ NAN+  A +FY+G L ++A   GTP+  G +E YLF L 
Sbjct  264   AGYGDLPIIVGEVGWPTNGDVNANINNAIRFYRGLLPRIAANTGTPLRPGNIEMYLFGLL  323

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+AK++APG FERHWGIF YDG+PKFP+D TG+  D   VGAK+V YL  QWC  +   
Sbjct  324   DEDAKTVAPGNFERHWGIFRYDGQPKFPMDLTGQNRDVYLVGAKDVTYLQNQWCEFNPNA  383

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
             KD   +  N+ +AC+ +DC+ L  G+SC+ +D     SYAFN+YFQ  NQ++EACNF+GL
Sbjct  384   KDVSKLAENIDFACTFADCTPLGYGSSCHGMDANGNISYAFNVYFQTQNQNLEACNFQGL  443

Query  1417  AKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCL  1539
             A++   N S   C F + + S    +  +   F   F +  
Sbjct  444   ARLTLQNISAPTCNFTIQIASGLRTAVPVAFSFITAFMYLF  484



>ref|XP_007151834.1| hypothetical protein PHAVU_004G079100g [Phaseolus vulgaris]
 gb|ESW23828.1| hypothetical protein PHAVU_004G079100g [Phaseolus vulgaris]
Length=479

 Score =   499 bits (1285),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 240/440 (55%), Positives = 316/440 (72%), Gaps = 3/440 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L    +V+MLKDN I KVKLFD+D  +++  +G+GIE +  IPNN
Sbjct  22    VEGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIETMVAIPNN  81

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D D A  WVK N++S+   GGV IK+VAVGNEPFL++YNGSF  + FPAL+NI
Sbjct  82    QLSEM-NDYDRAMQWVKKNVTSYNFRGGVNIKYVAVGNEPFLRSYNGSFMKVTFPALQNI  140

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+E G+G+ IKAT+P NADVY S    P  S G FR DI +LMI+I ++L  + APF
Sbjct  141   QNALNEVGVGDSIKATVPLNADVYESPINNPVPSAGMFRPDISELMIQIVQFLAKNNAPF  200

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N NFP ++AFFDG A  ++D G +YTN+FDAN DTL+ +L+K   GD+
Sbjct  201   TVNIYPFLSLYGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALQKVGYGDM  260

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+KNAN+  A +FY G L ++A  +GTP+    +E YLF L DE+AKS
Sbjct  261   PILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLALNKGTPLKPKYIEVYLFGLIDEDAKS  320

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             I PG FERHWGIF YDGKPKFP+D +G+G  ++ VGA+NV YL  +WC+ + E +D   +
Sbjct  321   IDPGNFERHWGIFKYDGKPKFPMDLSGKGPKKLLVGAQNVHYLDPKWCMFNPETQDISKL  380

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+++DC+AL  G+SCN+LD    ASYAFNMY+Q  +Q+  ACNFEGLA++   
Sbjct  381   ADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNDLACNFEGLARLTTT  440

Query  1435  NASTNGCLFPVALESAATRS  1494
             N ST  C F + +  + + S
Sbjct  441   NISTPSCNFILQINPSLSPS  460



>ref|XP_006599436.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=483

 Score =   499 bits (1285),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 324/460 (70%), Gaps = 6/460 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L    +V+MLKDN I KVKLFD+D  +++  +G+GIEV+  IPNN
Sbjct  25    VEGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  84

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D D A  WVK N++ +   GG+ IK+VAVGNEPFLK+YNGSF ++  PAL+NI
Sbjct  85    QLAEM-NDYDRALQWVKKNVTRYNFRGGINIKYVAVGNEPFLKSYNGSFLNITLPALQNI  143

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL++AGLG+ IKAT+P NADVY S    P  S G FR DI DLM +I ++L  + APF
Sbjct  144   QNALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNAPF  203

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N NFP ++AFFDG A  ++D G +YTN+FDAN DTL+ +L K   G++
Sbjct  204   TVNIYPFLSLYGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGYGNM  263

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+KNAN+  A +FY G L ++A  +GTP+  G +E YLF L DE+AK+
Sbjct  264   PILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPGFIEVYLFGLIDEDAKT  323

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIFGYDGKPKFP+D +G+G +++ VGA+NV YL   WC+ + + +D   +
Sbjct  324   IAPGNFERHWGIFGYDGKPKFPMDLSGKGQNKLLVGAQNVHYLEPNWCMFNPDAQDLSKL  383

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+ +DC+A+  G+S N+LD    ASYAFNMY+Q  +Q+  ACNFEGLA++   
Sbjct  384   ADNINYACTFADCTAIGYGSSGNNLDANGNASYAFNMYYQTQDQNYMACNFEGLARLTTS  443

Query  1435  NASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLAL  1545
             N ST  C F V +    S++ R   + ++F  +    L L
Sbjct  444   NISTPTCNFIVQINPSLSSSLRPPIVASLFVTLLPLILFL  483



>ref|XP_004961391.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=450

 Score =   498 bits (1281),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 233/425 (55%), Positives = 310/425 (73%), Gaps = 4/425 (1%)
 Frame = +1

Query  226   LNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDW  405
             ++PS +V ML+ N +D+VKLFD+D WTV   AG+G++ +   PN+QLE  A D   A+DW
Sbjct  6     IHPSAVVGMLRANGVDRVKLFDADPWTVAALAGSGVQAMLAAPNDQLESLARDPRRARDW  65

Query  406   VKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKA  585
             V+ N+++++ + GV +++VAVGNEPFLK+YNGSF ++ FPALKN+Q+ALDEAG G +IK 
Sbjct  66    VRHNVTANL-NAGVDVRYVAVGNEPFLKSYNGSFINITFPALKNMQRALDEAGFGQRIKV  124

Query  586   TIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKN  759
              +P NAD+Y+S    P  S G+FR DI  LM+ I  +L  + APF+VNIYPFLSLY+N N
Sbjct  125   VVPLNADIYSSPENKPVPSAGSFRKDINALMVDIVNFLHVNDAPFVVNIYPFLSLYQNPN  184

Query  760   FPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNK  939
             FP+ F+FFDG  K V+D+G  YTN+FDAN DTL+WSLRKA   D+ +IVGE+GWPTDG+K
Sbjct  185   FPLNFSFFDGATKPVYDQGMVYTNVFDANFDTLVWSLRKAGVPDMRIIVGEVGWPTDGDK  244

Query  940   NANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGY  1119
             NAN+K A++FY GFL+ MAK  GTP+  G ++ YLF+L DEN KS+ PG FERHWG+F Y
Sbjct  245   NANVKYAQRFYSGFLKNMAKNVGTPLRPGHMDVYLFALIDENQKSVLPGRFERHWGLFTY  304

Query  1120  DGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA-VGSNLGYACSMSDCS  1296
             DGKPKF +D +G G D      K V YLP+QWCV + + KD +  + +++ YACS +DC+
Sbjct  305   DGKPKFSMDLSGNGKDNYLAEVKGVQYLPSQWCVFNKDAKDKYKDLPASVNYACSNADCT  364

Query  1297  ALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALE  1476
              L  G+SCN L      SYAFN+YFQ  +QDV AC+F GLAKI   NAS  GC+FPV + 
Sbjct  365   PLGYGSSCNGLSHDENISYAFNIYFQTMDQDVRACSFGGLAKITTTNASQGGCMFPVQIL  424

Query  1477  SAATR  1491
             S + R
Sbjct  425   SVSGR  429



>ref|XP_003560627.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=484

 Score =   498 bits (1283),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 251/435 (58%), Positives = 320/435 (74%), Gaps = 5/435 (1%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWG+Q    L PS +V+MLKDN I KVKLFD+D W V     +GIEV+ GIPN+ LE
Sbjct  30    VGVNWGSQLTHPLLPSSVVKMLKDNGIMKVKLFDADPWPVEALLDSGIEVMLGIPNDMLE  89

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               +    +A+DWVK N++++     +K+K+VAVGNEPFLK+YNG+F     PALKNIQKA
Sbjct  90    IMSS-YGSAQDWVKENVTAY--GDKLKLKYVAVGNEPFLKSYNGTFMKTTVPALKNIQKA  146

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             LD AGLG+K+KAT+P NADVY S    PS G FR DI D+M  + ++L DH APF+VNIY
Sbjct  147   LDAAGLGDKVKATVPLNADVYVSPDDKPSSGQFRPDIDDVMTDMVKFLHDHGAPFVVNIY  206

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDK-GATYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             PFLSLY++ +FP EFAFFDG  +++ DK G +Y+N+FDAN DTL+ +L+KA  G + V+V
Sbjct  207   PFLSLYQSDDFPFEFAFFDG-GRNIQDKDGVSYSNVFDANYDTLVSALKKAGVGGLKVVV  265

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE+GWPTDGNKNANMK+A +FY G ++K+AK EGT +  G ++ YLF L DE+ KSIAPG
Sbjct  266   GEVGWPTDGNKNANMKLARRFYDGLMKKLAKNEGTHLRPGKLDVYLFGLFDEDLKSIAPG  325

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWGI  YDGKPKFP+D +G+G+D++  G   V YLP QWCVLD+E K    +  N+
Sbjct  326   NFERHWGILTYDGKPKFPMDLSGQGHDKLLAGVSGVQYLPHQWCVLDDEAKAQDKLPGNI  385

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YAC+  DC+AL  G SC+ LD  S  SYAFNMYFQ+ +QDV AC+F+GLA I   NAST
Sbjct  386   QYACAGGDCTALGYGCSCDGLDEKSNISYAFNMYFQMQDQDVRACDFDGLANITDKNAST  445

Query  1447  NGCLFPVALESAATR  1491
              GCLFPV + SA  R
Sbjct  446   KGCLFPVQIISAGGR  460



>ref|XP_003565994.2| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=477

 Score =   498 bits (1283),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 324/438 (74%), Gaps = 6/438 (1%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
             G+GVNWGT  +  ++P+ +V+ML  N +D+VK+FD+D WTV+  AG+G++ +  +PN+ L
Sbjct  22    GVGVNWGTMMSHPMHPAAVVRMLAANGVDRVKMFDADPWTVSALAGSGVQAMLAVPNDHL  81

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
                A D   A+DWV+ N++ ++HDG V I++VAVGNEPFLK+YNGSF ++ FPALKNIQ+
Sbjct  82    ASVARDRRRARDWVRDNVTRNLHDG-VDIRYVAVGNEPFLKSYNGSFINITFPALKNIQR  140

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             ALDEAGL   +KA +P NADVY S    P  S GNFR DI  LM+ I  +L  + APF+V
Sbjct  141   ALDEAGL--LVKAVVPLNADVYNSPENNPVPSAGNFRRDINALMVDIVNFLHRNDAPFVV  198

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYP+LSLY+N NFP+ F+FFDG +K V+DKG  YTN+FDAN DTL+WSLRKA   D+ +
Sbjct  199   NIYPYLSLYQNANFPLNFSFFDGGSKPVYDKGMVYTNVFDANFDTLVWSLRKAGVPDMKI  258

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGEIGWPTDG+KNAN+K A+KFY GFL+K++K  GTP+  G +E YLF+L DEN KS+ 
Sbjct  259   IVGEIGWPTDGDKNANVKYAQKFYDGFLKKISKNVGTPLRPGRMEAYLFALIDENQKSVL  318

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA-VG  1257
             PG FERHWG+F YDGKPKF +D +G G ++   G + V YLP+QWCV + + KD +  + 
Sbjct  319   PGRFERHWGLFTYDGKPKFSMDLSGNGQNKFLFGVEGVQYLPSQWCVFNKDAKDKYRDLP  378

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
             +++ YACS +DC+ L  G+SCN L      SYAFN+YFQ  +QDV AC+F GLAKIV  N
Sbjct  379   ASVNYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAKIVTTN  438

Query  1438  ASTNGCLFPVALESAATR  1491
             AS  GC+FPV + SA+ R
Sbjct  439   ASQGGCVFPVQILSASER  456



>ref|XP_006297514.1| hypothetical protein CARUB_v10013538mg [Capsella rubella]
 gb|EOA30412.1| hypothetical protein CARUB_v10013538mg [Capsella rubella]
Length=493

 Score =   499 bits (1284),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 252/486 (52%), Positives = 326/486 (67%), Gaps = 7/486 (1%)
 Frame = +1

Query  97    NHTMPQPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDK  276
             NH   Q  +    +      +V   +  V GLGVNWGT A   L P  +V+ML+DN+I K
Sbjct  2     NHRAKQSTITNATVVFIIVSSVCFFSGGVSGLGVNWGTMATHQLPPKTVVEMLRDNNIQK  61

Query  277   VKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIK  456
             VKLFD+D  T+   AG+GIEV+  IPN+ L+   +    AKDWV+ N+S    + GVKIK
Sbjct  62    VKLFDADTNTMGALAGSGIEVMVAIPNDLLKAMGNP-QRAKDWVQRNVSRFNFNNGVKIK  120

Query  457   HVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--  630
             +VAVGNEPFL AYNGSF +L +PAL NIQ AL+EAG+G+ IKAT+P NADVY S      
Sbjct  121   YVAVGNEPFLTAYNGSFINLTYPALFNIQTALNEAGVGDFIKATVPLNADVYNSPPDNQV  180

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FRSDI   M +I  +L  ++APF VNIYPFLSLY +  FP ++AFFDG+  +V+D
Sbjct  181   PSAGRFRSDIIQEMTQIVNFLAQNKAPFTVNIYPFLSLYLSSEFPFDYAFFDGQ-NTVND  239

Query  811   KGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRK  990
              G  YTN+FDAN DTL+ SL+    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L +
Sbjct  240   NGVIYTNVFDANFDTLLASLKALDHGDMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPR  299

Query  991   MAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDR  1170
             +A   GTPV KG +E YLF L DE+AKS+APG FERHWGIF +DGKPKFP+ F G+G  +
Sbjct  300   LANNVGTPVRKGYIEVYLFGLIDEDAKSVAPGNFERHWGIFKFDGKPKFPVGFGGQGQKK  359

Query  1171  MPVGAKNVPYLPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
                GA+NV Y+  QWC+ + N + +   +G N+ YACS+SDC+AL  G+SC +LD    A
Sbjct  360   YLTGARNVQYMLNQWCMFNPNGRGNMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNA  419

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIF  1527
             SYAFNMYFQ+ NQ+ +AC+FEGLA I   N S   C FP+ +   +  SG     +  + 
Sbjct  420   SYAFNMYFQVQNQEAQACDFEGLATITTRNISQGQCNFPIQIGEPS--SGHYDYSYGSMV  477

Query  1528  FFCLAL  1545
               CL +
Sbjct  478   KLCLVM  483



>ref|XP_003624610.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|ABN09816.1| Glycoside hydrolase, family 17; X8 [Medicago truncatula]
 gb|AES80828.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=480

 Score =   498 bits (1282),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 244/458 (53%), Positives = 316/458 (69%), Gaps = 5/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L P  +V+MLKDN I KVKLFD+D  T+   AG+GIEV+  IPNN
Sbjct  23    VEGLGVNWGTQATHKLPPETVVKMLKDNGIQKVKLFDADDTTMTALAGSGIEVMVAIPNN  82

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    +D   A+ WV+ N++ +  DGGVKIK+VAVGNEPFLKAYN SF ++ FPAL+NI
Sbjct  83    QLAEM-NDFKRAQYWVRKNVTRYNFDGGVKIKYVAVGNEPFLKAYNNSFLNITFPALQNI  141

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q A++EAGLG+ +KAT+P NADVY S      PS G FR DI  LM ++ ++L  + APF
Sbjct  142   QNAINEAGLGDTVKATVPLNADVYMSPPDNQVPSAGIFRPDINGLMTQMVQFLNKNGAPF  201

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N +FP  FAFFDG  K + D G  YTN+FDAN DTL+ +L+    GD 
Sbjct  202   TVNIYPFLSLYGNDDFPFNFAFFDGVDKPITDNGIQYTNVFDANFDTLVSALKSIGFGDT  261

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPT+G+KNAN   A +FY G L ++A   GTP+  G +E YLF L DE+AKS
Sbjct  262   PILVGEVGWPTEGDKNANSGNAIRFYNGLLSRLAANRGTPLRPGFIEVYLFGLIDEDAKS  321

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF YDG+PKFP+D +G+  +++ VGA+ V YL   WC+ + + KD   +
Sbjct  322   IAPGNFERHWGIFRYDGQPKFPMDLSGQLQNKLLVGAQGVKYLDPMWCMFNPDAKDLSKL  381

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ +AC+  DC+AL  G+SCN+LD    ASYAFNMY+Q  NQD +ACNFEGLAK    
Sbjct  382   ADNINFACTFGDCTALGYGSSCNNLDANGNASYAFNMYYQTQNQDRQACNFEGLAKPTTD  441

Query  1435  NASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             N ST  C F + +  ++  S  +   FA + F   +++
Sbjct  442   NISTPTCNFIIQIVPSSASS--LMPSFAALLFIAFSVI  477



>gb|AAS99718.1| At1g64760 [Arabidopsis thaliana]
 dbj|BAD95084.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=481

 Score =   498 bits (1282),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 315/450 (70%), Gaps = 6/450 (1%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             LA+  GF +++  L   V+GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+
Sbjct  5     LALVVGFVIVIGHLGILVNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                AG+G+EV+  IPN+QL +     D AKD V+ N++ +  DGGV I  VAVGNEPFLK
Sbjct  65    GALAGSGLEVMVAIPNDQL-KVMTSYDRAKDLVRKNVTRYNFDGGVNITFVAVGNEPFLK  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNGSF +L FPAL NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI 
Sbjct  124   SYNGSFINLTFPALANIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDII  183

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ ++D G  YTN+FDA
Sbjct  184   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPLNYAFFDG-AEPINDNGIDYTNVFDA  242

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  243   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP  302

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPG FERHWGIF +DG+PKFPID +G+G  +  +GA++VPYL
Sbjct  303   TYIEVYLFGLLDEDAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQGQSKFLIGAQHVPYL  362

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WC  + E KD   + +N+ YAC+ SDC+AL  G+SCN LD    ASYAFNM+FQ+ N
Sbjct  363   PNKWCTFNPEAKDLTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKN  422

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             QD  AC F+GLA I   N S   C FP+ +
Sbjct  423   QDESACYFQGLATITTQNISQGQCNFPIQI  452



>ref|XP_009112609.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112611.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112614.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=478

 Score =   498 bits (1281),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 317/450 (70%), Gaps = 6/450 (1%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             LA+  G  ++L  L+  V GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+
Sbjct  6     LALLVGLTILLDPLSIMVDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTM  65

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                AG+G+EV+  IPN+QL +     D AKDWV+ N++ +  +GGV I  VAVGNEPFLK
Sbjct  66    GALAGSGLEVMVAIPNDQL-KVMGSYDRAKDWVRKNVTRYNFNGGVNITFVAVGNEPFLK  124

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNG+F +L FPAL+NIQ AL+EAGLGN IKAT+P NADVY S    P  S G FR DI 
Sbjct  125   SYNGTFINLTFPALQNIQNALNEAGLGNSIKATVPLNADVYDSPVSDPVPSAGRFRPDIL  184

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ + D G +YTN+FDA
Sbjct  185   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPINYAFFDG-AQPIDDHGVSYTNVFDA  243

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  244   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP  303

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPG FERHWG+F +DG+PKFP+D +G+G +++ +GA+NV YL
Sbjct  304   TYIEVYLFGLLDEDAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQGQNKLLIGARNVTYL  363

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WC+ +   KD   +  N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ N
Sbjct  364   PNKWCMFNPNAKDLTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKN  423

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             QD EAC F+GLA +   N S   C FPV +
Sbjct  424   QDEEACIFQGLATVTTQNISQGQCDFPVQI  453



>ref|NP_179534.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAD10143.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM14870.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC06881.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=478

 Score =   497 bits (1280),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 318/448 (71%), Gaps = 5/448 (1%)
 Frame = +1

Query  136   LAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNF  315
             LA   GF ++ +   V GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T++ 
Sbjct  4     LAFVVGFGIMGIVM-VDGLGVNWGTMATHKLPPKKVVQMLKDNNINKVKLFDADETTMSA  62

Query  316   FAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAY  495
              +G+G+EV+  IPN+QL +     D AKDWV  N++ +  +GGV I  VAVGNEPFLK+Y
Sbjct  63    LSGSGLEVMVAIPNDQL-KVMGSYDRAKDWVHKNVTRYNFNGGVNITFVAVGNEPFLKSY  121

Query  496   NGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDL  669
             NGSF +L FPAL+NIQ AL+EAGLG+ +KAT+P NADVY S +  P  S G FR DI   
Sbjct  122   NGSFINLTFPALQNIQNALNEAGLGSSVKATVPLNADVYDSPSSNPVPSAGRFRPDIIGQ  181

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M +I  +L ++ AP  +NIYPFLSLY N +FP+ +AFFDG AK V D G  YTN+FDAN 
Sbjct  182   MTQIVDFLGNNSAPITINIYPFLSLYGNDDFPLNYAFFDG-AKPVDDNGIAYTNVFDANF  240

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+ +L+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++ +  GTP+    
Sbjct  241   DTLVSALKAVGHGDMPIIVGEVGWPTEGDKHANSGSAYRFYNGLLPRLGENRGTPLRPTY  300

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             +E YLF L DE+AKSIAPGEFERHWGIF +DG+PKFPID +G+G +++ +GA+NV Y P 
Sbjct  301   IEVYLFGLLDEDAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKLLIGAENVTYQPK  360

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             +WC+ + E KD   + +N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ NQD
Sbjct  361   KWCMFNTEAKDLTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMYFQVKNQD  420

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVAL  1473
              +AC F+GLA I   N S   C FP+ +
Sbjct  421   EDACIFQGLATITTKNISQGQCNFPIQI  448



>ref|XP_011100192.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Sesamum indicum]
Length=407

 Score =   493 bits (1270),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/377 (62%), Positives = 293/377 (78%), Gaps = 3/377 (1%)
 Frame = +1

Query  130   VRLAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHW  303
             +++A    F ++L  +   V G+GVNWGTQAAQ L PS IVQ+LKDN IDK+KLFDSD W
Sbjct  7     MKMAWGAAFLIVLQFMFISVEGIGVNWGTQAAQNLPPSTIVQILKDNGIDKIKLFDSDAW  66

Query  304   TVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPF  483
             TV+ FA TGIEV+ G+PNNQL   A   D AKD+VK N++   +  GV I++VAVGNEPF
Sbjct  67    TVSHFAKTGIEVMLGVPNNQLASLAKSYDKAKDYVKENVTVA-YKAGVYIRYVAVGNEPF  125

Query  484   LKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIR  663
             LK+YNGS  D  FPA++N+QKAL+E G G+KIK T PQNADVY SG+ GPS G FRSDIR
Sbjct  126   LKSYNGSNHDTTFPAMQNVQKALNEEGYGDKIKVTTPQNADVYNSGSQGPSAGQFRSDIR  185

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
             D+M++I  +L+++ APF+VN+YPFLSLY N +FPVEFAFFDG A+ V DKG  YTNM DA
Sbjct  186   DVMLQIVNFLKENDAPFLVNVYPFLSLYLNPDFPVEFAFFDGGAQPVMDKGTAYTNMLDA  245

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             NLDTL+WSLRKA    + +I+GEIGWPTDGNK+AN+ MA+KFY GF +KMA K+GTP++ 
Sbjct  246   NLDTLVWSLRKAGAPKLKIILGEIGWPTDGNKDANVNMAKKFYDGFFKKMATKKGTPLYP  305

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
             G +E+YLFSLTDEN KSIAPG+FERHWG+  YDG+PKFP+DF+G G    PVGAK+V YL
Sbjct  306   GEMEYYLFSLTDENQKSIAPGDFERHWGVLRYDGQPKFPMDFSGNGRQVWPVGAKDVQYL  365

Query  1204  PAQWCVLDNEQKDSHAV  1254
               QWCV + + K+   V
Sbjct  366   EKQWCVFNTDIKNMTLV  382



>emb|CDY03359.1| BnaC09g09890D [Brassica napus]
Length=477

 Score =   496 bits (1276),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 245/474 (52%), Positives = 327/474 (69%), Gaps = 8/474 (2%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             LA+  G  ++L  L+  V GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+
Sbjct  5     LALLVGLTILLDPLSIMVDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                AG+G+EV+  IPN+QL +     D AKDWV  N++ +   GGV I  VAVGNEPFLK
Sbjct  65    GALAGSGLEVMVAIPNDQL-KVMGSYDRAKDWVHKNVTRYNFSGGVNITFVAVGNEPFLK  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNG+F +L FPAL+NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI 
Sbjct  124   SYNGTFINLTFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASDPVPSAGRFRPDIL  183

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ + D G +YTN+FDA
Sbjct  184   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPINYAFFDG-AQPIDDHGVSYTNVFDA  242

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  243   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP  302

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPG FERHWG+F +DG+PKFP+D +G+G +++ +GA+NV YL
Sbjct  303   TYIEVYLFGLLDEDAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQGQNKLLIGARNVTYL  362

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WC+ +   KD   +  N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ N
Sbjct  363   PNKWCMFNPNAKDLTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKN  422

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVF--AGIFFFCL  1539
             QD EAC F+GLA +   N S   C FPV + ++++     + V+  AG+ F  +
Sbjct  423   QDEEACIFQGLATVTTQNISQGQCDFPVQIVASSSSYVSCSLVWLVAGVLFVLM  476



>ref|XP_002884423.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60682.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   496 bits (1278),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 327/486 (67%), Gaps = 7/486 (1%)
 Frame = +1

Query  97    NHTMPQPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDK  276
             NH   Q  +          +A+  L+  V GLGVNWGT A   L P  +V+MLKDN+I K
Sbjct  2     NHRPKQSAITNSTGVFIIIYALFFLSGGVSGLGVNWGTMATHQLPPKTVVEMLKDNNIQK  61

Query  277   VKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIK  456
             VKLFD+D  T+   AG+G+EV+  IPN+ L+   +    AKDWV+ N+S    + GVKIK
Sbjct  62    VKLFDADTNTMGALAGSGVEVMVAIPNDLLQAMGN-YQRAKDWVQRNVSRFNFNNGVKIK  120

Query  457   HVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--  630
             +VAVGNEPFL AYNGSF +L++PAL NIQ AL+EAG+G+  KAT+P NADVY S      
Sbjct  121   YVAVGNEPFLTAYNGSFINLIYPALFNIQTALNEAGVGDFTKATVPLNADVYNSPPDNQV  180

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FRSDI   M +I  +L  ++APF VNIYPFLSLY + +FP ++AFFDG+  +V+D
Sbjct  181   PSAGRFRSDIIQEMTQIVNFLAQNKAPFTVNIYPFLSLYLSSDFPFDYAFFDGQ-NTVND  239

Query  811   KGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRK  990
              G  YTN+FDAN DTL+ SL     G++ VIVGE+GWPTDG+KNAN++ AE+FY G L +
Sbjct  240   NGVVYTNVFDANFDTLLASLNALNHGNMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPR  299

Query  991   MAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDR  1170
             +A   GTP+ KG +E YLF   DE+ KS+APG FERHWGIF +DG+PKFP+DF G+G  +
Sbjct  300   LANNVGTPMRKGYIEVYLFGFIDEDVKSVAPGNFERHWGIFKFDGQPKFPVDFRGQGQKK  359

Query  1171  MPVGAKNVPYLPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
                GA+NV YL  QWC+ + N + +  ++G N+ YACS SDC+AL  G+SC +LD    A
Sbjct  360   FLTGAQNVQYLLNQWCMFNPNGRGNMSSLGDNINYACSHSDCTALGYGSSCGNLDANGNA  419

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIF  1527
             SYAFNMYFQ+ NQ+ +AC+FEGLA I   N S   C FP+ +   +  +G     +  + 
Sbjct  420   SYAFNMYFQVQNQEAQACDFEGLATITTQNISQGECNFPIQIGEPS--AGHYDYSYGSMV  477

Query  1528  FFCLAL  1545
               CL +
Sbjct  478   RLCLVM  483



>ref|XP_010467891.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=477

 Score =   496 bits (1276),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 246/476 (52%), Positives = 331/476 (70%), Gaps = 9/476 (2%)
 Frame = +1

Query  136   LAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNF  315
             LA++ GF ++ +   V GLGVNWGT A   L+P  +VQ+LKDN+I+KVKLFD+D  T+  
Sbjct  5     LALFVGFGIMGIV--VDGLGVNWGTMATHKLSPKTVVQLLKDNNINKVKLFDADETTMGA  62

Query  316   FAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAY  495
              AG+G+EV+  IPN+QL +     D AKDWV+ N++ +  DGGV I  VAVGNEPFLK+Y
Sbjct  63    LAGSGLEVMVAIPNDQL-KVMGSYDRAKDWVRHNVTRYNFDGGVNITSVAVGNEPFLKSY  121

Query  496   NGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDL  669
             NGSF  L FPAL+NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI   
Sbjct  122   NGSFIKLTFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGP  181

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M +I  +L ++ AP  +NIYPFLSLY N +FP+ +AFFDG A  + D G  YTN+FDAN 
Sbjct  182   MTQIVDFLGNNSAPIAINIYPFLSLYGNDDFPLNYAFFDG-APPIDDNGIAYTNVFDANF  240

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++  K+GTP+    
Sbjct  241   DTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTKKGTPLRPTY  300

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             +E YLF L DENAKSIAPG FERHWG+F +DG+PKFPID +G+G +++ +GA+NV YL +
Sbjct  301   IEVYLFGLLDENAKSIAPGPFERHWGLFKFDGQPKFPIDLSGQGQNKLLIGAQNVTYLSS  360

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             +WC+ + + KD   +  N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ  NQD
Sbjct  361   KWCMFNPDSKDLTKLADNINFACTYSDCTALGYGSSCNSLDANGNASYAFNMYFQEKNQD  420

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVAL---ESAATRSGGITAVFAGIFFFCLALL  1548
               AC F+G+A I   N S   C FP+ +   +++++ S  +  + AG++F    L+
Sbjct  421   EYACVFQGMATITTQNISQGQCNFPIQIVASQASSSSSPSLVLLIAGVWFLFTGLM  476



>gb|EPS74227.1| beta-1,3-glucanase, acidic, partial [Genlisea aurea]
Length=444

 Score =   494 bits (1273),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 239/444 (54%), Positives = 310/444 (70%), Gaps = 4/444 (1%)
 Frame = +1

Query  166   LLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLP  345
             L +  V  LGVNWGT A   L P+++VQ+LKDN I+KVKLFD+D  T+N  AGTGIEV+ 
Sbjct  2     LFSLYVESLGVNWGTMATHRLPPNVVVQILKDNGINKVKLFDADQSTMNALAGTGIEVMV  61

Query  346   GIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFP  525
              IPN+QL       + AK WV+ N++ +   GGV IK+VAVGNEPFL +YN SF    FP
Sbjct  62    AIPNDQLAAMGS-YNRAKAWVRRNVTRYNFSGGVNIKYVAVGNEPFLTSYNNSFLHTTFP  120

Query  526   ALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRD  699
             AL+NIQ AL+EAGLG+ +KAT+P NADVY S    P  S G FR DI D M ++ ++L  
Sbjct  121   ALQNIQNALNEAGLGDSVKATVPLNADVYGSPDSNPVPSAGRFRPDILDQMTQMVQFLNQ  180

Query  700   HRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDK-GATYTNMFDANLDTLIWSLRK  876
             ++APF VNIYPFLSLY N+NFPV++AFFDG A  V D  G  YTN+FDAN DTL+ +LR 
Sbjct  181   NKAPFTVNIYPFLSLYANENFPVDYAFFDGAAAPVVDTNGIQYTNVFDANFDTLVSALRG  240

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
                GD+ ++VGE+GWPTDG++NAN+  A +FY+G L ++A   GTP+  G VE YLF L 
Sbjct  241   LGYGDMAIVVGEVGWPTDGDRNANVNNAVRFYRGLLPRLAANRGTPLRPGYVEVYLFGLI  300

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DE+AKS+ PG FERHWGI  YDG+PKFP+D +G+G +R  VGA+ V YLP +WCV   + 
Sbjct  301   DEDAKSVQPGNFERHWGILRYDGQPKFPMDLSGQGVERYLVGAQGVKYLPKKWCVFRQDA  360

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
             KD   +G N+ +AC+ SDC+AL  G+SC  LD    ASYAFNMYFQ  NQD  +C F+GL
Sbjct  361   KDLSKLGPNINFACTFSDCTALGYGSSCGGLDANGNASYAFNMYFQTQNQDELSCVFQGL  420

Query  1417  AKIVKHNASTNGCLFPVALESAAT  1488
             A +   N S   C F + + ++++
Sbjct  421   AVVTDQNVSQGNCNFTLQIAASSS  444



>gb|EMS57703.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=435

 Score =   494 bits (1271),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 235/417 (56%), Positives = 308/417 (74%), Gaps = 6/417 (1%)
 Frame = +1

Query  250   MLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSH  429
             M+  + +D+V+LFD+D WTV+  AG+GI+ +  +PN+ L   A D   A+DWV+ N++ +
Sbjct  1     MVAASGVDRVRLFDADPWTVSALAGSGIQAMLAVPNDHLASLARDPRRARDWVRDNVTRN  60

Query  430   IHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADV  609
             + D GV +++VAVGNEPFL++YNGSF ++ FPALKN+Q+ALDEAG+   +KA +P NADV
Sbjct  61    L-DAGVDVRYVAVGNEPFLRSYNGSFINITFPALKNMQRALDEAGV--MVKAVVPLNADV  117

Query  610   YAS--GTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFF  783
             Y S   T  PS G+FR DI  LM+ +  +L  + APF+VNIYP+LSLY+N NFP+ F+FF
Sbjct  118   YNSPEKTPVPSAGSFRKDINTLMVSVVNFLHRNDAPFVVNIYPYLSLYQNANFPLNFSFF  177

Query  784   DGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAE  963
             DG +K V DKG  YTN+FDAN DTL+WSLRKA   D+ +IVGEIGWPTDG+K AN+K A+
Sbjct  178   DGGSKPVFDKGLVYTNVFDANFDTLVWSLRKAGVPDMKIIVGEIGWPTDGDKRANVKYAQ  237

Query  964   KFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPI  1143
             KFY GFL+KMAK  GTP+  G ++ YLF+L DEN KS+ PG FERHWG+F YDGKPKFP+
Sbjct  238   KFYDGFLKKMAKNVGTPLRPGHMDAYLFALIDENQKSVLPGRFERHWGLFTYDGKPKFPM  297

Query  1144  DFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH-AVGSNLGYACSMSDCSALVPGASC  1320
             D +G G DR  +G + V YLP+QWCV D + KD +  + +++ YACS +DC+AL  G SC
Sbjct  298   DLSGNGQDRYLLGVQGVQYLPSQWCVFDKDLKDRYRELPASVNYACSNADCTALGYGCSC  357

Query  1321  NDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATR  1491
             N L      SYAFNMYFQ  +QDV AC+F GLAKIV  NAS  GC+FPV + SA+ R
Sbjct  358   NGLSHDGNISYAFNMYFQTMDQDVRACSFGGLAKIVTTNASQGGCVFPVQILSASER  414



>ref|XP_010553811.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=488

 Score =   496 bits (1276),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 327/462 (71%), Gaps = 8/462 (2%)
 Frame = +1

Query  178   PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPN  357
             PV+GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD++  T+   AG+G+EV+  IPN
Sbjct  26    PVNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMKALAGSGMEVMVAIPN  85

Query  358   NQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
             +QL R     D AK+WV+ N+S +  +GGV I  VAVGNEPFLK+YNGSF +L FPAL+N
Sbjct  86    DQL-RVMGSYDRAKEWVQRNVSRYNFNGGVNITFVAVGNEPFLKSYNGSFINLTFPALQN  144

Query  538   IQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAP  711
             IQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI   M +I  +L  + AP
Sbjct  145   IQNALNEAGLGN-VKATVPLNADVYDSPASNPVPSTGRFRPDILGQMTQIVDFLGKNNAP  203

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F +NIYPFLSLY N +FP  +AFFDG A  + D G  Y N+FDAN DTL+ +L+ A  GD
Sbjct  204   FTINIYPFLSLYGNDDFPFNYAFFDG-ATPIIDNGIEYNNVFDANFDTLVSALKAAGHGD  262

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             + +IVGE+GWPT+G+KNAN   A +FY G L ++A   GTP+ +G +E YLF L DE+AK
Sbjct  263   MPIIVGEVGWPTEGDKNANNGNAFRFYNGLLPRLAANRGTPLRQGYIEVYLFGLLDEDAK  322

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             SIAPG FERHWGIF +DG+PKFP+D +G+G +++ +GA+NV YLP++WC  + + KD   
Sbjct  323   SIAPGNFERHWGIFRFDGQPKFPLDLSGQGQNKLLIGAQNVTYLPSKWCQFNPQAKDISK  382

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +  N+ +AC+ SDC+AL  G+SCN LD+   ASYAFNMYFQ+ NQD +AC F+GLA I  
Sbjct  383   LADNIDFACTYSDCTALEYGSSCNGLDVNGNASYAFNMYFQVKNQDEDACFFQGLAAITT  442

Query  1432  HNASTNGCLFPVAL---ESAATRSGGITAVFAGIFFFCLALL  1548
              N S   C FP+ +    SA++ S  +  + AGI+F  L ++
Sbjct  443   VNISQGQCNFPIQIVASSSASSSSSSLVLLMAGIWFLWLQVI  484



>ref|XP_008240488.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=485

 Score =   495 bits (1275),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 310/442 (70%), Gaps = 5/442 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D  T++  AG+G+EV+  IPN+
Sbjct  26    VEGLGVNWGTMATHELPPETVVQMLKDNGIQKVKLFDADESTMSALAGSGLEVMVAIPND  85

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL   A     AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+NI
Sbjct  86    QLAVMAT-YKRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNVTFPALQNI  144

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FRSDI  LMI I ++L  ++APF
Sbjct  145   QNALNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRSDISPLMIAIVQFLAKNKAPF  204

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWSLRKAKCG  888
              +NIYPFLSLY N +FP  +AFFDG    + D   G  YTN+FDAN DTL+ SL+    G
Sbjct  205   TINIYPFLSLYGNDDFPFNYAFFDGDTNPIVDATTGIQYTNVFDANFDTLVSSLKAVGFG  264

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             D+ ++VGE+GWPTDG+KNAN   A +FY G L K+    GTP+  G +E YLF L DE+A
Sbjct  265   DMTIVVGEVGWPTDGDKNANTGNAYRFYNGLLPKLGTNRGTPLRPGYIEVYLFGLIDEDA  324

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH  1248
             KSIAPG FERHWGIF YDG+PKF +D +G+G +++ V AKNV YL  +WC+ +   KD  
Sbjct  325   KSIAPGSFERHWGIFRYDGQPKFLVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKDVT  384

Query  1249  AVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIV  1428
              +  N+ YAC+ +DC+AL  G+SCN+LD    ASYAFNMY+Q+ NQD  +CNFEGLA + 
Sbjct  385   KLADNINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFEGLATMT  444

Query  1429  KHNASTNGCLFPVALESAATRS  1494
               N S   C F + + +++T S
Sbjct  445   TQNISQGNCNFIIQIATSSTFS  466



>ref|XP_010415342.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
 ref|XP_010415349.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
Length=477

 Score =   494 bits (1272),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 246/476 (52%), Positives = 328/476 (69%), Gaps = 9/476 (2%)
 Frame = +1

Query  136   LAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNF  315
             LA++ GF ++ +   V GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+  
Sbjct  5     LALFVGFGIMGIV--VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGA  62

Query  316   FAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAY  495
              AG+G+EV+  IPNNQL+      D AKDWV+ N++ +  DGGV I  VAVGNEPFLK+Y
Sbjct  63    LAGSGLEVMVAIPNNQLKVMGS-YDRAKDWVRQNVTRYNFDGGVNITSVAVGNEPFLKSY  121

Query  496   NGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPS--EGNFRSDIRDL  669
             NGSF +L FPAL+NIQ AL+EAGLGN +KAT+P NADVY S    P    G FR DI   
Sbjct  122   NGSFINLTFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPYAGRFRPDIIGP  181

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M +I  +L ++ AP  +NIYPFLSLY N +FP+ +AFFDG A  V D G  YTN+FDAN 
Sbjct  182   MTQIVDFLGNNSAPIAINIYPFLSLYGNDDFPINYAFFDG-APPVDDNGIDYTNVFDANF  240

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+    
Sbjct  241   DTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRPTY  300

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             +E YLF L DENAKSIAPG FERHWG+F +DG+PKFPID +G+G +++ +GA+NV YL +
Sbjct  301   IEVYLFGLLDENAKSIAPGPFERHWGLFKFDGQPKFPIDLSGQGQNKLLIGAQNVTYLSS  360

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             +WC+ + + KD   +  N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ  NQD
Sbjct  361   KWCMFNPDSKDLTKLADNINFACTYSDCTALGYGSSCNGLDANGNASYAFNMYFQEKNQD  420

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVAL---ESAATRSGGITAVFAGIFFFCLALL  1548
               AC F+G+A     N S   C FP+ +   +++++ S  +  + AG++F    L+
Sbjct  421   ENACVFQGMATTTTQNISQGQCNFPIQIVASQASSSSSHSLVLLIAGVWFLLTGLM  476



>ref|XP_010549610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=488

 Score =   494 bits (1272),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 252/473 (53%), Positives = 324/473 (68%), Gaps = 14/473 (3%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
             AV LL      LGVNWGT A+  L P  +VQMLK N+I KVKLFD+D  T+   AG+G+E
Sbjct  18    AVCLLFRGGEALGVNWGTMASHQLPPKTVVQMLKGNNIQKVKLFDADGSTMGAIAGSGME  77

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN+QL+        AKDWV+ N++S+  +GGV +K+VAVGNEPFL +YNG+F +L
Sbjct  78    VMVAIPNDQLKAMGS-FSRAKDWVRRNVTSYNFNGGVNVKYVAVGNEPFLTSYNGTFINL  136

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRY  690
              +PAL NIQ AL++AGLG+ IKAT+P NADVY S    P  S G FR DI D M  I  +
Sbjct  137   TYPALVNIQNALNQAGLGDSIKATVPLNADVYNSPPEKPFPSSGRFRQDILDQMSLIVNF  196

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIW  864
             L  ++APF VNIYPFLSLY + +FPV +AFF+G+  +V+D   G  YTN+FDAN DTL+ 
Sbjct  197   LAQNKAPFTVNIYPFLSLYLSSDFPVNYAFFEGQ-NTVNDPDNGVVYTNVFDANFDTLVA  255

Query  865   SLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYL  1044
             SL+    GD+ +IVGE+GWPTDG+KNAN+  AE+FY G L ++A   GTP+  G +E YL
Sbjct  256   SLKALNHGDMPIIVGEVGWPTDGDKNANVANAERFYAGLLPRLAANRGTPMRPGYIEVYL  315

Query  1045  FSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVL  1224
             F L DE+AKSIAPG FERHWGIF YDG+PKFP+DF+G+G  +  VGA+NV YLPA+WC+ 
Sbjct  316   FGLLDEDAKSIAPGSFERHWGIFKYDGQPKFPMDFSGQGLKKFLVGAQNVDYLPARWCMY  375

Query  1225  D-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEAC  1401
             + N   D   +G N+ YAC  SDC+AL  G+SC +LD+   ASYAFNMYFQ+ NQ  EAC
Sbjct  376   NPNGNGDISKLGENIDYACRFSDCTALGYGSSCGNLDVNGNASYAFNMYFQVQNQQEEAC  435

Query  1402  NFEGLAKIVKHNASTNGCLFPVALESAAT-------RSGGITAVFAGIFFFCL  1539
              F+GLA I   N S   C FPV +   ++        + G+  V   +FF  L
Sbjct  436   YFQGLATITSQNLSQGQCNFPVQIGQFSSGHYHRYGSAAGLCLVSVLVFFMRL  488



>ref|XP_004981482.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Setaria italica]
 ref|XP_004981483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X2 
[Setaria italica]
Length=494

 Score =   494 bits (1272),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 317/454 (70%), Gaps = 10/454 (2%)
 Frame = +1

Query  145   WTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAG  324
             W+G A       V  LG+NWGTQA   L P I+VQMLKDN I KVKLFD+D  T++  AG
Sbjct  23    WSGVAR------VEALGMNWGTQATHQLPPKIVVQMLKDNGIKKVKLFDADQSTLSALAG  76

Query  325   TGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGS  504
             TGIEV+  IPN  L+R  D  D AK+WV+ N+S +  DGGV IK+VAVGNEPFL AYN +
Sbjct  77    TGIEVMVAIPNVLLDRITD-YDTAKEWVRHNVSRYNFDGGVTIKYVAVGNEPFLAAYNNT  135

Query  505   FKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIK  678
             F  + FPAL+NIQ ALDEAGLG+ IKAT+P NADVY S T  P  S G +R DI DLM +
Sbjct  136   FDKVTFPALQNIQNALDEAGLGDTIKATVPLNADVYMSPTDNPVPSAGRWRPDIADLMTQ  195

Query  679   ICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTL  858
             + ++L +H APF VNIYPF+SL+ N NFPV+FAFFDG A  V D G  YTN+FDAN DTL
Sbjct  196   MVQFLSNHSAPFTVNIYPFISLFLNDNFPVDFAFFDGGATPVLDNGVQYTNVFDANFDTL  255

Query  859   IWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVE  1035
             + +L+ +  GD+ VIVGE+GWPTDG+K+A    A++FY G L+++A   GTPV     +E
Sbjct  256   VAALKASGHGDLPVIVGEVGWPTDGDKHATNVYAQRFYNGLLKRLAANAGTPVRPNQYIE  315

Query  1036  FYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQW  1215
              YLF L DE+ KS+APG FERHWGI  YDG+PK+P+D +G+G + M V A+ V YLP  W
Sbjct  316   VYLFGLLDEDIKSVAPGNFERHWGILRYDGQPKYPMDLSGQGQNAMLVPAQGVEYLPRTW  375

Query  1216  CVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVE  1395
             CV++ E  +   +  N+ +AC+ +DC+AL  G++C  +D    ASYAFN +FQ+ +Q  E
Sbjct  376   CVVNTESPNMDKLADNINFACTFADCTALGYGSTCGGMDSNGNASYAFNAFFQMKDQADE  435

Query  1396  ACNFEGLAKIVKHNASTNGCLFPVALESAATRSG  1497
             AC+F+GLA+  + + STN C F + + + +  +G
Sbjct  436   ACDFQGLARPTQTDPSTNTCNFTIQIATTSAAAG  469



>ref|XP_009793269.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=480

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/458 (53%), Positives = 317/458 (69%), Gaps = 6/458 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A+  L P I+VQMLK+N I KVKLFD+D  ++N  AGT IEV+  IPN+
Sbjct  24    VEGLGVNWGTMASHPLEPKIVVQMLKENGIKKVKLFDADKTSMNALAGTDIEVMVAIPND  83

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    D  D AKDWV+ N++ +    GV IK+VAVGNEPFL AYN SF +L FPAL+NI
Sbjct  84    QLLTMTD-YDRAKDWVRRNVTRYNIKSGVNIKYVAVGNEPFLTAYNNSFVNLTFPALQNI  142

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S    P  S G FR DI +LM +I +++  ++APF
Sbjct  143   QNALNEAGVGDYIKATVPLNADVYFSPESNPVPSAGRFRPDIAELMTQIVQFMSKNQAPF  202

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N++FP +FAFFDG +  V D G  YTN+FDAN DTL  +L+    G++
Sbjct  203   TVNIYPFLSLYANEHFPFDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGYGNM  262

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+KNAN+  A +FYKG   ++   +GTP+  G +E YLF L DE+AKS
Sbjct  263   TILVGEVGWPTDGDKNANLNNAYRFYKGLFSRLGANKGTPLRPGYIEVYLFGLIDEDAKS  322

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             I+PG FERHWGIF YDG+PKF +D +G+G+++  V AKNV YLP +WC+L+    +   +
Sbjct  323   ISPGNFERHWGIFRYDGQPKFAMDISGQGHEKHLVAAKNVQYLPKRWCMLNPNANNLSIL  382

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
              +N+ YAC+ SDC+AL  G+SCN+LD    ASYAFNMY+Q+ NQ   +C+F+GLA +   
Sbjct  383   ANNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLAMVTDK  442

Query  1435  NASTNGCLFPVALESAATRSG---GITAVFAGIFFFCL  1539
             N S   C F +     +  S    GI  + +G  F  L
Sbjct  443   NISQGTCNFIIQTGIYSVSSKVLPGIVVLLSGFTFLLL  480



>emb|CDY48710.1| BnaA09g09850D [Brassica napus]
Length=477

 Score =   493 bits (1270),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 315/450 (70%), Gaps = 6/450 (1%)
 Frame = +1

Query  136   LAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             LA+  G  ++L  L+  V GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T+
Sbjct  5     LALLVGLTILLDPLSIMVDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTM  64

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                A +G+EV+  IPN+QL +     D AKDWV+ N++ +  +GGV I  VAVGNEPFLK
Sbjct  65    GALASSGLEVMVAIPNDQL-KVMGSYDRAKDWVRKNVTRYNFNGGVNITFVAVGNEPFLK  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             +YNG+F +L FPAL+NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI 
Sbjct  124   SYNGTFINLTFPALQNIQNALNEAGLGNTVKATVPLNADVYDSPVSDPVPSAGRFRPDIL  183

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDA  843
               M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ + D G +YTN+FDA
Sbjct  184   GQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPINYAFFDG-AQPIDDHGVSYTNVFDA  242

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+  
Sbjct  243   NFDTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP  302

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+AKSIAPG FERHWG+F +DG+PKFP+D +G+G + + +GA+NV YL
Sbjct  303   TYIEVYLFGLLDEDAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQGQNTLLIGARNVTYL  362

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WC+ +   KD   +  N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ N
Sbjct  363   PNKWCMFNPNAKDLTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKN  422

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             QD EAC F+GLA +   N S   C FPV +
Sbjct  423   QDEEACIFQGLATVTTQNISQGQCDFPVQI  452



>ref|XP_010086599.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB22055.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=488

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 239/429 (56%), Positives = 308/429 (72%), Gaps = 9/429 (2%)
 Frame = +1

Query  136   LAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNF  315
             L +W  F+       V GLGVNWGTQA   L P  +VQMLKDN I KVKLFD+D  T++ 
Sbjct  19    LLVWISFS----WKDVEGLGVNWGTQATHKLPPKTVVQMLKDNGIQKVKLFDTDDSTMSA  74

Query  316   FAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAY  495
              AG+GIEV   IPN+QL    +    A+DWVK N++ +   GGV IK+VAVGNEPFL +Y
Sbjct  75    LAGSGIEVFVAIPNDQLSAM-NSFKRAQDWVKRNVTRYNFSGGVNIKYVAVGNEPFLSSY  133

Query  496   NGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDL  669
             NGSF ++ FPAL+NIQ+AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI  L
Sbjct  134   NGSFLNVTFPALQNIQRALNEAGVGDSIKATVPLNADVYNSPESNPFPSAGRFRTDINQL  193

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDA  843
             M +I ++L +++APF VNIYPFLSLY N +FP ++AFFDG + ++ D   G  YTN+FDA
Sbjct  194   MTQIVQFLNENKAPFTVNIYPFLSLYGNDHFPFDYAFFDGVSNTILDPSTGIQYTNVFDA  253

Query  844   NLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHK  1023
             N DTL+ +LR A  GD+ ++VGE+GWPTDG+KNAN   A +FY G L ++A   GTP+  
Sbjct  254   NFDTLVAALRAAGYGDMTILVGEVGWPTDGDKNANTGYAYRFYNGLLPRLASNRGTPLRP  313

Query  1024  GVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
             G +E YLF L DE+AKS+APG FERHWGIF YDG+PKFP+D +G+G +++ V AKNV YL
Sbjct  314   GYIEVYLFGLIDEDAKSVAPGNFERHWGIFRYDGQPKFPVDLSGQGQNKLLVPAKNVEYL  373

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P +WC+ +   KD   +  N+ YAC+ SDC+AL  G+SCN+LD    ASYAFNMYFQ+ N
Sbjct  374   PNKWCMFNPNAKDLSKLADNIDYACTFSDCTALGYGSSCNNLDSNGNASYAFNMYFQVQN  433

Query  1384  QDVEACNFE  1410
             QD  ACNF+
Sbjct  434   QDDMACNFQ  442



>ref|XP_010517383.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   494 bits (1271),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 326/486 (67%), Gaps = 7/486 (1%)
 Frame = +1

Query  97    NHTMPQPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDK  276
             NH   Q  +    +      +V   +  V GLGVNWGT A   L P  +V+ML+DN+I K
Sbjct  2     NHRPKQSPITNSTVVFIIVSSVCFFSGCVSGLGVNWGTMATHQLPPKTVVEMLRDNNIQK  61

Query  277   VKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIK  456
             VKLFD+D  T+   AG+G+EV+  IPN+ L+   +    AKDWV+ N+S    + GVKIK
Sbjct  62    VKLFDADTNTMGALAGSGVEVMVAIPNDLLKAMGN-FQRAKDWVQRNVSRFNFNNGVKIK  120

Query  457   HVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--  630
             +VAVGNEPFL AYNGSF +L +PAL NIQ AL+EAG+G+ IKAT+P NADVY S      
Sbjct  121   YVAVGNEPFLTAYNGSFINLTYPALFNIQTALNEAGVGDFIKATVPLNADVYNSPPDNQV  180

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FRSDI   M +I  +L  ++APF VNIYPFLSLY + +FP ++AFFDG+  +V+D
Sbjct  181   PSAGRFRSDIIQEMTQIVNFLAQNKAPFTVNIYPFLSLYLSSDFPFDYAFFDGQ-NTVND  239

Query  811   KGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRK  990
              G  YTN+FDA+ DTL+ SL     GD+ VIVGE+GWPTDG+KNAN++ AE+FY G L +
Sbjct  240   NGVIYTNVFDASFDTLVASLNALNHGDMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPR  299

Query  991   MAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDR  1170
             ++   GTP+ KG +E YLF   DE+AKS+APG FERHWGIF +DGKPKFP DF G+G  +
Sbjct  300   LSNNLGTPMRKGYIEVYLFGFIDEDAKSVAPGNFERHWGIFKFDGKPKFPFDFRGQGQKK  359

Query  1171  MPVGAKNVPYLPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
                GA+NV Y+  QWC+ + N + +   +G N+ YACS+SDC+AL  G+SC +LD    A
Sbjct  360   FLTGARNVQYMLNQWCMFNPNGRGNMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNA  419

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIF  1527
             SYAFNMYFQ+ NQ+ +AC+FEGLA I   N S   C FP+ +   +  SG     +  + 
Sbjct  420   SYAFNMYFQVQNQEAQACDFEGLAMITTRNISQGQCNFPIQIGEPS--SGHYDYSYGSMV  477

Query  1528  FFCLAL  1545
               CL +
Sbjct  478   RLCLVM  483



>ref|XP_006297581.1| hypothetical protein CARUB_v10013602mg [Capsella rubella]
 gb|EOA30479.1| hypothetical protein CARUB_v10013602mg [Capsella rubella]
Length=477

 Score =   493 bits (1269),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 314/448 (70%), Gaps = 6/448 (1%)
 Frame = +1

Query  136   LAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNF  315
             LA+  GF ++ +   V GLGVNWGT A   L P  +VQMLKDN+I KVKLFD+D  T+  
Sbjct  5     LALVVGFGMMGIV--VDGLGVNWGTMATHKLPPKTVVQMLKDNNIKKVKLFDADETTMGA  62

Query  316   FAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAY  495
              AG+G+EV+  IPN+QL +     D AK+WV+ N++ +  DGGV I  VAVGNEPFLK+Y
Sbjct  63    LAGSGLEVMVAIPNDQL-KVMGSYDRAKEWVRKNVTRYNFDGGVNITFVAVGNEPFLKSY  121

Query  496   NGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDL  669
             NG+F +L FPAL+NIQ AL+EAG+GN +KAT+P NADVY S    P  S G FR DI   
Sbjct  122   NGTFINLTFPALQNIQNALNEAGVGNGVKATVPLNADVYDSPPSNPVPSAGRFRPDIIGQ  181

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A  V D G  YTN+FDAN 
Sbjct  182   MTQIVDFLGKNNAPITINIYPFLSLYGNDDFPLNYAFFDG-ATPVDDHGIAYTNVFDANF  240

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+ SL+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+    
Sbjct  241   DTLVSSLKAVGHGDMPIIVGEVGWPTEGDKHANSGDAYRFYNGLLPRLGTNKGTPLRPTY  300

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             +E YLF L DE+AKSIAPGEFERHWGIF +DG+PKFPID +G+G ++M +GA+NV YL  
Sbjct  301   IEVYLFGLLDEDAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKMLIGAQNVSYLSN  360

Query  1210  QWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             +WC+ +   KD   + +N+ +AC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ NQD
Sbjct  361   KWCMFNPAAKDLTKLAANIDFACTFSDCTALGYGSSCNGLDAAGNASYAFNMYFQVKNQD  420

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVAL  1473
               ACNF+GLA I   N S   C FP+ +
Sbjct  421   EMACNFQGLATITTQNISQGQCNFPIQI  448



>ref|NP_001056153.1| Os05g0535100 [Oryza sativa Japonica Group]
 gb|AAT39206.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF18067.1| Os05g0535100 [Oryza sativa Japonica Group]
Length=488

 Score =   493 bits (1269),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 315/438 (72%), Gaps = 6/438 (1%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
              +GVNWGT  +  + P  +V+ML  N + +VK+FD+D WT    A TGI+V+  +PN+QL
Sbjct  32    AVGVNWGTMTSHPILPCEVVRMLAANGVARVKMFDADPWTAAPLAHTGIQVMLAVPNDQL  91

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
              R A D   A  W + N+S+++ + GV +++VAVGNEPFLK+YNGS  ++ FPALKN+Q+
Sbjct  92    ARLAGDPRRAYRWAEQNVSAYL-EAGVDVRYVAVGNEPFLKSYNGSLINVTFPALKNMQR  150

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             ALD+ GLG+ +KA +P NADVY S    P  S G+FR DI  LM+ I  +L  + APF+V
Sbjct  151   ALDKLGLGDHVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLNMNNAPFVV  210

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY+N NFP+ F+FFDG +K V+DKG  YTN+FDAN DTL+WSLRKA   D+ +
Sbjct  211   NIYPFLSLYQNPNFPLNFSFFDGGSKPVYDKGVVYTNVFDANFDTLVWSLRKAGVPDMKI  270

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGE+GWPTDG+K+AN++ A+KFY GFL+KM +  GTP+  G +E YLF+L DEN KS+ 
Sbjct  271   IVGEVGWPTDGDKHANVRYAQKFYDGFLKKMVRNIGTPLRPGWMEVYLFALIDENQKSVL  330

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA-VG  1257
             PG FERHWG+  YDGKPKF +D +G G D + VG + V YLPAQWCV + + KD    + 
Sbjct  331   PGRFERHWGLLTYDGKPKFSMDLSGDGLDNL-VGVE-VEYLPAQWCVFNKDAKDKFKDLP  388

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
             + + YACS +DC+ L  G+SCN+L      SYAFN+YFQ  +QDV AC+FEGLAKI   N
Sbjct  389   AAVNYACSNADCTPLGYGSSCNNLSHDGNISYAFNIYFQTMDQDVRACSFEGLAKITTIN  448

Query  1438  ASTNGCLFPVALESAATR  1491
             AS  GCLFPV + SA+ R
Sbjct  449   ASQGGCLFPVQILSASER  466



>ref|XP_009353157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=478

 Score =   492 bits (1267),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 310/444 (70%), Gaps = 5/444 (1%)
 Frame = +1

Query  175   SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIP  354
             S V GLGVNWGT A   L P  +VQMLKDN I KVKLFD++  T++  AG+G+EV+  IP
Sbjct  18    SGVEGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIP  77

Query  355   NNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALK  534
             N+QL         AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++  PAL+
Sbjct  78    NDQLAVMTS-YKRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNVTLPALQ  136

Query  535   NIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRA  708
             NIQ AL+EAG+G+ +KAT+P NADVY S    P  S G FR+DI  LM +I ++L  ++A
Sbjct  137   NIQNALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKNQA  196

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKAK  882
             PF +NIYPFLSLY N +FP  +AFFDG    + D G    YTN+FDAN DTL+ SL+   
Sbjct  197   PFTINIYPFLSLYGNDDFPFNYAFFDGDTNPIVDTGTGIQYTNVFDANFDTLVSSLKAVG  256

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
              G++ ++VGE+GWPTDG+KNAN   A +FY G L ++    GTP+  G +E YLF L DE
Sbjct  257   FGNMPIVVGEVGWPTDGDKNANAGNALRFYNGLLTRLGTNRGTPLRPGYIEVYLFGLIDE  316

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             +AKSIAPG FERHWGIFGYDG+PKFP+D +G+G +++ V AKNV YL  +WC+ +   KD
Sbjct  317   DAKSIAPGSFERHWGIFGYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKD  376

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +  N+ YAC+ SDC+AL  G+SCN+LD    ASYAFNMY+Q+ NQD  +CNF+GLA 
Sbjct  377   VSKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFQGLAT  436

Query  1423  IVKHNASTNGCLFPVALESAATRS  1494
             +   N S   C F + + +++  S
Sbjct  437   LTTQNISQGNCNFIIQIATSSAFS  460



>ref|XP_010485770.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   492 bits (1267),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/493 (50%), Positives = 327/493 (66%), Gaps = 13/493 (3%)
 Frame = +1

Query  97    NHTMPQPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDK  276
             NH   Q  +    +      +V   +  V GLGVNWGT A   L P  +V+M +DN+I K
Sbjct  2     NHRPKQSPITNSTVVFIIVSSVCFFSGCVSGLGVNWGTMATHQLPPKTVVEMFRDNNIQK  61

Query  277   VKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIK  456
             VKLFD+D  T+   AG+G+EV+  IPN+ L+   +    AKDWV+ N+S    + GVKIK
Sbjct  62    VKLFDADTNTMGALAGSGVEVMVAIPNDLLKAMGN-FQRAKDWVQRNVSRFNFNNGVKIK  120

Query  457   HVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--  630
             +VAVGNEPFL AYNGSF +L +PAL NIQ AL+EAG+G+ IKAT+P NADVY S      
Sbjct  121   YVAVGNEPFLTAYNGSFINLTYPALFNIQTALNEAGVGDFIKATVPLNADVYNSPPDNQV  180

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FRSDI   M +I  +L  ++APF VNIYPFLSLY + +FP ++AFFDG+  +V+D
Sbjct  181   PSAGRFRSDIIQEMTQIVNFLAQNKAPFTVNIYPFLSLYLSSDFPFDYAFFDGQ-NTVND  239

Query  811   KGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRK  990
              G  YTN+FDA+ DTL+ SL     GD+ VIVGE+GWPTDG+KNAN++ AE+FY G L +
Sbjct  240   NGVIYTNVFDASFDTLVASLNALNHGDMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPR  299

Query  991   MAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDR  1170
             +    GTP+ KG +E YLF   DE+AKS+APG FERHWGIF +DG+PKFP DF G+G  +
Sbjct  300   LTNNVGTPMRKGYIEVYLFGFIDEDAKSVAPGNFERHWGIFKFDGQPKFPFDFRGQGQKK  359

Query  1171  MPVGAKNVPYLPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
                GA+NV Y+  QWC+ + N + +   +G N+ YACS+SDC+AL  G+SC +LD    A
Sbjct  360   FLTGARNVQYMLNQWCMFNPNARGNMSKLGDNIDYACSLSDCTALGSGSSCGNLDANGNA  419

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL--------ESAATRSGGI  1503
             SYAFNMYFQ+ NQ+ +AC+FEGLA I   N S   C FP+ +        + + +    +
Sbjct  420   SYAFNMYFQVQNQEAQACDFEGLATITTRNISQGQCNFPIQIGEPSFGHYDYSYSSMVRL  479

Query  1504  TAVFAGIFFFCLA  1542
               V +G+ F  LA
Sbjct  480   CLVMSGLVFLLLA  492



>ref|XP_010463871.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   492 bits (1267),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 243/462 (53%), Positives = 317/462 (69%), Gaps = 5/462 (1%)
 Frame = +1

Query  97    NHTMPQPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDK  276
             NH   Q  +    +      +V   +  V GLGVNWGT A   L P  +V+M KDN+I K
Sbjct  2     NHRQKQSPITNSTVVFVIFSSVCFFSGCVSGLGVNWGTMATHQLPPKTVVEMFKDNNIQK  61

Query  277   VKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIK  456
             VKLFD+D  T+   AG+G+EV+  IPN+ L+   +    AKDWV+ N+S    + GVKIK
Sbjct  62    VKLFDADTNTMGALAGSGVEVMVAIPNDLLKAMGN-FQRAKDWVQRNVSRFNFNNGVKIK  120

Query  457   HVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--  630
             +VAVGNEPFL AYNGSF +L +PAL NIQ AL+EAG+G+ IKAT+P NADVY S      
Sbjct  121   YVAVGNEPFLTAYNGSFINLTYPALFNIQTALNEAGVGDFIKATVPLNADVYNSPPDNQV  180

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FRSDI   M +I  +L  ++APF VNIYPFLSLY + +FP ++AFFDG+  +V+D
Sbjct  181   PSAGRFRSDIIQEMTQIVNFLAQNKAPFTVNIYPFLSLYLSSDFPFDYAFFDGQ-NTVND  239

Query  811   KGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRK  990
              G  YTN+FDA+ DTL+ SL     GD+ VIVGE+GWPTDG+KNAN++ AE+FY G L +
Sbjct  240   NGVIYTNVFDASFDTLVASLNALNHGDMEVIVGEVGWPTDGDKNANIQNAERFYSGLLPR  299

Query  991   MAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDR  1170
             ++   GTP+ KG +E YLF   DE+AKS+APG FERHWGIF +DG+PKFP DF G+G  +
Sbjct  300   LSNNVGTPMRKGYIEVYLFGFIDEDAKSVAPGNFERHWGIFKFDGQPKFPFDFRGQGQKK  359

Query  1171  MPVGAKNVPYLPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
                GA+NV Y+  QWC+ + N + +   +G N+ YACS+SDC+AL  G+SC +LD    A
Sbjct  360   FLTGARNVQYMLNQWCMFNPNGRGNMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNA  419

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             SYAFNMYFQ+ NQ+ +AC+FEGLA I   N S   C FP+ +
Sbjct  420   SYAFNMYFQVQNQEAQACDFEGLATITTRNISQGQCNFPIQI  461



>ref|XP_009336372.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=480

 Score =   491 bits (1265),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 236/470 (50%), Positives = 327/470 (70%), Gaps = 10/470 (2%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             V L IW    +      V GLGVNWG  ++  L P+ +V+MLKDN I KVKLFD+D  T+
Sbjct  10    VMLGIWVDLDL------VQGLGVNWGQMSSHPLPPNDVVKMLKDNGIKKVKLFDADPTTM  63

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                +GTGI+V+ GIPN +L + A D   A+ WVK N+++++HDGGV I +VAVGNEPFL 
Sbjct  64    KALSGTGIDVMVGIPNEKLNKIAHDYATARKWVKQNVTAYLHDGGVTISYVAVGNEPFLT  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDL  669
             +YNG+F   V+P++KN+QKALDEAG+G KIK  +P NADVY S +  PS+G FR DI+  
Sbjct  124   SYNGTFVKDVYPSVKNVQKALDEAGVGGKIKCVVPFNADVYESPSNKPSDGRFRKDIKKS  183

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M++I  YLR H++PF+VNIYPFLSL ++  FP EFAFFDG  K V D GA Y+N+FDAN 
Sbjct  184   MMEILEYLRTHKSPFVVNIYPFLSLSQSSGFPKEFAFFDGGGKPVRDNGARYSNVFDANY  243

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+W+L+KA   ++++++GE+GWPTDG+   N ++A+KFY G L+K+A + GTP+ KG 
Sbjct  244   DTLLWALKKAGVPNLDIVIGEVGWPTDGHDFGNSRLAKKFYDGLLKKLASEVGTPLRKGY  303

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLP  1206
             +E YLF L DE+ KSIAPG+FERHWGIF YDGKPKFP+D +G+ +  +M  G + V YL 
Sbjct  304   LEVYLFGLFDEDEKSIAPGDFERHWGIFRYDGKPKFPMDLSGQASGHQMLKGVEGVKYLE  363

Query  1207  AQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQ  1386
              +WCVL+++ ++     +   YACS +DC++L    SC DL+M  R SYAFN ++Q  +Q
Sbjct  364   KKWCVLNSDVRNLSRALAEFNYACSQADCTSLGGKRSC-DLEMHDRISYAFNEFYQKGDQ  422

Query  1387  DVEACNFEGLAKIVKHNASTNGCLFPVALE--SAATRSGGITAVFAGIFF  1530
             D   C+F G+   V  + S   CLF V ++  SAA +   ++  +A + F
Sbjct  423   DYRKCDFSGMGTKVTRDPSKGDCLFRVQIDLLSAAGQRHALSYAYASLLF  472



>ref|XP_006409040.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
 gb|ESQ50493.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
Length=482

 Score =   491 bits (1264),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 239/451 (53%), Positives = 317/451 (70%), Gaps = 6/451 (1%)
 Frame = +1

Query  133   RLAIWTGFAVIL--LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWT  306
             +LA+   FA+++  L   V GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD+D  T
Sbjct  4     QLALVVEFAILIGTLGIMVDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADEST  63

Query  307   VNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFL  486
             ++  AG+G++V+  IPN+QL+      D AKDWV+ N++ +   GGV I  VAVGNEPFL
Sbjct  64    MSALAGSGLQVMVAIPNDQLKVMCS-YDRAKDWVRKNVTRYNFTGGVNITFVAVGNEPFL  122

Query  487   KAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDI  660
             K+YNGSF ++ FPAL+NIQ AL+EAGLGN +KAT+P NADVY S    P  S G FR DI
Sbjct  123   KSYNGSFINITFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDI  182

Query  661   RDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFD  840
                M +I  +L  + AP  +NIYPFLSLY N +FP+ +AFFDG A+ ++D G  YTN+FD
Sbjct  183   IGQMTQIVDFLGKNNAPITINIYPFLSLYGNDDFPLNYAFFDG-AQPINDNGVDYTNVFD  241

Query  841   ANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVH  1020
             AN DTL+ +L+    GD+ +IVGE+GWPT+G+K+AN   A +FY G L ++   +GTP+ 
Sbjct  242   ANFDTLVSALKAVGHGDMPIIVGEVGWPTEGDKHANTGNAYRFYNGLLPRLGTNKGTPLR  301

Query  1021  KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPY  1200
                +E YLF L DE+AKSIAPG+FERHWGIF +DG+PKFPID +G+G ++M +GA+ V Y
Sbjct  302   PTYIEVYLFGLLDEDAKSIAPGDFERHWGIFKFDGQPKFPIDLSGQGQNKMLIGAQGVTY  361

Query  1201  LPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQIN  1380
             LP +WC  + + KD   + +N+ +AC+ SDC+ L  G+SCN LD    ASYAFNMYFQ+ 
Sbjct  362   LPNKWCTFNPQAKDLTKLAANIDFACTYSDCTGLGYGSSCNGLDANGNASYAFNMYFQVK  421

Query  1381  NQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             NQD  AC F+GLA I   N S   C FP+ +
Sbjct  422   NQDEGACIFQGLATITTQNISQGQCNFPIQI  452



>ref|NP_187051.3| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF05860.1|AC011698_11 putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABJ98575.1| At3g04010 [Arabidopsis thaliana]
 gb|AEE74025.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=491

 Score =   491 bits (1265),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 319/466 (68%), Gaps = 7/466 (2%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
             AV  L+  V GLGVNWGT A+  L P  +V+MLKDN+I KVKLFD+D  T+   AG+G+E
Sbjct  22    AVCFLSGGVSGLGVNWGTMASHQLPPKTVVEMLKDNNIQKVKLFDADTNTMGALAGSGVE  81

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN+ L    +    AKDWV+ N+S    + GVKIK+VAVGNEPFL AYNGSF +L
Sbjct  82    VMVAIPNDLLLAMGN-YQRAKDWVQRNVSRFNFNNGVKIKYVAVGNEPFLTAYNGSFINL  140

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRY  690
              +PAL NIQ AL+EAG+G+  KAT+P NADVY S      PS G FRSDI   M +I  +
Sbjct  141   TYPALFNIQTALNEAGVGDFTKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNF  200

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSL  870
             L  ++APF VNIYPFLSLY + +FP E+AFFDG+  +V+D G  YTN+FDA+ DTL+ SL
Sbjct  201   LAQNKAPFTVNIYPFLSLYLSSDFPFEYAFFDGQ-NTVNDNGVIYTNVFDASFDTLLASL  259

Query  871   RKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFS  1050
                  G++ VIVGE+GWPTDG+KNAN+  AE+FY G L ++A   GTP+ KG +E YLF 
Sbjct  260   NALNHGNMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRLANNVGTPMRKGYIEVYLFG  319

Query  1051  LTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-  1227
               DE+AKS+APG FERHWGIF +DG+PKFP+DF G+G  +   GA+NV Y   QWC+ + 
Sbjct  320   FIDEDAKSVAPGNFERHWGIFKFDGQPKFPVDFRGQGQKKFLTGAQNVQYFLNQWCMFNP  379

Query  1228  NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
             N + +   +G N+ YACS SDC+AL  G+SC +LD    ASYAFNMYFQ+ NQ+ +AC+F
Sbjct  380   NGRGNMSRLGDNINYACSHSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDF  439

Query  1408  EGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLAL  1545
             EGLA I   N S   C FP+ +   +  SG     +  +   CL +
Sbjct  440   EGLATITTQNISQGQCNFPIQIGEPS--SGHYDYSYGSMVRLCLVM  483



>ref|XP_002459388.1| hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor]
 gb|EER95909.1| hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor]
Length=490

 Score =   490 bits (1261),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 236/449 (53%), Positives = 309/449 (69%), Gaps = 3/449 (1%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             A P   LG+NWGTQA   L P  +VQ+L+DN I KVKLFD+D   ++  AGTGIEV+  I
Sbjct  23    AGPATALGMNWGTQATHPLPPKAVVQVLQDNGIKKVKLFDTDPAAMSALAGTGIEVMVAI  82

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PNN L   ADD   AKDWVK N+  +  DGGV IK+VAVGNEPFL++YNGSF ++ FPAL
Sbjct  83    PNNMLADLADDAGKAKDWVKRNVRRYDFDGGVTIKYVAVGNEPFLESYNGSFINVTFPAL  142

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHR  705
             +NIQ AL+ AG+G++IKAT+P NADVY S      PS G FR+DI  LM  + ++L  + 
Sbjct  143   ENIQNALNNAGIGDRIKATVPLNADVYNSPKNNQVPSAGRFRADIAGLMTDMVKFLAKNN  202

Query  706   APFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKC  885
             APF VNIYPFLSLY N NFP+++AFFDG A  V+D G  YTN+FDAN DTL+ +L+    
Sbjct  203   APFTVNIYPFLSLYLNDNFPLDYAFFDGGATPVNDNGVLYTNVFDANFDTLVAALKAVGH  262

Query  886   GDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDE  1062
             GD+ ++VGE+GWPTDG+K+A    AE+FY G L+++A   GTP       E YLF L DE
Sbjct  263   GDLPIVVGEVGWPTDGDKHAKASYAERFYAGLLKRLAANTGTPARPNQYTEVYLFGLVDE  322

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             +AKS+APG FERHWG+  YDG+PKF +D  G+G + M V AK V YLP  WC L+   KD
Sbjct  323   DAKSVAPGSFERHWGVLRYDGQPKFAMDLAGQGRNTMLVPAKGVKYLPRAWCALNPNAKD  382

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +G+N+ YAC+ +DC+ L  G++CN +D+   ASYAFN Y+Q+ NQ  EAC+F+GLA 
Sbjct  383   LGKLGANIDYACTFADCTPLGYGSTCNGMDVAGNASYAFNAYYQVQNQKDEACDFQGLAL  442

Query  1423  IVKHNASTNGCLFPVALESAATRSGGITA  1509
               + + ST  C F + +++ A     + A
Sbjct  443   PTETDPSTATCNFTIQIQTGAAAMASLGA  471



>gb|EEE64491.1| hypothetical protein OsJ_19341 [Oryza sativa Japonica Group]
Length=488

 Score =   489 bits (1260),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 315/438 (72%), Gaps = 6/438 (1%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
              +GVNWGT  +  + P  +V++L  N + +VK+FD+D WT   FA TGI+V+  +PN+QL
Sbjct  32    AVGVNWGTMTSHPIIPCEVVRILAANGVARVKMFDADPWTAAPFAQTGIQVMLAVPNDQL  91

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
                A D   A  W + N+S+++ + GV +++VAVGNEPFLK+YNGS  ++ FPALKN+Q+
Sbjct  92    AGLAGDPRRAYRWAEQNVSAYL-EAGVDVRYVAVGNEPFLKSYNGSLINVTFPALKNMQR  150

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             ALD+ GLG+ +KA +P NADVY S    P  S G+FR DI  LM+ I  +L  + APF+V
Sbjct  151   ALDKLGLGDHVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLNMNNAPFVV  210

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY+N NFP+ F+FFDG +K V+DKG  YTN+FDAN DTL+WSLRKA   D+ +
Sbjct  211   NIYPFLSLYQNPNFPLNFSFFDGGSKPVYDKGVVYTNVFDANFDTLVWSLRKAGVPDMKI  270

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGE+GWPTDG+K+AN++ A+KFY GFL+KM +  GTP+  G +E YLF+L DEN KS+ 
Sbjct  271   IVGEVGWPTDGDKHANVRYAQKFYDGFLKKMVRNIGTPLRPGWMEVYLFALIDENQKSVL  330

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA-VG  1257
             PG FERHWG+  YDGKPKF +D +G G D + VG + V YLPAQWCV + + KD    + 
Sbjct  331   PGRFERHWGLLTYDGKPKFSMDLSGDGLDNL-VGVE-VEYLPAQWCVFNKDAKDKFKDLP  388

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
             + + YACS +DC+ L  G+SCN+L      SYAFN+YFQ  +QDV AC+FEGLAKI   N
Sbjct  389   AAVNYACSNADCTPLGYGSSCNNLSHDGNISYAFNIYFQTMDQDVRACSFEGLAKITTIN  448

Query  1438  ASTNGCLFPVALESAATR  1491
             AS  GCLFPV + SA+ R
Sbjct  449   ASQGGCLFPVQILSASER  466



>ref|XP_009130411.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=492

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 239/434 (55%), Positives = 307/434 (71%), Gaps = 5/434 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V  LGVNWGT A+  L P  +V+ML DN+I KVKLFD+D  T+   AG+G+EV+  IPN+
Sbjct  30    VSALGVNWGTMASHQLPPKTVVRMLTDNNIKKVKLFDADTDTMGALAGSGVEVMVAIPND  89

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L+        AKDWV+ N+S    + GVKIK+VAVGNEPFL +YNGSF +L +PAL NI
Sbjct  90    LLQTMGT-YQRAKDWVQRNVSRFNFNDGVKIKYVAVGNEPFLTSYNGSFINLTYPALVNI  148

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S      PS G FRSDI   M  I  +L  ++APF
Sbjct  149   QTALNEAGIGDYIKATVPLNADVYNSPPDNQVPSAGRFRSDILQEMTDIVNFLAQNKAPF  208

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY + +FP E+AFFDG+  +V+D G  YTN+FDA+ DTL+ SL     GD+
Sbjct  209   TVNIYPFLSLYLSSDFPFEYAFFDGQ-NTVNDNGVIYTNVFDASFDTLLASLNALNHGDM  267

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              VIVGE+GWPTDG+KNAN+  AE+FY G L ++A   GTP+ KG +E YLF   DE+AKS
Sbjct  268   EVIVGEVGWPTDGDKNANVANAERFYSGLLPRLANNIGTPMRKGYIEVYLFGFIDEDAKS  327

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHA  1251
             +APG FERHWGIF +DG+PKFP+D  G+G  +   GA+NV YL  QWC+ + N + +   
Sbjct  328   VAPGNFERHWGIFKFDGQPKFPVDLQGQGQKKFLTGAQNVQYLLNQWCMFNPNGRGNISK  387

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +G N+ YACS+SDC+AL  G+SC +LD    ASYAFNMYFQ+ NQ+ +AC+FEGLA I  
Sbjct  388   LGDNINYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGLATITT  447

Query  1432  HNASTNGCLFPVAL  1473
              N S   C+FP+ +
Sbjct  448   QNISQGQCVFPIQI  461



>ref|XP_002873877.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50136.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 255/485 (53%), Positives = 326/485 (67%), Gaps = 11/485 (2%)
 Frame = +1

Query  112   QPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFD  291
             Q    G+ L I T   + LL+  V  LGVNWGT A   L P  +VQMLKDN++ KVKLFD
Sbjct  7     QSTTVGIFLCI-TISTLSLLSGDVSALGVNWGTMATHQLPPKTVVQMLKDNNVRKVKLFD  65

Query  292   SDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVG  471
             +D  T+   AG+GIEV+  IPN+QL+      + AKDWV+ NI+    D  VKIK+VAVG
Sbjct  66    ADTNTMVALAGSGIEVMVAIPNDQLKAMGS-YNRAKDWVRRNITRFNDD--VKIKYVAVG  122

Query  472   NEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGN  645
             NEPFL AYNGSF +L +PAL NIQKAL+EAG+G+ IKAT+P NADVY S    P  S G+
Sbjct  123   NEPFLTAYNGSFLNLTYPALFNIQKALNEAGVGDFIKATVPLNADVYNSPLENPVPSAGS  182

Query  646   FRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATY  825
             FR DI + M  I  +L  ++APF VNIYPFLSLY + +FP ++AFF+G+  +V D G  Y
Sbjct  183   FRQDIFEEMKLIVNFLAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFNGQ-NTVSDNGVIY  241

Query  826   TNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKE  1005
             TN+FDAN DTL+ SL+    GD++VIVGE+GWPTDG+KNAN+  AE+FY G L K+A   
Sbjct  242   TNVFDANFDTLLASLKALGHGDMSVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAANR  301

Query  1006  GTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGA  1185
             GTP+  G +E YLF   DE+AKSIAPG FERHWGIF YDG+PKFP D +G G  ++  GA
Sbjct  302   GTPMRPGYIEVYLFGFIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGAGQKKILTGA  361

Query  1186  KNVPYLPAQWCVLDNE----QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASY  1353
             +NV YL  QWC+L+ +      +++ +G N+ YAC+ SDC+AL  G+SC +LD    ASY
Sbjct  362   QNVQYLQNQWCMLNPDGLTFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASY  421

Query  1354  AFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFF  1533
             AFNMYFQ+ NQ  EAC+FEGLA I   N S   C FP+ +    +        F G+   
Sbjct  422   AFNMYFQVQNQKAEACDFEGLAIITTRNISREQCNFPIQIGDPTSGHSDHNHRFIGLALV  481

Query  1534  CLALL  1548
              + LL
Sbjct  482   SMLLL  486



>ref|XP_009418954.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   489 bits (1258),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/458 (53%), Positives = 313/458 (68%), Gaps = 7/458 (2%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
             GLGVNWGT A   L P I+VQ+LKDN I KVK+FD+D  T+N  AG+GIEV+  IPNN L
Sbjct  22    GLGVNWGTMATHPLPPKIVVQLLKDNGIRKVKIFDADAATMNALAGSGIEVMVAIPNNML  81

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
               +  D + AK WV  N++ +   GGV IK+VAVGNEPFL  YNGSF +L  PAL+N+Q 
Sbjct  82    G-YMIDYETAKKWVNQNVTRYNFQGGVNIKYVAVGNEPFLTTYNGSFLNLTLPALQNVQT  140

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             AL+ AG+G+ IKAT+P NADVY S    P  S G FR+DI DLM +I  +L    APF V
Sbjct  141   ALNNAGIGDTIKATVPLNADVYNSPVSNPVPSAGRFRADINDLMTEIVMFLNQSGAPFTV  200

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY+N NFPV++AFFDG +  V D G  YTN+FDAN DTL+ +L     G++ +
Sbjct  201   NIYPFLSLYDNPNFPVDYAFFDGTSTPVVDNGIQYTNVFDANFDTLVSALNAVGLGNLPI  260

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKSI  1077
             IVGE+GWPTDG+ NA +  A++FY G LR++   +GTP+     +E Y+FSL DE+AKSI
Sbjct  261   IVGEVGWPTDGDINAKVSYAQRFYNGLLRRLTVNQGTPLRPNQYIEVYMFSLIDEDAKSI  320

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHAV  1254
              PG FERHWGIF YDG+PK+ +D +G+G + MPV AK V YLP +WCV + N   D   +
Sbjct  321   DPGNFERHWGIFKYDGQPKYALDPSGQGQNMMPVAAKGVQYLPQKWCVFNPNGGGDMSKL  380

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
             G N+ YACS SDC+AL  G++CN LD    AS+AFNMYFQ+ NQ  ++C F+GLA     
Sbjct  381   GDNINYACSRSDCTALGYGSTCNGLDANGNASFAFNMYFQVQNQMTQSCFFQGLAVETTQ  440

Query  1435  NASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             N ST  C F + + S+A+     T +   +F   LALL
Sbjct  441   NPSTADCNFTIQIVSSASACSFATLLM--VFVSVLALL  476



>gb|EMS57429.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=473

 Score =   489 bits (1258),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 310/443 (70%), Gaps = 19/443 (4%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             AS    LGVNWG+Q    L+PS +V+MLK N I KVKLFD+D W V     +GIEV+ GI
Sbjct  23    ASSAVDLGVNWGSQCTHQLDPSEVVKMLKANGIMKVKLFDADPWPVGALLDSGIEVMLGI  82

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN+ LE       NA+DWV  N +S+     +K+++VAVGNEPFLK+YNGSF +   PAL
Sbjct  83    PNDMLEAMTS-YGNAEDWVAENATSY--GDRLKLRYVAVGNEPFLKSYNGSFMENTVPAL  139

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAP  711
             KNIQKALDEAG+G+K+KAT+P NADVY      PSEG FR DI D+M  + +++ DH AP
Sbjct  140   KNIQKALDEAGIGDKVKATVPLNADVYVGDK--PSEGKFRPDIDDVMTDMVKFMHDHGAP  197

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA-TYTNMFDANLDTLIWSLRKAKCG  888
             F+VNIYPFLSLY++ NFP     FD     + D G  +Y+N+FDAN DTL+ +L+KA   
Sbjct  198   FVVNIYPFLSLYQSDNFP-----FD-----IQDTGGVSYSNVFDANYDTLVSALKKAGVP  247

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
              + V+VGEIGWPTDGNKNAN K+A +FY G L+K+AK EGT +  G ++ YLF L DE+ 
Sbjct  248   SLKVVVGEIGWPTDGNKNANPKLARRFYDGLLKKLAKNEGTHLRPGKMDVYLFGLFDEDM  307

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE---QK  1239
             KSIAPG FERHWGI  YDGKPKF +D +G+GNDR       V YLP QWCV D+E    +
Sbjct  308   KSIAPGNFERHWGILTYDGKPKFSMDLSGQGNDRRLAAVSGVEYLPKQWCVFDDEAAKDE  367

Query  1240  DSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLA  1419
             D   +G N+ YAC+  DC+AL  G SCN LD  S  SYAFNMYFQ+ +QDV AC+F+GLA
Sbjct  368   DMDKLGGNIQYACASGDCTALGYGCSCNGLDEMSNISYAFNMYFQMQDQDVRACDFDGLA  427

Query  1420  KIVKHNASTNGCLFPVALESAAT  1488
             KI   NAST  CLFPV + SAAT
Sbjct  428   KISDKNASTKTCLFPVQIISAAT  450



>ref|XP_006408232.1| hypothetical protein EUTSA_v10020592mg [Eutrema salsugineum]
 gb|ESQ49685.1| hypothetical protein EUTSA_v10020592mg [Eutrema salsugineum]
Length=493

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 243/462 (53%), Positives = 315/462 (68%), Gaps = 5/462 (1%)
 Frame = +1

Query  97    NHTMPQPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDK  276
             NH   Q  +    +      AV + +  V  LGVNWGT A+  L P  +VQMLKDN+I K
Sbjct  2     NHRQKQSPITNSAVVFIIISAVCIFSGGVSALGVNWGTMASHQLPPKTVVQMLKDNNIKK  61

Query  277   VKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIK  456
             VKLFD+D  T+   AG+GIEV+  IPN+ L+        AKDWV+ N++    + GVKIK
Sbjct  62    VKLFDADTNTMGALAGSGIEVMVAIPNDLLKAMGS-YQRAKDWVQRNVTRFNFNNGVKIK  120

Query  457   HVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--  630
             +VAVGNEPFL AYNGS+ +L +PAL NIQ AL++AG+G+ IKAT+P NADVY S      
Sbjct  121   YVAVGNEPFLTAYNGSYINLTYPALVNIQTALNDAGIGDFIKATVPLNADVYNSPPDNQV  180

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FRSDI   M  I  +L  ++APF VNIYPFLSLY + +FP ++AFFDG+  +++D
Sbjct  181   PSAGRFRSDIIQEMTLIVNFLAQNKAPFTVNIYPFLSLYLSSDFPFDYAFFDGQ-NTIND  239

Query  811   KGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRK  990
              G  YTN+ DAN DTL+ SL     GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L +
Sbjct  240   NGVIYTNVLDANFDTLLASLNALNHGDMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPR  299

Query  991   MAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDR  1170
             +A   GTP+ K  +E YLF   DE+AKS+APG FERHWG+F +DG+PKFP+DF G+G  R
Sbjct  300   LANNVGTPMRKSYIEVYLFGFIDEDAKSVAPGNFERHWGLFKFDGQPKFPVDFQGQGQKR  359

Query  1171  MPVGAKNVPYLPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
                GA+NV YL  QWC+ + N + +   +G N+ YACS+SDC+AL  G+SC +LD    A
Sbjct  360   FLTGAQNVQYLLNQWCMFNPNGRGNISKLGDNIDYACSLSDCTALGYGSSCGNLDANGNA  419

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             SYAFNMYFQ+ NQ+ +AC+FEGLA I   N S   C FP+ +
Sbjct  420   SYAFNMYFQVQNQEAQACDFEGLATITTRNISQGQCNFPIQI  461



>ref|XP_007030700.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY11202.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=479

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 317/459 (69%), Gaps = 6/459 (1%)
 Frame = +1

Query  127   GVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWT  306
             G+ L I+    + L    V+GLGVNWGT A   L P  +VQM+KDN I KVKLFD+D  T
Sbjct  8     GILLPIF--LCLYLFGGFVNGLGVNWGTMATHKLPPKTVVQMIKDNGIKKVKLFDADSNT  65

Query  307   VNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFL  486
             ++  AG+ +EV+  IPN+QL    +  D AK+WV+ N++ +  +GGV IK+VAVGNEPFL
Sbjct  66    MSALAGSDLEVMVAIPNDQLLAM-NSYDRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFL  124

Query  487   KAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDI  660
               YNGSF ++ FPAL+NIQ AL++AG+G+ IKAT+P NADVY S    P  S G FRSDI
Sbjct  125   TTYNGSFVNITFPALQNIQNALNDAGVGDSIKATVPLNADVYNSPDSNPVPSAGRFRSDI  184

Query  661   RDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFD  840
               +M +I  +L  + APF VNIYPFLSLY N +FP  +AFFDG    + D G  YTN+FD
Sbjct  185   SGIMTQIVDFLSKNSAPFTVNIYPFLSLYGNDDFPFNYAFFDG-GTPITDNGIQYTNVFD  243

Query  841   ANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVH  1020
             AN DTL+ +L+    GD+ +IVGE+GWPTDG+KNAN+  A++FY G + ++A   GTP+ 
Sbjct  244   ANFDTLVSALKAVGHGDMTIIVGEVGWPTDGDKNANVANAQRFYNGLMPRLAANTGTPLR  303

Query  1021  KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPY  1200
              G +E YLF L DE+AKSIAPG FERHWGI+ YDG+PKFP+D +G+  +R  +GA+NV Y
Sbjct  304   PGYIEVYLFGLIDEDAKSIAPGNFERHWGIYRYDGQPKFPLDLSGQNQNRFLIGAQNVEY  363

Query  1201  LPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQIN  1380
             LP +WC  +   KD   +  N+ YAC+ SDC+AL  G+SCN+LD    AS+AFNMY+Q+ 
Sbjct  364   LPQKWCTFNPNAKDLSKLADNINYACTFSDCTALGYGSSCNNLDANGNASFAFNMYYQVQ  423

Query  1381  NQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSG  1497
             NQ+  ACNF+GL  +   N S   C F + + S+++  G
Sbjct  424   NQNDMACNFQGLGTVTTQNLSQGTCNFIIQIASSSSSVG  462



>ref|XP_008391677.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Malus domestica]
Length=484

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 310/444 (70%), Gaps = 5/444 (1%)
 Frame = +1

Query  175   SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIP  354
             S V GLGVNWGT A   L P  +VQMLKDN I KVKLFD++  T++  AG+G+EV+  IP
Sbjct  18    SGVEGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIP  77

Query  355   NNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALK  534
             N+QL         AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+
Sbjct  78    NDQLAVMTS-YKRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNVTFPALQ  136

Query  535   NIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRA  708
             NIQ AL+EAG+G+ +KAT+P NADVY S    P  S G FR+DI  LM +I ++L  ++A
Sbjct  137   NIQNALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKNQA  196

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKAK  882
             PF +NIYPFLSLY N +FP  +AFFDG    + D G    YTN+FDAN DTL+ SL+   
Sbjct  197   PFSINIYPFLSLYGNDDFPFNYAFFDGDTNPIVDAGTGIQYTNVFDANFDTLVSSLKAVG  256

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
              G++ ++VGE+GWPTDG+KNAN   A +FY G L ++    GTP+  G +E YLF L DE
Sbjct  257   FGNMPIVVGEVGWPTDGDKNANAGNALRFYNGLLPRLGTNRGTPLRPGYIEVYLFGLIDE  316

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             +AKSIAPG FERHWGIF YDG+PKFP+D +G+G +++ V AKNV YL  +WC+ +   KD
Sbjct  317   DAKSIAPGSFERHWGIFRYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKD  376

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +  N+ YAC+ SDC+AL  G+SCN+LD    ASYAFNMY+Q+ NQD  +CNF+GLA 
Sbjct  377   VSKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFQGLAT  436

Query  1423  IVKHNASTNGCLFPVALESAATRS  1494
             +   N S   C F + + +++  S
Sbjct  437   LTTQNISQGNCNFIIQIATSSAFS  460



>emb|CDY42897.1| BnaC05g47540D [Brassica napus]
Length=492

 Score =   489 bits (1258),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 316/458 (69%), Gaps = 7/458 (2%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V  LGVNWGT ++  L P  +V+ML DN+I KVKLFD+D  T+   AG+G+EV+  IPN+
Sbjct  30    VSALGVNWGTMSSHQLPPKTVVRMLTDNNIKKVKLFDADTDTMGALAGSGVEVMVAIPND  89

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L+        AKDWV+ N+S    + GVKIK+VAVGNEPFL +YNGSF +L +PAL NI
Sbjct  90    LLQAMGT-YQRAKDWVQRNVSRFNFNDGVKIKYVAVGNEPFLTSYNGSFINLTYPALVNI  148

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+EAG+G+ IKAT+P NADVY S      PS G FRSDI   M  I  +L  ++APF
Sbjct  149   QTALNEAGIGDYIKATVPLNADVYNSPPDNQVPSAGRFRSDILQEMTDIVNFLAQNKAPF  208

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY + +FP E+AFFDG+  +V+D G  YTN+FDA+ DTL+ SL     GD+
Sbjct  209   TVNIYPFLSLYLSSDFPFEYAFFDGQ-NTVNDNGVIYTNVFDASFDTLLASLNALNHGDM  267

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              VIVGE+GWPTDG+KNAN+  AE+FY G L ++A   GTP+ KG +E YLF   DE+AKS
Sbjct  268   EVIVGEVGWPTDGDKNANVANAERFYSGLLPRLANNIGTPMRKGYIEVYLFGFIDEDAKS  327

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHA  1251
             +APG FERHWGIF +DG+PKFP+D  G+G  +   GA+NV YL  QWC+ + N + +   
Sbjct  328   VAPGNFERHWGIFKFDGQPKFPVDLQGQGQKKFLTGAQNVQYLLNQWCMFNPNGRGNISK  387

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +G N+ YACS+SDC+AL  G+SC +LD    ASYAFNMYFQ+ NQ+ +AC+FEGLA I  
Sbjct  388   LGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGLATITT  447

Query  1432  HNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLAL  1545
              N S   C+FP+ +   +  SG     ++ I  F L +
Sbjct  448   QNISQGQCVFPIQIGKPS--SGHYDYSYSSIVRFGLVM  483



>ref|XP_003602499.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES72750.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=487

 Score =   488 bits (1256),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 234/436 (54%), Positives = 321/436 (74%), Gaps = 2/436 (0%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
             A  + GLG+NWG  A+  ++P+I+  MLKDN I KVKLFD+D W V+ F+G   EV+ GI
Sbjct  28    ADSIPGLGINWGALASNPMDPNIVANMLKDNGIKKVKLFDADPWIVSAFSGD-FEVMVGI  86

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN+QL +FA  L +A+DWVK N++ H+H+GGV I++VAVGNEPFL +Y   +    FPA+
Sbjct  87    PNDQLSKFAGSLGDAEDWVKENLTKHLHNGGVNIRYVAVGNEPFLTSYGDKYVKKTFPAM  146

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +NIQKA+D+AG G ++K T   NADVY S T  PS+G+FR +IRD+M +I ++L + ++P
Sbjct  147   QNIQKAIDKAGHG-EVKVTTALNADVYESQTNKPSDGDFRDNIRDVMKQIIQFLHEKKSP  205

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F+VNIYPFLSLY+++ FP +FAFF   + ++ DK A Y+N+FDANLDTL W+L+K+   D
Sbjct  206   FLVNIYPFLSLYQSEGFPEDFAFFGTHSMTISDKNAQYSNVFDANLDTLAWALKKSGYSD  265

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             + ++VGEIGWPTDGNKNAN+  A++FY+GFL+ MA K+GTP+  G ++ YLFSL DEN K
Sbjct  266   IKIVVGEIGWPTDGNKNANVNNAKRFYQGFLKNMASKKGTPMLPGHMDAYLFSLFDENLK  325

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             SI PG FERHWGI+ YDGKPKFPIDF+G+G +++P  AK V Y   +WCVL+ + K+   
Sbjct  326   SIDPGNFERHWGIYRYDGKPKFPIDFSGKGEEKLPQSAKGVRYQEHKWCVLNADVKNMSL  385

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +   L YAC+ +DC++L  G SC +L +   AS+AFN +FQ  +Q VEAC+F GL  IV 
Sbjct  386   IPPALDYACAGADCTSLGYGCSCGNLGLAGNASFAFNQFFQTRDQSVEACDFNGLGSIVT  445

Query  1432  HNASTNGCLFPVALES  1479
              + S   CLFP+ LES
Sbjct  446   QDPSKGTCLFPIELES  461



>ref|XP_007161926.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
 gb|ESW33920.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
Length=477

 Score =   487 bits (1254),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 238/428 (56%), Positives = 304/428 (71%), Gaps = 3/428 (1%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
              G+GVNWGTQA   L P  +VQ+LKDN I KVKLFD+D  T++  AGTGIEV+  IPN Q
Sbjct  21    EGIGVNWGTQATHKLPPDTVVQLLKDNGIQKVKLFDADDSTMSALAGTGIEVMVAIPNIQ  80

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L    +D   AK WVK N++ +  +GGV IK+VAVGNEPFLK+YN SF ++ FPAL+NIQ
Sbjct  81    LLEM-NDFGRAKQWVKKNVTRYTFNGGVNIKYVAVGNEPFLKSYNNSFLNITFPALQNIQ  139

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFM  717
              AL++AG+G+ IKAT+P NADVY S    P  S G FR DI  LM +I ++L  + APF 
Sbjct  140   NALNDAGVGDTIKATVPLNADVYQSPENNPVPSAGIFRPDITGLMTQIVQFLSKNGAPFT  199

Query  718   VNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVN  897
             VNIYPFLSLY N +FP  +AFFDG    V+D G  YTN+FDAN DTL+ +L+    GD+ 
Sbjct  200   VNIYPFLSLYGNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFGDLP  259

Query  898   VIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSI  1077
             ++VGE+GWPT+G+KNAN+  A +FY G L ++A   GTP   G +E YLF L DE+AKSI
Sbjct  260   ILVGEVGWPTEGDKNANVGNALRFYNGLLPRLAGNRGTPCRPGHIEVYLFGLIDEDAKSI  319

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
             APG FERHWGIF YDG+PKFP+D +G+  ++  +GA+NV YL  +WC+ +   KD  ++ 
Sbjct  320   APGNFERHWGIFRYDGQPKFPMDLSGQNQNKFLIGAQNVKYLAPRWCMFNPNAKDLTSLP  379

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              N+ YAC+  DC+AL  G+SCN+LD    ASYAFNMYFQ+ NQ+  ACNF+GLAKI   N
Sbjct  380   DNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAKITTDN  439

Query  1438  ASTNGCLF  1461
              ST  C F
Sbjct  440   ISTPTCNF  447



>ref|XP_004955566.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=487

 Score =   487 bits (1254),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 234/446 (52%), Positives = 309/446 (69%), Gaps = 3/446 (1%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
             +A     LG+NWGTQA+  L P  +VQ+L+DN I KVKLFD+D   ++  +GTGIEV+  
Sbjct  19    VAPGAEALGMNWGTQASHPLPPKAVVQVLRDNGIKKVKLFDTDFAAMSALSGTGIEVMAA  78

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPA  528
             IPNN L   ADD   AKDWVK N+  +  DGGV IK+VAVGNEPFL++YNG+F ++ FPA
Sbjct  79    IPNNMLADLADDAGKAKDWVKRNVKRYDFDGGVTIKYVAVGNEPFLQSYNGTFINITFPA  138

Query  529   LKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDH  702
             L+NIQ AL++AG+G++IKAT+P NADVY S      PS G FR DI  LM  I ++L  +
Sbjct  139   LQNIQNALNDAGVGDRIKATVPLNADVYNSPDSHPVPSAGRFRPDISGLMTDIVKFLAKN  198

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
              APF VNIYPFLSLY + NFP+++AFFDG A  V+D G  YTN+FDAN DTL+ +LR   
Sbjct  199   NAPFTVNIYPFLSLYLSDNFPLDYAFFDGGATPVNDNGVLYTNVFDANFDTLVAALRAVG  258

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTD  1059
              GD+ V+VGE+GWPTDG+K+A +  A++FY G LR++A   GTP      +E YLF L D
Sbjct  259   HGDMPVVVGEVGWPTDGDKHAKVSYAQRFYAGLLRRLAANAGTPARPNQYIEVYLFGLVD  318

Query  1060  ENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK  1239
             E+ KS+APG FERHWGI  YDG+PK+P+D  G+G + M V AK + YLP  WC L+   K
Sbjct  319   EDLKSVAPGNFERHWGILRYDGQPKYPMDLAGQGRNTMLVPAKGIKYLPKTWCALNPNAK  378

Query  1240  DSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLA  1419
             D   +G+N+ YAC+ +DC+ L  G++CN +D    ASYAFN Y+Q+ NQ  +AC+F+GLA
Sbjct  379   DLSKLGANIDYACTFADCTPLGYGSTCNGMDTAGNASYAFNAYYQVQNQKDDACDFQGLA  438

Query  1420  KIVKHNASTNGCLFPVALESAATRSG  1497
                + + ST  C F + +  AA   G
Sbjct  439   LPTETDPSTAACNFTIQIAGAAAVHG  464



>ref|XP_010036190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Eucalyptus 
grandis]
 gb|KCW47732.1| hypothetical protein EUGRSUZ_K01479 [Eucalyptus grandis]
Length=481

 Score =   487 bits (1254),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 233/438 (53%), Positives = 306/438 (70%), Gaps = 4/438 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A   L P  +VQMLKDN I KVKLFD+D  T++  AG+GIEV+  IPN+
Sbjct  25    VDGLGVNWGTLATHKLPPKTVVQMLKDNGIQKVKLFDADRKTMSALAGSGIEVMVAIPND  84

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL       D A++WVK N++++   GGV +K+VAVGNEPFLK+YNGSF +   PAL+NI
Sbjct  85    QLAVMGS-YDRAQEWVKKNVTAYNFTGGVNVKYVAVGNEPFLKSYNGSFVNTTLPALQNI  143

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             QKAL+EAGLG+ +KAT+P NADVY S    P  S G FRSDI D+M +I +++ ++ APF
Sbjct  144   QKALNEAGLGDTVKATVPLNADVYESPEDNPLPSAGTFRSDISDVMTQIVKFMAENNAPF  203

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N +FP  +AFFDG A  + DKG  YTN+FDAN DTL+ +L+    G++
Sbjct  204   TVNIYPFLSLYGNNDFPFNYAFFDG-ATPIVDKGIEYTNVFDANFDTLVSALKAVGHGNM  262

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              +I+GE+GWPT+G+ NAN   A +FY G   K+    GTP+  G +E YLF L DE+AKS
Sbjct  263   TIIIGEVGWPTEGDINANNGNAYRFYNGLFTKLGANRGTPLRPGYIEVYLFGLIDEDAKS  322

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             +APG FERHWG+F YDG+PKF ID TGRG +++ + A+NV Y P +WC  +   KD   +
Sbjct  323   VAPGNFERHWGLFRYDGQPKFLIDLTGRGQNKLLIPAQNVEYQPQKWCTFNAGAKDVSKL  382

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ +AC+ +DC+ L  G+SCN LD    ASYAFN YFQ  NQD ++CNF+GLA +   
Sbjct  383   VDNINFACTYADCTTLGYGSSCNSLDANGNASYAFNAYFQTQNQDPDSCNFQGLATVTTK  442

Query  1435  NASTNGCLFPVALESAAT  1488
             N S   C F + L +++T
Sbjct  443   NISQGSCNFTIQLVASST  460



>ref|XP_006655526.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like, partial [Oryza 
brachyantha]
Length=492

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 319/454 (70%), Gaps = 8/454 (2%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
              +GVNWGT  +  ++P  +V ML  N +D+VK+FD+D WT    A TGI+V+  +PN+QL
Sbjct  36    AVGVNWGTMMSHPISPCQVVAMLVANGVDRVKMFDADPWTALALADTGIQVMFAVPNDQL  95

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
             E  A D   A  W + N+S+++ + GV +++VAVGNEPFLK+YNGS  ++ FPALKN+Q+
Sbjct  96    EYLAGDPRRAYLWAEQNVSAYL-EAGVDVRYVAVGNEPFLKSYNGSLINVTFPALKNMQR  154

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             ALD+  L  ++KA +P NADVY S    P  S G+FR DI  LM+ I  +L  + APF+V
Sbjct  155   ALDKLRLSEQVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLHMNDAPFVV  214

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY+N NFP+ F+FFDG +K V+DKG  YTN+FDAN DTL+WSLRKA   D+ V
Sbjct  215   NIYPFLSLYQNPNFPLNFSFFDGGSKPVYDKGMVYTNVFDANFDTLVWSLRKAGVPDMKV  274

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             +VGE+GWPTDG+KNAN++ A++FY GFL+KM    GTP+  G +E YLF+L DEN KS+ 
Sbjct  275   VVGEVGWPTDGDKNANVRYAQRFYDGFLKKMVGNIGTPLRPGWMEVYLFALIDENQKSVL  334

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA-VG  1257
             PG FERHWG+  YDGKPKF +D +G G D + VG + V YLPAQWCV + + KD +  + 
Sbjct  335   PGRFERHWGLLTYDGKPKFSMDLSGDGLDNL-VGIE-VDYLPAQWCVFNKDAKDKYKDLA  392

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
             +++ YACS +DC+ L  G+SCN L      SYAFN+YFQ  +QDV AC+F GLAKI   N
Sbjct  393   ASVDYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAKITTIN  452

Query  1438  ASTNGCLFPVALESAATRSGGITAVFAGIFFFCL  1539
             AS  GCLFPV + SA+ R   +   F+ I F  L
Sbjct  453   ASQGGCLFPVQIISASERV--VPVRFSLISFLVL  484



>gb|AAO37977.1| putative beta-1,3 glucanase [Oryza sativa Japonica Group]
 gb|ABF99303.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY92146.1| hypothetical protein OsI_13858 [Oryza sativa Indica Group]
 gb|EAZ28873.1| hypothetical protein OsJ_12912 [Oryza sativa Japonica Group]
 dbj|BAH01366.1| unnamed protein product [Oryza sativa Japonica Group]
Length=491

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 234/441 (53%), Positives = 312/441 (71%), Gaps = 6/441 (1%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
               LG+NWGTQA+  L P I+ Q+L+DN I KVKLFD+D  T++  AGTGIEV+  IPN  
Sbjct  32    EALGMNWGTQASHPLPPKIVAQLLQDNGIKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  91

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L+   D  D AK+WV+ N+S +  DGGV IK+VAVGNEPFL AYNG+F  +  PAL NIQ
Sbjct  92    LDSITD-YDTAKEWVRRNVSRYNFDGGVTIKYVAVGNEPFLAAYNGTFDKVTLPALMNIQ  150

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPFM  717
              AL++AGLG+ IKAT+P NADVY S      PS G FR+DI DLM ++ ++L ++ APF 
Sbjct  151   NALNDAGLGDSIKATVPLNADVYDSPQDQQVPSAGRFRADIADLMTQMVQFLANNSAPFT  210

Query  718   VNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVN  897
             VNIYPF+SLY N +FPV+FAFFDG A  V D G +YTN+FDAN DTL+ +L+    GD+ 
Sbjct  211   VNIYPFISLYLNDDFPVDFAFFDGGATPVVDNGISYTNVFDANFDTLVAALKGVGHGDMP  270

Query  898   VIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKS  1074
             ++VGE+GWPTDG+K+A    A++FY G L+++A   GTP   G  +E YLF L DE+AKS
Sbjct  271   IVVGEVGWPTDGDKHATATYAQRFYNGLLKRLAANAGTPARPGQYIEVYLFGLLDEDAKS  330

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             +APG+FERHWGI  +DG+PK+P+D TG+G + M V AK V YLP  WCV++   KD+  +
Sbjct  331   VAPGDFERHWGILRFDGQPKYPVDLTGQGQNTMLVPAKGVTYLPRTWCVINTNAKDTSKL  390

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ +AC+ +DC+AL  G++C  +D    ASYAFN YFQ+ NQ  +AC+F+GLA   + 
Sbjct  391   ADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDDACDFQGLAMPTQT  450

Query  1435  NASTNGCLFPVALESAATRSG  1497
             + ST  C F + +  AAT +G
Sbjct  451   DPSTPACNFTIQI--AATSAG  469



>ref|XP_008338633.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
 ref|XP_008361504.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=480

 Score =   485 bits (1249),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 233/470 (50%), Positives = 323/470 (69%), Gaps = 10/470 (2%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             V L IW    +      V G GVNWG  ++  L P+ +V+MLKDN I KVKLFD+D  T+
Sbjct  10    VMLGIWVDLDL------VQGFGVNWGQMSSHPLPPNNVVKMLKDNGIKKVKLFDADPTTM  63

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                +GTGI+V+ GIPN +L + A D   A+ WVK N+++++HDGGV I +VAVGNEPFL 
Sbjct  64    KALSGTGIDVMVGIPNEKLNKIAHDYATARKWVKQNVTAYLHDGGVTISYVAVGNEPFLT  123

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDL  669
              YNG+F   V+P++KN+QKALDEAG+G KIK  +P NADVY S +  PS+G FR DI+  
Sbjct  124   GYNGTFVKDVYPSVKNVQKALDEAGVGGKIKCVVPFNADVYESPSNKPSDGRFRKDIKKS  183

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M +I  +LR H++PF+VNIYPFLSL  +  FP EFAFFDG  K V D GA Y+N+FDAN 
Sbjct  184   MSQILEFLRTHKSPFVVNIYPFLSLSLSSGFPKEFAFFDGGGKPVRDNGAQYSNVFDANY  243

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL+W+L+KA   ++++++GE+GWPTDG+   N ++A+KFY G L+K+A + GTP+ KG 
Sbjct  244   DTLLWALKKAGVPNLDIVIGEVGWPTDGHDYGNSRLAKKFYDGLLKKLASQVGTPLRKGY  303

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLP  1206
             +E YLF L DE+ KSIAPG+FERHWGIF YDGKPKFP+D +G+ +  +M  G + V YL 
Sbjct  304   LEVYLFGLFDEDEKSIAPGDFERHWGIFRYDGKPKFPMDLSGQASGHQMLKGVEGVKYLQ  363

Query  1207  AQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQ  1386
              QWCVL+++ ++     +   YACS +DC++L    SC DL+M  R S+AFN ++Q  +Q
Sbjct  364   KQWCVLNSDVRNLSRALAEFNYACSQADCTSLGGKRSC-DLEMHDRISFAFNEFYQKGDQ  422

Query  1387  DVEACNFEGLAKIVKHNASTNGCLFPVALE--SAATRSGGITAVFAGIFF  1530
             D   C+F G+   V  + S   CLF + ++  SAA +   ++  +A + F
Sbjct  423   DYRKCDFSGMGTKVTRDPSKGDCLFRIQIDLLSAAGQRHALSYAYASLLF  472



>ref|NP_197323.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB09480.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AED92520.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=488

 Score =   485 bits (1248),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 249/460 (54%), Positives = 315/460 (68%), Gaps = 13/460 (3%)
 Frame = +1

Query  112   QPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFD  291
             Q    G+ L I     V LL+  V  LGVNWGT +   L P  +VQMLKDN++ KVKLFD
Sbjct  7     QSTTAGIFLCITI---VSLLSGDVSALGVNWGTMSTHQLPPKTVVQMLKDNNVKKVKLFD  63

Query  292   SDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVG  471
             +D  T+   AG+GIEV+  IPN+QL+      + AKDWV+ NI+    D  VKIK+VAVG
Sbjct  64    ADTNTMVALAGSGIEVMVAIPNDQLKAMGS-YNRAKDWVRRNITRFNDD--VKIKYVAVG  120

Query  472   NEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGN  645
             NEPFL AYNGSF +L +PAL NIQKAL+EAG+G+ IKAT+P NADVY S    P  S G+
Sbjct  121   NEPFLTAYNGSFINLTYPALFNIQKALNEAGVGDFIKATVPLNADVYNSPLENPVPSAGS  180

Query  646   FRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATY  825
             FR DI + M  I  +L  ++APF VNIYPFLSLY + +FP ++AFF+G+  +V D G  Y
Sbjct  181   FRQDIFEEMKLIVNFLAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFNGQ-NTVSDNGVIY  239

Query  826   TNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKE  1005
             TN+FDAN DTL+ SL+    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A   
Sbjct  240   TNVFDANFDTLLASLKALGHGDMTVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAANR  299

Query  1006  GTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGA  1185
             GTP+  G +E YLF   DE+AKSIAPG FERHWGIF YDG+PKFP D +G G  ++  GA
Sbjct  300   GTPMRPGYIEVYLFGFIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGAGQKKILTGA  359

Query  1186  KNVPYLPAQWCVLDNE----QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASY  1353
             +NV YL  QWC+ +        +++ +G N+ YAC+ SDC+AL  G+SC +LD    ASY
Sbjct  360   QNVQYLRNQWCMFNPNALTFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASY  419

Query  1354  AFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             AFNMYFQ+ NQ  EAC+FEGLA I   N S   C FP+ +
Sbjct  420   AFNMYFQVQNQKAEACDFEGLAIITTRNISREQCNFPIQI  459



>ref|XP_007208233.1| hypothetical protein PRUPE_ppa017706mg [Prunus persica]
 gb|EMJ09432.1| hypothetical protein PRUPE_ppa017706mg [Prunus persica]
Length=462

 Score =   484 bits (1245),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 233/452 (52%), Positives = 321/452 (71%), Gaps = 7/452 (2%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             LGVNWG  ++  L P+ +V+MLK N I KVKLFD+D  T+   AG+G++V+ GIPN +L+
Sbjct  5     LGVNWGQMSSHPLPPTNVVKMLKVNGIMKVKLFDADPKTMKALAGSGLDVMVGIPNEKLD  64

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
             + + D + A+ WVK N++ +++ GGV I  VAVGNEPFL +YNGS+   +FP++KNIQ+A
Sbjct  65    KLSHDYELAQKWVKENVTEYLYKGGVSISSVAVGNEPFLSSYNGSYVKTLFPSVKNIQRA  124

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             LDEAG+G KIK  +P NADVY S +  PS+G FR +I   M++I  +LR  +APF+VNIY
Sbjct  125   LDEAGVGGKIKCVVPFNADVYESPSNKPSDGRFRKNIMKEMMEILHFLRAKKAPFVVNIY  184

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVG  909
             PFLSLY++  FP EFAFFD     + DKGA Y+N+FDAN DTL+W+L+K    ++++++G
Sbjct  185   PFLSLYQSSGFPQEFAFFD-NGSPIRDKGAQYSNVFDANYDTLLWALKKVGFANLDIVIG  243

Query  910   EIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGE  1089
             E+GWPTDGN   N ++A+KFY G L+K+A KEGTP+ KG +E YLF L DE+ KSIAPG+
Sbjct  244   EVGWPTDGNGYCNNRLAKKFYDGLLKKLASKEGTPLRKGYLEVYLFGLFDEDQKSIAPGD  303

Query  1090  FERHWGIFGYDGKPKFPIDFTG-RGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
             FERHWGIF YDGKPKFP+D  G +   +M  G + V YL  QWCVL+++ ++       L
Sbjct  304   FERHWGIFRYDGKPKFPMDLAGQKSGHQMLKGVEGVKYLERQWCVLNSDVRNLSNAQVEL  363

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YACSM+DC++L    SC DL++  R SYAFN ++Q  +QDV AC+F G+   V  + ST
Sbjct  364   NYACSMADCTSLGKQRSC-DLELHDRISYAFNEFYQNRDQDVRACDFSGMGTKVTQDPST  422

Query  1447  NGCLFPVALE-SAATRSGGIT---AVFAGIFF  1530
               C+FPV +  SA  R  G++   +VFA +FF
Sbjct  423   GDCIFPVQVALSAGERRHGLSYALSVFAPLFF  454



>ref|XP_002325410.1| hypothetical protein POPTR_0019s04850g [Populus trichocarpa]
 gb|EEE99791.1| hypothetical protein POPTR_0019s04850g [Populus trichocarpa]
Length=508

 Score =   485 bits (1249),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 246/463 (53%), Positives = 313/463 (68%), Gaps = 33/463 (7%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGT A + L P  +VQMLKDN I KVKLFD+D  T+   AGTGIEV+  IPN+
Sbjct  20    VDGLGVNWGTMAIRKLPPETVVQMLKDNGILKVKLFDADQNTMTSLAGTGIEVMVAIPND  79

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKI----------------------------K  456
             QL    D  + AKDWVK N++ +  DGG  +                            K
Sbjct  80    QLAVMGD-YNRAKDWVKRNVTRYDFDGGEFVVFVGGKICLPFLNKLVIMTSQGIINAVEK  138

Query  457   HVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYAS--GTGG  630
             +VAVGNEPFLK+YNGSF +  FPAL+NIQ AL++AG+G+ IKAT+P NADVY S      
Sbjct  139   YVAVGNEPFLKSYNGSFLNTTFPALRNIQNALNDAGVGDSIKATVPFNADVYNSPDDQAY  198

Query  631   PSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD  810
             PS G FRSDI D+M ++ ++L  + APF VNIYPFLSLY N +FP ++AFFDG  + V D
Sbjct  199   PSSGRFRSDINDIMTEMVQFLGQNNAPFTVNIYPFLSLYGNDDFPFDYAFFDGAPQPVVD  258

Query  811   KGA--TYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFL  984
             +G    YTN+FDAN DTL+ +L+ A  GD+ +IVGE+GWPTDG+KNAN+  A +FY G L
Sbjct  259   RGTGIQYTNVFDANFDTLVSALKAAGHGDMPIIVGEVGWPTDGDKNANIGNAIRFYNGLL  318

Query  985   RKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGN  1164
              ++A   GTP+  G +E YLF L DE+AKSIAPG FERHWGIF YDG+PKFP+D +G+  
Sbjct  319   PRLAGNRGTPLRPGYIEVYLFGLLDEDAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQVA  378

Query  1165  DRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSR  1344
             ++  VGA+NV YLP++WC+ +   KD   +  N+ YACS SDC+AL  G+SCN LD    
Sbjct  379   NKWLVGAQNVQYLPSKWCMFNPNAKDLSKLADNINYACSRSDCTALGYGSSCNGLDTNGN  438

Query  1345  ASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             ASYAFNMY+Q+ NQD  ACNFEGLA + + N S   C F + +
Sbjct  439   ASYAFNMYYQVQNQDEFACNFEGLAMVTEQNISQGNCNFTIQI  481



>ref|XP_006657484.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=480

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 302/434 (70%), Gaps = 3/434 (1%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
              GLG+NWGTQA   L P ++VQML+DN I KVKLFD+D   ++  AG+GIEV+  IPN  
Sbjct  21    EGLGMNWGTQATHPLPPKVVVQMLRDNGITKVKLFDTDFAAMSALAGSGIEVMVAIPNKD  80

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L   A D  NA+ WVK N+  +  DGGV IK+VAVGNEPFLK YNGSF ++  PAL+NIQ
Sbjct  81    LNTMASDYSNAQSWVKKNVKRYDFDGGVTIKYVAVGNEPFLKTYNGSFINITLPALQNIQ  140

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
              AL++AG+G++IKAT+P NADVY      PS G FR +I  LM  I ++L  + APF VN
Sbjct  141   NALNDAGIGDRIKATVPLNADVYDGQL--PSAGRFRPEISGLMTDIVKFLAKNNAPFTVN  198

Query  724   IYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVI  903
             IYPFLSLY + NFPV +AFFDG +  V+D G  YTN+FDAN DTL+ +L+    GD+ +I
Sbjct  199   IYPFLSLYLDDNFPVNYAFFDGGSTPVNDGGVLYTNVFDANFDTLVAALKGVGHGDMPII  258

Query  904   VGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKSIA  1080
             VGE+GWPTDG+KNA + +A++FY G L+++A   GTP      +E YLF L DE+AKS+A
Sbjct  259   VGEVGWPTDGDKNAKVALAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDEDAKSVA  318

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGS  1260
             PG FERHWG+  YDG+PKF +D TG+G + M V A+ V YL   WCV++   KD   +G 
Sbjct  319   PGSFERHWGVLRYDGQPKFAMDLTGQGRNTMLVPARGVQYLSKTWCVINTNAKDLSNLGD  378

Query  1261  NLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNA  1440
              + +AC+ +DC+ L  G+SCN +D    ASYAFN YFQ  +Q  EACNF+GLA   + + 
Sbjct  379   KINFACTFADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLAVPTQTDP  438

Query  1441  STNGCLFPVALESA  1482
             STN C F + ++S+
Sbjct  439   STNACNFTIQIKSS  452



>ref|XP_009412333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   482 bits (1241),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/427 (54%), Positives = 306/427 (72%), Gaps = 4/427 (1%)
 Frame = +1

Query  214   AAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDN  393
             A   L P  I Q+L+DN I KVK+FD+D  +++  AGTGIEV+  IPN+ L +  +D D 
Sbjct  2     ATHRLPPKTIAQLLQDNGIKKVKIFDADPSSMSALAGTGIEVMIAIPNDMLAKM-NDYDA  60

Query  394   AKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGN  573
             AK WVK N++ +  + GV IK+VAVGNEPFLK+YN SF ++ FPALKNIQ AL+EAG+G+
Sbjct  61    AKQWVKKNVTRYNFNDGVDIKYVAVGNEPFLKSYNDSFTNITFPALKNIQNALNEAGIGD  120

Query  574   KIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLY  747
              IKAT+P NADVY S    P  S G+FR+DIRDLM +I  +   + APF VNIYPFLSLY
Sbjct  121   AIKATVPLNADVYDSPASNPVPSAGDFRADIRDLMAQIVEFFSLNGAPFTVNIYPFLSLY  180

Query  748   ENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPT  927
              N +FP++FAFFDG +  V D G  YTN+FDAN DTL+ +LRKA  GD+ ++VGE+GWPT
Sbjct  181   GNSDFPIDFAFFDGTSAPVVDNGVAYTNVFDANFDTLVSALRKAGFGDLPIVVGEVGWPT  240

Query  928   DGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV-VEFYLFSLTDENAKSIAPGEFERHW  1104
             DG+ NAN+ MAE+F+ G L+++A K GTP+   + ++ YLF L DE+AKS+APG FERHW
Sbjct  241   DGDVNANVAMAERFFGGLLKRLAAKSGTPLRPNMEMQVYLFGLVDEDAKSVAPGNFERHW  300

Query  1105  GIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSM  1284
             G+F YDG+PKF +DF+G+G + MPVGAK V YLP +WC L+    D   +  N+ +AC+ 
Sbjct  301   GLFTYDGRPKFAVDFSGQGQNGMPVGAKGVQYLPTRWCALNPAATDLGKLADNVNFACTY  360

Query  1285  SDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFP  1464
             +DC+AL  G SC+ LD   +ASYAFN YFQ  +Q+ E+C F+GLA +   N S   C F 
Sbjct  361   ADCTALGGGCSCDALDASGKASYAFNAYFQAQSQNGESCYFQGLAMVTTQNISQGSCNFT  420

Query  1465  VALESAA  1485
             + + S+A
Sbjct  421   IQIASSA  427



>ref|XP_006650710.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=493

 Score =   483 bits (1244),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 232/433 (54%), Positives = 306/433 (71%), Gaps = 4/433 (1%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
               LG+NWGTQA+  L P ++ Q+LKDN + KVKLFD+D  T++  AGTGIEV+  IPN  
Sbjct  33    EALGMNWGTQASHPLPPKVVAQLLKDNGVKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  92

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L+   D  D AK+WV+ N+S +  DGGV IK+VAVGNEPFL AYNG+F  +  PAL NIQ
Sbjct  93    LDSITD-YDTAKEWVRRNVSRYNFDGGVTIKYVAVGNEPFLAAYNGTFDKVTLPALMNIQ  151

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPFM  717
              AL++AGLG+ IKAT+P NADVY S      PS G FR+DI DLM ++ ++L ++ APF 
Sbjct  152   NALNDAGLGDSIKATVPLNADVYNSPADQQVPSAGRFRADIADLMTQMVQFLANNSAPFT  211

Query  718   VNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVN  897
             VNIYPF+SLY N NFPV+FAFFDG A    D G +YTN+FDAN DTL+ +L+    GD+ 
Sbjct  212   VNIYPFISLYLNDNFPVDFAFFDGGATPGADNGISYTNVFDANFDTLVAALKAVGHGDMP  271

Query  898   VIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKS  1074
             +IVGE+GWPTDG+K+A    A++FY G LR++A   GTP+  G  +E YLF L DE+AKS
Sbjct  272   IIVGEVGWPTDGDKHATAAYAQRFYNGLLRRLAANAGTPLRPGQYIEVYLFGLLDEDAKS  331

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             +APG FERHWGI  +DG+PK+P+D TG+G + M V AK+V YL   WCV++   KD+  +
Sbjct  332   VAPGSFERHWGILRFDGQPKYPVDLTGQGQNTMLVPAKDVQYLSRTWCVVNTNAKDTSKL  391

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ +AC+ +DC+AL  G++C  +D    ASYAFN YFQ+ NQ  EAC+F+GLA   + 
Sbjct  392   ADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDEACDFQGLAMPTQT  451

Query  1435  NASTNGCLFPVAL  1473
             + ST  C F V +
Sbjct  452   DPSTPACNFTVQI  464



>dbj|BAD31779.1| putative 3-glucanase [Oryza sativa Japonica Group]
 gb|EAZ02906.1| hypothetical protein OsI_25042 [Oryza sativa Indica Group]
 gb|EAZ38824.1| hypothetical protein OsJ_23232 [Oryza sativa Japonica Group]
 dbj|BAG97331.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   483 bits (1242),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 303/434 (70%), Gaps = 3/434 (1%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
              GLG+NWGTQA   L P  +VQ+LKDN I KVKLFD+D   ++  AG+G+EV+  IPN  
Sbjct  23    EGLGINWGTQATHPLPPKAVVQLLKDNGIAKVKLFDTDFAAMSALAGSGVEVMVAIPNKD  82

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L   A D  NAKDWVK N+     DGGV IK+VAVGNEPFLKAYNGSF ++  PAL+N+Q
Sbjct  83    LATMASDYGNAKDWVKKNVKRFDFDGGVTIKYVAVGNEPFLKAYNGSFINITLPALQNVQ  142

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
              AL++AG+G++IKAT+P NADVY S    PS G FR +I  LM  I ++L  + APF VN
Sbjct  143   NALNDAGIGDRIKATVPLNADVYESTV--PSAGRFRPEIAGLMTDIVKFLAKNNAPFTVN  200

Query  724   IYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVI  903
             IYPFLSLY +++FP+ FAFFDG +  V+D G  YTN+FDAN DTL+ +L+    GD+ +I
Sbjct  201   IYPFLSLYLDEHFPINFAFFDGGSTPVNDGGIMYTNVFDANFDTLVAALKAVGHGDMPII  260

Query  904   VGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKSIA  1080
             VGE+GWPTDG+KNA + +A++FY G L+++A   GTP      +E YLF L DE+ KS+A
Sbjct  261   VGEVGWPTDGDKNARVDLAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDEDMKSVA  320

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGS  1260
             PG FERHWG+  YDG+PKF +D  G+G + M V AK + YLP  WCV++   KD   +G 
Sbjct  321   PGSFERHWGVLRYDGQPKFAMDLAGQGRNTMLVPAKGIEYLPKTWCVINTNAKDVSKLGD  380

Query  1261  NLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNA  1440
             N+ +AC+ +DC+ L  G+SCN +D    ASYAFN YFQ  +Q  EACNF+GLA   + + 
Sbjct  381   NINFACTYADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLAVPTETDP  440

Query  1441  STNGCLFPVALESA  1482
             +T  C F + ++S+
Sbjct  441   TTAQCNFTIQIKSS  454



>ref|XP_010495273.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=491

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 311/445 (70%), Gaps = 10/445 (2%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
              V L +  V  LGVNWGT A   L P  +VQMLKDN++ KVKLFD+D  T+   AG+GIE
Sbjct  21    TVYLNSRDVFALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIE  80

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN+QL+      + AKDWV+ NI+    D  VKIK+VAVGNEPFL AYNGSF +L
Sbjct  81    VMVAIPNDQLKAMGS-YNRAKDWVRRNITRFNDD--VKIKYVAVGNEPFLTAYNGSFINL  137

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRY  690
              +PAL +IQKAL+EAG+G+ IKAT+P NADVY S    P  S G+FR DI + M  I  +
Sbjct  138   TYPALFHIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGSFRQDIYEEMKLIVNF  197

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSL  870
             L  ++APF VNIYPFLSLY + +FP ++AFF+G+  +V D G  YTN+FDAN DTL+ SL
Sbjct  198   LAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFNGQ-NTVSDNGVIYTNVFDANFDTLLASL  256

Query  871   RKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFS  1050
             R    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A  +GTP+  G +E YLF 
Sbjct  257   RALGHGDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNKGTPMRPGYIEVYLFG  316

Query  1051  LTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDN  1230
               DE+AKSIAPG FERHWGIF YDG+PKFP D +G G  +M  GA++V YL  QWC+L+ 
Sbjct  317   FIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGQKKMLNGAQSVQYLQNQWCMLNP  376

Query  1231  E----QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
                     ++ +G N+ YAC+ SDC+AL  G SC +LD    ASYAFNMYFQ+++Q  EA
Sbjct  377   NAHTFSNSTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEA  436

Query  1399  CNFEGLAKIVKHNASTNGCLFPVAL  1473
             C+FEGLA I  HN S   C FP+ +
Sbjct  437   CDFEGLAIITTHNISREQCNFPIQI  461



>gb|KDO50472.1| hypothetical protein CISIN_1g045344mg, partial [Citrus sinensis]
Length=627

 Score =   487 bits (1254),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 245/451 (54%), Positives = 312/451 (69%), Gaps = 8/451 (2%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWG  A+  L   IIVQMLKDN I + KLFD+D  +V   A TGIEV+  IPN  L 
Sbjct  183   VGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLF  242

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               A D  NA++WVK N++  + DG VK+K+VAVGNEPFLK+YN SF    FPALKN+Q+A
Sbjct  243   DMAVDYSNAQNWVKENVTRWVKDGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQA  302

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVNIY  729
             L EAG G  +KAT+P NADVY      PS+G FR DI+  +  I + L D+++PF+VNIY
Sbjct  303   LVEAGHGKMVKATVPLNADVYEGTL--PSDGVFRKDIKQHIDNILKNLHDNKSPFIVNIY  360

Query  730   PFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVG  909
             PFLSLYE+ +FPVE+AFF+  AK + DK   YTN+ D N DTL+ +L+KA   D+ +I+G
Sbjct  361   PFLSLYESPDFPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIG  420

Query  910   EIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV-VEFYLFSLTDENAKSIAPG  1086
             EIGWPTDG+K A  + A+KFY G  +K+AK++GTP+  G   + YLF   DE+AKSIAPG
Sbjct  421   EIGWPTDGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPG  480

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
             +FERHWGIF +DG+PKFPIDFTGRG ++MPVGAK V Y   +WCVLD    +   V   L
Sbjct  481   KFERHWGIFRFDGQPKFPIDFTGRGQNKMPVGAKGVKYYDHKWCVLDKGVTNFDLVDQQL  540

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
               AC   DC+A  PG+SC+ LD  ++ SYAFNMYFQ+N Q  +AC+FEGLA I   NAS 
Sbjct  541   FKACQEGDCTATEPGSSCSGLDNLTKVSYAFNMYFQMNQQVNKACDFEGLALITDKNASV  600

Query  1447  NGCLFPVALESAATRSGGITAVFAGIFFFCL  1539
               CLFP+ ++SAA     + A  AGI    L
Sbjct  601   GNCLFPIQIDSAA-----MAATVAGILLTIL  626



>ref|XP_008232612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=469

 Score =   481 bits (1238),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 322/455 (71%), Gaps = 7/455 (2%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWG  ++  L P+ +V+MLK N I KVKLFD+D  T+   AG+G++V+ GIPN+
Sbjct  9     VRGLGVNWGQMSSHPLPPTDVVKMLKVNGIKKVKLFDADPKTMKALAGSGLDVMVGIPND  68

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             +L++ + D + A+ WVK N++ ++++GGV I +VAVGNEPFL +YNGS+   +FP++KNI
Sbjct  69    KLDKLSHDYEFAQKWVKENVTEYLYEGGVSISYVAVGNEPFLSSYNGSYVKTLFPSMKNI  128

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q+ALDEAG+G KIK  +P NADVY S +  PS+G FR DI   M++I  + R  +APF+V
Sbjct  129   QRALDEAGVGQKIKCVVPFNADVYESPSNKPSDGRFRKDIMKHMLEILHFFRAKKAPFVV  188

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY++  FP EFAFFD     + D GA Y+N+FDAN DTL+W+L+K    ++++
Sbjct  189   NIYPFLSLYQSTGFPQEFAFFDN-GSPIRDNGAQYSNVFDANYDTLLWALKKVGVANLDI  247

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             ++GE+GWPTDGN   N ++A+KFY G L+K+A KEGTP+ KG +E YLF L DE+ KSIA
Sbjct  248   VIGEVGWPTDGNGYCNNRLAKKFYDGLLKKLASKEGTPLRKGYLEVYLFGLFDEDQKSIA  307

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGN-DRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
             PG+FERHWGIF YDGKPKFP+D  G+ +  +M    + V YL  QWCVL+++ ++     
Sbjct  308   PGDFERHWGIFRYDGKPKFPMDLAGQNSGHQMLKDVEGVKYLERQWCVLNSDVRNLSKAQ  367

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
               L YACS++DC++L    SC DL++  R SYAFN ++Q  +QDV AC+F G+   +  +
Sbjct  368   VELNYACSLADCTSLGKQRSC-DLELHDRISYAFNEFYQSRDQDVRACDFNGMGTKMTQD  426

Query  1438  ASTNGCLFPVALE-SAATRSGGIT---AVFAGIFF  1530
              S   C+F V +  SA  R  G++   +VFA +FF
Sbjct  427   PSIGDCIFRVQVALSAGERRHGLSYALSVFAPLFF  461



>ref|XP_010454046.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   481 bits (1239),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/445 (55%), Positives = 311/445 (70%), Gaps = 10/445 (2%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
              V L +  V  LGVNWGT A   L P  +VQMLKDN++ KVKLFD+D  T+   AG+GIE
Sbjct  21    TVYLNSRDVSALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIE  80

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN+QL+      + A+DWV+ NI+    D  VKIK+VAVGNEPFL AYNGSF +L
Sbjct  81    VMVAIPNDQLKAMGS-YNRARDWVRRNITRFNDD--VKIKYVAVGNEPFLTAYNGSFINL  137

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRY  690
              +PAL +IQKAL+EAG+G+ IKAT+P NADVY S    P  S G+FR DI + M  I  +
Sbjct  138   TYPALFHIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGSFRQDIFEEMKLIVNF  197

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSL  870
             L  ++APF VNIYPFLSLY + +FP ++AFF+G+  +V D G  YTN+FDAN DTL+ SL
Sbjct  198   LAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFNGQ-NTVSDNGVIYTNVFDANFDTLLASL  256

Query  871   RKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFS  1050
             R    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A   GTP+  G +E YLF 
Sbjct  257   RALGHGDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNRGTPMRPGYIEVYLFG  316

Query  1051  LTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDN  1230
               DE+AKSIAPG FERHWGIF YDG+PKFP D +G G  +M  GA++V YL  QWC+L+ 
Sbjct  317   FIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGQKKMLNGAQSVQYLQNQWCMLNP  376

Query  1231  E----QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
                    +++ +G N+ YAC+ SDC+AL  G SC +LD    ASYAFNMYFQ+++Q  EA
Sbjct  377   NAHTFSNNTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEA  436

Query  1399  CNFEGLAKIVKHNASTNGCLFPVAL  1473
             C+FEGLA I  HN S   C FP+ +
Sbjct  437   CDFEGLAIITTHNISREQCNFPIQI  461



>ref|XP_009388996.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 315/461 (68%), Gaps = 8/461 (2%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
              GLGVNWGT A+  L P I+VQ+LKDN IDKVK+FD+D  T+   AG+ IEV+  IPNN 
Sbjct  22    QGLGVNWGTMASHPLPPKIVVQLLKDNGIDKVKIFDADSSTMKALAGSDIEVMVAIPNNM  81

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L R   D   A+DWVK N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPALKNIQ
Sbjct  82    L-RTMTDYGAARDWVKTNVTRYHFEGGVNIKYVAVGNEPFLSSYNGSFLNVTFPALKNIQ  140

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFM  717
              AL++AG+G  IKAT+P NADVY S    P  S G FR+DI DLM +I ++L    APF 
Sbjct  141   NALNDAGVGGSIKATVPLNADVYNSPESNPVPSAGRFRTDISDLMTEIVQFLNQSGAPFT  200

Query  718   VNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVN  897
             VNIYPFLSLY N NFPVEFAFFDG +  V D G  YTN+FDAN DTL+ +L+    GD+ 
Sbjct  201   VNIYPFLSLYGNPNFPVEFAFFDGGSDPVVDNGIQYTNVFDANFDTLVSALKGVGLGDLP  260

Query  898   VIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKS  1074
             +IVGE+GWPTDG+KNA    A++FY G L+++    GTP+     +E YLFSL DE+AKS
Sbjct  261   IIVGEVGWPTDGDKNAKASYAQRFYDGLLKRLVANHGTPLRPNQYIEVYLFSLIDEDAKS  320

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHA  1251
             I PG FERHWG+  YDG+PK+ +D +G+G  +  V  K+V YLP +WCV D N   +   
Sbjct  321   IEPGNFERHWGVLKYDGQPKYNMDLSGQGQAKTLVPTKDVEYLPKKWCVFDPNGGGNVST  380

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +G  + +AC+ SDC+AL  G++CN LD    AS+AFNMY+Q+ N    +CNF+GLA    
Sbjct  381   LGDQITFACTWSDCTALGYGSTCNGLDGNGNASFAFNMYYQVQNHQELSCNFQGLATETT  440

Query  1432  HNASTNGCLFPVALESAATRS--GGITAVFAGIFFFCLALL  1548
              + ST GC F + + ++A  +    +  VF  ++ + +ALL
Sbjct  441   QDPSTAGCNFTIQIATSAADAPMKPLLVVFM-MYAYVMALL  480



>ref|XP_006289696.1| hypothetical protein CARUB_v10003257mg [Capsella rubella]
 gb|EOA22594.1| hypothetical protein CARUB_v10003257mg [Capsella rubella]
Length=491

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 244/463 (53%), Positives = 318/463 (69%), Gaps = 11/463 (2%)
 Frame = +1

Query  106   MPQPVVGGVRLAIWTGFAVILLAS-PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVK  282
             M Q     + + ++   + + L S  V  LGVNWGT A   L P  +VQM+KDN++ KVK
Sbjct  1     MKQITTTAIIIVLYITISTVSLNSGDVSALGVNWGTMATHQLPPKTVVQMMKDNNVKKVK  60

Query  283   LFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHV  462
             LFD+D  T+   AGTGIEV+  IPN+QL+      + AKDWV+ NI+    D  VKIK+V
Sbjct  61    LFDADTNTMVALAGTGIEVMVAIPNDQLKAMGS-YNRAKDWVRRNITRFNDD--VKIKYV  117

Query  463   AVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--S  636
             AVGNEPFL AYNGSF ++ +PAL NIQKAL+EAG+G+ IKAT+P NADVY S    P  S
Sbjct  118   AVGNEPFLTAYNGSFINVTYPALFNIQKALNEAGVGDFIKATVPLNADVYNSPPDNPVPS  177

Query  637   EGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKG  816
              G+FR DI + M  I  +L  ++APF VNIYPFLSLY + +FP ++AFFDG+  +V D G
Sbjct  178   AGSFRQDIFEEMKLIVNFLAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFDGQ-NTVSDNG  236

Query  817   ATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMA  996
               YTN+FDAN DTL+ SLR    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A
Sbjct  237   VIYTNVFDANFDTLLASLRALGHGDMTVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLA  296

Query  997   KKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMP  1176
                GTP+  G ++ YLF   DE+AKSIAPG FERHWGIF +DG+PKFP D +G G  ++ 
Sbjct  297   GNRGTPMRPGYIQVYLFGFIDEDAKSIAPGNFERHWGIFKFDGQPKFPADLSGEGQKKIL  356

Query  1177  VGAKNVPYLPAQWCVLDNE----QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSR  1344
              GA+NV Y   QWC+L+ +      +++ +G N+ YAC+ SDC+AL  G+SC +LD    
Sbjct  357   NGAQNVQYFQNQWCMLNPDAHTFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGN  416

Query  1345  ASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             ASYAFNMYFQ+++Q  EAC+FEGLA +   N S   C FP+ +
Sbjct  417   ASYAFNMYFQVHDQKAEACDFEGLAMVTTRNISREQCNFPIQI  459



>gb|AIR93903.1| glucanase [Cicer arietinum]
Length=480

 Score =   481 bits (1237),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 313/458 (68%), Gaps = 8/458 (2%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+GVNWGTQA   L    +V+MLKDN I KVKLFD+D  T++   G+GIEV+  IPNN
Sbjct  23    VEGVGVNWGTQATHPLKADTVVEMLKDNGIQKVKLFDTDDATMSALGGSGIEVMVAIPNN  82

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
             QL    ++ D A  WV+ N++     GGV IK+VAVGNEPFLK+YN +  ++ FPAL+NI
Sbjct  83    QLAEM-NNYDRALQWVRKNVTRFTFKGGVNIKYVAVGNEPFLKSYNNTLLNVTFPALQNI  141

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q AL+E GLG+ IKAT+P NAD+Y S      PS G FR D+  LM +I ++L  + APF
Sbjct  142   QNALNEVGLGDSIKATVPLNADIYESPIENSVPSAGIFRPDLIGLMTQIIQFLNKNNAPF  201

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY N+NFP +FAFFDG +  ++D G  YTN+FDAN DTL+ +L+    GD+
Sbjct  202   TVNIYPFLSLYGNENFPFDFAFFDGNSNPINDNGILYTNVFDANFDTLVSALKSIGFGDM  261

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              + VGE+GWPTDG+KNAN++ A +FY G  +K+A  +GTP   G +E YLF L DE+AK+
Sbjct  262   PIFVGEVGWPTDGDKNANIENALRFYNGLFQKIASNKGTPKRPGYIEIYLFGLIDEDAKA  321

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF +DGKPKFP+  + +G +++ +GAKNV YL  +WC+ +    +   +
Sbjct  322   IAPGNFERHWGIFSFDGKPKFPMHISSQGQNKLLIGAKNVYYLDPKWCIFNPNSNNLTKL  381

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               N+ YAC+ +DC+ L  G+SCN+LD    ASYAFNMY+Q+ NQ   ACNFEGLA +   
Sbjct  382   AENIDYACTYADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQVDMACNFEGLAMVTTK  441

Query  1435  NASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             N ST  C F + +  +++     + +F  +  F  ++L
Sbjct  442   NISTPTCNFIIEINPSSS-----SYLFPSLVAFLFSML  474



>ref|XP_009121000.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=492

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 317/462 (69%), Gaps = 12/462 (3%)
 Frame = +1

Query  112   QPVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFD  291
             +P    V     T  ++   +S V  LGVNWGT A   L P  +VQMLKDN++ KVKLFD
Sbjct  6     KPSTTTVIFLCITISSLSFFSSNVSALGVNWGTMATHQLPPKTVVQMLKDNNVQKVKLFD  65

Query  292   SDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVG  471
             +D  T+   AG+GIEV+  IPN+QL+      + AKDWV+ NI+    D  +KIK+VAVG
Sbjct  66    ADTNTMVALAGSGIEVMVAIPNDQLKAMGS-YNRAKDWVRRNITRFNDD--IKIKYVAVG  122

Query  472   NEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGN  645
             NEPFL +YNGSF +L +PAL NIQKAL+EAG+G+ IKAT+P NADVY+S    P  S G 
Sbjct  123   NEPFLTSYNGSFINLTYPALFNIQKALNEAGVGDFIKATVPSNADVYSSPPENPVPSAGR  182

Query  646   FRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKG--A  819
             FR DI + M  I  +L  ++APF VNIYPFLSLY + +FP ++AFF+G+  +V+D G   
Sbjct  183   FRQDIYEEMRLIVNFLAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFNGQ-NTVNDNGNGV  241

Query  820   TYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAK  999
              YTN+FDAN DTL+ SL++   GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A 
Sbjct  242   VYTNVFDANFDTLLASLKELGHGDMTVIVGEVGWPTDGDKNANIPNAERFYAGLLPKLAA  301

Query  1000  KEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPV  1179
               GTP+  G +E YLF   DE+AKSIAPG FERHWGIF YDG+PKFP D +G G  +   
Sbjct  302   NRGTPMRPGYIEVYLFGFIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGEKKALT  361

Query  1180  GAKNVPYLPAQWCVLD----NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRA  1347
             GA+NV YL  QWC+L+    +    ++ +G N+ YAC+ SDC+AL  G+SC +LD    A
Sbjct  362   GAQNVQYLQNQWCMLNPNAISFSNSTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNA  421

Query  1348  SYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVAL  1473
             SYAFNMYFQ+ NQ  EAC+FEGLA I   N S + C FP+ +
Sbjct  422   SYAFNMYFQVQNQKAEACDFEGLAMITTKNISRDQCNFPIQI  463



>gb|KDO55075.1| hypothetical protein CISIN_1g011532mg [Citrus sinensis]
Length=483

 Score =   480 bits (1236),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 301/438 (69%), Gaps = 4/438 (1%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
              S V+GLGVNWGTQ    L P  IVQMLKDN I KVKLFD+   T+   AG+ IEV+  I
Sbjct  17    GSCVNGLGVNWGTQTTHQLPPKTIVQMLKDNGISKVKLFDAHQGTMIALAGSDIEVMVAI  76

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN  L    +  D AK WVK N++ +   GGV IK+VAVGNEPFLKAYNGSF +  FPAL
Sbjct  77    PNKDLLDM-NSYDRAKQWVKRNVTRYNFKGGVSIKYVAVGNEPFLKAYNGSFLNTTFPAL  135

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHR  705
             +NIQ AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI   M +I  +L  + 
Sbjct  136   QNIQNALNEAGVGDSIKATVPLNADVYESPENNPYPSFGRFRTDILGQMTQIVEFLAKNN  195

Query  706   APFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD-KGATYTNMFDANLDTLIWSLRKAK  882
             APF VNIYPFLSLY N +FP  +AFFDG    V    G  YTN+FDAN DTL+ +L+   
Sbjct  196   APFTVNIYPFLSLYGNDDFPFNYAFFDGGTPIVDSGTGIQYTNVFDANFDTLVSALKAVG  255

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
              GD+ +IVGE+GWPTDG+KNAN   A +FY G L K+A  +GTP+  G +E YLF L DE
Sbjct  256   HGDMPMIVGEVGWPTDGDKNANNGNAYRFYNGLLPKLAANKGTPLRPGYIEVYLFGLVDE  315

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             +AKSI PG FERHWGIF YDG+PKF +D +G+G ++M +GA  V Y+P+QWC+L+ + KD
Sbjct  316   DAKSIDPGYFERHWGIFRYDGQPKFAMDLSGQGQNKMLIGASGVKYMPSQWCMLNPDAKD  375

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +  N+ YAC+ SDC+AL  G+SCN+LD    ASYAFNMY+QI NQD  AC F+GL K
Sbjct  376   MSKLVDNIKYACTWSDCTALGYGSSCNNLDANGNASYAFNMYYQIKNQDELACGFQGLGK  435

Query  1423  IVKHNASTNGCLFPVALE  1476
             +   N S   C F + L+
Sbjct  436   VTTQNLSQGQCSFIIQLD  453



>ref|XP_006443393.1| hypothetical protein CICLE_v10019922mg [Citrus clementina]
 ref|XP_006479087.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
 gb|ESR56633.1| hypothetical protein CICLE_v10019922mg [Citrus clementina]
Length=483

 Score =   480 bits (1236),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 301/438 (69%), Gaps = 4/438 (1%)
 Frame = +1

Query  172   ASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGI  351
              S V+GLGVNWGTQ    L P  IVQMLKDN I KVKLFD+   T+   AG+ IEV+  I
Sbjct  17    GSCVNGLGVNWGTQTTHQLPPKTIVQMLKDNGISKVKLFDAHQGTMIALAGSDIEVMVAI  76

Query  352   PNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPAL  531
             PN  L    +  D AK WVK N++ +   GGV IK+VAVGNEPFLKAYNGSF +  FPAL
Sbjct  77    PNKDLLDM-NSYDRAKQWVKRNVTRYNFKGGVSIKYVAVGNEPFLKAYNGSFLNTTFPAL  135

Query  532   KNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHR  705
             +NIQ AL+EAG+G+ IKAT+P NADVY S    P  S G FR+DI   M +I  +L  + 
Sbjct  136   QNIQNALNEAGVGDSIKATVPLNADVYESPENNPYPSFGRFRTDILGQMTQIVEFLAKNN  195

Query  706   APFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD-KGATYTNMFDANLDTLIWSLRKAK  882
             APF VNIYPFLSLY N +FP  +AFFDG    V    G  YTN+FDAN DTL+ +L+   
Sbjct  196   APFTVNIYPFLSLYGNDDFPFNYAFFDGGTPIVDSGTGIQYTNVFDANFDTLVSALKAVG  255

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
              GD+ +IVGE+GWPTDG+KNAN   A +FY G L K+A  +GTP+  G +E YLF L DE
Sbjct  256   HGDMPMIVGEVGWPTDGDKNANNGNAYRFYNGLLPKLAANKGTPLRPGYIEVYLFGLVDE  315

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             +AKSI PG FERHWGIF YDG+PKF +D +G+G ++M +GA  V Y+P+QWC+L+ + KD
Sbjct  316   DAKSIDPGYFERHWGIFRYDGQPKFAMDLSGQGQNKMLIGASGVKYMPSQWCMLNPDAKD  375

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
                +  N+ YAC+ SDC+AL  G+SCN+LD    ASYAFNMY+QI NQD  AC F+GL K
Sbjct  376   MSKLVDNIKYACTWSDCTALGYGSSCNNLDANGNASYAFNMYYQIKNQDELACGFQGLGK  435

Query  1423  IVKHNASTNGCLFPVALE  1476
             +   N S   C F + L+
Sbjct  436   VTTQNLSQGQCSFIIQLD  453



>gb|AAD38251.1|AC006193_7 Similar to glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
Length=450

 Score =   479 bits (1233),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 232/422 (55%), Positives = 297/422 (70%), Gaps = 4/422 (1%)
 Frame = +1

Query  214   AAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDN  393
             A   L P  +VQMLKDN+I+KVKLFD+D  T+   AG+G+EV+  IPN+QL +     D 
Sbjct  2     ATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPNDQL-KVMTSYDR  60

Query  394   AKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGN  573
             AKDWV+ N++ +  DGGV I  VAVGNEPFLK+YNGSF +L FPAL NIQ AL+EAGLGN
Sbjct  61    AKDWVRKNVTRYNFDGGVNITFVAVGNEPFLKSYNGSFINLTFPALANIQNALNEAGLGN  120

Query  574   KIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLY  747
              +KAT+P NADVY S    P  S G FR DI   M +I  +L  + AP  +NIYPFLSLY
Sbjct  121   SVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNAPITINIYPFLSLY  180

Query  748   ENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPT  927
              N +FP+ +AFFDG A+ ++D G  YTN+FDAN DTL+ SL+    GD+ +IVGE+GWPT
Sbjct  181   GNDDFPLNYAFFDG-AEPINDNGIDYTNVFDANFDTLVSSLKAVGHGDMPIIVGEVGWPT  239

Query  928   DGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWG  1107
             +G+K+AN   A +FY G L ++   +GTP+    +E YLF L DE+AKSIAPG FERHWG
Sbjct  240   EGDKHANAGSAYRFYNGLLPRLGTNKGTPLRPTYIEVYLFGLLDEDAKSIAPGPFERHWG  299

Query  1108  IFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMS  1287
             IF +DG+PKFPID +G+G  +  +GA+NVPYLP +WC  + E KD   + +N+ YAC+ S
Sbjct  300   IFKFDGQPKFPIDLSGQGQSKFLIGAQNVPYLPNKWCTFNPEAKDLTKLAANIDYACTFS  359

Query  1288  DCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPV  1467
             DC+AL  G+SCN LD    ASYAFNM+FQ+ NQD  AC F+GLA I   N S   C FP+
Sbjct  360   DCTALGYGSSCNTLDANGNASYAFNMFFQVKNQDESACYFQGLATITTQNISQGQCNFPI  419

Query  1468  AL  1473
              +
Sbjct  420   QI  421



>dbj|BAJ98060.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   481 bits (1237),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 322/460 (70%), Gaps = 10/460 (2%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
              LG+NWGTQA   L+P I+VQMLKDN I KVKLFD+D  T++  AGT IEV+  IPNN L
Sbjct  27    ALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNLL  86

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
             +   ++ DNA++WV+ NIS +  DGGV IK+VAVGNEPFL +YNG+F  + FPAL+NIQ 
Sbjct  87    D-LMNEKDNAREWVRHNISRYHFDGGVNIKYVAVGNEPFLASYNGTFDKVTFPALQNIQN  145

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             AL++AG  ++IKAT+P NADVY S +  P  S G FR+D+  LM ++ ++L ++ APF V
Sbjct  146   ALNDAGF-SEIKATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSAPFTV  204

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYP+LSLY + +FPV+FAFFDG A  V D   TYTN+FDAN DTL+ +L     GD+ +
Sbjct  205   NIYPYLSLYLSADFPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGHGDLPI  264

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKSI  1077
             I+GE+GWPTDG+K+AN  +A++FY G L ++A   GTP+     +E YLF L DE+ KS+
Sbjct  265   IIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDEDVKSV  324

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
             APG FERHWG+  +DG+PKFP+D TG+G + M V AK V YLP  WCV +   +D   + 
Sbjct  325   APGAFERHWGVLRFDGQPKFPMDLTGKGQNTMLVPAKGVRYLPRTWCVYNPNAEDKSKLV  384

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              N+ YAC+ +DC+AL  G++C  +D+   ASYAFNMYFQ+ NQ  EAC+F+ LA   + +
Sbjct  385   ENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALAVPTQTD  444

Query  1438  ASTNGCLFPVALESAATRSGGITAVFAG----IFFFCLAL  1545
              ST  C FP+ + +++T SGG     AG    +  F LAL
Sbjct  445   PSTAACNFPIQIAASST-SGGRRRTRAGPLGAVALFVLAL  483



>ref|XP_003619009.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=449

 Score =   479 bits (1233),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 233/432 (54%), Positives = 305/432 (71%), Gaps = 6/432 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L P  +VQMLKDN I KVKLFD+D  T++   G+GIEV+  IPNN
Sbjct  15    VEGLGVNWGTQATHPLKPDTVVQMLKDNGIQKVKLFDADEETMSALGGSGIEVMVAIPNN  74

Query  361   QLERFADDLDNAKDWVKANISSH-IHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
             QL   +D  D A  WV+ N++ +    GGV IK+VAVGNEPFLKAYN SF ++ FPAL N
Sbjct  75    QLAEMSD-YDRALQWVRKNVTRYNFKSGGVNIKYVAVGNEPFLKAYNNSFLNVTFPALMN  133

Query  538   IQKALDEAGLGNKIKATIPQNADVYAS---GTGGPSEGNFRSDIRDLMIKICRYLRDHRA  708
             IQ AL++ GLG+ IKAT+P NADVY S       PS G FR D+ +LM +I ++L  + A
Sbjct  134   IQNALNQVGLGDSIKATVPLNADVYESPDSNNAVPSAGIFRPDLSELMTQIVQFLSKNNA  193

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCG  888
             PF VNIYPFLSLY N NFP ++AFFDG +  ++D G  YTN+FDAN DTL+ +L+    G
Sbjct  194   PFTVNIYPFLSLYGNDNFPFDYAFFDGVSNPINDNGVLYTNVFDANFDTLVSALKSIGFG  253

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             ++ + VGE+GWPTDG+KNAN++ A +FY G L ++A  +GTP  +G +E YLF L DE+A
Sbjct  254   NMPIFVGEVGWPTDGDKNANIQNALRFYNGLLPRLASNKGTPRRQGYIEVYLFGLIDEDA  313

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGR-GNDRMPVGAKNVPYLPAQWCVLDNEQKDS  1245
             KSI PG FERHWGIF +DGKPKFP+  + + G +++ VGAK+V YL  +WC+ +    + 
Sbjct  314   KSIEPGNFERHWGIFSFDGKPKFPMHVSNQHGQNKLLVGAKDVHYLDPKWCMFNPNANNL  373

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKI  1425
               +  N+ YAC+ +DC+ L  G+SCN+LD    ASYAFNMY+Q+ NQ+  ACNFEGLA +
Sbjct  374   SNLADNINYACTFADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQNDLACNFEGLAML  433

Query  1426  VKHNASTNGCLF  1461
               +N ST  C+F
Sbjct  434   TTNNISTPTCVF  445



>dbj|BAJ90806.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   480 bits (1236),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 322/460 (70%), Gaps = 10/460 (2%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
              LG+NWGTQA   L+P I+VQMLKDN I KVKLFD+D  T++  AGT IEV+  IPNN L
Sbjct  27    ALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNLL  86

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
             +   ++ DNA++WV+ NIS +  DGGV IK+VAVGNEPFL +YNG+F  + FPAL+NIQ 
Sbjct  87    D-LMNEKDNAREWVRHNISRYHFDGGVNIKYVAVGNEPFLASYNGTFDKVTFPALQNIQN  145

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             AL++AG  ++IKAT+P NADVY S +  P  S G FR+D+  LM ++ ++L ++ APF V
Sbjct  146   ALNDAGF-SEIKATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSAPFTV  204

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYP+LSLY + +FPV+FAFFDG A  V D   TYTN+FDAN DTL+ +L     GD+ +
Sbjct  205   NIYPYLSLYLSADFPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGHGDLPI  264

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKSI  1077
             I+GE+GWPTDG+K+AN  +A++FY G L ++A   GTP+     +E YLF L DE+ KS+
Sbjct  265   IIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDEDVKSV  324

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
             APG FERHWG+  +DG+PKFP+D TG+G + M V AK V YLP  WCV +   +D   + 
Sbjct  325   APGAFERHWGVLRFDGQPKFPMDLTGKGQNTMLVPAKGVRYLPRTWCVYNPNAEDKSKLV  384

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              N+ YAC+ +DC+AL  G++C  +D+   ASYAFNMYFQ+ NQ  EAC+F+ LA   + +
Sbjct  385   ENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALAVPTQTD  444

Query  1438  ASTNGCLFPVALESAATRSGGITAVFAG----IFFFCLAL  1545
              ST  C FP+ + +++T SGG     AG    +  F LAL
Sbjct  445   PSTAACNFPIQIAASST-SGGRRRTRAGPLGAVALFVLAL  483



>emb|CBI21529.3| unnamed protein product [Vitis vinifera]
Length=1073

 Score =   499 bits (1285),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 324/473 (68%), Gaps = 50/473 (11%)
 Frame = +1

Query  142   IWTGFAVILLA-SPVHG--LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             +W   +V+LLA +  HG  LGVNWGTQA+  L PSI+V++LKDN I+KVKLFD+D WTVN
Sbjct  8     VWAFLSVVLLAFNTSHGDALGVNWGTQASHILQPSIVVRLLKDNGINKVKLFDADSWTVN  67

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
               AG+GIEV+ GIPN  L+R+ +    AK WV+ N++ H++DGGV I++VAVGNEPFL +
Sbjct  68    ALAGSGIEVMVGIPNKDLQRY-NSYKKAKHWVEKNVTKHLYDGGVDIRYVAVGNEPFLTS  126

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLM  672
             YNGSF +  FPAL NIQKALDEAG G+KIKATIP NADVY S T  PS+G FR DI+DLM
Sbjct  127   YNGSFLNTTFPALSNIQKALDEAGHGDKIKATIPLNADVYESATNKPSDGQFRKDIKDLM  186

Query  673   IKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLD  852
             IKI + L + ++ F+VNIYPFLSLY+N +FP++FAFF+G      DKG  YTN+FDAN D
Sbjct  187   IKIVKLLHEKKSAFVVNIYPFLSLYQNPDFPLDFAFFNGGGNPTEDKGVQYTNVFDANHD  246

Query  853   TLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVV  1032
             TL+W+LRKA   D+ ++VGEIGWPTDG+KNAN+K+A +FY G L+K+A  +GTP+  G +
Sbjct  247   TLVWALRKAGVPDLKILVGEIGWPTDGDKNANLKLARRFYDGLLKKLADGKGTPLRPGRL  306

Query  1033  EFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQ  1212
             + YLF L DEN KS+APG FERHWGIF +DGKPKFP+DF+G+G D+    AK V YL  +
Sbjct  307   DVYLFGLIDENMKSVAPGSFERHWGIFFFDGKPKFPMDFSGKGLDKFLEPAKGVIYLEPK  366

Query  1213  WCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDV  1392
             WCVL+ +     AV                                   NM     NQDV
Sbjct  367   WCVLNRD-----AVK----------------------------------NM---TQNQDV  384

Query  1393  EACNFEGLAKIVKHNASTNGCLFPVALESAATR--SGGITAV-FAGIF-FFCL  1539
             EACNF G+ KI   NAST  CLFPV + SA  +    G++   F G+F  +C+
Sbjct  385   EACNFNGMGKITTKNASTGTCLFPVQMMSAGEKLIGYGVSVTGFMGLFQLYCI  437



>ref|XP_011082117.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Sesamum indicum]
Length=484

 Score =   479 bits (1234),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 230/456 (50%), Positives = 314/456 (69%), Gaps = 5/456 (1%)
 Frame = +1

Query  148   TGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGT  327
             TG  +  + + V  +G NWGTQA   L+PSI+V++LKDN I KVKLFD++   +N  +G+
Sbjct  13    TGVVLFFMVNTVQSIGANWGTQATHPLHPSIVVKLLKDNGIQKVKLFDAEATVLNALSGS  72

Query  328   GIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSF  507
             GIEV+ GIPN+ L   A+ +D A+ WV+ N+S+H+    V I++VAVGNEPFL  YNG+F
Sbjct  73    GIEVMVGIPNDMLSTLANSVDAAERWVERNVSAHVSSNSVDIRYVAVGNEPFLSTYNGTF  132

Query  508   KDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICR  687
             +    PAL+NIQ AL +AGLGN++K T+P NADVY S T  PS G+FR++I DLM++I  
Sbjct  133   QATTLPALQNIQAALIKAGLGNRVKVTVPLNADVYQSSTEQPSTGDFRANIHDLMVQIVS  192

Query  688   YLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWS  867
             +L  + APF VNIYPF+SLY + NFPV++AFFDG +  + D G TYTN+FDAN DTL+W+
Sbjct  193   FLSLNGAPFTVNIYPFISLYNDPNFPVDYAFFDGYSSPIVDNGRTYTNVFDANYDTLVWA  252

Query  868   LRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLF  1047
             L+K   G++ +IVGEIGWPTDG++NAN+  A++F +GF+  M    GTP+  G ++ YLF
Sbjct  253   LQKNGFGNMTIIVGEIGWPTDGDRNANIGYAQRFNQGFMSHM--NAGTPMRPGPIDAYLF  310

Query  1048  SLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD  1227
             SL DE+AKSI PG FERHWGIF YDG PK+ +   G  N    V A NV YLP +WCVL 
Sbjct  311   SLIDEDAKSIQPGNFERHWGIFNYDGTPKYNLSL-GSSNSHSLVPASNVHYLPRRWCVLS  369

Query  1228  -NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACN  1404
              +   +   V  ++ YAC+  DC++L  G SC +LD     SYAFN Y+QINNQ   AC 
Sbjct  370   PSANLEDPQVALSVSYACANGDCTSLGYGTSCGNLDAQRNISYAFNSYYQINNQLESACR  429

Query  1405  FEGLAKIVKHNASTNGCLFPVALESAAT-RSGGITA  1509
             F  L+ I   + S   C F + +++AA  R+GG+++
Sbjct  430   FPNLSVITTTDPSVGTCRFNIMIQTAANQRNGGLSS  465



>dbj|BAK05853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   479 bits (1234),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 321/460 (70%), Gaps = 10/460 (2%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
              LG+NWGTQA   L+P I+VQMLKDN I KVKLFD+D  T++  AGT IEV+  IPNN L
Sbjct  27    ALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNLL  86

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
             +   ++ DNA++WV+ NIS +  DGGV IK+VAVGNEPFL +YNG+F  + FPAL+NIQ 
Sbjct  87    D-LMNEKDNAREWVRHNISRYHFDGGVNIKYVAVGNEPFLASYNGTFDKVTFPALQNIQN  145

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             AL++AG  ++IKAT+P NADVY S +  P  S G FR+D+  LM ++ ++L ++ APF V
Sbjct  146   ALNDAGF-SEIKATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSAPFTV  204

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYP+LSLY + +FPV+FAFFDG A  V D   TYTN+FDAN DTL+ +L     GD+  
Sbjct  205   NIYPYLSLYLSADFPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGHGDLPT  264

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKSI  1077
             I+GE+GWPTDG+K+AN  +A++FY G L ++A   GTP+     +E YLF L DE+ KS+
Sbjct  265   IIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDEDVKSV  324

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
             APG FERHWG+  +DG+PKFP+D TG+G + M V AK V YLP  WCV +   +D   + 
Sbjct  325   APGAFERHWGVLRFDGQPKFPMDLTGKGQNTMLVPAKGVRYLPRTWCVYNPNAEDKSKLV  384

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              N+ YAC+ +DC+AL  G++C  +D+   ASYAFNMYFQ+ NQ  EAC+F+ LA   + +
Sbjct  385   ENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALAVPTQTD  444

Query  1438  ASTNGCLFPVALESAATRSGGITAVFAG----IFFFCLAL  1545
              ST  C FP+ + +++T SGG     AG    +  F LAL
Sbjct  445   PSTAACNFPIQIAASST-SGGRRRTRAGPLGAVALFVLAL  483



>ref|XP_004289257.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   478 bits (1230),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 311/443 (70%), Gaps = 6/443 (1%)
 Frame = +1

Query  130   VRLAIWTGFAVIL----LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSD  297
             VR+ +   + V L    L     GLGVNWG  A+  L+P+ +V+MLKDN I KVKLFD++
Sbjct  2     VRVLLLLTYVVSLMLVNLTDEAQGLGVNWGGMASHPLDPNNVVKMLKDNGIKKVKLFDAE  61

Query  298   HWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAV-GN  474
               T+   +G+G  V+ GIPN++L   + D  +A++WVK NI+ + H+GGV I+   V  N
Sbjct  62    PSTMKALSGSGFSVIVGIPNDKLASISSDYKHAQEWVKENITKYDHNGGVDIRFGFVSAN  121

Query  475   EPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRS  654
               F KAYNGSF    FPAL+NIQKALD AG   KIKA +P NADVY + +G PS+G+FR 
Sbjct  122   FLFFKAYNGSFLKTTFPALQNIQKALDAAGTRQKIKAIVPFNADVYEASSGKPSDGSFRK  181

Query  655   DIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNM  834
             DIR  M+KI   L+++++PF VNIYPF+SL ++  FP EFAFFDG ++ V D    YTN+
Sbjct  182   DIRVEMLKILGLLKNNKSPFFVNIYPFISLQQSSTFPREFAFFDGTSQPVQDNNNQYTNV  241

Query  835   FDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTP  1014
             FDANLDTL+ +L+K    D+++++GE GWPTDG+KNAN  +A+KFY G ++K+AK EGTP
Sbjct  242   FDANLDTLVCALKKVGYQDLDIVIGEAGWPTDGDKNANPTLAKKFYDGLMKKLAKAEGTP  301

Query  1015  VHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNV  1194
             + KG +E YLF LTDE+ KS+APG+FERHWGIF YDGKPKF +D TG+GND+M  G + V
Sbjct  302   LQKGYLEVYLFGLTDEDQKSVAPGDFERHWGIFSYDGKPKFAMDLTGKGNDQMLKGVQGV  361

Query  1195  PYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQ  1374
              Y+  QWCV++++ K+   + ++L YACS +DC++L  G SC DLDM  + SYA+N  FQ
Sbjct  362   QYMDKQWCVVNSDVKNGTLLKTDLNYACSQADCTSLGSGRSC-DLDMQGKVSYAYNSLFQ  420

Query  1375  INNQDVEACNFEGLAKIVKHNAS  1443
               +QDV  CNF G   I K + S
Sbjct  421   SKDQDVRTCNFNGKGTITKTDPS  443



>ref|XP_003557824.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=493

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 314/459 (68%), Gaps = 9/459 (2%)
 Frame = +1

Query  145   WTGFAVILLASPV----HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             W    V  LA+ V      LG+NWGTQA   L+P I+VQMLKDN I KVKLFD+D  T+ 
Sbjct  11    WLCCVVAALAASVSPAAEALGMNWGTQATHPLSPKIVVQMLKDNGIKKVKLFDADQGTLG  70

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
               AGT IEV+  IPN  L+   D  DNA+DWV+ N+S +  DGGV IK+VAVGNEPFL +
Sbjct  71    ALAGTDIEVMVAIPNVLLDLMTDS-DNARDWVRHNVSRYHFDGGVNIKYVAVGNEPFLAS  129

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRD  666
             YNG+F  +  PALKNIQ AL++AGL + +KAT+P NADVY S    P  S G FR DI D
Sbjct  130   YNGTFDKVTLPALKNIQNALNDAGLSD-VKATVPLNADVYNSPKDKPVPSAGTFRPDITD  188

Query  667   LMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDAN  846
             LM ++  +L  + APF VNIYP+LSLY + +FPV FAFFDG A  V D G +YTN+FDAN
Sbjct  189   LMTEMVDFLAKNGAPFTVNIYPYLSLYLSDDFPVNFAFFDGGADPVVDNGNSYTNVFDAN  248

Query  847   LDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG  1026
              DTL+ +L+    GD+ +++GE+GWPTDG+K+A    A++FY G L+++A   GTP+   
Sbjct  249   FDTLVSALKAVGHGDLPIVIGEVGWPTDGDKHATYVYAQRFYTGLLKRLAANVGTPLRPN  308

Query  1027  -VVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYL  1203
               +E YLF L DE+ KS+APG FERHWG+  +DG+PKFP+D TG+G + M   AK+V YL
Sbjct  309   KYMEVYLFGLLDEDIKSVAPGAFERHWGVLRFDGQPKFPMDLTGQGQNTMLAPAKDVQYL  368

Query  1204  PAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINN  1383
             P  WCV +   KD+  +  N+ +AC+ +DC+AL  G+SC  +D    ASYAFNMYFQ+ N
Sbjct  369   PKTWCVYNANAKDTSKLAENVNFACTFADCTALGFGSSCAGMDAIGNASYAFNMYFQVQN  428

Query  1384  QDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGG  1500
             Q  EAC+F+ LA   + + ST+ C FP+ + +A++ S G
Sbjct  429   QKDEACDFQALAVPTQTDPSTDTCHFPIQIAAASSTSSG  467



>ref|XP_010528707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=495

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/432 (55%), Positives = 306/432 (71%), Gaps = 5/432 (1%)
 Frame = +1

Query  178   PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPN  357
             P +GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD++  T+   AG+GIEV+  IPN
Sbjct  26    PANGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMRALAGSGIEVMVAIPN  85

Query  358   NQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
             +QL R     D AK+WV+ N+S +  DGGV I +VAVGNEPFL +YNGSF +L FPAL+N
Sbjct  86    DQL-RVMGSYDRAKEWVQMNVSRYNFDGGVNITYVAVGNEPFLTSYNGSFVNLTFPALQN  144

Query  538   IQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +Q AL+EA LG+ +KAT+P NADVY S      PS G FR DI   M +I  +L  + AP
Sbjct  145   VQNALNEARLGH-VKATVPLNADVYDSPANNQVPSAGRFRPDIISQMTEIVDFLGKNNAP  203

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F +NIYPFLSLY + +FP ++AFFDG  + V D G  Y N+FDAN DTL+ +L+    GD
Sbjct  204   FTINIYPFLSLYGSSDFPFDYAFFDGPTQIV-DNGIQYNNVFDANFDTLVSALKAIGHGD  262

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             + +IVGE+GWPTDG+KNAN   A ++Y G L ++A K+GTP+  G +E YLF L DE+AK
Sbjct  263   MPIIVGEVGWPTDGDKNANTGNALRYYNGLLPRLAAKKGTPLRPGYIEVYLFGLLDEDAK  322

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             SIAPG FERHWGI  +DG+PKFP+D +G+G ++  +GA+NV YL  +WC+ + E KD   
Sbjct  323   SIAPGNFERHWGIVRFDGQPKFPLDLSGQGQNKFLIGAQNVKYLQNKWCMFNPEAKDISK  382

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ NQ+ +AC F+GLA I  
Sbjct  383   LVENVDYACTHSDCTALGFGSSCNSLDGHRNASYAFNMYFQVRNQEEDACFFQGLATITT  442

Query  1432  HNASTNGCLFPV  1467
              N S   C FP+
Sbjct  443   QNISQGQCNFPI  454



>gb|KFK37837.1| hypothetical protein AALP_AA3G035600 [Arabis alpina]
Length=553

 Score =   481 bits (1237),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 305/441 (69%), Gaps = 5/441 (1%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             +   +  V  LGVNWGT A   L P  +V+ML+DN+I KVKLFD+D  T+   AG+G+EV
Sbjct  23    ITAFSGGVSALGVNWGTMATHQLPPKTVVEMLRDNNIKKVKLFDADTKTMGALAGSGVEV  82

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             +  IPN+ L+   +    AKDWV+ N++    + GVKIK+VAVGNEPFL AYNGSF +L 
Sbjct  83    MVAIPNDLLQAMGN-YQRAKDWVQRNVTRFNFNNGVKIKYVAVGNEPFLTAYNGSFINLT  141

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYL  693
             +PAL NIQ AL++AG+G+ IKAT+P NADVY S      PS G FRSDI   M  I  +L
Sbjct  142   YPALVNIQTALNDAGIGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIMQEMTNIVNFL  201

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
               ++APF VNIYPFLSLY   +FP ++ FFDG+  +V+D G  YTN+FDAN DTL+ SL 
Sbjct  202   AQNKAPFTVNIYPFLSLYLTSDFPFDYTFFDGQ-NTVNDNGVVYTNVFDANFDTLLASLN  260

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
                 GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L ++A   GTP+ KG +E YLF  
Sbjct  261   ALNHGDMEVIVGEVGWPTDGDKNANVPNAERFYAGLLPRLANNVGTPMRKGYIEVYLFGF  320

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-N  1230
              DE AKS+APG FERHWG+F +DG+PKFP+DF G+G  +   GA+NV YL  QWC+ + N
Sbjct  321   IDEEAKSVAPGNFERHWGLFKFDGQPKFPVDFIGQGQKKFLTGAQNVQYLLNQWCMFNPN  380

Query  1231  EQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFE  1410
              + +    G N+ YACS +DC+AL  G+SC +LD    ASYAFNMYFQ+ NQ+ +AC+F+
Sbjct  381   GRGNISKFGDNVDYACSRADCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFD  440

Query  1411  GLAKIVKHNASTNGCLFPVAL  1473
             GLA I   N S   C FP+ +
Sbjct  441   GLATITTQNISQGQCNFPIQI  461



>gb|KEH32093.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=521

 Score =   479 bits (1233),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 235/461 (51%), Positives = 312/461 (68%), Gaps = 5/461 (1%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
             ++S  +G+GVNWGT A   L P  +V+ML++N  DK+KLFD+D W +    GT IEV+  
Sbjct  24    MSSCGYGVGVNWGTMATHQLPPKNVVKMLQENGFDKLKLFDADEWVMAALLGTDIEVMLA  83

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPA  528
             IPNN LE  + D   A  WV  N++S+++ GG+ IK++AVGNEPFLK YNG++     PA
Sbjct  84    IPNNMLEEISKDPKVADSWVYENVTSYLYPGGLNIKYIAVGNEPFLKEYNGTYLMYTLPA  143

Query  529   LKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDH  702
             LKNIQ +L+ AGLG+ IKAT+P NAD Y S      PS G+FR ++RDL I+I  YL  +
Sbjct  144   LKNIQTSLNNAGLGSSIKATVPFNADAYYSPDSNLVPSAGDFRPEVRDLTIEIINYLYTN  203

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
              APF VNIYPFLSLY N +FP +FAFFDG  K + D    YTN+FDANLDTL+++L KA 
Sbjct  204   NAPFTVNIYPFLSLYGNDHFPFDFAFFDGNNKPLVDGNLLYTNVFDANLDTLLYALEKAG  263

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
               D++VI+GE+GWPTDG+KNAN++ A++F  G L+      GTP  KG+++ YLFSL DE
Sbjct  264   YPDMHVIIGEVGWPTDGDKNANIQNAKRFNNGLLKHCLSGNGTPKRKGIIDIYLFSLIDE  323

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             NAKSIAPG FERHWGIF +DGKPK+ +D  G   D   V  + V Y+  QWC+LD +  D
Sbjct  324   NAKSIAPGNFERHWGIFEFDGKPKYELDLKGFQGDEGLVAVEGVKYMEKQWCILDPDISD  383

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
              H +  ++ YACS+SDC+AL  G+SCN L +   ASYAFNMY+Q++NQ    C+F GLA 
Sbjct  384   LHYLAGSIDYACSLSDCTALGYGSSCNGLSLEGNASYAFNMYYQVHNQKDWDCDFSGLAI  443

Query  1423  IVKHNASTNGCLFPVALESAATRS--GGITAVFAGIFFFCL  1539
             +   + S  GC FPV +  A+      G  A F G++ F +
Sbjct  444   LSDQDPSEKGCQFPVMISHASCLGLHKGFLA-FGGVYIFLV  483



>ref|NP_001058984.2| Os07g0168600 [Oryza sativa Japonica Group]
 dbj|BAF20898.2| Os07g0168600, partial [Oryza sativa Japonica Group]
Length=558

 Score =   480 bits (1236),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 303/434 (70%), Gaps = 3/434 (1%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
              GLG+NWGTQA   L P  +VQ+LKDN I KVKLFD+D   ++  AG+G+EV+  IPN  
Sbjct  102   EGLGINWGTQATHPLPPKAVVQLLKDNGIAKVKLFDTDFAAMSALAGSGVEVMVAIPNKD  161

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L   A D  NAKDWVK N+     DGGV IK+VAVGNEPFLKAYNGSF ++  PAL+N+Q
Sbjct  162   LATMASDYGNAKDWVKKNVKRFDFDGGVTIKYVAVGNEPFLKAYNGSFINITLPALQNVQ  221

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
              AL++AG+G++IKAT+P NADVY S    PS G FR +I  LM  I ++L  + APF VN
Sbjct  222   NALNDAGIGDRIKATVPLNADVYESTV--PSAGRFRPEIAGLMTDIVKFLAKNNAPFTVN  279

Query  724   IYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVI  903
             IYPFLSLY +++FP+ FAFFDG +  V+D G  YTN+FDAN DTL+ +L+    GD+ +I
Sbjct  280   IYPFLSLYLDEHFPINFAFFDGGSTPVNDGGIMYTNVFDANFDTLVAALKAVGHGDMPII  339

Query  904   VGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDENAKSIA  1080
             VGE+GWPTDG+KNA + +A++FY G L+++A   GTP      +E YLF L DE+ KS+A
Sbjct  340   VGEVGWPTDGDKNARVDLAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDEDMKSVA  399

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGS  1260
             PG FERHWG+  YDG+PKF +D  G+G + M V AK + YLP  WCV++   KD   +G 
Sbjct  400   PGSFERHWGVLRYDGQPKFAMDLAGQGRNTMLVPAKGIEYLPKTWCVINTNAKDVSKLGD  459

Query  1261  NLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNA  1440
             N+ +AC+ +DC+ L  G+SCN +D    ASYAFN YFQ  +Q  EACNF+GLA   + + 
Sbjct  460   NINFACTYADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLAVPTETDP  519

Query  1441  STNGCLFPVALESA  1482
             +T  C F + ++S+
Sbjct  520   TTAQCNFTIQIKSS  533



>gb|KHN10411.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=466

 Score =   477 bits (1227),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 230/466 (49%), Positives = 311/466 (67%), Gaps = 7/466 (2%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
             +AS   G+GVNWGT A   L P+ +V+ML++N IDK+KLFD++ W +    GT IEV+  
Sbjct  1     MASCGSGVGVNWGTMATHKLPPNKVVKMLQENRIDKLKLFDAEEWIMAALMGTDIEVMLA  60

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPA  528
             IPNN LE  + +   A  WV  N++ +++ GG+ IK++AVGNEPFLK YNG++     PA
Sbjct  61    IPNNMLEEMSRNPQVADSWVYENVTGYMYPGGLNIKYIAVGNEPFLKEYNGAYLQSTLPA  120

Query  529   LKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDH  702
             LKNIQ AL+  G G++IK T+P NADVY S      PS G+FR ++RD  I+I ++L  +
Sbjct  121   LKNIQTALNSWGFGSQIKVTVPFNADVYYSPDSNQVPSAGDFRPEVRDQTIEIVQFLYAN  180

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
              APF VNIYPFLSLY N +FP +FAFFDG  + + D  + YTN+FDANLDTL+W+L K+ 
Sbjct  181   NAPFTVNIYPFLSLYGNDHFPFDFAFFDGSNRPLIDGNSAYTNVFDANLDTLLWALEKSG  240

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
               D+ VIVGE+GWPTDG+KNAN++ A++F  G L+      GTP  KG+++ YLFSL DE
Sbjct  241   YPDIEVIVGEVGWPTDGDKNANVQNAKRFNMGLLKHALSGNGTPKRKGIIDIYLFSLVDE  300

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             NAKSIAPG FERHWGIF +DGKPK+ +D  G   +   V  + + Y+  QWC+LD+  KD
Sbjct  301   NAKSIAPGNFERHWGIFEFDGKPKYELDLRGLEENNGLVPVEGIRYMEKQWCILDSNVKD  360

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
              H +  ++ YACS SDC+AL  G+SCN L +   ASYAFNMY+Q+NNQ    C+F GLA 
Sbjct  361   LHNLAESIDYACSKSDCTALGYGSSCNSLSLQGNASYAFNMYYQVNNQKDWDCDFSGLAT  420

Query  1423  IVKHNASTNGCLFPVALESAAT-----RSGGITAVFAGIFFFCLAL  1545
             +   + S  GC FP+ +   ++     R   I     GI+ F + L
Sbjct  421   VTDEDPSEKGCQFPIMISYGSSLLQQERLTNILKKALGIYIFVILL  466



>ref|XP_010420566.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=494

 Score =   478 bits (1230),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 316/469 (67%), Gaps = 11/469 (2%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
              V L +  V  LGVNWGT A   L P  +VQMLKDN++ KVKLFD+D  T+   AG+GIE
Sbjct  21    TVYLNSRDVSALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIE  80

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN+QL+      + AKDWV+ NI+    D  VKIK+VAVGNEPFL AYNGSF +L
Sbjct  81    VMVAIPNDQLKAMGS-YNRAKDWVRRNITRFNDD--VKIKYVAVGNEPFLTAYNGSFINL  137

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRY  690
              +PAL +IQKAL+EAG+G+ IKAT+P NADVY S    P  S G FR DI + M  I  +
Sbjct  138   TYPALFHIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGTFRQDIFEEMKLIVNF  197

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSL  870
             L  ++APF VNIYPFLSL  + +FP ++AFF+G+  +V D G  YTN+FDAN DTL+ SL
Sbjct  198   LAHNKAPFTVNIYPFLSLSLSSDFPFDYAFFNGQ-NTVSDNGVIYTNVFDANFDTLLASL  256

Query  871   RKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFS  1050
             R    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A  +GTP+  G +E YLF 
Sbjct  257   RALGHGDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNKGTPMRPGYIEVYLFG  316

Query  1051  LTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDN  1230
               DE+AKSIAPG FERHWGIF YDG+PKFP D  G G  ++  GA++V YL  QWC+L+ 
Sbjct  317   FIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLPGEGQKKVLTGAQSVQYLQNQWCMLNP  376

Query  1231  E----QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
                    +++ +G N+ YAC+ SDC+AL  G SC +LD    ASYAFNMYFQ+++Q  EA
Sbjct  377   NAHTFSNNTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEA  436

Query  1399  CNFEGLAKIVKHNASTNGCLFPVAL-ESAATRSGGITAVFAGIFFFCLA  1542
             C+FEGLA I  HN S   C FP+ + +  +  S      F  I   CL 
Sbjct  437   CDFEGLAIITTHNISREQCNFPIQIGDPTSGHSDHNNHRFGSIIGVCLV  485



>ref|XP_006400369.1| hypothetical protein EUTSA_v10015448mg [Eutrema salsugineum]
 gb|ESQ41822.1| hypothetical protein EUTSA_v10015448mg [Eutrema salsugineum]
Length=494

 Score =   478 bits (1230),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 309/445 (69%), Gaps = 10/445 (2%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
              V L +  V  LGVNWGT A   L P  +VQMLKDN++ KVKLFD+D  T+   AG+GIE
Sbjct  21    TVSLFSGDVSALGVNWGTMATHQLPPKTVVQMLKDNNVQKVKLFDADTNTMGALAGSGIE  80

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN+ L+      + AKDWV+ NI+    +  VKIK+VAVGNE FL +YNGSF +L
Sbjct  81    VMVAIPNDLLKAMGS-YNRAKDWVRRNITRF--NDAVKIKYVAVGNEAFLSSYNGSFINL  137

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRY  690
              +PAL NIQKAL+EAG+G+ IKAT+P NADVY S    P  S G FR DI + M  I  +
Sbjct  138   TYPALFNIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGRFRQDIFEEMKLIVNF  197

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSL  870
             L  ++APF VNIYPFLSLY + +FP ++AFF+G+  +V+D G  YTN+FDAN DTL+ SL
Sbjct  198   LAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFNGQ-NTVNDNGVIYTNVFDANFDTLLASL  256

Query  871   RKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFS  1050
             R    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A   GTP+  G +E YLF 
Sbjct  257   RALGHGDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNRGTPMRPGYIEVYLFG  316

Query  1051  LTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-  1227
               DE+AKSIAPG FERHWGIF +DG+PKFP D +G G  ++  GA+NV YL  QWC+L+ 
Sbjct  317   FIDEDAKSIAPGNFERHWGIFRFDGQPKFPADLSGEGKKKILTGAQNVQYLQNQWCMLNP  376

Query  1228  ---NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
                +   +++ +G N+ YAC+ SDC+AL  G+SC +LD    ASYAFNMYFQ+ NQ  EA
Sbjct  377   NGHSFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEA  436

Query  1399  CNFEGLAKIVKHNASTNGCLFPVAL  1473
             C+FEGLA I   N S   C FP+ +
Sbjct  437   CDFEGLAMITTRNISREQCNFPIQM  461



>ref|XP_009366428.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Pyrus x bretschneideri]
Length=487

 Score =   478 bits (1229),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 303/436 (69%), Gaps = 5/436 (1%)
 Frame = +1

Query  199   NWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFA  378
             NWGT A   L P+ +VQMLKDN I KVKLFD++  T++    +G+EV+  IPN+QL    
Sbjct  29    NWGTMATHELPPATVVQMLKDNGIPKVKLFDAEESTMSALLDSGLEVMVAIPNDQLAVLT  88

Query  379   DDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDE  558
                  AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+NIQ AL+E
Sbjct  89    S-YKRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLSSYNGSFLNVTFPALQNIQNALNE  147

Query  559   AGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYP  732
             AG+G+ +KAT+P NADVY S    P  S G FR+DI  LM +I ++L  ++APF +NIYP
Sbjct  148   AGVGDSVKATVPLNADVYDSPENNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINIYP  207

Query  733   FLSLYENKNFPVEFAFFDGRAKSVHDK--GATYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             FLSLY N  FP  +AFFDG    + D   G  YTN+FDAN DTL+ SL+    G++ ++V
Sbjct  208   FLSLYGNDGFPFNYAFFDGDTTPIVDTTTGIQYTNVFDANFDTLVSSLKAVGFGNMPIVV  267

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE+GWPTDG+KNAN+  A +FY G L K+    GTP+  G +E YLF L DE+AKSIAPG
Sbjct  268   GEVGWPTDGDKNANVGNAFRFYNGLLTKLGTNRGTPLRTGYIEVYLFGLIDEDAKSIAPG  327

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWGIF YDG+PKFP+D +G+G +++ V AKNV YL  +WC+ +   KD   +   +
Sbjct  328   SFERHWGIFSYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKDVSNLADKI  387

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YAC+ +DC+AL  G+SCN+LD    ASYAFNMY+Q+ NQD ++CNF+GLA +   N S 
Sbjct  388   NYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDQSCNFQGLATLTTQNVSQ  447

Query  1447  NGCLFPVALESAATRS  1494
               C F + + +++  S
Sbjct  448   GNCNFIIQMATSSASS  463



>ref|XP_007204344.1| hypothetical protein PRUPE_ppa005641mg [Prunus persica]
 gb|EMJ05543.1| hypothetical protein PRUPE_ppa005641mg [Prunus persica]
Length=450

 Score =   476 bits (1224),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 230/431 (53%), Positives = 300/431 (70%), Gaps = 5/431 (1%)
 Frame = +1

Query  214   AAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDN  393
             A   L P  +VQMLKDN I KVKLFD+D  T++  AG+G+EV+  IPN+QL   A     
Sbjct  2     ATHKLPPETVVQMLKDNGIQKVKLFDADESTMSALAGSGLEVMVAIPNDQLAVMAT-YKR  60

Query  394   AKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGN  573
             AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+NIQ AL+EAG+G+
Sbjct  61    AKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLTSYNGSFLNVTFPALQNIQNALNEAGVGD  120

Query  574   KIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLY  747
              IKAT+P NADVY S    P  S G FRSDI  LMI I ++L  ++APF +NIYPFLSLY
Sbjct  121   SIKATVPLNADVYNSPDSNPVPSAGRFRSDISPLMIAIVQFLAKNKAPFTINIYPFLSLY  180

Query  748   ENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGW  921
              N +FP  +AFFDG    + D   G  YTN+FDAN DTL+ SL+    GD+ ++VGE+GW
Sbjct  181   GNDDFPFNYAFFDGDTNPIVDATTGIQYTNVFDANFDTLVSSLKAEGFGDMTIVVGEVGW  240

Query  922   PTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERH  1101
             PTDG+KNAN   A +FY G L K+    GTP+  G +E YLF L DE+AKSIAPG FERH
Sbjct  241   PTDGDKNANAGNAYRFYNGLLPKLGTNRGTPLRPGYIEVYLFGLIDEDAKSIAPGSFERH  300

Query  1102  WGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACS  1281
             WGIF YDG+PKF +D +G+  +++ V AKNV YL  +WC+ +   KD   +  N+ YAC+
Sbjct  301   WGIFSYDGQPKFLVDLSGQSQNKLLVPAKNVQYLSKKWCMFNPNAKDVTKLADNINYACT  360

Query  1282  MSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLF  1461
              +DC+AL  G+SCN+LD    ASYAFNMY+Q+ NQD  +CNFEGLA +   N S   C F
Sbjct  361   YADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFEGLATLTTQNISQGNCNF  420

Query  1462  PVALESAATRS  1494
              + + +++T S
Sbjct  421   IIQIATSSTFS  431



>ref|XP_003550844.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=487

 Score =   477 bits (1228),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 230/466 (49%), Positives = 311/466 (67%), Gaps = 7/466 (2%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
             +AS   G+GVNWGT A   L P+ +V+ML++N IDK+KLFD++ W +    GT IEV+  
Sbjct  22    MASCGSGVGVNWGTMATHKLPPNKVVKMLQENRIDKLKLFDAEEWIMAALMGTDIEVMLA  81

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPA  528
             IPNN LE  + +   A  WV  N++ +++ GG+ IK++AVGNEPFLK YNG++     PA
Sbjct  82    IPNNMLEEMSRNPQVADSWVYENVTGYMYPGGLNIKYIAVGNEPFLKEYNGAYLQSTLPA  141

Query  529   LKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDH  702
             LKNIQ AL+  G G++IK T+P NADVY S      PS G+FR ++RD  I+I ++L  +
Sbjct  142   LKNIQTALNSWGFGSQIKVTVPFNADVYYSPDSNQVPSAGDFRPEVRDQTIEIVQFLYAN  201

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAK  882
              APF VNIYPFLSLY N +FP +FAFFDG  + + D  + YTN+FDANLDTL+W+L K+ 
Sbjct  202   NAPFTVNIYPFLSLYGNDHFPFDFAFFDGSNRPLIDGNSAYTNVFDANLDTLLWALEKSG  261

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDE  1062
               D+ VIVGE+GWPTDG+KNAN++ A++F  G L+      GTP  KG+++ YLFSL DE
Sbjct  262   YPDIEVIVGEVGWPTDGDKNANVQNAKRFNMGLLKHALSGNGTPKRKGIIDIYLFSLVDE  321

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKD  1242
             NAKSIAPG FERHWGIF +DGKPK+ +D  G   +   V  + + Y+  QWC+LD+  KD
Sbjct  322   NAKSIAPGNFERHWGIFEFDGKPKYELDLRGLEENNGLVPVEGIRYMEKQWCILDSNVKD  381

Query  1243  SHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAK  1422
              H +  ++ YACS SDC+AL  G+SCN L +   ASYAFNMY+Q+NNQ    C+F GLA 
Sbjct  382   LHNLAESIDYACSKSDCTALGYGSSCNSLSLQGNASYAFNMYYQVNNQKDWDCDFSGLAT  441

Query  1423  IVKHNASTNGCLFPVALESAAT-----RSGGITAVFAGIFFFCLAL  1545
             +   + S  GC FP+ +   ++     R   I     GI+ F + L
Sbjct  442   VTDEDPSEKGCQFPIMISYGSSLLQQERLTNILKKALGIYIFVILL  487



>ref|XP_010528719.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=493

 Score =   477 bits (1228),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 304/432 (70%), Gaps = 5/432 (1%)
 Frame = +1

Query  178   PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPN  357
             P +GLGVNWGT A   L P  +VQMLKDN+I+KVKLFD++  T+   AG+GIEV+  IPN
Sbjct  26    PANGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMRALAGSGIEVMVAIPN  85

Query  358   NQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
             +QL R     D AK+WV+ N+S +  DGGV I +VAVGNEPFL +YNGSF +L FPAL+N
Sbjct  86    DQL-RVMGSYDRAKEWVQRNVSRYNFDGGVNITYVAVGNEPFLTSYNGSFVNLTFPALQN  144

Query  538   IQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +Q AL+EA LG+ +KAT+P NADVY S      PS G FR DI   M +I  +L  + AP
Sbjct  145   VQNALNEARLGH-VKATVPLNADVYDSPANNQVPSAGRFRPDIISQMTEIVDFLGKNNAP  203

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F +NIYPFLSLY + +FP ++AFFDG  + V D G  Y N+FDAN DTL+ +L+    GD
Sbjct  204   FTINIYPFLSLYGSSDFPFDYAFFDGPTQIV-DNGIQYNNVFDANFDTLVSALKAIGHGD  262

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             + +IVGE+GWPTDG+KNAN   A ++Y G L ++A  +GTP+  G +E YLF L DE+AK
Sbjct  263   MPIIVGEVGWPTDGDKNANTGNALRYYNGLLPRLAANKGTPLRPGYIEVYLFGLLDEDAK  322

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHA  1251
             SIAPG FERHWGI  +DG+PKFP+D  G+G ++  +GA+NV YL  +WC+ + E KD   
Sbjct  323   SIAPGNFERHWGIVRFDGQPKFPLDLLGQGQNKFLIGAQNVKYLQNKWCMFNPEAKDISK  382

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             +  N+ YAC+ SDC+AL  G+SCN LD    ASYAFNMYFQ+ NQ+ +AC F+GLA I  
Sbjct  383   LAENVDYACTHSDCTALGFGSSCNSLDAHGNASYAFNMYFQVRNQEEDACFFQGLATITT  442

Query  1432  HNASTNGCLFPV  1467
              N S   C FP+
Sbjct  443   QNISQGQCDFPI  454



>ref|XP_010669627.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Beta vulgaris 
subsp. vulgaris]
Length=488

 Score =   477 bits (1227),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 237/476 (50%), Positives = 317/476 (67%), Gaps = 12/476 (3%)
 Frame = +1

Query  142   IWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             IW    +I + +PV+G+G NWGTQ++  L+P+++V+ML++N I KVKLFD+ + T++   
Sbjct  18    IW----LISMINPVNGIGANWGTQSSHPLSPAVVVRMLRENRIQKVKLFDAAYDTLHALG  73

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
              TGIEV+ GIPN+ L   A     A+ WV  NI+ HI +  V I++VAVGNEPFL  YNG
Sbjct  74    STGIEVMVGIPNDMLSTLATSSRAAEKWVSENITEHISNNKVNIRYVAVGNEPFLATYNG  133

Query  502   SFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKI  681
             SF    FPAL+NIQ AL  AG GN++K T+P NADVYAS +  PS G+FRSDI D MI+I
Sbjct  134   SFLRTTFPALQNIQNALLRAGHGNQVKVTVPSNADVYASPSSMPSGGDFRSDINDYMIQI  193

Query  682   CRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLI  861
              ++L D+ APF VNIYPF+SLY + NFPVE+AFFDG A  ++D G  Y NMFDAN DTLI
Sbjct  194   VKFLSDNGAPFTVNIYPFISLYTDANFPVEYAFFDGNATPLNDGGTNYYNMFDANYDTLI  253

Query  862   WSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFY  1041
             W+L+K   G++ +IVGEIGWPTDG+ NAN+K A++F +GF+  +A  +GTP+  G ++ Y
Sbjct  254   WALQKNGFGNMPIIVGEIGWPTDGDMNANVKFAQRFNQGFMSHIANGKGTPMRAGPIDAY  313

Query  1042  LFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCV  1221
             LFSL DE+ KSI PG FERHWGIF +DG PK+ ++  G  N    V AK V Y   QWCV
Sbjct  314   LFSLIDEDQKSIQPGNFERHWGIFTFDGLPKYQLNL-GTTNLGTLVKAKGVTYEQRQWCV  372

Query  1222  LDNEQK-DSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             L    K D   +  ++ YAC+ +DC++L  G SC  LD+    SYAFN Y+QIN+Q  EA
Sbjct  373   LKPSVKLDDSRLAPSVSYACARADCTSLGYGTSCGSLDIQGNVSYAFNSYYQINDQVDEA  432

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALESAATRSG------GITAVFAGIFFFCLALL  1548
             C F+GLA + K + S + C F + +E   + S       GI + F       L + 
Sbjct  433   CKFDGLAAVTKSDPSRDSCRFEIMIEPEESGSEQMLHVPGILSCFISTIVLYLTMF  488



>gb|KFK26060.1| hypothetical protein AALP_AA8G198000 [Arabis alpina]
Length=484

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 308/445 (69%), Gaps = 10/445 (2%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
             A+  L+  V  LGVNWGT +   L P  +V+MLKDN++ KVKLFD+D  T+   AG+GIE
Sbjct  17    ALSFLSGDVSALGVNWGTMSTHQLPPKTVVEMLKDNNVQKVKLFDADTNTMVALAGSGIE  76

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN+QL+   +    AKDWV+ NI+    +  VKIK+VAVGNEPFL +YNG+F ++
Sbjct  77    VMVAIPNDQLKAMGN-YSRAKDWVRRNITRF--NDSVKIKYVAVGNEPFLTSYNGTFINV  133

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRY  690
              +PAL NIQKAL+EAG+G+ IKAT+P NADVY S    P  S G FR DI + M  I  +
Sbjct  134   TYPALFNIQKALNEAGVGDFIKATVPLNADVYNSPPDNPVPSAGRFRQDIFEEMKLIVNF  193

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSL  870
             L  ++APF VNIYPFLSLY + +FP ++AFF+ +  +V+D G  YTN+FDAN DTL+ SL
Sbjct  194   LAQNKAPFTVNIYPFLSLYLSSDFPFDYAFFNSQ-NTVNDNGLVYTNVFDANFDTLLASL  252

Query  871   RKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFS  1050
             R    GD+ VIVGE+GWPTDG+KNAN+  AE+FY G L K+A   GTP   G ++ YLF 
Sbjct  253   RALGHGDLTVIVGEVGWPTDGDKNANIANAERFYTGLLPKLAANRGTPARPGYIQVYLFG  312

Query  1051  LTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-  1227
               DE+AKSIAPG FERHWGIF YDG+PKFP D +G G  +   GA+NV YL  QWC+L+ 
Sbjct  313   FIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGQKKSLNGAQNVQYLQNQWCMLNP  372

Query  1228  ---NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
                +    ++ +G N+ YAC+ SDC+AL  G+SC +LD    ASYAFNMYFQ+ NQ  EA
Sbjct  373   NGHSFSNSTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEA  432

Query  1399  CNFEGLAKIVKHNASTNGCLFPVAL  1473
             C+FEGLA I   N S   C FP+ +
Sbjct  433   CDFEGLAMITTRNISREQCNFPIQI  457



>gb|KHN46790.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=436

 Score =   474 bits (1219),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 235/435 (54%), Positives = 304/435 (70%), Gaps = 4/435 (1%)
 Frame = +1

Query  250   MLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSH  429
             MLKDN I KVKLFDSD  T++  AGTGIEV+  IPNNQL    +D   AK WVK N++ +
Sbjct  1     MLKDNGIKKVKLFDSDDSTMSALAGTGIEVMVAIPNNQLAEM-NDYGRAKQWVKKNVTRY  59

Query  430   IHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADV  609
               +GGV +K+VAVGNEPFLK+YN SF ++  PAL+NIQ AL+EAGLG+KIKAT+P NADV
Sbjct  60    NFNGGVNVKYVAVGNEPFLKSYNNSFLNITLPALQNIQNALNEAGLGDKIKATVPLNADV  119

Query  610   YASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFF  783
             Y S    P  S G FR DI  LM +I ++L  + APF VNIYPFLSLY N +FP  +AFF
Sbjct  120   YQSPESNPVPSAGIFRPDISGLMTQIVQFLSKNGAPFTVNIYPFLSLYGNDDFPFNYAFF  179

Query  784   DGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAE  963
             DG    V+D G  YTN+FDAN DTL+ +L+    GD+ ++VGE+GWPT+G+KNAN   A 
Sbjct  180   DGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFGDLPILVGEVGWPTEGDKNANAGNAL  239

Query  964   KFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPI  1143
             +FY G L ++A   GTP   G +E YLF L DE+AKSIAPG FERHWGIF YDG+PKFP+
Sbjct  240   RFYNGLLPRLAANRGTPRRPGYIEVYLFGLIDEDAKSIAPGNFERHWGIFRYDGQPKFPM  299

Query  1144  DFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCN  1323
             D +G+  ++  +GA+NV YL  +WC+ + + KD   +  N+ YAC+  DC+AL  G+SCN
Sbjct  300   DLSGQNQNKFLIGAQNVKYLAPRWCMFNPDAKDLSKLPDNINYACTFGDCTALGYGSSCN  359

Query  1324  DLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGI  1503
             +LD    ASYAFNMYFQ+ NQ+  ACNF+GLAK+   N ST  C F V + +++  S  +
Sbjct  360   NLDANGNASYAFNMYFQVQNQNPMACNFQGLAKLTTDNISTPTCNFIVQIVNSSASSLMM  419

Query  1504  TAVFAGIFFFCLALL  1548
              ++ A I F  L L+
Sbjct  420   PSLVA-ILFVSLFLI  433



>ref|XP_010257791.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Nelumbo nucifera]
Length=481

 Score =   475 bits (1222),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 227/446 (51%), Positives = 314/446 (70%), Gaps = 6/446 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+GVNWGT A   L P ++V+ML+ N  DKVKLF++    +    GT IEV+  IPNN
Sbjct  20    VGGVGVNWGTMATHHLPPEMVVEMLRVNGFDKVKLFEAHEGILRALIGTDIEVMLAIPNN  79

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L+   D  D A +W++ N++S++++GGV IK+VAVGNEPFL++YNG+F  +  PAL+NI
Sbjct  80    MLQDMVDP-DLAANWIEENVTSYLNNGGVNIKYVAVGNEPFLRSYNGTFLKVTLPALRNI  138

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPF  714
             Q+ALD+AGLG++IKAT+P NAD+Y S    P  S G+FR +IRD+++++  +L ++ APF
Sbjct  139   QRALDDAGLGSRIKATVPFNADIYNSPASNPVPSAGDFRREIRDIVLEVVEFLYNNNAPF  198

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPFLSLY +  FPV++AFFDG  K + D    YTN+FDANLDTL+WSL++A    +
Sbjct  199   TVNIYPFLSLYGDPYFPVDYAFFDGTKKPIKDGDVAYTNVFDANLDTLLWSLKRAGYPSM  258

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              ++VGE+GWPTDG+K+AN+K A++F +G LR +   +GTP+ +G +  YLFSL DENAKS
Sbjct  259   QIMVGEVGWPTDGDKHANIKNAKRFNQGLLRHVLSGKGTPMKRGRINVYLFSLLDENAKS  318

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAV  1254
             IAPG FERHWGIF +DGKPK+  D +G   ++  +GA+NV Y P +WCV++    D   +
Sbjct  319   IAPGNFERHWGIFEFDGKPKYEFDLSGHEENKGLIGAENVEYFPMRWCVMNPNADDLTEL  378

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
              SN  YACS SDC+AL  G+SCN LD+   ASY+FNM++Q NNQ    C+F GLA +   
Sbjct  379   SSNFQYACSFSDCTALGYGSSCNHLDVRGNASYSFNMFYQWNNQRNWDCDFSGLAVVTDV  438

Query  1435  NASTNGCLFPVALE---SAATRSGGI  1503
             + S   C FP+ +    S + R G I
Sbjct  439   DPSVGECRFPIMIAYGFSVSLRRGVI  464



>ref|XP_010088872.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB37069.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=490

 Score =   475 bits (1222),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 235/491 (48%), Positives = 328/491 (67%), Gaps = 5/491 (1%)
 Frame = +1

Query  88    LQRNHTMPQPVVGGVRLAIWTGFAVIL-LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDN  264
             ++R   +PQ ++G   L++   F V+L +      +GVNWGT A+  L P  +V+M+K+N
Sbjct  1     MERPRKVPQLILGSNNLSLAVSFLVLLTMVCSCSSVGVNWGTIASHKLPPGKVVKMMKEN  60

Query  265   HIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGG  444
                KVKLF++D W +    GT IEV+ GIPN  L+  +++   A DWV+AN++ +++ GG
Sbjct  61    GFTKVKLFEADEWILEALMGTNIEVMVGIPNIMLQEISENPKVAADWVEANVTDYLYTGG  120

Query  445   VKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGT  624
             V IK+VAVGNEPFL+AYNGS+    FPALKNIQ+AL++ G+G+K+KAT+P NADVY S  
Sbjct  121   VHIKYVAVGNEPFLEAYNGSYTHTTFPALKNIQQALNDQGVGSKVKATVPFNADVYFSPD  180

Query  625   GGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDG-RA  795
               P  S G+FR  +RD+ I+I +YL  + APF VNIYPFLSLY N  FP++FAFFDG   
Sbjct  181   SNPVPSAGDFRPQVRDITIEIIQYLHANDAPFTVNIYPFLSLYSNDYFPLDFAFFDGTNY  240

Query  796   KSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYK  975
             K V D    Y N+FDAN DTL+ ++ KA   D+ +IVGE+GWPTDG+++AN+K A++F +
Sbjct  241   KPVRDGDRVYNNVFDANFDTLVEAINKAGFPDMKIIVGEVGWPTDGDRHANVKNAKRFNQ  300

Query  976   GFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTG  1155
             G L+      GTP  KG +E YLFSL DE+AKSI PG FERHWGI+ YDGKPK+ +D +G
Sbjct  301   GMLQHALSGNGTPAQKGKIEVYLFSLIDEDAKSIEPGNFERHWGIYEYDGKPKYELDLSG  360

Query  1156  RGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDM  1335
                ++  V    V Y+  +WCVL+ + +    +  ++ YACS+SDC+AL  G+SCN+L  
Sbjct  361   SKRNKGLVAVDGVEYMLKRWCVLNPDAEYLDDLPDSIDYACSLSDCTALGFGSSCNNLSA  420

Query  1336  PSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVF  1515
                ASYAFNMY+Q+N Q+  +C+F GLA +   + S   C FPV + S   + G     F
Sbjct  421   QGNASYAFNMYYQVNGQNSRSCDFSGLAVVSDKDPSVGDCQFPVMI-SRGGQMGFSLLRF  479

Query  1516  AGIFFFCLALL  1548
              G+F F + LL
Sbjct  480   FGVFVFLVILL  490



>gb|ABK25447.1| unknown [Picea sitchensis]
Length=477

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 230/459 (50%), Positives = 310/459 (68%), Gaps = 5/459 (1%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               + +L   V GLGVNWGT A   L+P I+VQMLKDN I KVKLFD++  T+   A TGI
Sbjct  8     LVMFVLVGWVQGLGVNWGTMATHPLSPDIVVQMLKDNGITKVKLFDAEEHTMKALANTGI  67

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             +V+ GIPN+QL+  A    +A +WV+ N++    DG V I+ VAVGNEPFL++YNG+F  
Sbjct  68    QVMVGIPNDQLQMIATSTKDAANWVETNVTEFNLDGSVDIRFVAVGNEPFLESYNGTFIQ  127

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
               FPAL+NIQ AL++AGL N IKAT+P NADVY      PSEG FR+DI DLMI+IC++L
Sbjct  128   YTFPALQNIQNALNKAGLSN-IKATVPLNADVYEGVV--PSEGQFRTDINDLMIQICQFL  184

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
               + APF VNIYPFLSLY N+NFPV+FAFFDG  + + D    YTN+FDA LDTL W+L+
Sbjct  185   ASNGAPFTVNIYPFLSLYSNENFPVDFAFFDGTGQPLIDGNVQYTNVFDAALDTLFWALK  244

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             K+   ++ V+VGE+GWPTDG+K+ N+  A++F +G L+ +    GTP+     E YLFSL
Sbjct  245   KSGFPNLPVLVGEVGWPTDGDKHGNINFAQRFNQGLLKNIMSGLGTPMRFKAAETYLFSL  304

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+AKSIAPG FERHWGIF YDG PK+ +D +G+  ++  V AK V YLP +WCV++  
Sbjct  305   VDEDAKSIAPGNFERHWGIFQYDGTPKYALDLSGQAQNKALVSAKGVKYLPRRWCVINLS  364

Query  1234  QKDS--HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
                +    +  ++ YAC+  DC++L  G+SCN L+    ASYAFN Y+Q NNQ    C F
Sbjct  365   ASSTALTQLSDSITYACTHGDCTSLGYGSSCNSLNYQGNASYAFNAYYQANNQQNGDCVF  424

Query  1408  EGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGI  1524
              GLA + + + S   C F + +  +AT     + +++ I
Sbjct  425   SGLAVVTQTDPSQGACKFEIQIAVSATSKAMNSCIYSLI  463



>gb|ACG29689.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=485

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 300/440 (68%), Gaps = 4/440 (1%)
 Frame = +1

Query  178   PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPN  357
             P   LGVNWGTQA   L P  +VQ+L+DN I KVKLFD+D   +   AGTGIEV+  IPN
Sbjct  17    PATALGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPN  76

Query  358   NQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
               L   A D   A+DWVK N+  +  DGGV IK+VAVGNEPFL++YNGSF ++  PAL+N
Sbjct  77    AMLAGLAADAGQARDWVKRNVRRYDFDGGVTIKYVAVGNEPFLESYNGSFINVTLPALQN  136

Query  538   IQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +Q AL++AG+G++IKAT+P NADVY S      PS G FR+DI  LM  + R+L  + AP
Sbjct  137   VQNALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAP  196

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F VNIYPFLSLY N++FP+++AFFDG A  V D G  YTN+FDAN DTL+ +L     GD
Sbjct  197   FTVNIYPFLSLYLNEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGD  256

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV--VEFYLFSLTDEN  1065
             + V+VGE+GWPTDG+++A    A++FY G LR++A   GTP   G    E YLF L DE+
Sbjct  257   MPVVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANAGTPARPGQRPAEVYLFGLVDED  316

Query  1066  AKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDS  1245
             AKS+APG FERHWG+  YDG+PKF +D TG+G D   V A+ V YL   WC L+   KD 
Sbjct  317   AKSVAPGNFERHWGVLRYDGQPKFAMDLTGQGRDTTLVPARGVAYLSRTWCALNPRAKDL  376

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKI  1425
               +G+N+ YAC+ +DC+ L  G++C  +D+   ASYAFN Y+Q  NQ  EAC+F+GLA  
Sbjct  377   GRLGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLALP  436

Query  1426  VKHNASTNGCLFPVALESAA  1485
              + + ST  C F + +++ A
Sbjct  437   TETDPSTATCNFTIQIQTGA  456



>emb|CDM83452.1| unnamed protein product [Triticum aestivum]
Length=485

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/468 (51%), Positives = 313/468 (67%), Gaps = 6/468 (1%)
 Frame = +1

Query  157   AVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIE  336
             AV+ L + V GLGVNWGT A+  L PS +VQML+DN I KVKLFD+D   +   A +GIE
Sbjct  16    AVVGLPAAV-GLGVNWGTMASHQLPPSTVVQMLQDNGIKKVKLFDADAEPLGALARSGIE  74

Query  337   VLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDL  516
             V+  IPN  L+   D  D A++WV  N+S++   GGV I++VAVGNEPFL + NG+F ++
Sbjct  75    VMVAIPNKMLDMMTD-YDTAREWVHKNVSAYNFGGGVNIRYVAVGNEPFLSSLNGTFLNV  133

Query  517   VFPALKNIQKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIRDLMIKICRY  690
               PAL+NIQKALDEAG+G+ IKAT+P NADVY S   T  PS G FR +I  LM +I ++
Sbjct  134   TLPALQNIQKALDEAGVGDTIKATVPLNADVYQSPKDTPVPSAGRFRPEISGLMTEIVQF  193

Query  691   LRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSL  870
             L    APF VNIYP+LSLY N +FP++FAFFDG +  V D    YTN+FDAN DTL+ +L
Sbjct  194   LNQSGAPFTVNIYPYLSLYGNDDFPLDFAFFDGASSPVVDGNIQYTNVFDANFDTLVSAL  253

Query  871   RKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLF  1047
               A  G + VIVGE+GWPTDG K+A    A++FY G  RK+A   GTP+     +E YLF
Sbjct  254   TAAGVGGLPVIVGEVGWPTDGEKHATAAYAQRFYTGLFRKLASNAGTPLRPNQYIEIYLF  313

Query  1048  SLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD  1227
             SL DE+ KSI PG FERHWG+  YDG+PK+ +D TG+G +   VGA+ V YLP  WCVL+
Sbjct  314   SLIDEDVKSIDPGYFERHWGVMRYDGQPKYAMDPTGQGRNTALVGARGVEYLPRVWCVLN  373

Query  1228  NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
                 +   +  N+GYACS +DC++L  G++CN +D    ASYAFN YFQ+ +QD +AC F
Sbjct  374   ANAGNMSRLADNVGYACSNADCTSLSLGSTCNGMDPAGNASYAFNAYFQVQDQDEQACGF  433

Query  1408  EGLAKIVKHNASTNGCLFPVALESAATRSGGITAVF-AGIFFFCLALL  1548
             +GLA   + + ST  C F + LE+ +  +G  T +F   +    LA +
Sbjct  434   DGLAVRTRQDPSTGTCNFTIQLETTSAAAGRPTVLFTTALLVLVLAAM  481



>ref|XP_003559620.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=492

 Score =   473 bits (1218),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 234/441 (53%), Positives = 304/441 (69%), Gaps = 8/441 (2%)
 Frame = +1

Query  178   PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPN  357
             P   LGVNWGT A+  L PS +V+ML+DN I KVKLFD+D   +   AG+GIEV+  IPN
Sbjct  26    PAGALGVNWGTMASHQLPPSSVVRMLQDNGIKKVKLFDADAGPLEALAGSGIEVMVAIPN  85

Query  358   NQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
               L+   D  D A+DWV  N+S++  DGGV IK+VAVGNEPFL + NG+F ++ FPAL+N
Sbjct  86    IMLDMMTD-YDTARDWVHKNVSAYNFDGGVNIKYVAVGNEPFLSSLNGTFLNVTFPALQN  144

Query  538   IQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAP  711
             IQ+AL+EAG+G+ +KAT+P NADVY S      PS G FR++I  LM +I ++L    AP
Sbjct  145   IQRALNEAGVGDTVKATVPLNADVYESPKDNPVPSAGRFRAEISGLMTEIVQFLNQSGAP  204

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWSLRKAKC  885
             F VNIYP+LSLY N  FP++FAFFDG    V D   G +YTN+FDAN DTL+ +L  A  
Sbjct  205   FTVNIYPYLSLYGNAGFPLDFAFFDGTTSPVVDTNSGISYTNVFDANFDTLVSALNAAGV  264

Query  886   GDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTDE  1062
             G + V+VGE+GWPTDG+K A    A++FY G L+K+A   GTP+     VE YLFSL DE
Sbjct  265   GGLPVMVGEVGWPTDGDKQATAAYAQRFYAGLLKKLASNAGTPLRANQYVEVYLFSLIDE  324

Query  1063  NAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQK  1239
             + KS+APG FERHWGI  YDG+PK+ +D TG+G +   VGA+ V YLP  WCVL+ N   
Sbjct  325   DVKSVAPGNFERHWGIMRYDGQPKYAMDLTGQGRNTALVGARGVEYLPRAWCVLNANAPA  384

Query  1240  DSHA-VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
             +S + +G N+ YACS +DC+AL  G++C  LD    ASYAFN YFQ+ NQ+VEAC F+GL
Sbjct  385   ESMSRLGDNVDYACSNADCTALSYGSTCGGLDAAGNASYAFNAYFQVQNQEVEACGFQGL  444

Query  1417  AKIVKHNASTNGCLFPVALES  1479
             A     + ST  C F + +E+
Sbjct  445   AASTTQDPSTGTCNFSIQIET  465



>gb|KDO55074.1| hypothetical protein CISIN_1g048257mg [Citrus sinensis]
Length=510

 Score =   474 bits (1219),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/454 (52%), Positives = 321/454 (71%), Gaps = 11/454 (2%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             +R+ ++ G    +L   V+GLGVNWGT A+  L P   V++LKDN I KVKLFD+D+  +
Sbjct  8     LRIILFVG----VLGCRVNGLGVNWGTVASHQLPPKTTVKLLKDNGILKVKLFDADNTIL  63

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
             +  AGT IEV+  + N +L+   D  D AK+WVKAN++ + + GGV IK VAVGNEPFLK
Sbjct  64    DALAGTDIEVMLAVSNQELKTMTD-FDKAKEWVKANVTKYTNKGGVNIKFVAVGNEPFLK  122

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             AYNGS  +  FPALKNIQ AL++AG+G+ IKAT+P NADVY S    P  S G FR+DI 
Sbjct  123   AYNGSHINTTFPALKNIQNALNDAGVGDTIKATVPFNADVYDSPDKNPYPSAGKFRTDIF  182

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDK--GATYTNMF  837
               M +I  +L +++APF+VNIYPFLSLY N +FPV++AFFDG  KS+ D   G  YT++F
Sbjct  183   ATMKEIVDFLAENKAPFIVNIYPFLSLYGNDDFPVDYAFFDG-GKSIVDSVTGNKYTDVF  241

Query  838   DANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPV  1017
             DAN DT + +L+ A  GD+ V+VGEIGWPTDG+K AN   A ++Y G L K+A  +GTP+
Sbjct  242   DANYDTCVSALKAAGHGDMPVVVGEIGWPTDGDKMANTANAFRYYSGLLPKLAADKGTPL  301

Query  1018  HKG-VVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNV  1194
               G  +E Y+FSL DE++KSI PG FE+HWGIF YDG+PKFP+DF+G+G ++  VGAK+V
Sbjct  302   RPGSYIEVYMFSLFDEDSKSIDPGNFEKHWGIFTYDGQPKFPMDFSGKGENKTLVGAKDV  361

Query  1195  PYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQ  1374
              YLP +WC ++ +  D+  +   + +AC+ SDC++L  G+SCN LD   + SYAFNMY+Q
Sbjct  362   KYLPKKWCTVNPDATDTSKLAEKMQFACNKSDCTSLGFGSSCNKLDGNGKVSYAFNMYYQ  421

Query  1375  INNQDVEACNFEGLAKIVKHNASTNGCLFPVALE  1476
             +NNQD  AC+F+GL K+   N S   C F + LE
Sbjct  422   MNNQDDRACDFQGLGKVTTENISQGTCNFLIQLE  455



>ref|XP_008787369.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Phoenix dactylifera]
Length=466

 Score =   472 bits (1215),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 312/458 (68%), Gaps = 8/458 (2%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
             +G+GVNWG  A   L   ++V+ML DN  DKVKLFD+D  ++   AGT IEV+  IPN  
Sbjct  6     NGVGVNWGKMATHQLPSDMVVKMLLDNGFDKVKLFDADADSLTALAGTDIEVMVAIPNYM  65

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             LE  + +   A DWV  N++S  + GGV I++VAVGNEPFL+ Y G + +L  PAL NIQ
Sbjct  66    LEGLSSNPQAAVDWVDENVTSWNYTGGVNIRYVAVGNEPFLQTYKGIYDELTLPALVNIQ  125

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFM  717
             KALD+AG+G +IKAT+P NAD+Y S    P  S G+FRSDIRDL I+I ++L ++ APF+
Sbjct  126   KALDDAGVGGRIKATVPFNADIYDSPGSAPIPSAGDFRSDIRDLAIQIIQFLSENDAPFV  185

Query  718   VNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVN  897
             VNIYPFLS+  +++FP++FAFF+G  +S+ D  A YTN+FDAN DTL+WSL+KA   D+ 
Sbjct  186   VNIYPFLSVVGDQHFPMDFAFFEGTNRSIKDGDAVYTNVFDANFDTLVWSLKKAGYPDMP  245

Query  898   VIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSI  1077
             +IVGE+GWPTDG++NAN++MAE F +G LR +   +GTP  KG ++ YLFSL DE+AKSI
Sbjct  246   IIVGEVGWPTDGDRNANIEMAEDFNQGLLRHLMSSKGTPARKGSIDVYLFSLIDEDAKSI  305

Query  1078  APGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVG  1257
             APG FERHWGIF YDGKPK+ ++ +G   D   V A  V YL  +WC++D +  D  ++ 
Sbjct  306   APGNFERHWGIFEYDGKPKYGLNLSGHEEDMNLVSAHGVKYLERRWCIIDPDATDLASLP  365

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              ++ +AC+ SDC++L  G+SCN LD+   ASYAFNMY+Q+ NQ    C+F  LA I   +
Sbjct  366   RSMDFACTFSDCTSLSYGSSCNHLDLCGNASYAFNMYYQVRNQKAGDCDFSDLAMITDRD  425

Query  1438  ASTNGCLFPVALESAATRSGGI------TAVFAGIFFF  1533
              S   C FPV +   +  +  I       A+  GI  F
Sbjct  426   PSDEKCRFPVMIAYGSVAAPEIRVLDLLAAILGGISTF  463



>ref|NP_001130924.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF79312.1| unknown [Zea mays]
 gb|ACG29657.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 tpg|DAA42581.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=486

 Score =   473 bits (1216),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 300/440 (68%), Gaps = 4/440 (1%)
 Frame = +1

Query  178   PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPN  357
             P   LGVNWGTQA   L P  +VQ+L+DN I KVKLFD+D   +   AGTGIEV+  IPN
Sbjct  18    PATALGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPN  77

Query  358   NQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
               L   A D   A++WVK N+  +  DGGV IK+VAVGNEPFL++YNGSF ++  PALKN
Sbjct  78    AMLAGLAADAGQARNWVKHNVRRYDFDGGVTIKYVAVGNEPFLESYNGSFINVTLPALKN  137

Query  538   IQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRAP  711
             +Q AL++AG+G++IKAT+P NADVY S      PS G FR+DI  LM  + R+L  + AP
Sbjct  138   VQNALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAP  197

Query  712   FMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
             F VNIYPFLSLY N++FP+++AFFDG A  V D G  YTN+FDAN DTL+ +L     GD
Sbjct  198   FTVNIYPFLSLYLNEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGD  257

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV--VEFYLFSLTDEN  1065
             + V+VGE+GWPTDG+++A    A++FY G LR++A   GTP   G    E YLF L DE+
Sbjct  258   MPVVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANTGTPARPGQRPAEVYLFGLVDED  317

Query  1066  AKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDS  1245
             AKS+APG FERHWG+  YDG+PKF +D TG+G D   V A+ V YL   WC L+   KD 
Sbjct  318   AKSVAPGNFERHWGVLRYDGQPKFAMDLTGQGRDTTLVPARGVAYLSRTWCALNPRAKDL  377

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKI  1425
               +G+N+ YAC+ +DC+ L  G++C  +D+   ASYAFN Y+Q  NQ  EAC+F+GLA  
Sbjct  378   GRLGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLALP  437

Query  1426  VKHNASTNGCLFPVALESAA  1485
              + + ST  C F + +++ A
Sbjct  438   TETDPSTATCNFTIQIQTGA  457



>ref|XP_008386810.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=488

 Score =   473 bits (1217),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 221/434 (51%), Positives = 303/434 (70%), Gaps = 5/434 (1%)
 Frame = +1

Query  199   NWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLERFA  378
             NWGT A   L P  ++Q+LKDN I KVKLFD+D  T++   G+G+EV+  IPN+QL    
Sbjct  29    NWGTMATHELPPDTVIQILKDNGIPKVKLFDADESTMSALTGSGLEVMVAIPNDQLAVMT  88

Query  379   DDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKALDE  558
                  AK+WV+ N++ +  +GGV IK+VAVGNEPFL +YNGSF ++ FPAL+NIQ AL+E
Sbjct  89    S-YKRAKEWVRRNVTRYNFNGGVNIKYVAVGNEPFLSSYNGSFLNVTFPALQNIQNALNE  147

Query  559   AGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVNIYP  732
             AG+G+ +KAT+P NADVY S    P  S G FR+DI  LM +I ++L  ++APF +NIYP
Sbjct  148   AGVGDSVKATVPLNADVYDSPVDNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINIYP  207

Query  733   FLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMFDANLDTLIWSLRKAKCGDVNVIV  906
             FLSLY N  FP  +AFFDG    + D G    YTN+FDAN DTL+ SL+    G++ ++V
Sbjct  208   FLSLYGNDGFPFNYAFFDGDTTPIVDTGTGIQYTNVFDANFDTLVSSLKAVGFGNMPIVV  267

Query  907   GEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAPG  1086
             GE+GWPTDG+KNAN+  A +FY G L ++   +GTP+  G +E YLF L DE+AKSIAPG
Sbjct  268   GEVGWPTDGDKNANVGNAFRFYNGLLTRLGTNKGTPLRTGYIEVYLFGLIDEDAKSIAPG  327

Query  1087  EFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSNL  1266
              FERHWGIF YDG+PKFP+D +G+G +++ V AKNV YL  +WC+ +   KD   +   +
Sbjct  328   SFERHWGIFSYDGQPKFPVDLSGQGQNKLLVPAKNVLYLSKKWCMXNPNAKDVSNLADKI  387

Query  1267  GYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAST  1446
              YAC+ +DC+AL  G+SCN+LD    ASYAFNMY+Q+ +QD ++C+F+GLA +   N S 
Sbjct  388   NYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQDQDDQSCSFQGLATLTTQNISQ  447

Query  1447  NGCLFPVALESAAT  1488
               C F + + + ++
Sbjct  448   GNCNFIIQMATTSS  461



>emb|CCH47219.1| similar to glucan endo-1,3-beta-glucosidase [Lupinus angustifolius]
Length=485

 Score =   473 bits (1216),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 221/441 (50%), Positives = 305/441 (69%), Gaps = 3/441 (1%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             V LL   V G+GVNWGTQ+   L PS +V+MLKDN I KVKLFD+D   ++    +GI+V
Sbjct  19    VALLLGSVSGIGVNWGTQSTHLLPPSTVVKMLKDNGIQKVKLFDADSSILDALKKSGIQV  78

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             + GIPN+ L   A+ +  A+ WV  NIS+H+  GGV I++VAVGNEPFL  YNG+F+   
Sbjct  79    MVGIPNDMLYMLANSVQAAEKWVSKNISAHVSSGGVDIRYVAVGNEPFLSTYNGTFESTT  138

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRD  699
              PAL+NIQ AL ++GLGN++K T+P NADVY S +  PS+GNFR DI DLM++I ++L  
Sbjct  139   LPALQNIQSALVKSGLGNQVKVTVPMNADVYLSASDKPSDGNFRPDIHDLMLQIVKFLSQ  198

Query  700   HRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKA  879
             + APF VNIYPF+SLY + NFPV+FAFF+G    ++D G  Y N+ DAN DTL+W+L+K 
Sbjct  199   NNAPFTVNIYPFISLYSDANFPVDFAFFNGFQSPINDNGRIYDNVLDANHDTLVWALQKN  258

Query  880   KCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTD  1059
               G++ ++VGEIGWPTDG+ NAN++ A++F +GF+ +    +GTP+  G ++ YLFSL D
Sbjct  259   GFGNLPIVVGEIGWPTDGDHNANLQYAQRFNQGFMSRFVAGKGTPMRPGPIDAYLFSLID  318

Query  1060  ENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQ  1236
             E+ KSI PG FERHWG+F YDGKPK+P++   R N    VGA  V YLP +WC+L  +  
Sbjct  319   EDDKSIQPGNFERHWGLFYYDGKPKYPLNLGTRTNGL--VGASGVAYLPKKWCILQPSAN  376

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
              +S  V  ++ YAC  +DC++L  G SC  LD+    SYAFN Y+Q+N+Q   AC F GL
Sbjct  377   LNSDQVAPSVSYACQNADCTSLGYGTSCGGLDVRGNLSYAFNSYYQVNDQMDSACKFPGL  436

Query  1417  AKIVKHNASTNGCLFPVALES  1479
             + +   + ST  C F + +++
Sbjct  437   SVVTDKDPSTPSCKFIIMIQT  457



>gb|KDO67128.1| hypothetical protein CISIN_1g010789mg [Citrus sinensis]
Length=501

 Score =   473 bits (1216),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 307/441 (70%), Gaps = 3/441 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+GVNWGTQA   L PS +V+MLKDN ID+VKLFD+D   +N  A +GI+V+ GIPN 
Sbjct  41    VSGIGVNWGTQATHPLPPSTVVRMLKDNGIDRVKLFDADSKYLNALANSGIQVMVGIPNE  100

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A  +  A++WV  N+SSH+   GV I++VAVGNEPFL  +NG+F     PAL+NI
Sbjct  101   MLSTLASSVQAAENWVAKNVSSHVSSNGVDIRYVAVGNEPFLPTFNGTFIGTTLPALQNI  160

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q AL +AGLG +IK T+P NADVY S +  PSEG+FR+DI DLM++I ++L D+  PF V
Sbjct  161   QAALIKAGLGTRIKVTVPLNADVYQSQSNLPSEGDFRTDIHDLMLQILKFLSDNGGPFTV  220

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY + +FP++FAFFD  +  ++D G  Y N+FDAN DTL+W+L+K   G++++
Sbjct  221   NIYPFISLYNDPSFPIDFAFFDSNSSPINDNGRVYENVFDANYDTLVWALQKNGFGNLSI  280

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGEIGWPTDG+KNAN+K A++F +GF+ ++   +GTP+  G ++ YLFSL DE+AKSI 
Sbjct  281   IVGEIGWPTDGDKNANLKFAQRFNQGFMSRVNAGKGTPMRSGAIDAYLFSLIDEDAKSIQ  340

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHAVG  1257
             PG FERHWG+  +DG+PK+ +   G G + + V AK+V YL  +WCV+  +   D   V 
Sbjct  341   PGNFERHWGLLYFDGQPKYQLSL-GNGRNGL-VAAKDVHYLAQKWCVMSPSASLDDPQVA  398

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
             +++ YAC  +DC++L  G SC +LD     SYAFN Y+QINNQ   AC F  L+ +   N
Sbjct  399   ASVSYACGNADCTSLGYGTSCGNLDSRGNISYAFNSYYQINNQLDSACRFPNLSAVTTTN  458

Query  1438  ASTNGCLFPVALESAATRSGG  1500
              ST  CLF + +++  T   G
Sbjct  459   PSTGDCLFRIMIKTDTTAGAG  479



>ref|XP_010688142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 220/436 (50%), Positives = 309/436 (71%), Gaps = 2/436 (0%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWGT A   L P ++VQMLK+N  DK+KLF++D   ++   GT IEV+  IPNN LE
Sbjct  28    VGVNWGTIATHQLPPEMVVQMLKNNGFDKLKLFEADDRILSALIGTQIEVMLAIPNNMLE  87

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               +  +D A  WV+AN++++ + GGV I +VAVGNEP L+ YNG++   + PALKNIQ+A
Sbjct  88    EMSSSVDAAVSWVEANVTTYYYSGGVNINYVAVGNEPTLQTYNGTYLKYMLPALKNIQEA  147

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
             L+ AG G++IKATIP NADVY S    P  S G+FR+++RDL ++I ++L ++ APF VN
Sbjct  148   LNHAGYGDQIKATIPFNADVYYSPDSNPVPSAGDFRAEVRDLTLEILQFLHENNAPFTVN  207

Query  724   IYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVI  903
             IYPFLSLY NKNFP+++AFF+G    + D+G  YTN+FDAN DTL+ +L KA   D+++I
Sbjct  208   IYPFLSLYGNKNFPIDYAFFEGSNVPIRDQGVVYTNVFDANFDTLVSALNKAGYPDMDII  267

Query  904   VGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAP  1083
             VGE+GWPTDG+  AN++ A++F +G L+ +   EGTP+ KG ++ YLFSL DENAKS+AP
Sbjct  268   VGEVGWPTDGDIYANVENAKRFNQGLLQHILSGEGTPLRKGKIDVYLFSLIDENAKSVAP  327

Query  1084  GEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSN  1263
             G FERHWGIF +DG PK+ +D  G   DR+ +  + V Y+  +WCVL+ +      +  N
Sbjct  328   GNFERHWGIFEFDGMPKYELDLAGMQEDRVLIPVEGVQYMVKRWCVLNPDATGLGNLADN  387

Query  1264  LGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAS  1443
             + YACS+SDC++L  G SCN L +   ASYAFNMY+QI +QD   C+F+GLA I   + S
Sbjct  388   INYACSLSDCTSLGYGCSCNHLSVQGNASYAFNMYYQIKSQDTWNCDFDGLAMITDQDPS  447

Query  1444  TNGCLFPVALESAATR  1491
              + C FP+ ++ ++ R
Sbjct  448   DSTCQFPIMIDYSSCR  463



>ref|XP_009376335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Pyrus x bretschneideri]
Length=500

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/464 (50%), Positives = 312/464 (67%), Gaps = 9/464 (2%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+G NWGTQA+  L P  +V++LKDN   +VKLFD+D+ T+N  A +GIEV+ GIPN+
Sbjct  38    VSGIGANWGTQASHPLPPDTVVRLLKDNGFQRVKLFDADYDTLNSLAKSGIEVMVGIPND  97

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A  +  A+ WV  N+S+HI    VKI++VAVGNEPFL  YNGSF    FPAL+N+
Sbjct  98    MLASLATSVKAAEKWVSKNVSAHISSNNVKIRYVAVGNEPFLSTYNGSFLRTTFPALQNV  157

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q AL +AGL N++K T+PQNADVYAS  G PS G+FR+DI D MI+I ++L D+  PF V
Sbjct  158   QSALIKAGLSNQVKVTVPQNADVYASSNGFPSGGDFRTDIHDYMIQIVKFLSDNGCPFTV  217

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY + NFPV++AFFDG A  + D  ATY NMFDAN DTL+W+L+K   G++ +
Sbjct  218   NIYPFISLYIDSNFPVDYAFFDGNASPITDGSATYYNMFDANYDTLVWTLQKNGFGNLPI  277

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGEIGWPTDG++NAN+  A++F +GF+  +    GTP+  G ++ YLFSL DE+AKSI 
Sbjct  278   IVGEIGWPTDGDRNANLVYAQRFNQGFMSHILGGRGTPMRPGPIDAYLFSLIDEDAKSID  337

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHAVG  1257
             PG FERHWGIF +DG  K+ ++  G  N    V AK V YL  +WCV+  +   D   V 
Sbjct  338   PGNFERHWGIFTFDGLAKYQLNL-GSTNSGALVPAKGVRYLERKWCVMKPSASLDDQQVA  396

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              ++ YAC ++DC++L  G SC +LD  +  SYA N Y+Q NNQ  EAC F  L+ I K N
Sbjct  397   LSVSYACGLADCTSLGYGTSCGNLDDRANISYAVNSYYQRNNQLDEACKFPNLSMITKTN  456

Query  1438  ASTNGCLFPVALE----SAATRSGGIT---AVFAGIFFFCLALL  1548
              S   C F + +E    +A  RSG +    ++ A + FF L L+
Sbjct  457   PSVGSCRFEIMIEPYYGAAERRSGHLQKPLSLVALLVFFMLTLV  500



>ref|XP_002530371.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32004.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=482

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 233/466 (50%), Positives = 313/466 (67%), Gaps = 9/466 (2%)
 Frame = +1

Query  175   SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIP  354
             S V G+G NWGTQA   L P  +V++L++N I KVKLFD+D+  +     +GIEV+ GIP
Sbjct  18    STVSGIGANWGTQATHPLPPDTVVRLLRENGIQKVKLFDADYDALRALGKSGIEVMVGIP  77

Query  355   NNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALK  534
             N+ L   A  +  A+ WV  N+S+HI    V I++VAVGNEPFL+ YNG+F    FPAL+
Sbjct  78    NDMLSSMAGSMKAAEKWVAKNVSTHITTNNVNIRYVAVGNEPFLETYNGTFLSTTFPALQ  137

Query  535   NIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             N+Q AL +AGL N++K T+P NADVYAS TG PS G+FR+DI DLMI I ++L D  +PF
Sbjct  138   NVQSALIKAGLSNQVKVTVPLNADVYASSTGFPSGGDFRTDIHDLMINIVKFLSDSGSPF  197

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDV  894
              VNIYPF+SLY + NFPVE+AFFDG A  V+D G +Y NMFDAN DTL ++L+K   G++
Sbjct  198   TVNIYPFISLYSDPNFPVEYAFFDGNAVPVNDGGTSYYNMFDANYDTLAYALQKNGFGNL  257

Query  895   NVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKS  1074
              +IVGEIGWPTDG+KNANM  A++F +GF+++++  +GTP+    ++ YLFSL DE+AKS
Sbjct  258   PIIVGEIGWPTDGDKNANMIYAQRFNQGFMQRISGGKGTPLRPEPIDAYLFSLIDEDAKS  317

Query  1075  IAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK-DSHA  1251
             I PG FERHWGIF +DG+ K+ ++  G  N R  V AKNV YL  +WCV+ +  K D   
Sbjct  318   IDPGNFERHWGIFTFDGRAKYTLNL-GTTNSRALVEAKNVRYLERKWCVMKSSAKLDDPN  376

Query  1252  VGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVK  1431
             V  ++ YAC + DC++L  G SC +LD     SYA N Y+QI NQ   AC FE ++ I K
Sbjct  377   VAPSVSYACGLGDCTSLGYGTSCGNLDARGNISYALNSYYQIQNQLDSACKFENISTITK  436

Query  1432  HNASTNGCLFPVALE---SAATRSGGI----TAVFAGIFFFCLALL  1548
              + ST  C F + +E     A R+ G       + AG+  F L +L
Sbjct  437   SDPSTETCKFEIMIEPYYGGAKRTVGCPHKPLVLAAGLILFFLTIL  482



>ref|XP_004498612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Cicer arietinum]
Length=481

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/465 (48%), Positives = 318/465 (68%), Gaps = 4/465 (1%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
             FA  LL  PV G+GVNWGTQ+   L PS +V+MLKDN I KVKLFD+D   +N    +GI
Sbjct  19    FAATLLVGPVCGIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADPDILNALKKSGI  78

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             +V+ GIPN+ L   A+ L  A+ WV  N+S+H+  GGV I++VAVGNEPFL  YNG+F+ 
Sbjct  79    QVMVGIPNDLLYTMANSLQAAEKWVSKNVSAHVSSGGVDIRYVAVGNEPFLSTYNGTFEA  138

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYL  693
                PALKNIQ AL +AGLGN ++ T+P NADVY S +  PS+G+FR+DI DLM++I ++L
Sbjct  139   TTLPALKNIQSALVKAGLGNSVRVTVPLNADVYQSSSDKPSDGDFRTDIHDLMLQIVKFL  198

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
               + APF VNIYPF+SLY + NFPV++AFF+G    + D G  Y N+FDAN DTL+W+L+
Sbjct  199   SQNNAPFAVNIYPFISLYADPNFPVDYAFFNGFGSPLTDNGNIYDNVFDANYDTLVWALQ  258

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             K   G++ +IVGEIGWPTDG++NAN+ +A++F +GF+ +    +GTP+  G ++ YLFSL
Sbjct  259   KNGFGNLPIIVGEIGWPTDGDRNANVLLAQRFNQGFMSRFVAGKGTPMRPGPIDAYLFSL  318

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-N  1230
              DE+ KSI PG FERHWG+F +DG+PK+ ++   R +    VGA  V +LP +WC+L  +
Sbjct  319   VDEDDKSIQPGNFERHWGLFYFDGRPKYQLNLGLRSSGL--VGATGVAHLPKKWCILKPS  376

Query  1231  EQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFE  1410
                +S  +  ++ YAC  +DC++L  G SC+ LD+    SYAFN Y+Q+N+Q   AC F 
Sbjct  377   ANLNSDQLAESVSYACQNADCTSLGYGTSCSGLDVRGNISYAFNSYYQVNDQIDSACKFP  436

Query  1411  GLAKIVKHNASTNGCLFPVALES-AATRSGGITAVFAGIFFFCLA  1542
             GL+ +   + ST  C+F + +++ +A R G +  V     F+ + 
Sbjct  437   GLSVVTDKDPSTPDCIFKIMIQTDSAGRIGSLRIVLFVFLFYIIV  481



>ref|XP_009418582.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 309/464 (67%), Gaps = 11/464 (2%)
 Frame = +1

Query  184   HGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQ  363
              G+G NWGTQA+  L PS +VQ+LKDN I K KLFD+D   ++  A +GI+V+ GIPN+ 
Sbjct  21    RGIGANWGTQASHPLPPSTVVQLLKDNGIQKAKLFDADDRVLSALANSGIQVMVGIPNDM  80

Query  364   LERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQ  543
             L   A D   A+ WV  N+S ++HDG V I+ VAVGNEPFL+ YNGSF    +PAL+NIQ
Sbjct  81    LASLASDHKAAERWVAKNVSDYVHDG-VDIRFVAVGNEPFLETYNGSFLQTTYPALQNIQ  139

Query  544   KALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
              ALD AGL N++K T+P NADVY S TG PS+G+FRS+I DLM+ I ++L D+ APF  N
Sbjct  140   AALDAAGLSNQVKTTVPLNADVYRSVTGKPSDGDFRSNIHDLMLSIVKFLSDNGAPFTAN  199

Query  724   IYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVI  903
             IYPF+SLYE+ NFPV++AFFDG +  + D   TYTN+FDAN DTL+ +L++   G+V++I
Sbjct  200   IYPFISLYEDPNFPVDYAFFDGYSSPIVDGSFTYTNVFDANHDTLVAALQRNGFGNVSII  259

Query  904   VGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAP  1083
             VGEIGWPTDGN NAN ++A++F +GF+  ++   GTP+  G ++ YLFSL DE+ KSI P
Sbjct  260   VGEIGWPTDGNMNANQQLAQRFNQGFMNHVSSGNGTPLRPGPIDAYLFSLVDEDEKSIQP  319

Query  1084  GEFERHWGIFGYDGKPKFPIDFTGR---------GNDRMPVGAKNVPYLPAQWCVLD-NE  1233
             G FERHWG+F YDG PK+ +D              N    VGAKN+ YL  +WCVL  + 
Sbjct  320   GNFERHWGVFAYDGSPKYELDLRSTTEAAAAAAVANSSSLVGAKNIKYLERKWCVLKPSV  379

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               D   +  ++ YAC  +DCS+L    +C+DLD     SYAFN Y+Q N+QD  AC F G
Sbjct  380   SLDDAEIAPSVSYACENADCSSLGYKTACSDLDAQGNISYAFNSYYQKNDQDNRACGFSG  439

Query  1414  LAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLAL  1545
             LA + + + ST+ C F + +++ A  S     +      +C+ L
Sbjct  440   LATVTEKDPSTSTCKFDIMIDAEAAESWKARTLTQLNLLWCIVL  483



>ref|XP_006474357.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like isoform X1 
[Citrus sinensis]
Length=480

 Score =   470 bits (1210),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 227/460 (49%), Positives = 307/460 (67%), Gaps = 5/460 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLG NWGTQA+  L P  +V +L+DN   K KLFD+D+ T+     +GIEV+ GIPN+
Sbjct  22    VSGLGANWGTQASHPLPPETVVNLLRDNGFQKAKLFDADYGTLRALGKSGIEVMVGIPND  81

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A  +  A+ WV  N+S HI    V I++VAVGNEPFL+ YNGSF    FPAL+N+
Sbjct  82    MLASLASSMKTAEKWVSQNVSQHIRKNNVNIRYVAVGNEPFLETYNGSFLRTTFPALRNV  141

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q AL +AGL N++K T+P NADVY S +G PS G+FR+DI DLM+ I ++L D+  PF V
Sbjct  142   QAALIKAGLSNQVKVTVPLNADVYESASGVPSGGDFRADIHDLMLAIVKFLSDNGGPFTV  201

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY + NFPVE+AFFDG +  ++D GATY NMFDAN DTL+ +L+K   G++ +
Sbjct  202   NIYPFISLYSDSNFPVEYAFFDGNSSPINDGGATYYNMFDANHDTLVRALQKNGYGNLPI  261

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             I+GEIGWPTDG++NAN + A +F +GF+  ++  +GTP+  G ++ YLFSL DE+AKS+ 
Sbjct  262   IIGEIGWPTDGDRNANNEYARRFNQGFMSHISGGKGTPMRPGPIDAYLFSLIDEDAKSVD  321

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK-DSHAVG  1257
             PG FERHWGIF YDG+PK+ I+  G  N    V A++V YL  +WCV+    + D   V 
Sbjct  322   PGNFERHWGIFTYDGRPKYQINL-GTTNSGSLVPARSVHYLQKKWCVMKPSARLDDPQVA  380

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              ++ YAC ++DC++L  G SC +LD     SYAFN Y+Q NNQ   AC F  L+ I K +
Sbjct  381   PSVSYACGLADCTSLGYGTSCGNLDARGNISYAFNSYYQKNNQLDTACKFPNLSMITKAD  440

Query  1438  ASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLALL  1548
              S   C+F + +E     A R  G   +  G+F F L +L
Sbjct  441   PSVGSCIFQITMEPYYGGAERRIGSLRLVVGLFLFVLIIL  480



>ref|XP_006443394.1| hypothetical protein CICLE_v10023781mg [Citrus clementina]
 ref|XP_006479327.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
 gb|ESR56634.1| hypothetical protein CICLE_v10023781mg [Citrus clementina]
Length=510

 Score =   471 bits (1211),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 320/454 (70%), Gaps = 11/454 (2%)
 Frame = +1

Query  130   VRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             +R+ ++ G    +L   V+GLGVNWGT A+  L P   V++LKDN I KVKLFD+D+  +
Sbjct  8     LRIILFVG----VLGCRVNGLGVNWGTVASHQLPPKTTVKLLKDNGILKVKLFDADNTIL  63

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
             +  AGT IEV+  + N +L+   D  D AK+WVKAN++ + + GGV IK VAVGNEPFLK
Sbjct  64    DALAGTDIEVMLAVSNQELKTMTD-FDKAKEWVKANVTKYTNKGGVNIKFVAVGNEPFLK  122

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYAS--GTGGPSEGNFRSDIR  663
             AYNGS  +  FPALKNIQ AL++AG+G+ IKAT+P NADVY S      PS G FR DI 
Sbjct  123   AYNGSHINTTFPALKNIQNALNDAGVGDTIKATVPFNADVYDSPDKNPDPSAGKFRPDIF  182

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDK--GATYTNMF  837
               + +I  +L +++APF+VNIYPFLSLY N +FPV++AFFDG  KS+ D   G  YT++F
Sbjct  183   ATIQEIVDFLAENKAPFIVNIYPFLSLYGNDDFPVDYAFFDG-GKSIVDSVTGNKYTDVF  241

Query  838   DANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPV  1017
             DAN DT + +L+ A  GD+ V+VGEIGWPTDG+K AN   A ++Y G L K+A  +GTP+
Sbjct  242   DANYDTCVSALKAAGHGDMPVVVGEIGWPTDGDKMANTANAFRYYSGLLPKLAADKGTPL  301

Query  1018  HKG-VVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNV  1194
               G  +E Y+FSL DE++KSI PG FE+HWGIF YDG+PKFP+DF+G+G ++  VGAK+V
Sbjct  302   RPGSYIEVYMFSLFDEDSKSIDPGNFEKHWGIFTYDGQPKFPMDFSGKGENKTLVGAKDV  361

Query  1195  PYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQ  1374
              YLP +WC ++ +  D+  +   + +AC+ SDC++L  G+SCN LD   + SYAFNMY+Q
Sbjct  362   KYLPKKWCTVNPDATDTSKLAEKMQFACNKSDCTSLGFGSSCNKLDGNGKVSYAFNMYYQ  421

Query  1375  INNQDVEACNFEGLAKIVKHNASTNGCLFPVALE  1476
             +NNQD  AC+F+GL K+   N S   C F + LE
Sbjct  422   MNNQDDRACDFQGLGKVTTENISQGTCNFLIQLE  455



>gb|EYU37424.1| hypothetical protein MIMGU_mgv1a005873mg [Erythranthe guttata]
Length=466

 Score =   469 bits (1206),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 310/470 (66%), Gaps = 15/470 (3%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
             + + VH +G NWGTQA   L PSIIV++LKDN I KVKLFD++   +N F+G+GIEV+ G
Sbjct  1     MVNSVHSIGANWGTQATHPLAPSIIVKLLKDNGIQKVKLFDAEARVLNAFSGSGIEVMVG  60

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPA  528
             IPN  L   A+ +  A+ WV+ N+S+H+    V I++VAVGNEPFL +YNG+F    +PA
Sbjct  61    IPNEMLSLLANSVSAAERWVERNVSAHVSANSVDIRYVAVGNEPFLSSYNGTFLATTYPA  120

Query  529   LKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRA  708
             L+NIQ AL +AGLGNK+K T+P NADVY S T  PS G+F +DI  LM++I  +L  + A
Sbjct  121   LQNIQAALIKAGLGNKVKVTVPLNADVYQSSTAQPSTGDFHADIHSLMLEIVNFLSLNGA  180

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCG  888
             PF VNIYPF+SLY + NFP+++AFFDG    + D G  YTN+FDAN DTL+W+L+K    
Sbjct  181   PFTVNIYPFISLYNDPNFPIDYAFFDGYPSPIEDNGKIYTNVFDANYDTLVWALQKNGFS  240

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             ++ +IVGEIGWPTDG++NAN   A++F +GF+ ++   +GTP+  G V+ YLFSL DE+A
Sbjct  241   NLTIIVGEIGWPTDGDRNANAASAQRFNQGFISRL--NQGTPMRPGPVDAYLFSLVDEDA  298

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDS  1245
             KSI PG FERHWGIF YDG PK+ +     GN R  V A NV YLP +WCV+      + 
Sbjct  299   KSIQPGNFERHWGIFNYDGTPKYNLSLG--GNSRGLVPATNVRYLPRRWCVMSPTASLED  356

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKI  1425
               VG ++ YAC+ +DC+ L  G SC++LD     SYAFN Y+QINNQ   AC F  L+ +
Sbjct  357   PQVGLSVSYACARADCTKLGFGTSCSNLDARGNISYAFNSYYQINNQLETACRFPNLSVV  416

Query  1426  VKHNASTNGCLFPVALESAATRSGGITAVFAG----------IFFFCLAL  1545
                + S   C F + +E+  +  G    V +G          +F F L L
Sbjct  417   TTSDPSVGTCKFGLMIETPGSVRGNGGGVVSGKPVGLVVQMIVFLFTLLL  466



>ref|XP_006476105.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
Length=490

 Score =   469 bits (1208),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 227/457 (50%), Positives = 311/457 (68%), Gaps = 4/457 (1%)
 Frame = +1

Query  187   GLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQL  366
             G+GVNWGT +   L    +VQML++N  +K+KLF++D   ++   G+ IEV+  IPN  L
Sbjct  29    GVGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEVMLAIPNYML  88

Query  367   ERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQK  546
                ++D   A  WV AN+SS+ ++GGV IK+VAVGNEPFL+ YN +++ +  PALKNIQ+
Sbjct  89    LEMSEDPGAAASWVYANVSSYFYNGGVNIKYVAVGNEPFLRTYNDTYRYITLPALKNIQQ  148

Query  547   ALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             AL++AGLG+KIKAT+P NAD+Y S    P  S G FR +++DL I I ++L  + APF V
Sbjct  149   ALNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFLHLNNAPFTV  208

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPFLSLY N  FPV+FAFF+G  K + D    YTN+FDAN DTL+WSL KA   D+++
Sbjct  209   NIYPFLSLYGNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLDKAGYPDMHI  268

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGE+GWPTDG+KNAN++ A+KF +G L+ +    GTP  KG ++ YLFSL DENAKSIA
Sbjct  269   IVGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGTIDVYLFSLLDENAKSIA  328

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGS  1260
             PG FERHWGIF YDGKPK+ +D +G+  ++     + V Y+P +WCVL+    D   +  
Sbjct  329   PGNFERHWGIFEYDGKPKYELDLSGKMKNKGLAPVEGVAYMPRRWCVLNPHADDFEELPD  388

Query  1261  NLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNA  1440
             ++ YACS+SDC+AL  G+SCN L +   ASYAFNMY+Q+N+Q+   C+F GLA +   + 
Sbjct  389   SIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDFSGLAMVTDEDP  448

Query  1441  STNGCLFPVALE--SAATRSGGITAVFAGIFFFCLAL  1545
             S + C FPV +   S+    GGI      +   C+  
Sbjct  449   SDDHCQFPVMIAHGSSLLLRGGILDTLLAVVGQCIVF  485



>ref|XP_002463758.1| hypothetical protein SORBIDRAFT_01g005610 [Sorghum bicolor]
 gb|EER90756.1| hypothetical protein SORBIDRAFT_01g005610 [Sorghum bicolor]
Length=495

 Score =   469 bits (1208),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 236/456 (52%), Positives = 311/456 (68%), Gaps = 10/456 (2%)
 Frame = +1

Query  175   SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIP  354
             SP   LG+NWGTQA   L P I+ Q+L+DN I KVKLFD+D  T++  AGTGIEV+  IP
Sbjct  26    SPADALGMNWGTQATHPLPPKIVAQLLRDNGIKKVKLFDADQETLSALAGTGIEVMVAIP  85

Query  355   NNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALK  534
             N  L+   D  D AK+WV+ N+S +  DGGV IK+VAVGNEPFL AYNG+F  + FPAL+
Sbjct  86    NVMLDTMTD-YDTAKEWVRRNVSRYNFDGGVTIKYVAVGNEPFLAAYNGTFDKVTFPALQ  144

Query  535   NIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLRDHRA  708
             NIQ AL+EAGLG+ IKAT+P NADVY S      PS G +R+DI DLM ++ ++L ++ A
Sbjct  145   NIQNALNEAGLGDTIKATVPLNADVYMSPKDNPVPSAGRWRTDITDLMTQMVQFLSNNSA  204

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHD--KGATYTNMFDANLDTLIWSLRKAK  882
             PF VNIYPF+SL+ N +FPV FAFFDG A  + D   G +YTN+FDAN DTL+ +L+   
Sbjct  205   PFTVNIYPFISLFLNDDFPVNFAFFDGDATPLVDPGTGVSYTNVFDANFDTLVAALKSVG  264

Query  883   CGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKG-VVEFYLFSLTD  1059
              GD+ ++VGE+GWPTDG+K+A    A++FY G L+++A   GTP      +E YLF L D
Sbjct  265   HGDMPIVVGEVGWPTDGDKHATSAYAQRFYNGLLKRLAANAGTPARPNQYIEVYLFGLLD  324

Query  1060  ENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQ  1236
             E+ KS+APG FERHWGI  YDG+PK+P+D +G+G + M V A  V YLP  WCV++ N  
Sbjct  325   EDVKSVAPGNFERHWGILRYDGQPKYPMDLSGQGQNTMLVPASGVEYLPRTWCVVNTNAG  384

Query  1237  KDS-HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
              D+   +  N+ YAC+ +DC+AL  G++C  +D    ASYAFN +FQ+ NQ  EAC F+G
Sbjct  385   SDAMEKLADNINYACTFADCTALGYGSTCGGMDSNGNASYAFNAFFQVQNQKDEACGFQG  444

Query  1414  LAKIVKHNASTNGCLFP--VALESAATRSGGITAVF  1515
             LA   + + ST  C F   +A  SAA R     A+F
Sbjct  445   LAVPTQTDPSTATCNFTIQIATTSAAHRRPLGVALF  480



>ref|XP_010672072.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Beta vulgaris 
subsp. vulgaris]
Length=478

 Score =   469 bits (1207),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 306/452 (68%), Gaps = 3/452 (1%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             V L    V G+GVNWGTQA   L  + +VQMLKDN I KVKLFD+D   ++  +GTGIEV
Sbjct  16    VSLWTYNVEGIGVNWGTQANHKLPLNTVVQMLKDNRIQKVKLFDADESILSALSGTGIEV  75

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             +  IPN  L    D  + A+ WV+ N+  +   GGV IK+VAVGNEPFL++YNG+F++  
Sbjct  76    MVAIPNGDLVTMLDS-NQARRWVERNVVRYNFRGGVNIKYVAVGNEPFLRSYNGTFENAT  134

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYL  693
              PAL NIQ AL+EAG+GN +KAT+P NADVY S    P  S G FR+D+  LM ++ +++
Sbjct  135   LPALVNIQNALNEAGVGNTVKATVPLNADVYGSPPSNPVPSAGRFRADVAVLMTQMVQFM  194

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
               + APF VNIYPFLSLYE+ NFPV +AFFDG A  + D G  YTN+FDAN DTL+ +L 
Sbjct  195   SQNNAPFTVNIYPFLSLYEDPNFPVNYAFFDGGATPLDDNGLQYTNVFDANFDTLVSALN  254

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
              A  G++ +IVGE+GWPTDG+ NAN+  A +FY+  L ++A   GTP+  G ++ YLF L
Sbjct  255   AAGYGNMPIIVGEVGWPTDGDINANINNAFRFYRSLLPRIAANTGTPLRPGNIDMYLFGL  314

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DE+AKSI PG FERHWGIF YDG+PKFP+D +G+  D   VGAKNV YL  +WC  +  
Sbjct  315   LDEDAKSIGPGSFERHWGIFQYDGQPKFPMDLSGQNQDIYLVGAKNVQYLENEWCEFNPN  374

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
              +D   +G ++ +ACS +DC+ L  G+SC  LD+   ASYAFN+Y+Q   Q+++AC+F G
Sbjct  375   ARDLSRLGDSINFACSAADCTPLGYGSSCQGLDVYQNASYAFNVYYQTQYQNLQACDFGG  434

Query  1414  LAKIVKHNASTNGCLFPVALESAATRSGGITA  1509
             LA++   N S   C F + + S+  ++    A
Sbjct  435   LARLTLQNISIGTCNFTIQIASSGLKTAAPVA  466



>ref|XP_010048510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Eucalyptus grandis]
 gb|KCW80769.1| hypothetical protein EUGRSUZ_C02156 [Eucalyptus grandis]
 gb|KCW80770.1| hypothetical protein EUGRSUZ_C02156 [Eucalyptus grandis]
 gb|KCW80771.1| hypothetical protein EUGRSUZ_C02156 [Eucalyptus grandis]
Length=483

 Score =   469 bits (1207),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 311/470 (66%), Gaps = 5/470 (1%)
 Frame = +1

Query  151   GFAVIL---LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             G A +L   +   V G+G NWGTQA+  L P+ +V+ML++N I KVKLFD+D+  +    
Sbjct  8     GLAWVLSFSMVCSVSGIGANWGTQASHPLPPATVVRMLRENGIQKVKLFDADYGALRALG  67

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
              TGIEV+ GIPN+ L  FA  +  A+ WV  N+S+HI    V I++VAVGNEPFLK YN 
Sbjct  68    RTGIEVMVGIPNDMLASFAGSVKAAERWVSKNVSTHITSSNVNIRYVAVGNEPFLKTYND  127

Query  502   SFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKI  681
             SF    +PAL+N+Q AL  AGL +++K T+P NADVYAS TG PS G+FR+DI+ LMI+I
Sbjct  128   SFITTTYPALQNVQSALIRAGLSSQVKVTVPLNADVYASSTGLPSGGDFRADIQQLMIQI  187

Query  682   CRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLI  861
              ++L D+   F VNIYPF+SLY + NFPVE+AFFDG A  + D  ATY NMFDAN DTL+
Sbjct  188   VKFLSDNGGSFTVNIYPFISLYTDANFPVEYAFFDGNASPIVDGSATYYNMFDANYDTLV  247

Query  862   WSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFY  1041
             W+L+K   G++ +IVGEIGWPTDG++NAN+  A++F +GF+  ++  +GTP+  G ++ Y
Sbjct  248   WALQKNGFGNLAIIVGEIGWPTDGDRNANLVYAQRFNQGFMSHISGGKGTPMRPGPIDAY  307

Query  1042  LFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCV  1221
             LFSL DE+AKSI PG FERHWGIFGYDGKPK+  +  G  N    + A+ V YL  +WC+
Sbjct  308   LFSLIDEDAKSIEPGNFERHWGIFGYDGKPKYLFNL-GTTNSNGLIPARGVNYLEPKWCL  366

Query  1222  LD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEA  1398
             L  +       +  ++ YACS  DC++L  G SC +LD     SYAFN Y+QINNQ   A
Sbjct  367   LKPSANLTGDQMAPSVSYACSRGDCTSLGYGTSCGNLDAEGNISYAFNSYYQINNQLDSA  426

Query  1399  CNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGIFFFCLALL  1548
             C F GL+ I + N S   C F   ++     +G +      +F   L+L+
Sbjct  427   CKFSGLSMITRTNPSVGTCRFNTMIQPYYGSAGRLHGYLGNVFGPSLSLI  476



>ref|XP_006851012.1| hypothetical protein AMTR_s00025p00220320 [Amborella trichopoda]
 gb|ERN12593.1| hypothetical protein AMTR_s00025p00220320 [Amborella trichopoda]
Length=492

 Score =   469 bits (1208),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 304/444 (68%), Gaps = 10/444 (2%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             ++ L   VHGLG NWGTQ+   L PSI+V +L+DN   KVKLFD+D  T+     +G++V
Sbjct  13    LLFLVGFVHGLGANWGTQSTHPLKPSIVVNLLRDNGFQKVKLFDADAGTMKALGKSGLQV  72

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             + GIPN+ L + A  +  A+DWV  N+SS++   GV I++VAVGNEPFL  YNGSF  L 
Sbjct  73    MVGIPNDMLAKLATSVKAAEDWVSKNVSSYMSKDGVDIRYVAVGNEPFLTTYNGSFLQLT  132

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRD  699
              PAL+NIQ AL +AGL  ++K T+P NADVY S    PS G+FRSDI DLM+ + +YL D
Sbjct  133   LPALQNIQSALIKAGLSTRVKPTVPLNADVYQSPNNLPSSGDFRSDIHDLMVALTKYLSD  192

Query  700   HRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKA  879
             + APF VNIYPF+SLY + +FPV+FAFFDG A  ++D G  YTN+FDAN DTL+W+LRK 
Sbjct  193   NGAPFTVNIYPFISLYNDPSFPVDFAFFDGDATPLNDGGTLYTNVFDANYDTLVWALRKN  252

Query  880   KCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTD  1059
               G + +IVGE+GWPTDGN++A ++ A+KF +GFL ++A  +GTP+    ++ YLFSL D
Sbjct  253   GFGSLQIIVGEVGWPTDGNEHATIQFAQKFNQGFLTRIASGKGTPMQLSAIDAYLFSLID  312

Query  1060  ENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK  1239
             E+AKSI PG FERHWG+F YDG  K+ +   G GN ++ +GAK V YLP +WCVL  +  
Sbjct  313   EDAKSIDPGNFERHWGVFNYDGSIKYQL---GVGNSQL-IGAKGVKYLPKKWCVLTPQAN  368

Query  1240  -DSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG-  1413
              D   +G ++ YACS++DC+AL  G+SCN LD+    SYAFN YFQ NNQ   AC F   
Sbjct  369   LDDPKIGESVNYACSLADCTALGYGSSCNSLDVRGNISYAFNSYFQRNNQLQVACKFPNV  428

Query  1414  ----LAKIVKHNASTNGCLFPVAL  1473
                 L+     + +T  C F + +
Sbjct  429   SSAYLSMTTGSDPTTPSCRFEIMI  452



>ref|XP_004288682.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 225/447 (50%), Positives = 306/447 (68%), Gaps = 2/447 (0%)
 Frame = +1

Query  154   FAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGI  333
               + L+A      GVNWGT A + L P  +VQML++N   K+KLF++DH  ++   GT I
Sbjct  18    LVLALMAHKGSSFGVNWGTMATRQLPPEKVVQMLQENGFTKLKLFEADHKILDALVGTQI  77

Query  334   EVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKD  513
             EV+  IPN  L+  + D   A  WV AN+SS+ +DGGV IK+VAVGNEPFLKAYNG++  
Sbjct  78    EVMLAIPNFMLQDMSIDTVAAISWVDANVSSYCYDGGVNIKYVAVGNEPFLKAYNGTYLK  137

Query  514   LVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICR  687
                PALKNIQ+AL+  GLG+++K T+P NAD+Y S    P  S G+F  +++D +I+I +
Sbjct  138   TTLPALKNIQEALNRFGLGSQVKVTVPFNADIYFSPDSDPVPSTGDFLPELKDHVIEIIQ  197

Query  688   YLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWS  867
             YL  + APF VNIYPFLSLY N  FP EFAFFDG++K + D    YTN+FDAN DTL+WS
Sbjct  198   YLYTNEAPFTVNIYPFLSLYGNAYFPFEFAFFDGKSKPIRDGDLLYTNVFDANFDTLVWS  257

Query  868   LRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLF  1047
             L KA   ++ +IVGE+GWPTDG  NAN+  A++F +G L+      GTP  KG+++ YLF
Sbjct  258   LTKAGFPEIKIIVGEVGWPTDGVVNANIPNAKRFNQGMLKHALSGNGTPARKGMIDVYLF  317

Query  1048  SLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD  1227
             SL DENAKSIAPG FERHWG+F +DGKPK+ +D +G   ++  V  + V Y+  +WCVL+
Sbjct  318   SLIDENAKSIAPGCFERHWGLFEFDGKPKYELDLSGSLQNKGLVAVEGVDYMSKRWCVLN  377

Query  1228  NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF  1407
              + KD + + S++ YACS+SDC+AL  G+SCN+L +   ASYAFNMY+Q+N+Q +  C+F
Sbjct  378   PDAKDLYGLASSIDYACSLSDCTALGYGSSCNNLSLEGNASYAFNMYYQVNDQKIWTCDF  437

Query  1408  EGLAKIVKHNASTNGCLFPVALESAAT  1488
              GLA     + S   C FPV +  A +
Sbjct  438   SGLAVETDEDPSVGNCQFPVMIAYAPS  464



>ref|XP_006450066.1| hypothetical protein CICLE_v10008079mg [Citrus clementina]
 gb|ESR63306.1| hypothetical protein CICLE_v10008079mg [Citrus clementina]
Length=501

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 221/441 (50%), Positives = 306/441 (69%), Gaps = 3/441 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+GVNWGTQA   L PS +V+MLKDN ID+VKLFD+D   +N  A +GI+V+ GIPN 
Sbjct  41    VSGIGVNWGTQATHPLPPSTVVRMLKDNGIDRVKLFDADSKYLNALANSGIQVMVGIPNE  100

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A  +  A++WV  N+SSH+   GV I++VAVGNEPFL  +NG+F     PAL+NI
Sbjct  101   MLSTLASSVQAAENWVAKNVSSHVSSNGVDIRYVAVGNEPFLPTFNGTFIGTTLPALQNI  160

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q AL +AGLG +IK T+P NADVY S +  PSEG+ R+DI DLM++I ++L D+  PF V
Sbjct  161   QAALIKAGLGTRIKVTVPLNADVYQSQSNLPSEGDLRTDIHDLMLQILKFLSDNGGPFTV  220

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY++ +FP++FAFFD  +  ++D G  Y N+FDAN DTL+W+L+K   G++++
Sbjct  221   NIYPFISLYKDPSFPIDFAFFDSNSSPINDNGRVYENVFDANYDTLVWALQKNGFGNLSI  280

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGEIGWPTDG+KNAN+K A++F +GF+ ++   +GTP+  G ++ YLFSL DE+AKSI 
Sbjct  281   IVGEIGWPTDGDKNANLKFAQRFNQGFMSRVNAGKGTPMRSGAIDAYLFSLIDEDAKSIQ  340

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSH-AVG  1257
             PG FERHWG+  +DG+PK+ +   G G + + V AK+V YL  +WCV+      +   V 
Sbjct  341   PGNFERHWGLLYFDGQPKYQLSL-GNGRNGL-VAAKDVHYLAQKWCVMSPSASLADPQVA  398

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
             +++ YAC  +DC++L  G SC +LD     SYAFN Y+QINNQ   AC F  L+ +   N
Sbjct  399   ASVSYACGNADCTSLGYGTSCGNLDARGNISYAFNSYYQINNQLDSACRFPNLSAVTTTN  458

Query  1438  ASTNGCLFPVALESAATRSGG  1500
              ST  CLF + +++  T   G
Sbjct  459   PSTGDCLFRIMIKTDTTAGAG  479



>ref|XP_006483661.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Citrus sinensis]
Length=501

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 306/441 (69%), Gaps = 3/441 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+GVNWGTQA   L PS +V+MLKDN ID+VKLFD+D   +N  A +GI+V+ GIPN 
Sbjct  41    VSGIGVNWGTQATHPLPPSTVVRMLKDNGIDRVKLFDADSKYLNALANSGIQVMVGIPNE  100

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A  +  A++WV  N+SSH+   GV I++VAVGNEPFL  +NG+F     PAL+NI
Sbjct  101   MLSTLASSVQAAENWVAKNVSSHVSSNGVDIRYVAVGNEPFLPTFNGTFIGTTLPALQNI  160

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q AL +AGLG +IK T+P NADVY S +  PSEG+FR+DI DLM++I ++L D+  PF V
Sbjct  161   QAALIKAGLGTRIKVTVPLNADVYQSQSNLPSEGDFRTDIHDLMLQILKFLSDNGGPFTV  220

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY + +FP++FAFFD  +  ++D G  Y N+FDAN DTL+W+L+K   G++++
Sbjct  221   NIYPFISLYNDPSFPIDFAFFDSNSSPINDNGRVYENVFDANYDTLVWALQKNGFGNLSI  280

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGEIGWPTDG+KNAN+K A++F +GF+ ++   +GTP+  G ++ YLFSL DE+AKSI 
Sbjct  281   IVGEIGWPTDGDKNANLKFAQRFNQGFMSQVNAGKGTPMRSGAIDAYLFSLIDEDAKSIQ  340

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHAVG  1257
             PG FERHWG+F +DG+PK+ +   G G + + V  K+V YL  +WCV+  +   D   V 
Sbjct  341   PGNFERHWGLFYFDGQPKYQLSL-GNGRNGL-VTPKDVHYLAQKWCVMSPSASLDDPQVA  398

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              ++ YAC  +DC++L  G SC +LD     SYAFN Y+QINNQ   AC F  L+ +   N
Sbjct  399   LSVSYACGNADCTSLGYGTSCGNLDSRGNISYAFNSYYQINNQLDTACKFPNLSVVTNTN  458

Query  1438  ASTNGCLFPVALESAATRSGG  1500
              ST  C F + +++  T S G
Sbjct  459   PSTGDCQFRIMIKTDTTASAG  479



>ref|XP_008380615.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Malus domestica]
 ref|XP_008380617.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Malus domestica]
Length=500

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 231/461 (50%), Positives = 309/461 (67%), Gaps = 6/461 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+G NWGTQA+  L P  +V++LKDN   +VKLFD+D+ T+N  A +GIEV+ GIPN+
Sbjct  38    VSGIGANWGTQASHPLPPDTVVRLLKDNGFQRVKLFDADYDTLNSLAKSGIEVMVGIPND  97

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A  +  A+ WV  N+S+HI    VKI++VAVGNEPFL+ YNGSF    FPAL+N+
Sbjct  98    MLASLATSVKAAEKWVSKNVSAHISSNNVKIRYVAVGNEPFLETYNGSFLRTTFPALQNV  157

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q AL +AGL N++K T+PQNADVYAS  G PS G+FR+DI D MI+I ++L D+  PF V
Sbjct  158   QSALIKAGLSNQVKVTVPQNADVYASSNGFPSGGDFRTDIHDYMIQIVKFLSDNGCPFTV  217

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY + NFPV++AFFDG A  + D  ATY NMFDAN DTL+W+L+K   G++ +
Sbjct  218   NIYPFISLYIDSNFPVDYAFFDGNASPITDGSATYYNMFDANYDTLVWTLQKNGFGNLPI  277

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGEIGWPTDG++NAN+  A++F +GF+  +    GTP+  G ++ YLFSL DE+AKSI 
Sbjct  278   IVGEIGWPTDGDRNANLVYAQRFNQGFMSHILGGRGTPMRPGPIDAYLFSLIDEDAKSID  337

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHAVG  1257
             PG FERHWGIF +DG  K+ ++  G  N    V AK V YL  +WCV+  +   D   V 
Sbjct  338   PGNFERHWGIFTFDGLAKYQLNL-GSTNSGALVPAKGVHYLERKWCVMKPSASLDDPQVA  396

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              ++ YAC ++DC++L  G SC +LD  +  SYA N Y+Q NNQ  EAC F  L+ I K N
Sbjct  397   LSVSYACGLADCTSLGYGTSCGNLDDRANISYAVNSYYQRNNQLDEACKFPNLSMITKTN  456

Query  1438  ASTNGCLFPVALE----SAATRSGGITAVFAGIFFFCLALL  1548
              S   C F + +E    +A  RSG +    + +  F   +L
Sbjct  457   PSVGSCRFEIMIEPYYGAAERRSGHLQKPLSLVALFAFLML  497



>gb|KDO80436.1| hypothetical protein CISIN_1g047337mg [Citrus sinensis]
Length=490

 Score =   469 bits (1206),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/466 (49%), Positives = 313/466 (67%), Gaps = 4/466 (1%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             V+   S   G+GVNWGT +   L    +VQML++N  +K+KLF++D   ++   G+ IEV
Sbjct  20    VMFEVSSGDGVGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEV  79

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             +  IPN  L   ++D   A  WV AN+SS+ + GGV IK+VAVGNEPFL+ YN +++ + 
Sbjct  80    MLAIPNYMLLEMSEDPGAAASWVYANVSSYFYTGGVNIKYVAVGNEPFLRTYNDTYRYIT  139

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYL  693
              PALKNIQ+AL++AGLG+KIKAT+P NAD+Y S    P  S G FR +++DL I I ++L
Sbjct  140   LPALKNIQQALNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFL  199

Query  694   RDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLR  873
               + APF VNIYPFLSLY N  FPV+FAFF+G  K + D    YTN+FDAN DTL+WSL 
Sbjct  200   HLNNAPFTVNIYPFLSLYGNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLD  259

Query  874   KAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSL  1053
             KA   D+++IVGE+GWPTDG+KNAN++ A+KF +G L+ +    GTP  KG ++ YLFSL
Sbjct  260   KAGYPDMHIIVGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGTIDVYLFSL  319

Query  1054  TDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNE  1233
              DENAKSIAPG FERHWGIF YDGKPK+ +D +G+  ++     + V Y+P +WCVL+  
Sbjct  320   LDENAKSIAPGNFERHWGIFEYDGKPKYELDLSGKMKNKGLAPVEGVAYMPRRWCVLNPH  379

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               D   +  ++ YACS+SDC+AL  G+SCN L +   ASYAFNMY+Q+N+Q+   C+F G
Sbjct  380   ADDFEELPDSIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDFSG  439

Query  1414  LAKIVKHNASTNGCLFPVALE--SAATRSGGITAVFAGIFFFCLAL  1545
             LA +   + S + C FPV +   S+    GGI      +   C+  
Sbjct  440   LAMVTDGDPSDDHCQFPVMIAHGSSLLLRGGILDTLLAVVGQCIVF  485



>gb|KDO73371.1| hypothetical protein CISIN_1g011636mg [Citrus sinensis]
Length=480

 Score =   468 bits (1204),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 226/460 (49%), Positives = 307/460 (67%), Gaps = 5/460 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLG NWGTQA+  L P  +V +L+DN   K KLFD+D+ T+     +GIEV+ GIPN+
Sbjct  22    VSGLGANWGTQASHPLPPETVVNLLRDNGFQKAKLFDADYGTLRALGKSGIEVMVGIPND  81

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A  +  A+ WV  N+S HI    V I++VAVGNEPFL+ YNGSF    FPAL+N+
Sbjct  82    MLASLASSMKTAEKWVSQNVSQHIRKNNVNIRYVAVGNEPFLETYNGSFLRTTFPALRNV  141

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q AL +AGL N++K T+P NADVY S +G PS G+FR+DI DLM+ I ++L D+  PF V
Sbjct  142   QAALIKAGLSNQVKVTVPLNADVYESASGVPSGGDFRADIHDLMLAIVKFLSDNGGPFTV  201

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY + NFPVE+AFFDG +  ++D GATY NMFDAN DTL+ +L+K   G++ +
Sbjct  202   NIYPFISLYIDSNFPVEYAFFDGNSSPINDGGATYYNMFDANHDTLVRALQKNGYGNLPI  261

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             I+GEIGWPTDG++NAN + A +F +GF+  ++  +GTP+  G ++ YLFSL DE+AKS+ 
Sbjct  262   IIGEIGWPTDGDRNANNEYARRFNQGFMSHISGGKGTPMRPGPIDAYLFSLIDEDAKSVD  321

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK-DSHAVG  1257
             PG FERHWGIF YDG+PK+ ++  G  N    V A++V YL  +WCV+    + D   V 
Sbjct  322   PGNFERHWGIFTYDGRPKYQLNL-GTTNSGSLVPARSVHYLQKKWCVMKPSARLDDPQVA  380

Query  1258  SNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHN  1437
              ++ YAC ++DC++L  G SC +LD     SYAFN Y+Q NNQ   AC F  L+ I K +
Sbjct  381   PSVSYACGLADCTSLGYGTSCGNLDARGNISYAFNSYYQKNNQLDTACKFPNLSMITKAD  440

Query  1438  ASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLALL  1548
              S   C+F + +E     A R  G   +  G+F F L +L
Sbjct  441   PSVGSCIFQITMEPYYGGAERRIGSLRLVVGLFLFVLIIL  480



>ref|XP_010536989.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Tarenaya hassleriana]
Length=483

 Score =   467 bits (1202),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 222/440 (50%), Positives = 303/440 (69%), Gaps = 2/440 (0%)
 Frame = +1

Query  160   VILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEV  339
             V ++     G+G NWGTQ++  L P ++V++L+DN I KVKLFD+D+ T+     +GIEV
Sbjct  17    VTMMCGTSSGIGANWGTQSSHPLPPDVVVRLLRDNGIQKVKLFDADYDTLRALGKSGIEV  76

Query  340   LPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLV  519
             + GIPN+ L   A  L  A+ WV  N+S+H+    V I++VAVGNEPFL+ YNGS+    
Sbjct  77    MVGIPNDMLSSLASSLKAAEKWVSKNVSTHLSTDTVNIRYVAVGNEPFLETYNGSYLKTT  136

Query  520   FPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRD  699
             FPAL+NIQ AL +AGL N++K T+P NADVY S TG PS G+FRSDIRDLMI I ++L D
Sbjct  137   FPALRNIQIALVKAGLQNQVKVTVPLNADVYESSTGLPSGGDFRSDIRDLMITIVKFLSD  196

Query  700   HRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKA  879
             +  PF VNIYPF+SLY + NFPVE+AFFDG +  ++D G  Y NMFDAN DTL+ +L+K 
Sbjct  197   NGGPFTVNIYPFISLYIDANFPVEYAFFDGNSSPLNDGGTYYYNMFDANHDTLVHALQKN  256

Query  880   KCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTD  1059
               G++ +IVGEIGWPTDG++NAN++ A +F +GF+  ++  +GTP+  G ++ YLFSL D
Sbjct  257   GFGNMPIIVGEIGWPTDGDRNANIEYARRFNQGFMSHISGGKGTPMRPGPIDVYLFSLID  316

Query  1060  ENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQ  1236
             E+AKSI PG FERHWGIF YDG+PK+ ++  G  N    + AK V YL  +WC++  N +
Sbjct  317   EDAKSIQPGNFERHWGIFTYDGRPKYQLNL-GTTNSGALIPAKGVRYLEQKWCIMKPNAK  375

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
              D   V  ++ YAC + DC++L  G SC +LD     SYAFN YFQI +Q   AC F  +
Sbjct  376   LDDPQVAPSVSYACGLGDCTSLGYGTSCGNLDARGNISYAFNSYFQIQDQQDSACKFPNI  435

Query  1417  AKIVKHNASTNGCLFPVALE  1476
             + I+K + S   C FP+ +E
Sbjct  436   SMIIKTDPSRGSCKFPIMIE  455



>ref|XP_009623324.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   467 bits (1201),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 231/474 (49%), Positives = 317/474 (67%), Gaps = 11/474 (2%)
 Frame = +1

Query  154   FAVIL---LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFF--  318
             F V+L   L SPV G+G NWGTQ+   L P I+V+ML++N I KVKLFD+D+ T+     
Sbjct  10    FGVVLFLVLVSPVSGIGANWGTQSTHRLPPEIVVRMLRENGIRKVKLFDADYDTLKALGK  69

Query  319   AGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYN  498
             AG  +EV+ GIPN+ L      L  A+ WV  N+S HI +  V I++VAVGNEP+L  YN
Sbjct  70    AGPELEVMVGIPNDMLSTMGS-LKAAEKWVSKNVSVHISNNNVNIRYVAVGNEPYLTTYN  128

Query  499   GSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIK  678
             G++     PA++N+Q AL +AGLGNK+K T P NADVY S +G PS G+FR+DI   + +
Sbjct  129   GTYLRTTLPAMQNVQTALIKAGLGNKVKVTCPLNADVYESSSGLPSGGDFRADIHGFVSQ  188

Query  679   ICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTL  858
             + ++L D+  PF +NIYPF+SLY + NFPVE+AFFDG A  ++D G TYTNMFDAN DTL
Sbjct  189   LVKFLSDNGCPFTINIYPFISLYIDPNFPVEYAFFDGNATPLNDGGTTYTNMFDANHDTL  248

Query  859   IWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEF  1038
             +W+L+K   G+V +I+GEIGWPTDG++NAN ++A++F +GF++ +++ +GTP+  G ++ 
Sbjct  249   VWALQKNGFGNVPIIIGEIGWPTDGDRNANAQLAQRFNQGFMQHISEGKGTPMRPGPIDA  308

Query  1039  YLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWC  1218
             YLFSL DE+AKSI PG FERHWGIF YDG PK+ ++  G  N    V AKNV YL  +WC
Sbjct  309   YLFSLIDEDAKSIQPGNFERHWGIFTYDGLPKYSLNL-GTTNSGSLVQAKNVKYLERKWC  367

Query  1219  VLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVE  1395
             V   N + D   +  ++ YAC + DC++L  G SC  LD     SYAFN Y+QINNQ  +
Sbjct  368   VFKPNAKVDDPQIAPSMSYACGLGDCTSLGYGTSCGGLDARGNISYAFNSYYQINNQLDD  427

Query  1396  ACNFEGLAKIVKHNASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLALL  1548
             AC F+GL  + K + ST  C + + +E     A R  G T +   + FF   +L
Sbjct  428   ACKFQGLGTVTKSDPSTGTCRYGLMIEPYYGGAERQLGYTRMALALLFFLWTIL  481



>ref|XP_004289256.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   466 bits (1200),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 224/451 (50%), Positives = 314/451 (70%), Gaps = 2/451 (0%)
 Frame = +1

Query  142   IWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFA  321
             +W    +++      G G+NWG+     L P  +V MLK+N   KVKLFD++   ++  A
Sbjct  8     VWLLSMMLVSIDIAQGYGINWGSMMTHPLPPKKVVAMLKENGFKKVKLFDAEPSMMDALA  67

Query  322   GTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNG  501
             G+G+EV+ GIPN++L   A D  +AK WVK N++S+++DGGV IK+VAVGNEPFL +YNG
Sbjct  68    GSGLEVMVGIPNDKLSELASDYGSAKAWVKHNVTSYLYDGGVAIKYVAVGNEPFLSSYNG  127

Query  502   SFKDLVFPALKNIQKALDEAG--LGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMI  675
             S+    +PA+KNIQKAL ++   +G+KIK T P NADVY S +  P++G FR +IRD M+
Sbjct  128   SYVKTTYPAMKNIQKALYDSSQEVGSKIKVTTPFNADVYHSKSDKPTDGEFRQNIRDSMV  187

Query  676   KICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDT  855
             +I   L+  ++PF+VNIYPFLSL +N +FP EFAFFDG  K V D    Y N+FDANLDT
Sbjct  188   QILGLLKQAKSPFLVNIYPFLSLSQNTDFPREFAFFDGGGKGVDDGNIHYDNVFDANLDT  247

Query  856   LIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVE  1035
               ++L+K    D+ +I+GE+GWPTDG ++AN+K+A+KFY G  +K+AK +G+P+ KG VE
Sbjct  248   AHYALKKEGYSDLEIIIGEVGWPTDGGRDANVKLAQKFYDGLFKKLAKGQGSPLRKGSVE  307

Query  1036  FYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQW  1215
              YLF L DEN+KSIAPG+FERHWGIF YDG+PKFP+D +G+G ++M    K V  L  QW
Sbjct  308   VYLFGLFDENSKSIAPGDFERHWGIFRYDGQPKFPMDISGKGQNQMLKPVKGVEMLDKQW  367

Query  1216  CVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVE  1395
             CVL+++ ++         YACS +DC+++   +SC+ L+   + SYAFN ++Q  NQ VE
Sbjct  368   CVLNSDVRNLSKAMKEKDYACSNADCTSIKNSSSCSFLEPSDQVSYAFNSFYQSRNQSVE  427

Query  1396  ACNFEGLAKIVKHNASTNGCLFPVALESAAT  1488
             ACNF G+   V  + S   CLFP+ +ES+AT
Sbjct  428   ACNFNGMGTKVTQDPSKGDCLFPLQIESSAT  458



>ref|XP_009797292.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Nicotiana 
sylvestris]
Length=481

 Score =   466 bits (1200),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 232/474 (49%), Positives = 317/474 (67%), Gaps = 11/474 (2%)
 Frame = +1

Query  154   FAVIL---LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFF--  318
             F V+L   L SPV G+G NWGTQ+   L P I+V+ML++N I KVKLFD+D+ T+     
Sbjct  10    FGVVLFLVLVSPVSGIGANWGTQSTHRLPPEIVVRMLRENGIRKVKLFDADYDTLKALGK  69

Query  319   AGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYN  498
             AG  +EV+ GIPN+ L   A  L  A+ WV  N+S HI +  V I++VAVGNEP+L  YN
Sbjct  70    AGPELEVMVGIPNDLLSTLAS-LKAAEKWVSKNVSVHISNNNVNIRYVAVGNEPYLTTYN  128

Query  499   GSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIK  678
             G++     PA++N+Q AL +AGLGNK+K T P NADVY S +G PS G+FR+ I   + +
Sbjct  129   GTYLRTTLPAMQNVQTALVKAGLGNKVKVTCPLNADVYESSSGLPSGGDFRAAIHGFVSQ  188

Query  679   ICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTL  858
             + ++L D+  PF +NIYPF+SLY + NFPVE+AFFDG A  ++D G TYTNMFDAN DTL
Sbjct  189   LVKFLSDNGCPFTINIYPFISLYNDPNFPVEYAFFDGNATPLNDGGTTYTNMFDANHDTL  248

Query  859   IWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEF  1038
             +W+L+K   G+V +I+GEIGWPTDG++NAN ++A++F +GF++ +++ +GTP+  G V+ 
Sbjct  249   VWALQKNGFGNVPIIIGEIGWPTDGDRNANAQLAQRFNQGFMQHISEGKGTPMRPGPVDA  308

Query  1039  YLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWC  1218
             YLFSL DE+AKSI PG FERHWGIF YDG PK+ ++  G  N    V AKNV YL  +WC
Sbjct  309   YLFSLIDEDAKSIQPGNFERHWGIFTYDGLPKYSLNL-GTTNSGALVQAKNVKYLERKWC  367

Query  1219  VLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVE  1395
             V   N + D   +  ++ YAC ++DC++L  G SC  LD     SYAFN Y+QINNQ  +
Sbjct  368   VFKPNAKVDDPQIAPSMSYACGLADCTSLGYGTSCGGLDARGNISYAFNSYYQINNQLDD  427

Query  1396  ACNFEGLAKIVKHNASTNGCLFPVALE---SAATRSGGITAVFAGIFFFCLALL  1548
             AC F+GL  + K + ST  C + + +E     A R  G T +   +  F   LL
Sbjct  428   ACKFQGLGTVTKSDPSTGTCRYGLMIEPYYGGAERQLGYTRMALALLLFMWTLL  481



>ref|XP_010929423.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Elaeis guineensis]
Length=487

 Score =   467 bits (1201),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 238/471 (51%), Positives = 316/471 (67%), Gaps = 15/471 (3%)
 Frame = +1

Query  115   PVVGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDS  294
             PVVG   +  W     + L   V G+G NWG Q +  L  S++V+ML++N   KVKLFD+
Sbjct  11    PVVG---VICW-----LCLVVSVSGIGANWGMQTSHPLPASVVVRMLRENGFQKVKLFDA  62

Query  295   DHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGN  474
             +  T+N    +G+EV+ GIPN+ L   A  +  A+ WVKAN+S +I+ GGV I++VAVGN
Sbjct  63    EDGTMNALKKSGLEVMVGIPNDMLATLATSVKAAEQWVKANVSDYIN-GGVNIRYVAVGN  121

Query  475   EPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRS  654
             EPFL+ YNGSF    FPAL+NIQ AL +AGL +++K T+P NADVY S +G PS+G+FRS
Sbjct  122   EPFLETYNGSFLQSTFPALQNIQGALIKAGLSSQVKVTVPLNADVYQSSSGRPSDGDFRS  181

Query  655   DIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNM  834
             DIRDLM+ I ++L D+ APF VNIYPF+SLY + NFPVE+AFF G +  V D  ATY NM
Sbjct  182   DIRDLMLAIVKFLSDNAAPFTVNIYPFISLYSDPNFPVEYAFFGGSSSPVVDASATYDNM  241

Query  835   FDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTP  1014
             FDAN DTLIW+L+K   G++ VIVGEIGWPTDG+ NAN++ A++F +GF+  +A  +GTP
Sbjct  242   FDANHDTLIWALKKNGFGNLPVIVGEIGWPTDGDMNANIQYAQRFNQGFMTHIATGQGTP  301

Query  1015  VHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNV  1194
             +  G ++ YLFSL DE+ KSI PG FERHWGIF YDG PK+ ++  G  N    V AKNV
Sbjct  302   MRPGPIDAYLFSLIDEDEKSIQPGNFERHWGIFTYDGLPKYQLNL-GTSNSGGLVRAKNV  360

Query  1195  PYLPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYF  1371
              YL  +WCVL  +   D   V  ++ YAC+ +DC++L    SC D+D     SYAFN Y+
Sbjct  361   NYLDKKWCVLKPSVNLDDSRVAPSVSYACANADCTSLGYKTSCGDMDTRGNISYAFNSYY  420

Query  1372  QINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAVFAGI  1524
             Q N+QD  AC F  LA I   + ST  C F + +E+ +    GI+  F  I
Sbjct  421   QKNDQDDVACGFSNLATITNKDPSTGSCRFEIMIEADS----GISCTFWQI  467



>gb|AES75227.2| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=437

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/416 (54%), Positives = 295/416 (71%), Gaps = 6/416 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V GLGVNWGTQA   L P  +VQMLKDN I KVKLFD+D  T++   G+GIEV+  IPNN
Sbjct  23    VEGLGVNWGTQATHPLKPDTVVQMLKDNGIQKVKLFDADEETMSALGGSGIEVMVAIPNN  82

Query  361   QLERFADDLDNAKDWVKANISSH-IHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKN  537
             QL   +D  D A  WV+ N++ +    GGV IK+VAVGNEPFLKAYN SF ++ FPAL N
Sbjct  83    QLAEMSD-YDRALQWVRKNVTRYNFKSGGVNIKYVAVGNEPFLKAYNNSFLNVTFPALMN  141

Query  538   IQKALDEAGLGNKIKATIPQNADVYAS---GTGGPSEGNFRSDIRDLMIKICRYLRDHRA  708
             IQ AL++ GLG+ IKAT+P NADVY S       PS G FR D+ +LM +I ++L  + A
Sbjct  142   IQNALNQVGLGDSIKATVPLNADVYESPDSNNAVPSAGIFRPDLSELMTQIVQFLSKNNA  201

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCG  888
             PF VNIYPFLSLY N NFP ++AFFDG +  ++D G  YTN+FDAN DTL+ +L+    G
Sbjct  202   PFTVNIYPFLSLYGNDNFPFDYAFFDGVSNPINDNGVLYTNVFDANFDTLVSALKSIGFG  261

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             ++ + VGE+GWPTDG+KNAN++ A +FY G L ++A  +GTP  +G +E YLF L DE+A
Sbjct  262   NMPIFVGEVGWPTDGDKNANIQNALRFYNGLLPRLASNKGTPRRQGYIEVYLFGLIDEDA  321

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGR-GNDRMPVGAKNVPYLPAQWCVLDNEQKDS  1245
             KSI PG FERHWGIF +DGKPKFP+  + + G +++ VGAK+V YL  +WC+ +    + 
Sbjct  322   KSIEPGNFERHWGIFSFDGKPKFPMHVSNQHGQNKLLVGAKDVHYLDPKWCMFNPNANNL  381

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               +  N+ YAC+ +DC+ L  G+SCN+LD    ASYAFNMY+Q+ NQ+  ACNFEG
Sbjct  382   SNLADNINYACTFADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQNDLACNFEG  437



>gb|KDP39750.1| hypothetical protein JCGZ_02770 [Jatropha curcas]
Length=463

 Score =   466 bits (1198),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 232/464 (50%), Positives = 310/464 (67%), Gaps = 5/464 (1%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
             +AS V  +G NWGTQA   L P  +V++L DN I KVKLFD+D+ T+     +GIEV+ G
Sbjct  1     MASEVSCIGANWGTQATHPLPPDTVVRLLLDNRIQKVKLFDADYDTLRALGKSGIEVMVG  60

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPA  528
             IPN+ L   A  +  A+ WV  N+S+HI    V I++VAVGNEPFL+ YNGSF    FPA
Sbjct  61    IPNDLLASMASSVKAAEKWVSKNVSTHISTNNVNIRYVAVGNEPFLETYNGSFIQSTFPA  120

Query  529   LKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRA  708
             L+N+Q AL +AGL N++K T+P NADVY S TG PS G+FR+DI DLMI I ++L D  +
Sbjct  121   LQNVQSALIKAGLSNQVKVTVPLNADVYESSTGLPSGGDFRADIHDLMINIVKFLSDSGS  180

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCG  888
             PF VNIYPF+SLY + NFPVE+AFFDG A  V+D G +Y NMFDAN DTL  +L+K   G
Sbjct  181   PFTVNIYPFISLYIDPNFPVEYAFFDGNATPVNDGGTSYYNMFDANYDTLASALQKNGFG  240

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             ++ +IVGEIGWPTDG+KNAN+  A++F +GF+  ++  +GTP+  G ++ YLFSL DE+A
Sbjct  241   NLPIIVGEIGWPTDGDKNANLVYAQRFNQGFMSHISDGKGTPLRPGPIDAYLFSLIDEDA  300

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK-DS  1245
             KSI PG FERHWGIF YDGK K+ ++  G  N  + V AKNV YL  +WCV+    K D 
Sbjct  301   KSIDPGNFERHWGIFTYDGKAKYALNL-GTANSGLLVEAKNVHYLERKWCVMKPSAKLDD  359

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKI  1425
               V  ++ +AC ++DC++L  G SC +LD     SYA N Y+QI NQ   AC FE ++ I
Sbjct  360   PNVAPSVSFACGLADCTSLGYGTSCGNLDARGNISYALNSYYQIQNQVDTACKFENVSMI  419

Query  1426  VKHNASTNGCLFPVALESAATRSG---GITAVFAGIFFFCLALL  1548
              K++ +T  C F + +E     +G       + AG+  F L +L
Sbjct  420   TKNDPTTGTCRFGIMIEQYYGGAGFPQKSLGLAAGLILFLLTIL  463



>ref|XP_010913808.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Elaeis guineensis]
Length=484

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 229/465 (49%), Positives = 318/465 (68%), Gaps = 9/465 (2%)
 Frame = +1

Query  124   GGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHW  303
             G V++  W     + L   V G+GVNWGTQA+  L P  +V+ML+DN I +VKLFD +  
Sbjct  7     GLVKVVSW-----LCLVGVVSGIGVNWGTQASHPLPPGTVVRMLRDNGIQQVKLFDPEDS  61

Query  304   TVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPF  483
              +   + +GI+V+ GIPN  L   A  +  A+DWV  N+SS+I DG V I++VAVGNEPF
Sbjct  62    VMGALSKSGIQVMVGIPNEMLAGLASSMKAAEDWVSKNVSSYIKDG-VDIRYVAVGNEPF  120

Query  484   LKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIR  663
             L+ YNGSF    FPAL+NIQ AL +AG+ +++K TIP NADVY S +G PS+G+FR +I 
Sbjct  121   LETYNGSFLQTTFPALQNIQGALIKAGVSSQVKVTIPLNADVYESSSGKPSDGDFRMNIH  180

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGR-AKSVHDKGATYTNMFD  840
             DLM+ I ++L D+ APF VNIYPF+SLY + NFPV++AFFDG+ A  V D   TYTN+FD
Sbjct  181   DLMVSIIKFLSDNGAPFTVNIYPFISLYNDPNFPVDYAFFDGQPASPVVDGSITYTNVFD  240

Query  841   ANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVH  1020
             AN DTL+W+L+K   G++++IVGEIGWPTDG+ NAN++ A++F +GFL+++A  +GTP+ 
Sbjct  241   ANHDTLVWALQKNGYGNLSIIVGEIGWPTDGDMNANIQYAQRFNQGFLKRVASGQGTPMR  300

Query  1021  KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPY  1200
              G ++ YLFSL DE+ KSI PG FERHWGIF YDG+ K+ +  +   +  + VGAKNV Y
Sbjct  301   PGPIDAYLFSLIDEDQKSIQPGNFERHWGIFYYDGQTKYQLSISTSKSGTL-VGAKNVKY  359

Query  1201  LPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQI  1377
             L  +WCV   +   D   V   + YAC+ +DC++L    SC DLD     SYAFN Y+Q+
Sbjct  360   LDKKWCVFKPSVNLDDSRVPPAVSYACAKADCTSLGYKTSCGDLDARGNVSYAFNSYYQV  419

Query  1378  NNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAV  1512
             N+QD  AC+F+G+      + ST+ C F + +E+ +  S  + AV
Sbjct  420   NDQDNRACDFQGIGTTTDRDPSTSTCRFEIMIEAGSATSRRLAAV  464



>ref|XP_004508564.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=485

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 232/466 (50%), Positives = 311/466 (67%), Gaps = 5/466 (1%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             I +AS  +G+GVNWGT A   L P+ +V+ML++N  DK+KLFD+D W +    GT IEV+
Sbjct  20    ISMASCGYGVGVNWGTMATHQLPPNKVVKMLQENGFDKLKLFDADEWLMAALLGTDIEVM  79

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
               IPNN LE  + +   A  WV  N++++++ GG+ IK++AVGNEPFLK YNG++     
Sbjct  80    LAIPNNMLEEISKNPKAADSWVYENVTNYLYPGGLNIKYIAVGNEPFLKEYNGTYLMYTL  139

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLR  696
             PALKNIQ +L+ AG G+ IKAT+P NADVY S      PS G+FR +++DL I+I  +L 
Sbjct  140   PALKNIQTSLNNAGHGSNIKATVPFNADVYYSPDTNQVPSAGDFRPEVKDLTIEIIHFLY  199

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
              + APF VNIYPFLSLY N +FP +FAFFDG  K + D    YTN+FDANLDTL+WSL K
Sbjct  200   TNNAPFTVNIYPFLSLYGNDHFPFDFAFFDGSNKPLLDGNWVYTNVFDANLDTLLWSLEK  259

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A   D++V++GE+GWPTDG+ NAN   A++F  G L+      GTP  KG+++ YLFSL 
Sbjct  260   AGYPDMHVVIGEVGWPTDGDINANTLNAKRFNNGLLKHALNGNGTPKRKGIIDIYLFSLI  319

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTG-RGNDRMPVGAKNVPYLPAQWCVLDNE  1233
             DENAKSI PG FERHWGIF +DGKPK+ +D  G + +++  V  + V YL  QWC+LD +
Sbjct  320   DENAKSIDPGNFERHWGIFEFDGKPKYELDLRGFQSDNKGLVAVEGVKYLGKQWCILDPD  379

Query  1234  QKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEG  1413
               D H +  ++ YACS+SDC+AL  G+SCN L +   ASYAFNMY+Q+NNQ    C+F G
Sbjct  380   VTDLHYLPGSIDYACSLSDCTALGFGSSCNGLSLQGNASYAFNMYYQVNNQRDWDCDFSG  439

Query  1414  LAKIVKHNASTNGCLFPVALE--SAATRSGGITAVFAGIFFFCLAL  1545
             LA +   + S  GC FP+ +   S      G+ A+   I F    L
Sbjct  440   LAILTDDDPSEKGCQFPIMISHGSCLLSCKGVLAIALYIIFVVFLL  485



>ref|XP_004296615.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 225/450 (50%), Positives = 305/450 (68%), Gaps = 4/450 (1%)
 Frame = +1

Query  136   LAIWTGFAV--ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             ++IW  F +  +++   V G+G NWGTQA+  L P  +V +L+ N I KVKLFD+D+ T+
Sbjct  9     ISIWVVFLISNLMMCGVVSGIGANWGTQASHPLPPDSVVSLLRQNGIQKVKLFDADYDTL  68

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
                  +GIEV+ GIPN+ L   A  +  A+ WV  N+S+HI    VKI++VAVGNEPFL+
Sbjct  69    TNLGKSGIEVMVGIPNDMLASLASSVKAAEKWVSKNVSAHISSNNVKIRYVAVGNEPFLE  128

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDL  669
              YNGSF   +FPALKN+Q AL +AG+ N++K T+PQNADVY S  G PS G+FR++I DL
Sbjct  129   TYNGSFLRTIFPALKNVQSALIKAGISNQVKVTVPQNADVYESSNGLPSGGDFRTEIHDL  188

Query  670   MIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANL  849
             M++I ++L D+ APF VNIYPF+SLY + NFPV++AFFDG A  + D   TY NMFDAN 
Sbjct  189   MLQIIKFLSDNGAPFTVNIYPFISLYIDANFPVDYAFFDGNASPITDGSLTYYNMFDANY  248

Query  850   DTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGV  1029
             DTL W+L+K   G++ +IVGEIGWPTDG++NAN+  A+KF +GF+  +    GTP+  G 
Sbjct  249   DTLAWALQKNGFGNLPIIVGEIGWPTDGDQNANLVYAQKFNQGFMSHILSGRGTPMRPGP  308

Query  1030  VEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPA  1209
             ++ YLFSL DE++KSI PG FERHWGIF +DG PK+ ++  G  N    V AK V YL  
Sbjct  309   IDAYLFSLIDEDSKSIDPGNFERHWGIFTFDGIPKYQLNL-GTTNSGSVVAAKGVHYLER  367

Query  1210  QWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQ  1386
             +WCV+  +   D   V  ++ YAC ++DC++L  G SC +LD     SYAFN Y+Q+NNQ
Sbjct  368   KWCVMRPSASLDDPQVALSMSYACGLADCTSLGYGTSCGNLDARGNISYAFNSYYQMNNQ  427

Query  1387  DVEACNFEGLAKIVKHNASTNGCLFPVALE  1476
                AC F  L+ I K N S   C F + +E
Sbjct  428   LDVACKFPNLSMITKTNPSVGSCRFEIMIE  457



>ref|XP_009390478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390479.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390480.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390481.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390482.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
Length=475

 Score =   466 bits (1198),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/478 (49%), Positives = 322/478 (67%), Gaps = 5/478 (1%)
 Frame = +1

Query  121   VGGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDH  300
             +G + LA      + LL S V G+G NWGTQA+  L+P+ +VQMLK+N   KVKLFD++ 
Sbjct  1     MGWISLAFGVLSWICLLVS-VGGIGANWGTQASHPLSPTTVVQMLKENGFQKVKLFDAEE  59

Query  301   WTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEP  480
              T++    +G+EV+ GIPN+ L   A  +  A +WV  N+S++I+DG V I++VAVGNEP
Sbjct  60    GTMSALRKSGLEVMVGIPNDMLAMLATSMKAANNWVSNNVSAYINDG-VNIRYVAVGNEP  118

Query  481   FLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDI  660
             FL+ YNGSF    FPAL+NIQ AL +AGL N++K T PQNADVYAS +G PS+G+FRSDI
Sbjct  119   FLQTYNGSFLQTTFPALQNIQGALIKAGLSNQVKVTTPQNADVYASPSGRPSDGDFRSDI  178

Query  661   RDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFD  840
             RDLM+ I ++L D+ APF VNIYPF+SLY + NFPV++AFF+G + +V D   TY+NMFD
Sbjct  179   RDLMLAIVKFLNDNAAPFTVNIYPFISLYSDPNFPVDYAFFEGSSSAVVDGSVTYSNMFD  238

Query  841   ANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVH  1020
             ANLDTL+W+++K    ++ +IVGEIGWPTDG+ NAN++ A+KF +GF+  ++  +GTP+ 
Sbjct  239   ANLDTLVWAMKKNGFPNLPIIVGEIGWPTDGDMNANVQYAQKFNQGFMNHISSGQGTPMR  298

Query  1021  KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPY  1200
              G ++ YLFSL DE+ KSI PG FERHWGI+ YDG PK+ ++  G       + AKN+ Y
Sbjct  299   AGPIDAYLFSLIDEDQKSIQPGNFERHWGIYTYDGWPKYQLNL-GTTKTGTLLRAKNIQY  357

Query  1201  LPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQI  1377
             L  +WCVL  +   D+  V  ++ YAC+ +DC++L    SC DLD     SYAFN ++Q 
Sbjct  358   LDKKWCVLKPSVNLDNSKVAPSISYACANADCTSLGYKTSCGDLDARGNISYAFNSFYQK  417

Query  1378  NNQDVEACNFEGLAKIVKHNASTNGCLFPVA-LESAATRSGGITAVFAGIFFFCLALL  1548
             N+QD  AC FE LA     + ST  C F V  +  +  R  G   + + +    L L 
Sbjct  418   NDQDDVACGFENLATTTNKDPSTGTCRFGVMIIADSGIRYQGAGLILSVLLSLFLTLF  475



>ref|XP_011003008.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Populus euphratica]
 ref|XP_011013771.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Populus euphratica]
Length=502

 Score =   466 bits (1199),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/444 (51%), Positives = 304/444 (68%), Gaps = 4/444 (1%)
 Frame = +1

Query  175   SPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIP  354
             S V G+GVNWGTQA   L PS +V ML+DN   KVKLFD+D  T+N FA +GI+++ GIP
Sbjct  36    SSVSGIGVNWGTQATHPLPPSTVVSMLRDNGFQKVKLFDADSATLNAFANSGIQIMVGIP  95

Query  355   NNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALK  534
             N+ L   A+    A++WV  N+SSHI  GGV I++VAVGNEPFL AYNGSF  +  PAL+
Sbjct  96    NDMLYTLANSEQAAENWVAKNVSSHISSGGVDIRYVAVGNEPFLSAYNGSFLGITLPALQ  155

Query  535   NIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPF  714
             NIQ AL +AGL  ++K T+P NADVY S T  PS+GNFRSDI+DLM+ I ++L D+ APF
Sbjct  156   NIQSALTKAGLDTRVKVTVPLNADVYESPTNLPSDGNFRSDIQDLMLSIVKFLSDNGAPF  215

Query  715   MVNIYPFLSLYENKNFPVEFAFFDGR-AKSVHDKGATYTNMFDANLDTLIWSLRKAKCGD  891
              VNIYPF+SLY N NFP+ FAFF+ R + S++D G  Y N+FDAN DTL+W+L+K   G+
Sbjct  216   TVNIYPFISLYTNPNFPLGFAFFNNRSSSSLNDGGKIYDNVFDANHDTLVWALQKNGYGN  275

Query  892   VNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAK  1071
             +++++GEIGWPTDG+KNAN+  A++F +GF+  +   +GTP+    V+ YLFSL DE+AK
Sbjct  276   LSIVIGEIGWPTDGDKNANLNYAQQFNQGFMNNVNAGKGTPMRPAPVDAYLFSLVDEDAK  335

Query  1072  SIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSH  1248
             SI PG FERHWG+F  DG+PK+ +   G  N    V A+ V YL  +WC++  +   D  
Sbjct  336   SIQPGNFERHWGLFYLDGQPKYALSL-GTTNSNGLVPARGVSYLAQKWCIMSPSASLDDP  394

Query  1249  AVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF-EGLAKI  1425
              V  ++ YAC+ +DC++L  G SC DL      SYAFN Y+Q NNQ   AC F   L+ +
Sbjct  395   QVAPSVSYACASADCTSLGYGTSCGDLSAQGNISYAFNSYYQQNNQLESACRFPNNLSVV  454

Query  1426  VKHNASTNGCLFPVALESAATRSG  1497
               ++ ST  C F + ++S    SG
Sbjct  455   TSNDPSTGTCKFRIMIQSQTVTSG  478



>ref|XP_004982257.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Setaria italica]
Length=495

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 242/458 (53%), Positives = 307/458 (67%), Gaps = 12/458 (3%)
 Frame = +1

Query  136   LAIWTGFAVILLAS-PVHG-LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTV  309
             LA+     V L+A  P  G LGVNWGT A   L    +V+ML+DN I KVKLFD+D   +
Sbjct  9     LAVMAALVVALVAGLPAAGALGVNWGTMATHRLPSGTVVRMLQDNGIRKVKLFDADPGPM  68

Query  310   NFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLK  489
             +  AG+GIEV+ GIPNN L+   D    A+DWV  N+S +  DGGV IK+VAVGNEPFL 
Sbjct  69    DALAGSGIEVMVGIPNNMLDMMTD-YGTARDWVHENVSRYNFDGGVTIKYVAVGNEPFLS  127

Query  490   AYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIR  663
             A+NG+F ++  PAL+NIQ+ALD+AGLG  IKAT+P NADVY S    P  S G FRSDI 
Sbjct  128   AFNGTFLNVTLPALQNIQRALDDAGLGESIKATVPLNADVYNSPVSNPVPSAGRFRSDIA  187

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA--TYTNMF  837
             DLM +I ++L    APF VNIYPFLSLY +  FP+++AFFDG +  V D G+  TYTN+F
Sbjct  188   DLMTEIVQFLNQSGAPFTVNIYPFLSLYGSDGFPLDYAFFDGTSSPVVDAGSGITYTNVF  247

Query  838   DANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPV  1017
             DAN DTL+ +L  A  G + V+VGE+GWPTDG+ +A    A+KFY G LRK+A   GTP+
Sbjct  248   DANFDTLVSALAAAGAGGLPVVVGEVGWPTDGDTHATAAYAQKFYAGLLRKLAANAGTPL  307

Query  1018  HKG-VVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGR--GNDRMPVGA-  1185
                  +E YLFSL DE+AKS+APG FERHWGI  YDG+PK+P+D +G   GN        
Sbjct  308   RPSQYIEVYLFSLIDEDAKSVAPGNFERHWGIVRYDGQPKYPMDLSGGQGGNAAPAALVA  367

Query  1186  -KNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFN  1362
              + V YLP QWCV +    D+  +   + YACS+SDC+AL  G+SCN LD    ASYAFN
Sbjct  368   ARGVQYLPRQWCVANPNAPDTSRISDGVAYACSLSDCTALGYGSSCNGLDAAGNASYAFN  427

Query  1363  MYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALE  1476
             MYFQ+ NQ   +C+F+GLA     N ST+ C F + +E
Sbjct  428   MYFQVQNQAEGSCDFQGLAVTTAQNPSTDACNFTIQIE  465



>gb|KDP32321.1| hypothetical protein JCGZ_13246 [Jatropha curcas]
Length=489

 Score =   465 bits (1197),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 217/441 (49%), Positives = 303/441 (69%), Gaps = 2/441 (0%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             + +AS V  +GVNWGT     L P  ++ M++DN   ++KLF++D   +    GT IEV+
Sbjct  1     MTMASRVTTIGVNWGTMTTHLLRPENVINMMRDNGFQRLKLFEADERIMAALIGTDIEVM  60

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
               IPN  L++ ++D   A +WV AN++S ++ GGV IK+VAVGNEPFL+ YNGS+  +  
Sbjct  61    LAIPNYMLQQMSEDPAAATNWVDANVTSWLYSGGVNIKYVAVGNEPFLQTYNGSYLQVTL  120

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGG--PSEGNFRSDIRDLMIKICRYLR  696
             PAL+NIQ AL+ A +G+++KAT+P NADVY S      PS G+FR ++RD  ++I ++L 
Sbjct  121   PALRNIQLALNHAKIGSRVKATVPFNADVYYSPDPNQIPSAGDFRPEVRDPTLEIIQFLH  180

Query  697   DHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRK  876
              + APF VNIYPFLSLY ++NFPV+FAFFDG    + D    YTN+FDAN DTL+W+L K
Sbjct  181   SNDAPFTVNIYPFLSLYSDENFPVDFAFFDGAKNPIKDGNLVYTNVFDANFDTLVWALNK  240

Query  877   AKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLT  1056
             A   D+ ++VGE+GWPTDG+KNAN++ A+KF +G ++ +   +GTP  KG ++ YLFSL 
Sbjct  241   AGYPDMKILVGEVGWPTDGDKNANIQNAKKFNQGLIQHVLSGKGTPARKGKIDVYLFSLI  300

Query  1057  DENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQ  1236
             DENAKSIAPG FERHWGIF YDGKPK+ +D +G   D+     + V Y+  +WCVL+ + 
Sbjct  301   DENAKSIAPGSFERHWGIFEYDGKPKYELDLSGLKEDKALAPVEGVKYMLRRWCVLNPDA  360

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
              D   +  ++ YACS+SDC++L  G+SCN L +   ASYAFNMY+Q+NNQ    C+F GL
Sbjct  361   SDLEELPDSINYACSLSDCTSLGYGSSCNHLSVEGNASYAFNMYYQVNNQKDWTCDFSGL  420

Query  1417  AKIVKHNASTNGCLFPVALES  1479
             A I   + S   C FP+ + S
Sbjct  421   AAITDQDPSDGDCEFPIMIAS  441



>ref|XP_010928748.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Elaeis guineensis]
Length=485

 Score =   465 bits (1197),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 311/464 (67%), Gaps = 8/464 (2%)
 Frame = +1

Query  163   ILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVL  342
             + L   V G+G NWGTQA+  L P  +VQML++N   KVKLFD +   ++  + +GI+V+
Sbjct  15    LCLVGFVSGIGANWGTQASNPLPPGTVVQMLRNNGFQKVKLFDPEDDVMSALSNSGIQVM  74

Query  343   PGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVF  522
              GIPN  L   A     A+DWV  N+SS+I +G V I++VAVGNEPFL+ YNGS+     
Sbjct  75    VGIPNEMLASLASGTKAAEDWVSNNVSSYIKEG-VDIRYVAVGNEPFLQTYNGSYLQTTL  133

Query  523   PALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDH  702
             PAL+NIQ AL +AGL N++K T+P NADVY S +G PS+G+FR+DI DLM+ I ++L D 
Sbjct  134   PALQNIQGALIKAGLSNQVKVTVPLNADVYESSSGKPSDGDFRTDIHDLMVSIVQFLSDS  193

Query  703   RAPFMVNIYPFLSLYENKNFPVEFAFFDGR-AKSVHDKGATYTNMFDANLDTLIWSLRKA  879
              APF VNIYPF+SLY++ NFP+++AFF+G  A  V D   TYTN+FDAN DTLIW+L+K 
Sbjct  194   AAPFTVNIYPFISLYDDPNFPIDYAFFNGTPASPVVDGSITYTNVFDANHDTLIWALKKN  253

Query  880   KCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTD  1059
               G++ VIVGEIGWPTDG+ NAN++ A++F +GF+++++  +GTP+  G ++ YLFSL D
Sbjct  254   GFGNLTVIVGEIGWPTDGDMNANIQYAQQFNQGFMQRISSGQGTPMRSGAIDAYLFSLID  313

Query  1060  ENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLD-NEQ  1236
             E+ KSI PG FERHWGIF YDG+PK+ +  +   N    VGAKNV YL  QWCV   +  
Sbjct  314   EDQKSIQPGNFERHWGIFYYDGQPKYQLTVS-TSNSGTLVGAKNVKYLDQQWCVFKPSVN  372

Query  1237  KDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGL  1416
              D   V   + YAC   DC++L    SC DLD     SYAFN Y+Q+N+QD  AC+F+G+
Sbjct  373   LDDSRVAPAVSYACGRGDCTSLGYKTSCGDLDARGNISYAFNSYYQMNDQDDRACDFQGI  432

Query  1417  AKIVKHNASTNGCLFPVALESAAT----RSGGITAVFAGIFFFC  1536
             A I   N S + C F + ++ A +    R   +    AG+ F+ 
Sbjct  433   ATITNSNPSNSTCRFEIMIDDAGSATSWRLAAVGGQGAGLVFYA  476



>ref|XP_007013263.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY30882.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=491

 Score =   465 bits (1197),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 305/462 (66%), Gaps = 12/462 (3%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWGT A   L P+ +V ML+DN +DK+KLF+ +   +    GT IEV+ GIPN+ L+
Sbjct  30    VGVNWGTMATHQLPPNKVVNMLRDNGVDKLKLFEYNEGIMTALTGTDIEVMVGIPNSMLK  89

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               ++D   A  +V  NIS + +DGGV IK++AVGNEPFL+ YNG++     PALKNIQKA
Sbjct  90    EMSEDPAAAASYVYNNISGYCYDGGVNIKYIAVGNEPFLQTYNGTYLPYTLPALKNIQKA  149

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
             LDE+G+    KAT+P NAD+Y S    P  S G+FR +++DL I+I ++L  H APF VN
Sbjct  150   LDESGVKCHYKATVPFNADIYNSPESNPVPSAGDFRPEVKDLAIEIIQFLYLHEAPFTVN  209

Query  724   IYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNVI  903
             IYPFLSLY N  FPVEFAFFDG +K + D    Y N FDANLDTLI++L KA   D+ VI
Sbjct  210   IYPFLSLYGNDYFPVEFAFFDGASKPLRDGTNVYRNAFDANLDTLIYALSKAGFSDMEVI  269

Query  904   VGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIAP  1083
             VGE+GWPTDG+KNAN++ A++F +G ++      GTP  KG +E YLFSL DENAKSI P
Sbjct  270   VGEVGWPTDGDKNANIQNAKRFNQGLIKHALSGTGTPARKGKIEVYLFSLLDENAKSIEP  329

Query  1084  GEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGSN  1263
             G FERHWGIF +DGKPK+ +D TG   D+     ++V Y   +WCVL+ +  D   +  +
Sbjct  330   GGFERHWGIFEFDGKPKYELDLTGLEVDKGLAPVEDVKYQQKRWCVLNTQATDMGELPKS  389

Query  1264  LGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNAS  1443
             + YACS+SDC+AL  G+SCN L     ASYAFNMY+Q+NNQ    C+F GLA +   N S
Sbjct  390   IDYACSLSDCTALGYGSSCNHLTAEGNASYAFNMYYQVNNQHFWDCDFSGLATVTDENPS  449

Query  1444  TNGCLFPV--ALESAATRSGG--------ITAVFAGIFFFCL  1539
               GC FPV  A  S+    GG        +  VF  +F F L
Sbjct  450   EEGCQFPVMIAYGSSMLLHGGDLLDVSLRLVGVFVVLFSFLL  491



>ref|XP_008458070.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Cucumis melo]
Length=496

 Score =   465 bits (1197),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 229/466 (49%), Positives = 312/466 (67%), Gaps = 15/466 (3%)
 Frame = +1

Query  190   LGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNNQLE  369
             +GVNWGT A   L P  +V+ML++N   K+KLF++D   +    GT IEV+  IPN+ L 
Sbjct  27    VGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGTDIEVMLAIPNSMLF  86

Query  370   RFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNIQKA  549
               + D   A  WV +N++++ + GGVKIK+VAVGNEPFLK+YNG++  L  PAL+NIQ+A
Sbjct  87    LMSQDPQAAASWVDSNVTAYTYHGGVKIKYVAVGNEPFLKSYNGTYLQLTLPALRNIQQA  146

Query  550   LDEAGLGNKIKATIPQNADVYASGTGGP--SEGNFRSDIRDLMIKICRYLRDHRAPFMVN  723
             L++AGLG+K+KATIP NAD+Y S    P  S G FR D+RDL I+I  YL  + APF VN
Sbjct  147   LNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLAIEILHYLSINNAPFTVN  206

Query  724   IYPFLSLYENKNFPVEFAFFDGRA-KSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             IYPFLSLY N  FP++FAFFDG A K + D+  TYTN+FDAN DTL+ +L KA   D+ +
Sbjct  207   IYPFLSLYGNDYFPIDFAFFDGTAYKPIKDRDLTYTNVFDANFDTLVSALAKAGYPDMKI  266

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGE+GWPTDG+K+AN++ A++F +G LR     EGTP   G+++ YLFSL DENAKSI 
Sbjct  267   IVGEVGWPTDGDKHANIQNAKRFNQGLLRHALSGEGTPARVGIIDIYLFSLIDENAKSIE  326

Query  1081  PGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQKDSHAVGS  1260
             PG FERHWGIF +DGKPK+ +D  G   ++  +  + V Y+  +WCVL+    D   +  
Sbjct  327   PGSFERHWGIFEFDGKPKYELDLAGTEEEKGLIPVEGVRYMGKRWCVLNPNVNDWEGLAD  386

Query  1261  NLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKHNA  1440
             ++ YACS+SDC+AL  G+SCN L     ASYAFNMY+Q+NNQ    C+F+GLA + + + 
Sbjct  387   SVDYACSLSDCTALEYGSSCNQLTAQGNASYAFNMYYQVNNQKSWNCDFDGLAVVTQQDP  446

Query  1441  STNGCLFPVALESAATRSGG------------ITAVFAGIFFFCLA  1542
             S   CLFP+ ++  ++ S              + A+F GI  F + 
Sbjct  447   SYGNCLFPIMIDYTSSSSSSSSFLVDERFFDLLVAIFMGIVVFLMV  492



>ref|XP_008776624.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Phoenix dactylifera]
Length=483

 Score =   464 bits (1195),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 312/465 (67%), Gaps = 10/465 (2%)
 Frame = +1

Query  124   GGVRLAIWTGFAVILLASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHW  303
             G ++L  W     + L   V G+G NWGTQA+  L P  +VQML+DN   KVKLFD +  
Sbjct  7     GCLKLVSW-----LCLVGFVSGIGANWGTQASHPLPPGTVVQMLRDNGFQKVKLFDPEDG  61

Query  304   TVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPF  483
             T++  + TGI+V+ GIPN  L         A++WV  N+SS+I DG V I++VAVGNEPF
Sbjct  62    TMSALSNTGIQVMVGIPNEMLADLGS-TKAAENWVSKNVSSYIKDG-VDIRYVAVGNEPF  119

Query  484   LKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIR  663
             L+ YNGSF    FPAL+NIQ A+ +AGL +++K T+P NADVY S TG PS+GNFRSDI 
Sbjct  120   LQTYNGSFLHTTFPALQNIQGAVTQAGLSSQVKVTVPLNADVYESSTGKPSDGNFRSDIL  179

Query  664   DLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGR-AKSVHDKGATYTNMFD  840
             DLM+ I +YL D+ AP  VNIYPF+SLY + NFP++FAFFDG  A  V D   TYTN+FD
Sbjct  180   DLMVSIVKYLSDNAAPLTVNIYPFISLYNDPNFPIDFAFFDGTPASPVVDGSITYTNVFD  239

Query  841   ANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVH  1020
             AN DTL+W+L+K   G++ VIVGEIGWPTDGN  AN++ A++F +GF++++A  +GTP+ 
Sbjct  240   ANHDTLLWALQKNGFGNLAVIVGEIGWPTDGNMYANIQYAQRFNQGFMKRIASGQGTPMR  299

Query  1021  KGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPY  1200
             +G ++ Y+FS  DE+ KSI PG FERHWGIF YDG+PK+ ++     +  + VGAKNV Y
Sbjct  300   QGPIDAYMFSFIDEDQKSILPGNFERHWGIFYYDGQPKYQLNIQTSKSGTL-VGAKNVKY  358

Query  1201  LPAQWCVLD-NEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQI  1377
             L  +WCV   +   D   V     YAC  +DC++L    SC DLD     SYAFN Y+Q+
Sbjct  359   LDKKWCVFKPSVNLDDSRVAPAASYACGKADCTSLGYNTSCGDLDARGNISYAFNSYYQM  418

Query  1378  NNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAATRSGGITAV  1512
             N+QD  ACNF+G+A     + ST+ C F + +E  +  S  + AV
Sbjct  419   NDQDDRACNFQGIATTTDRDPSTSKCKFEIMIEPDSAASWRLAAV  463



>gb|EPS71987.1| hypothetical protein M569_02770, partial [Genlisea aurea]
Length=461

 Score =   464 bits (1193),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 220/434 (51%), Positives = 299/434 (69%), Gaps = 4/434 (1%)
 Frame = +1

Query  181   VHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPGIPNN  360
             V G+G NWG+QA+  L P  +V+ML DN + KVKLFD+D+ T+     TGIEV+ GIPN+
Sbjct  1     VAGIGANWGSQASHLLPPETVVRMLLDNGVQKVKLFDTDYDTLRALGRTGIEVMVGIPND  60

Query  361   QLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPALKNI  540
              L   A +   A  WV  N+S H+ +  V I++VAVGNEPFL  YNGSF    FPAL+N+
Sbjct  61    MLSSLATNSRAADKWVSQNVSHHLQNSNVTIRYVAVGNEPFLATYNGSFLRTTFPALRNV  120

Query  541   QKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRAPFMV  720
             Q+AL +AGL N+IK T+P NADVY+S    PS G+FR+DI D MI+I ++L D+RAPF +
Sbjct  121   QQALTKAGLQNQIKVTVPLNADVYSSSNSLPSGGDFRADIHDYMIQIVQFLNDNRAPFTI  180

Query  721   NIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCGDVNV  900
             NIYPF+SLY + NFPVE+AFFDG A  V+D G +Y NMFDAN DTL+W+L+K   G + +
Sbjct  181   NIYPFISLYTDPNFPVEYAFFDGNASPVNDGGTSYYNMFDANHDTLVWALQKNGFGSLPI  240

Query  901   IVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENAKSIA  1080
             IVGEIGWPTDG++NAN++ A++F +GF+  ++   GTP+  G ++ YLFSL DE+ KSI 
Sbjct  241   IVGEIGWPTDGDRNANIQYAQRFNQGFMTHISGGRGTPMRPGPIDAYLFSLIDEDEKSIQ  300

Query  1081  PGEFERHWGIFGYDGKPKFPIDF-TGRGNDRMPVGAKNVPYLPAQWCVLD-NEQKDSHAV  1254
             PG FERHWGI  YDG+PK+P++     G   +PV  +NV YL  +WC++  N + D   V
Sbjct  301   PGNFERHWGILTYDGQPKYPLNLGISNGGSLIPV--RNVTYLDRKWCIMKPNARLDDPQV  358

Query  1255  GSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNFEGLAKIVKH  1434
               ++ YACS++DC++L    SC+ LD     SYAF+ Y+Q NNQ  EAC F GL  + + 
Sbjct  359   APSVSYACSLADCTSLGYLTSCSGLDARGNISYAFDSYYQKNNQLDEACKFNGLGTVTRA  418

Query  1435  NASTNGCLFPVALE  1476
             + S   C F V ++
Sbjct  419   DPSIGNCRFNVMIK  432



>ref|XP_010252157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Nelumbo nucifera]
Length=483

 Score =   464 bits (1194),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 235/466 (50%), Positives = 309/466 (66%), Gaps = 7/466 (2%)
 Frame = +1

Query  169   LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVNFFAGTGIEVLPG  348
             L   V G+G NWGTQ++  L PS +V++L+DN   KVKLFD+D  T+     TGIEV+ G
Sbjct  16    LVVSVGGIGANWGTQSSHPLPPSTVVRLLRDNGFQKVKLFDADSATLRALGKTGIEVMVG  75

Query  349   IPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKAYNGSFKDLVFPA  528
             IPN+ L   A  +  A+ WV  N+SS I + GV IK+VAVGNEPFL+ YNGSF    FPA
Sbjct  76    IPNDMLATIAGSMKAAEKWVSNNVSSPISNDGVNIKYVAVGNEPFLETYNGSFLTTTFPA  135

Query  529   LKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLMIKICRYLRDHRA  708
             L+NIQ AL ++GL +++K TIP NADVY S T  PS G+FRSDI DLMI I ++L D+  
Sbjct  136   LQNIQSALIKSGLSSQVKVTIPLNADVYQSTTDAPSGGDFRSDIHDLMITIVKFLSDNGG  195

Query  709   PFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLDTLIWSLRKAKCG  888
              F VNIYPFL LY + NFPV++AFFD     V D G  Y NMFDANLDTL+W+L+K   G
Sbjct  196   SFTVNIYPFLGLYTDPNFPVDYAFFDSTTARVTDNGNAYYNMFDANLDTLVWALQKNGYG  255

Query  889   DVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVVEFYLFSLTDENA  1068
             ++ +IVGEIGWPTDG+KNANM  A++F +GF+  ++  +GTP+  G+++ YLFSL DE+A
Sbjct  256   NLPIIVGEIGWPTDGDKNANMDYAQRFNQGFMNHISTGKGTPMRPGLIDAYLFSLIDEDA  315

Query  1069  KSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQWCVLDNEQK-DS  1245
             KSIAPG FERHWGIF YDG PK+ ++  G  N    V A+NV YL  +WCV+  +   D 
Sbjct  316   KSIAPGYFERHWGIFYYDGVPKYMLNL-GTTNSGTLVPARNVHYLEKKWCVMSPKANLDD  374

Query  1246  HAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQDVEACNF-EGLAK  1422
               V  ++ YACS++DC++L  G SC +LD     SYAFN Y+QINNQ   AC F + L+ 
Sbjct  375   SQVAPSVSYACSLADCTSLGYGTSCGNLDARGNISYAFNNYYQINNQLDSACQFPDHLSI  434

Query  1423  IVKHNASTNGCLFPVALE----SAATRSGGITAVFAGIFFFCLALL  1548
             I K + S   C F + ++     +  R+G +      + F  L LL
Sbjct  435   ITKTDPSIGSCRFGIMIQPYIGGSEQRTGCLRKKVHLVLFMFLILL  480



>ref|XP_008466353.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Cucumis melo]
Length=488

 Score =   464 bits (1194),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 303/449 (67%), Gaps = 7/449 (2%)
 Frame = +1

Query  145   WTGFAVILLAS----PVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKLFDSDHWTVN  312
             W  F V+LL+S     V G+GVNWGTQA   L P  +V+MLKDN I KVKLFD+D   + 
Sbjct  10    WRFFLVLLLSSAAVSSVIGIGVNWGTQATHPLPPGTVVKMLKDNGIQKVKLFDADPVVLK  69

Query  313   FFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVAVGNEPFLKA  492
                 +GIEV+ GIPN+ L   A+ + +A++WV  N+SS+I  G V I++VAVGNEPFLK 
Sbjct  70    ALGKSGIEVMVGIPNDLLYSLANSIQSAENWVAKNLSSYISSGSVDIRYVAVGNEPFLKT  129

Query  493   YNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGPSEGNFRSDIRDLM  672
             +NGSF    FPAL+N+Q A+ +AGL N++K T+P NADVY + TG PS G+FRSDIRDLM
Sbjct  130   FNGSFIGTTFPALQNVQAAIVKAGLSNRVKVTVPMNADVYQTSTGLPSGGDFRSDIRDLM  189

Query  673   IKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGATYTNMFDANLD  852
             + I ++L D  +PF VNIYPF+SLYE+ +FP+++AFFDG + +++D G  Y N+F AN D
Sbjct  190   LSIVKFLSDSASPFTVNIYPFISLYEDPSFPIDYAFFDGFSHALNDNGQIYENVFTANYD  249

Query  853   TLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAKKEGTPVHKGVV  1032
             TL+ SL+K    ++++IVGEIGWPTDG++NAN++ A++F +GF+      +GTP+  G +
Sbjct  250   TLVSSLQKNGFPNMSIIVGEIGWPTDGDRNANLQFAKRFSQGFISHFLSGQGTPMRPGPI  309

Query  1033  EFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPVGAKNVPYLPAQ  1212
             + YLFSL DE+AKSI PG FERHWG+F YDG+PK+ +  T   N  +P  A NV YL  +
Sbjct  310   DVYLFSLIDEDAKSILPGNFERHWGLFYYDGRPKYMLQMTNSTNGLVP--ASNVKYLAKK  367

Query  1213  WCVL-DNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAFNMYFQINNQD  1389
             WCVL  +   D   +  ++ YAC   DC++L  G SC  LD     SYAFN Y+QI NQ 
Sbjct  368   WCVLAPSASIDDPQIAPSVSYACENGDCTSLGLGTSCGTLDARQNISYAFNSYYQIKNQL  427

Query  1390  VEACNFEGLAKIVKHNASTNGCLFPVALE  1476
               AC F  L+ I   + S   C F V  +
Sbjct  428   ASACKFPHLSVITTQDPSVGSCKFVVMTQ  456



>ref|XP_002281500.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
Length=485

 Score =   464 bits (1194),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 235/486 (48%), Positives = 316/486 (65%), Gaps = 12/486 (2%)
 Frame = +1

Query  121   VGGVRLAIWTGFAVIL-----LASPVHGLGVNWGTQAAQFLNPSIIVQMLKDNHIDKVKL  285
             +G  RL+ +    + L     + S   G+GVNWGT A   L P  +V+MLKDN   K+KL
Sbjct  1     MGEARLSCYHLLVLFLVMWMSMRSSGFGVGVNWGTMATHQLPPEKVVRMLKDNGFRKLKL  60

Query  286   FDSDHWTVNFFAGTGIEVLPGIPNNQLERFADDLDNAKDWVKANISSHIHDGGVKIKHVA  465
             F++D   +    GT IEV+  IPN  L   ++D   A  WV+AN+SS+ + GGV IK+VA
Sbjct  61    FEADERILEALTGTHIEVMLAIPNYMLPEMSEDPSVATSWVQANVSSYSYAGGVNIKYVA  120

Query  466   VGNEPFLKAYNGSFKDLVFPALKNIQKALDEAGLGNKIKATIPQNADVYASGTGGP--SE  639
             VGNEPFL+ YNG+F     PALKNIQ+AL+   L   +KAT+P NAD+Y S    P  S 
Sbjct  121   VGNEPFLQTYNGTFLKYTLPALKNIQQALNNEAL-ESVKATVPFNADIYYSPDSNPVPSA  179

Query  640   GNFRSDIRDLMIKICRYLRDHRAPFMVNIYPFLSLYENKNFPVEFAFFDGRAKSVHDKGA  819
             G+FR+++RDL I+I +YL  + APF VNIYPFLSLY N  FP+++AFFDG  K + D   
Sbjct  180   GDFRAEVRDLTIEIIQYLHSNDAPFTVNIYPFLSLYGNAYFPMDYAFFDGSNKPIKDGNN  239

Query  820   TYTNMFDANLDTLIWSLRKAKCGDVNVIVGEIGWPTDGNKNANMKMAEKFYKGFLRKMAK  999
              YTN+FDAN DTL+W+L +A   DV +IVGE+GWPTDG+KNAN+K A++F +G +  +  
Sbjct  240   VYTNVFDANFDTLVWALDRAGYPDVKIIVGEVGWPTDGDKNANVKNAKRFNQGLIHHVLS  299

Query  1000  KEGTPVHKGVVEFYLFSLTDENAKSIAPGEFERHWGIFGYDGKPKFPIDFTGRGNDRMPV  1179
              +GTP  KG +E YLFSL DENAKSIAPG FERHWGIF YDGKPK+ +D +G   ++  V
Sbjct  300   GKGTPARKGKIEAYLFSLIDENAKSIAPGCFERHWGIFEYDGKPKYELDVSGSRENKGLV  359

Query  1180  GAKNVPYLPAQWCVLDNEQKDSHAVGSNLGYACSMSDCSALVPGASCNDLDMPSRASYAF  1359
              A+ V Y+  +WCVL+    D   +  ++ YACSMSDC+AL  G+SCN L +   ASYAF
Sbjct  360   AAEGVKYMVRRWCVLNPNTDDLEDLPDSINYACSMSDCTALGYGSSCNHLSVAGNASYAF  419

Query  1360  NMYFQINNQDVEACNFEGLAKIVKHNASTNGCLFPVALESAAT----RSGGITAVFAGIF  1527
             NMY+Q+NNQ    C+F GL    + + S + CLFPV +   ++    R   + ++  G  
Sbjct  420   NMYYQVNNQQSWDCDFSGLGIETEEDPSDDECLFPVMIAHGSSLALHRLDFLASIVGGWM  479

Query  1528  FFCLAL  1545
              F L +
Sbjct  480   VFLLMV  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4696885476248