BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26292_g1_i1 len=2972 path=[2950:0-2971]

Length=2972
                                                                      Score     E

ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2        1050   0.0      
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2        1050   0.0      
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like   1019   0.0      
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like   1004   0.0      
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    954   0.0      
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         947   0.0      
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    946   0.0      
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                    943   0.0      
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    942   0.0      
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    941   0.0      
ref|XP_002529832.1|  electron carrier, putative                         934   0.0      Ricinus communis
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    933   0.0      
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   927   0.0      
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                926   0.0      
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         925   0.0      
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             924   0.0      
ref|XP_007050220.1|  Alcohol oxidase                                    922   0.0      
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             922   0.0      
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg                921   0.0      
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         918   0.0      
emb|CAN71289.1|  hypothetical protein VITISV_019349                     917   0.0      Vitis vinifera
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         917   0.0      Vitis vinifera
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    915   0.0      
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    915   0.0      
emb|CDP03771.1|  unnamed protein product                                915   0.0      
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    915   0.0      
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    914   0.0      
ref|XP_004289971.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    914   0.0      
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    913   0.0      
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    912   0.0      
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    907   0.0      
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         906   0.0      
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    905   0.0      
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                         902   0.0      
ref|XP_002314488.2|  alcohol oxidase-related family protein             900   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    899   0.0      
gb|ACF22878.1|  alcohol oxidase                                         898   0.0      Glycine max [soybeans]
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    896   0.0      
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like    895   0.0      Vitis vinifera
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    892   0.0      
ref|XP_002311685.2|  alcohol oxidase-related family protein             884   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    883   0.0      
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    883   0.0      Lotus japonicus
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    880   0.0      
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             880   0.0      
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    878   0.0      
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    875   0.0      
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    875   0.0      
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    871   0.0      
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1         871   0.0      
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             870   0.0      
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    868   0.0      
gb|KDP40361.1|  hypothetical protein JCGZ_02359                         868   0.0      
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             868   0.0      
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         866   0.0      
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         865   0.0      
gb|EPS66779.1|  hypothetical protein M569_07992                         863   0.0      
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    862   0.0      
emb|CDP11641.1|  unnamed protein product                                862   0.0      
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         859   0.0      
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    857   0.0      
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    853   0.0      
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         855   0.0      
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    852   0.0      
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    851   0.0      Lotus japonicus
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        850   0.0      
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         847   0.0      
emb|CDX92884.1|  BnaC07g41420D                                          847   0.0      
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    847   0.0      
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg             847   0.0      
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg             847   0.0      
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    846   0.0      
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                    845   0.0      
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         845   0.0      
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             842   0.0      
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        839   0.0      
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    838   0.0      
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    838   0.0      
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         833   0.0      
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    836   0.0      
emb|CDO99261.1|  unnamed protein product                                833   0.0      
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906             833   0.0      
ref|XP_002528823.1|  disulfide oxidoreductase, putative                 832   0.0      Ricinus communis
emb|CDY51703.1|  BnaA03g58930D                                          832   0.0      
gb|AAM63097.1|  unknown                                                 831   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                      831   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    831   0.0      
gb|AAK64154.1|  unknown protein                                         831   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010102592.1|  Long-chain-alcohol oxidase FAO1                    830   0.0      
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            830   0.0      
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    828   0.0      
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    829   0.0      
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            829   0.0      
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                  829   0.0      
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    826   0.0      
gb|AGC65582.1|  fatty alcohol oxidase                                   822   0.0      
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g             823   0.0      
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    819   0.0      
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    816   0.0      
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g             815   0.0      
emb|CDX94858.1|  BnaC03g43300D                                          812   0.0      
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    808   0.0      
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            808   0.0      
emb|CDX92985.1|  BnaA03g37070D                                          805   0.0      
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    805   0.0      
emb|CDX85097.1|  BnaC07g08090D                                          805   0.0      
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3         805   0.0      
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                    803   0.0      
gb|KHG08529.1|  Long-chain-alcohol oxidase FAO2                         801   0.0      
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         801   0.0      
dbj|BAK02336.1|  predicted protein                                      800   0.0      
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       795   0.0      
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             797   0.0      
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855             796   0.0      
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    796   0.0      
gb|ACN27562.1|  unknown                                                 796   0.0      Zea mays [maize]
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg             794   0.0      
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370          795   0.0      Sorghum bicolor [broomcorn]
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    794   0.0      
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                       793   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148058.1|  oxidoreductase                                     793   0.0      Zea mays [maize]
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                         790   0.0      
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             790   0.0      
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         790   0.0      
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    786   0.0      
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390          788   0.0      Sorghum bicolor [broomcorn]
gb|EEC73620.1|  hypothetical protein OsI_08118                          786   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         785   0.0      
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                785   0.0      
ref|NP_001047464.1|  Os02g0621800                                       784   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                  776   0.0      
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         780   0.0      
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     779   0.0      
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    777   0.0      
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    776   0.0      
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1         775   0.0      
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    773   0.0      
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376             771   0.0      
emb|CDX89850.1|  BnaA10g02320D                                          770   0.0      
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    769   0.0      
ref|XP_006857358.1|  hypothetical protein AMTR_s00067p00112750          769   0.0      
emb|CAC87643.1|  alcohol oxidase                                        764   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    766   0.0      
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    763   0.0      
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                       763   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001176205.1|  Os10g0474966                                       762   0.0      
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    761   0.0      
emb|CDY18199.1|  BnaC05g02220D                                          758   0.0      
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    754   0.0      
gb|EPS58840.1|  hypothetical protein M569_15969                         751   0.0      
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    755   0.0      
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             752   0.0      
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470          752   0.0      Sorghum bicolor [broomcorn]
dbj|BAJ86655.1|  predicted protein                                      748   0.0      
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    745   0.0      
gb|KEH23951.1|  long-chain-alcohol oxidase FAO1                         735   0.0      
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    733   0.0      
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1         733   0.0      
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4                723   0.0      
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          722   0.0      Sorghum bicolor [broomcorn]
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed            722   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAD10696.1|  Unknown protein                                         719   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    706   0.0      
gb|ABR17814.1|  unknown                                                 706   0.0      Picea sitchensis
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                      707   0.0      Oryza sativa [red rice]
ref|NP_001142399.1|  uncharacterized protein LOC100274574               701   0.0      Zea mays [maize]
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg             693   0.0      
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    693   0.0      
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    688   0.0      
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                         688   0.0      
gb|KEH15695.1|  long-chain-alcohol oxidase FAO1                         688   0.0      
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...    682   0.0      
ref|XP_010529119.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    655   0.0      
gb|EEC67160.1|  hypothetical protein OsI_34014                          653   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAK00483.1|  predicted protein                                      643   0.0      
ref|XP_010501308.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    645   0.0      
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                     640   0.0      Oryza sativa [red rice]
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                    635   0.0      
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    637   0.0      
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308              629   0.0      
ref|XP_003607656.1|  Annotation was added to scaffolds in Novembe...    628   0.0      
gb|EEE57396.1|  hypothetical protein OsJ_07570                          642   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT04470.1|  Putative GMC-type oxidoreductase                        635   0.0      
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460          622   0.0      Sorghum bicolor [broomcorn]
ref|NP_001064839.2|  Os10g0474800                                       622   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                      621   0.0      Oryza sativa [red rice]
gb|AAL31049.1|AC078893_12  putative oxidase                             621   0.0      Oryza sativa [red rice]
ref|XP_003590828.1|  Annotation was added to scaffolds in Novembe...    612   0.0      
gb|AES61079.2|  long-chain-alcohol oxidase FAO1-like protein            610   0.0      
gb|EAY78905.1|  hypothetical protein OsI_34008                          598   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    589   0.0      
gb|EEE51131.1|  hypothetical protein OsJ_31875                          584   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ACF87929.1|  unknown                                                 563   0.0      Zea mays [maize]
gb|ACF88407.1|  unknown                                                 551   0.0      Zea mays [maize]
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        557   2e-180   
tpg|DAA49655.1|  TPA: hypothetical protein ZEAMMB73_468308              541   2e-179   
ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        551   6e-179   
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            552   2e-178   
gb|EEE51130.1|  hypothetical protein OsJ_31873                          542   2e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    546   3e-176   
gb|EEC67159.1|  hypothetical protein OsI_34012                          541   2e-175   Oryza sativa Indica Group [Indian rice]
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  543   6e-175   
ref|XP_006379996.1|  hypothetical protein POPTR_0008s18750g             526   9e-175   
emb|CDP07225.1|  unnamed protein product                                542   1e-174   
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        540   1e-174   
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        540   2e-174   
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    540   7e-174   
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        540   9e-174   
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    539   2e-173   
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             538   5e-173   
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  539   5e-173   
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370          536   1e-172   
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             536   2e-172   
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    534   3e-172   
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        534   3e-172   
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             533   4e-172   
emb|CDY01593.1|  BnaC07g35830D                                          534   4e-172   
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                533   8e-172   
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             534   1e-171   
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    532   2e-171   
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    543   3e-171   
gb|ACR36076.1|  unknown                                                 523   3e-171   Zea mays [maize]
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    531   5e-171   
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             529   1e-170   
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    531   1e-170   
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      528   3e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    531   3e-170   
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    529   4e-170   
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    530   1e-169   
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    528   2e-169   
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        527   4e-169   Vitis vinifera
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             524   8e-169   
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        524   1e-168   
emb|CDX77517.1|  BnaA07g06550D                                          516   1e-168   
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    525   1e-168   
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         524   2e-168   
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    524   3e-168   
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        524   9e-168   
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   525   1e-167   
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    523   2e-167   
ref|XP_006385149.1|  alcohol oxidase-related family protein             520   6e-167   
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    522   7e-167   
gb|AGK82821.1|  alcohol oxidase                                         519   8e-167   
gb|AGK82832.1|  alcohol oxidase                                         519   1e-166   
gb|AGK82806.1|  alcohol oxidase                                         519   1e-166   
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    518   2e-166   
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                517   4e-166   
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    520   4e-166   
gb|EPS64229.1|  hypothetical protein M569_10552                         515   1e-165   
gb|AGK82825.1|  alcohol oxidase                                         516   2e-165   
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    514   8e-165   
ref|XP_002519938.1|  electron carrier, putative                         512   1e-164   Ricinus communis
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             514   2e-164   
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    509   1e-163   
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    511   4e-163   
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    510   8e-163   
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    511   9e-163   
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    504   1e-161   
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    506   1e-161   
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    504   8e-161   
ref|XP_001763007.1|  predicted protein                                  503   4e-160   
gb|EPS61567.1|  hypothetical protein M569_13229                         499   2e-159   
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    500   4e-159   
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              496   1e-157   
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              494   3e-157   
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    492   1e-155   
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    491   3e-155   
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  483   2e-153   
ref|XP_006662437.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    476   5e-153   
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    483   2e-152   
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        483   2e-152   
ref|XP_010038987.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    469   7e-152   
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              474   6e-150   
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              473   2e-149   
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     473   5e-149   
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    473   6e-149   
ref|XP_004157399.1|  PREDICTED: LOW QUALITY PROTEIN: puromycin-se...    476   7e-148   
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        463   1e-146   
emb|CBI23676.3|  unnamed protein product                                460   2e-146   
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     463   2e-145   
ref|XP_004157702.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    448   5e-145   
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         457   7e-145   
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    459   5e-144   
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        454   7e-142   
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    447   5e-141   
ref|XP_006648845.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    447   2e-140   
emb|CDX98615.1|  BnaA03g44000D                                          447   4e-140   
ref|XP_004167305.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    442   5e-139   
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        440   4e-138   
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    441   4e-137   
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             434   5e-136   
emb|CAA18625.1|  putative protein                                       436   1e-135   
emb|CDY66156.1|  BnaA01g34950D                                          429   2e-135   
ref|XP_001753124.1|  predicted protein                                  436   2e-135   
emb|CDX99382.1|  BnaC01g11700D                                          426   3e-134   
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                         427   1e-133   
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    429   4e-133   
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935             424   1e-131   
emb|CBI29206.3|  unnamed protein product                                424   2e-131   
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855             423   4e-131   
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089             422   1e-130   
emb|CBI37146.3|  unnamed protein product                                416   3e-129   
ref|XP_011024801.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    410   4e-127   
ref|XP_001761391.1|  predicted protein                                  412   1e-126   
ref|XP_006662436.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    406   8e-126   
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    405   5e-123   
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                         339   2e-101   
ref|XP_006368110.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    335   2e-101   
ref|XP_009831231.1|  hypothetical protein H257_07412                    312   6e-89    
ref|WP_007907865.1|  glucose-methanol-choline oxidoreductase            310   1e-88    
ref|XP_009831229.1|  hypothetical protein, variant 1                    305   4e-86    
ref|XP_005644346.1|  FAD/NAD(P)-binding domain-containing protein       295   4e-85    
gb|KFY64266.1|  hypothetical protein V496_03367                         299   3e-84    
gb|EUN25552.1|  hypothetical protein COCVIDRAFT_39053                   299   3e-84    
ref|XP_007706606.1|  hypothetical protein COCCADRAFT_81154              298   6e-84    
ref|XP_008871235.1|  hypothetical protein H310_07607                    295   4e-83    
ref|XP_004309279.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    279   6e-83    
gb|KFY10153.1|  hypothetical protein V492_05166                         295   1e-82    
gb|KFY48297.1|  hypothetical protein V495_01464                         293   3e-82    
ref|XP_009831227.1|  hypothetical protein, variant 5                    289   5e-82    
gb|EHA26798.1|  long chain fatty alcohol oxidase                        293   7e-82    
ref|XP_001389382.1|  long chain fatty alcohol oxidase                   292   8e-82    
ref|XP_009831225.1|  hypothetical protein H257_07411                    293   1e-81    
gb|KFH71384.1|  hypothetical protein MVEG_01683                         290   2e-81    
ref|XP_003654573.1|  hypothetical protein THITE_2117674                 290   5e-81    
ref|XP_007684042.1|  GMC oxidoreductase                                 290   9e-81    
ref|XP_009831228.1|  hypothetical protein, variant 3                    288   1e-80    
gb|EGU13115.1|  Long chain fatty alcohol oxidase                        288   2e-80    
ref|XP_001214264.1|  conserved hypothetical protein                     288   3e-80    
gb|EKG12277.1|  Glucose-methanol-choline oxidoreductase                 288   4e-80    
gb|EMS23820.1|  long chain fatty alcohol oxidase                        287   4e-80    
emb|CDR40807.1|  RHTO0S05e07470g1_1                                     286   6e-80    
gb|ELR10689.1|  hypothetical protein GMDG_04950                         286   6e-80    
ref|XP_001268562.1|  long chain fatty alcohol oxidase, putative         287   7e-80    
gb|EMD94921.1|  hypothetical protein COCHEDRAFT_1201414                 287   7e-80    
dbj|GAA82032.1|  long chain fatty alcohol oxidase                       287   8e-80    
gb|KFY36052.1|  hypothetical protein V494_05366                         287   9e-80    
ref|XP_007697741.1|  hypothetical protein COCSADRAFT_295770             286   1e-79    
ref|XP_008026917.1|  hypothetical protein SETTUDRAFT_20639              284   6e-79    
ref|XP_002182547.1|  predicted protein                                  285   7e-79    
ref|XP_001591990.1|  hypothetical protein SS1G_07437                    284   8e-79    
ref|XP_008615139.1|  hypothetical protein SDRG_10901                    284   1e-78    
gb|KFH47883.1|  Long-chain-alcohol oxidase-like protein                 283   3e-78    
gb|KFY02756.1|  hypothetical protein O988_01934                         282   3e-78    
emb|CDS08066.1|  hypothetical protein LRAMOSA02015                      281   3e-78    
ref|WP_029214956.1|  hypothetical protein                               280   4e-78    
gb|KFY45551.1|  hypothetical protein V495_02926                         281   5e-78    
dbj|GAM35263.1|  hypothetical protein TCE0_017r03459                    281   7e-78    
ref|XP_007837981.1|  hypothetical protein PFICI_11209                   281   1e-77    
ref|XP_009831226.1|  hypothetical protein, variant 4                    278   1e-77    
gb|KFY79221.1|  hypothetical protein V499_01756                         283   1e-77    
ref|WP_019946571.1|  hypothetical protein                               278   2e-77    
gb|KHN10761.1|  Long-chain-alcohol oxidase FAO2                         273   4e-77    
gb|KFZ00641.1|  hypothetical protein V501_10589                         282   6e-77    
dbj|GAM23381.1|  hypothetical protein SAMD00019534_065560               278   6e-77    
gb|KFZ24759.1|  hypothetical protein V502_00763                         270   1e-76    
ref|XP_658227.1|  hypothetical protein AN0623.2                         278   1e-76    
gb|EMT02982.1|  Putative GMC-type oxidoreductase                        273   2e-76    
gb|KFY98584.1|  hypothetical protein V500_01604                         281   2e-76    
ref|XP_008084965.1|  FAD/NAD(P)-binding protein                         276   3e-76    
gb|KFY31288.1|  hypothetical protein V493_01243                         276   3e-76    
ref|XP_009831230.1|  hypothetical protein, variant 2                    276   4e-76    
gb|KFY68894.1|  hypothetical protein V496_00717                         275   6e-76    
gb|KGN53994.1|  hypothetical protein Csa_4G246400                       265   7e-76    
emb|CEI89775.1|  hypothetical protein RMCBS344292_04123                 274   1e-75    
gb|KFY41130.1|  hypothetical protein V494_03193                         275   1e-75    
emb|CEJ01770.1|  hypothetical protein RMCBS344292_15791                 274   1e-75    
gb|AHH21230.1|  glucose-methanol-choline (GMC) oxidoreductase fam...    273   1e-75    
gb|EMR84578.1|  putative long chain fatty alcohol protein               275   2e-75    
emb|CCD42906.1|  similar to long chain fatty alcohol oxidase            275   2e-75    
ref|XP_001554225.1|  hypothetical protein BC1G_07362                    274   2e-75    
gb|EER37923.1|  long chain fatty acid oxidase                           272   2e-75    
ref|XP_005650828.1|  FAD/NAD(P)-binding domain-containing protein       268   3e-75    
emb|CEG67601.1|  hypothetical protein RMATCC62417_04004                 272   4e-75    
gb|KFY15271.1|  hypothetical protein V492_02111                         273   4e-75    
ref|XP_007680563.1|  hypothetical protein BAUCODRAFT_274597             273   4e-75    
gb|KFZ10506.1|  hypothetical protein V501_05178                         272   6e-75    
ref|XP_002147053.1|  long chain fatty alcohol oxidase, putative         273   8e-75    
gb|KFY27803.1|  hypothetical protein V493_03299                         272   1e-74    
gb|KFY96639.1|  hypothetical protein V500_02373                         272   1e-74    
gb|KDO33323.1|  hypothetical protein SPRG_02132                         272   1e-74    
gb|KFX48806.1|  Long-chain-alcohol oxidase FAO2                         272   1e-74    
gb|KFZ16786.1|  hypothetical protein V502_04902                         271   2e-74    
gb|KFY76557.1|  hypothetical protein V499_03848                         271   2e-74    
gb|EXX66452.1|  hypothetical protein RirG_123640                        272   3e-74    
emb|CEG74394.1|  hypothetical protein RMATCC62417_09621                 270   3e-74    
ref|XP_001821106.1|  long chain fatty alcohol oxidase                   271   4e-74    
ref|XP_753079.1|  long chain fatty alcohol oxidase                      270   5e-74    
gb|KEY78297.1|  long chain fatty alcohol oxidase                        270   5e-74    
ref|XP_002569337.1|  Pc21g23700                                         270   6e-74    
gb|KGO74925.1|  Alcohol dehydrogenase, long-chain fatty                 270   8e-74    
gb|EME47783.1|  hypothetical protein DOTSEDRAFT_69651                   270   8e-74    
gb|EIT74840.1|  choline dehydrogenase                                   269   1e-73    
gb|EPB87888.1|  hypothetical protein HMPREF1544_05295                   268   2e-73    
gb|EEQ89581.1|  long chain fatty alcohol oxidase                        268   3e-73    
gb|KGO40669.1|  Alcohol dehydrogenase, long-chain fatty                 268   4e-73    
gb|EPB86823.1|  hypothetical protein HMPREF1544_06348                   266   5e-73    
ref|XP_001940486.1|  long chain fatty alcohol oxidase                   267   7e-73    
gb|ESA06032.1|  hypothetical protein GLOINDRAFT_82554                   264   9e-73    
gb|ESZ93853.1|  hypothetical protein SBOR_5750                          267   9e-73    
gb|EHK24705.1|  hypothetical protein TRIVIDRAFT_54537                   266   1e-72    
ref|XP_002788971.1|  long chain fatty acid oxidase                      266   1e-72    
ref|XP_003298648.1|  hypothetical protein PTT_09421                     265   2e-72    
dbj|GAC77008.1|  hypothetical protein PANT_22d00298                     265   4e-72    
ref|XP_002622231.1|  long chain fatty alcohol oxidase                   264   8e-72    
gb|EHL01767.1|  putative Long-chain-alcohol oxidase FAO2                263   1e-71    
dbj|GAK63894.1|  GMC oxidoreductase                                     264   1e-71    
gb|EWY81831.1|  hypothetical protein FOYG_16040                         263   1e-71    
ref|XP_001264046.1|  long chain fatty alcohol oxidase, putative         263   1e-71    
gb|EEH19591.1|  hypothetical protein PABG_07795                         263   1e-71    
gb|EGD99881.1|  long chain fatty alcohol oxidase                        263   1e-71    
gb|ELR05461.1|  hypothetical protein GMDG_01756                         262   2e-71    
gb|ETS63240.1|  hypothetical protein PaG_03027                          263   2e-71    
gb|KEZ42932.1|  Long chain fatty alcohol oxidase                        262   3e-71    
ref|XP_006667880.1|  long chain fatty alcohol oxidase                   263   3e-71    
gb|EZF29717.1|  hypothetical protein H101_06625                         262   3e-71    
gb|AIZ62505.1|  hypothetical protein PK28_00185                         260   4e-71    
gb|EGU81929.1|  hypothetical protein FOXB_07532                         261   5e-71    
ref|XP_003855144.1|  hypothetical protein MYCGRDRAFT_37086              262   5e-71    
ref|XP_002479333.1|  long chain fatty alcohol oxidase, putative         266   5e-71    
gb|EXK25528.1|  hypothetical protein FOMG_17829                         261   6e-71    
dbj|GAA98883.1|  hypothetical protein E5Q_05571                         261   7e-71    
ref|WP_018162755.1|  hypothetical protein                               259   8e-71    
ref|XP_010762144.1|  hypothetical protein PADG_06552                    261   8e-71    
gb|KFY78692.1|  hypothetical protein V499_02185                         262   9e-71    
ref|XP_003348911.1|  hypothetical protein SMAC_01933                    261   1e-70    
gb|ENH62892.1|  Long-chain-alcohol oxidase FAO2                         258   2e-70    
gb|EXL42725.1|  hypothetical protein FOCG_15170                         259   2e-70    
emb|CDX77516.1|  BnaA07g06540D                                          242   3e-70    
ref|XP_007922551.1|  hypothetical protein MYCFIDRAFT_52380              259   4e-70    
gb|EWZ33891.1|  hypothetical protein FOZG_13577                         258   5e-70    
gb|EXA34422.1|  hypothetical protein FOVG_14401                         258   5e-70    
gb|EMT74381.1|  Long-chain-alcohol oxidase FAO2                         257   7e-70    
ref|XP_007412898.1|  hypothetical protein MELLADRAFT_78490              258   7e-70    
gb|EXL94556.1|  hypothetical protein FOIG_12751                         258   8e-70    
gb|EMF15130.1|  long-chain fatty alcohol dehydrogenase                  259   8e-70    
gb|EXK85609.1|  hypothetical protein FOQG_10402                         258   8e-70    
ref|XP_629786.1|  glucose-methanol-choline oxidoreductase               259   9e-70    
emb|CDM31622.1|  Alcohol dehydrogenase, long-chain fatty                258   1e-69    
ref|XP_008597419.1|  GMC oxidoreductase                                 258   1e-69    
ref|XP_003231449.1|  long chain fatty alcohol oxidase                   254   1e-69    
ref|XP_003294587.1|  hypothetical protein DICPUDRAFT_159608             257   1e-69    
gb|EXM19432.1|  hypothetical protein FOTG_12485                         257   2e-69    
gb|EPS25096.1|  hypothetical protein PDE_00027                          257   2e-69    
gb|EMS67203.1|  Long-chain-alcohol oxidase FAO2                         247   2e-69    
ref|WP_022566024.1|  MULTISPECIES: putative oxidoreductase              255   2e-69    
gb|EWZ83069.1|  hypothetical protein FOWG_13006                         256   2e-69    
gb|KGQ12856.1|  Long-chain-alcohol oxidase FAO2                         257   3e-69    
gb|EZF27387.1|  hypothetical protein H100_00625                         256   4e-69    
ref|XP_007912489.1|  putative long chain fatty acid oxidase protein     256   5e-69    
gb|EZF78359.1|  hypothetical protein H105_00612                         256   5e-69    
ref|XP_003051757.1|  hypothetical protein NECHADRAFT_37686              256   5e-69    
ref|XP_003328562.1|  hypothetical protein PGTG_10521                    256   5e-69    
gb|EST07962.1|  choline dehydrogenase                                   256   6e-69    
gb|EYE98796.1|  putative long chain fatty alcohol oxidase               255   1e-68    
ref|WP_035567966.1|  hypothetical protein                               253   1e-68    
gb|KEQ78490.1|  putative long chain fatty alcohol oxidase               254   1e-68    
ref|XP_001792978.1|  hypothetical protein SNOG_02371                    254   2e-68    
ref|XP_758170.1|  hypothetical protein UM02023.1                        254   2e-68    
emb|CDI52877.1|  related to long chain fatty alcohol oxidase            254   2e-68    
ref|XP_003011696.1|  hypothetical protein ARB_02250                     254   2e-68    
ref|XP_007879028.1|  hypothetical protein PFL1_03320                    254   2e-68    
gb|EGC44059.1|  long chain fatty acid oxidase                           253   2e-68    
gb|EPB87889.1|  hypothetical protein HMPREF1544_05296                   253   3e-68    
gb|EWY79768.1|  hypothetical protein FOYG_17058                         253   3e-68    
gb|EQB53611.1|  GMC oxidoreductase                                      253   5e-68    
ref|WP_039808649.1|  oxidoreductase                                     250   8e-68    
ref|XP_003018036.1|  hypothetical protein TRV_07960                     252   8e-68    
gb|ENH81120.1|  long chain fatty alcohol oxidase                        252   1e-67    
emb|CCT75976.1|  related to long chain fatty alcohol oxidase            251   1e-67    
dbj|GAD98322.1|  hypothetical protein PVAR5_7014                        251   2e-67    
gb|AHJ99440.1|  hypothetical protein Hsw_3845                           250   2e-67    
gb|EWG51602.1|  hypothetical protein FVEG_10526                         251   2e-67    
ref|WP_032385620.1|  hypothetical protein                               249   2e-67    
gb|EWM21472.1|  glucose-methanol-choline oxidoreductase                 253   2e-67    
gb|EHK23131.1|  hypothetical protein TRIVIDRAFT_53801                   251   3e-67    
ref|WP_029932851.1|  oxidoreductase                                     248   4e-67    
gb|KDE02581.1|  hypothetical protein MVLG_06864                         249   4e-67    
gb|EZG10707.1|  long chain fatty alcohol oxidase                        250   5e-67    
dbj|GAC92532.1|  choline dehydrogenase                                  250   8e-67    
ref|XP_006692351.1|  hypothetical protein CTHT_0018560                  250   9e-67    
ref|XP_008871238.1|  hypothetical protein H310_07609                    244   1e-66    
ref|XP_004361070.1|  glucose-methanol-choline oxidoreductase            251   1e-66    
ref|XP_002841296.1|  hypothetical protein                               248   1e-66    
emb|CCF43856.1|  GMC oxidoreductase                                     244   2e-66    
ref|WP_011207508.1|  oxidoreductase                                     246   3e-66    
ref|XP_002842592.1|  long chain fatty acid oxidase                      248   3e-66    
emb|CCF53187.1|  related to long chain fatty alcohol oxidase            248   3e-66    
ref|XP_009851267.1|  hypothetical protein NEUTE1DRAFT_82541             248   4e-66    
gb|EMT65475.1|  Long-chain-alcohol oxidase FAO2                         247   4e-66    
gb|EXL95152.1|  hypothetical protein FOIG_12161                         243   4e-66    
ref|XP_006386919.1|  hypothetical protein POPTR_0002s26130g             241   5e-66    
ref|XP_001243546.1|  hypothetical protein CIMG_02987                    247   7e-66    
ref|XP_003041566.1|  hypothetical protein NECHADRAFT_77262              246   8e-66    
emb|CCX32413.1|  Similar to Long-chain-alcohol oxidase FAO1; acc....    246   8e-66    
ref|XP_007754800.1|  hypothetical protein A1O7_02579                    246   9e-66    
ref|XP_007296903.1|  hypothetical protein MBM_09014                     253   9e-66    
ref|XP_959005.1|  hypothetical protein NCU08977                         246   1e-65    
gb|EFQ33355.1|  GMC oxidoreductase                                      246   1e-65    
ref|XP_001904377.1|  hypothetical protein                               246   1e-65    



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =  1050 bits (2716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/731 (71%), Positives = 612/731 (84%), Gaps = 12/731 (2%)
 Frame = -3

Query  2361  HPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPF  2185
             H  L+GGR +S Y+HG SSSQ Q +A+ CE LIPP   P D  D    SF+SSS SQPPF
Sbjct  3     HSSLKGGRISSPYSHGFSSSQIQTIASFCETLIPP---PYDHQD----SFFSSSGSQPPF  55

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
             P+EVAE++++R  P+A+FI R+V+ +LSTRLGSL+LCG VC D R PF+HNFSEL LK+R
Sbjct  56    PNEVAELLVKRSKPEAMFIIRIVVFMLSTRLGSLVLCGRVCLDKRRPFVHNFSELSLKQR  115

Query  2004  EAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQ  1825
             E +L +WSRE+ +LPLRI F+ IKI  +FI+FSWTDEN+ NPAWEAIG+H DT + P + 
Sbjct  116   EPLLQRWSRESFLLPLRITFLLIKIMSFFIFFSWTDENFKNPAWEAIGYHPDTRQTPSEY  175

Query  1824  QTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaa  1645
                RPLEKGI+ETINE+  TLKESL KKG+ +TE    NT  IRCDVVIVGSGCGGGVAA
Sbjct  176   HKERPLEKGIVETINESDETLKESLTKKGVPLTEDTKDNTFKIRCDVVIVGSGCGGGVAA  235

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
             A+LA SGHKVVVLEKGHYFV EDYSGLEGPSL ELYESG ML+T DGK+M+ AGT VGGG
Sbjct  236   AILAKSGHKVVVLEKGHYFVPEDYSGLEGPSLNELYESGAMLSTLDGKIMIMAGTTVGGG  295

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWSAS++TP +VLN+WS++ KIP FG+SEYQSAMDAVCKRIGVTE CS EGLQNQV+
Sbjct  296   SAVNWSASLRTPTDVLNDWSVKHKIPWFGTSEYQSAMDAVCKRIGVTENCSNEGLQNQVI  355

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQA  1105
             R+GCENLGLKVE++PRN SE HYCGSCGYGC+TGDKKG DTT+LVDAVN GAVILTGC A
Sbjct  356   RRGCENLGLKVENIPRNSSENHYCGSCGYGCKTGDKKGTDTTWLVDAVNAGAVILTGCTA  415

Query  1104  EKFILEEDETA--RKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPLLISSGLKN  937
             E+FILE+D     RK+CLGV+A  +SK   + L IEARAT+S+CGSLFTPPLLISSGLKN
Sbjct  416   ERFILEDDMDGKMRKRCLGVVATTESKKLTRKLHIEARATISSCGSLFTPPLLISSGLKN  475

Query  936   KNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGP  757
             KNIG+NLHLHPVL AWGYFPESM+E +GKN++GGI+TS+HK+V E T   AIIEA +LGP
Sbjct  476   KNIGTNLHLHPVLLAWGYFPESMSEFKGKNYEGGIMTSLHKMVPEETNARAIIEATALGP  535

Query  756   AGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRT  577
             A FA + PWTSG DMKERM KYSRTVN+ ++ +D GSG+VKKAGRI YR+D+IDK+NI+ 
Sbjct  536   AIFAVLFPWTSGQDMKERMTKYSRTVNLLALAKDQGSGEVKKAGRIAYRLDEIDKENIKA  595

Query  576   GLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLY  397
             GLR+ALRILVAAGA EVGT++SDGQKI CKGIK EELE FLD V ATGGP S  E WT+Y
Sbjct  596   GLRRALRILVAAGAVEVGTYQSDGQKISCKGIKNEELEEFLDTVRATGGPNSKGEQWTIY  655

Query  396   CSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCIS  217
              SAHQMGSCRMGA EEDGA+D NGECWEAKGLYVCDGSVLP+A+GVNPMITI STAYCI+
Sbjct  656   GSAHQMGSCRMGANEEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAYCIA  715

Query  216   NGLAKSLNSGK  184
               +A+S+++ K
Sbjct  716   KRIAESMHNEK  726



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score =  1050 bits (2716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/739 (70%), Positives = 614/739 (83%), Gaps = 8/739 (1%)
 Frame = -3

Query  2379  MNERKCHPLLRGGR-RNSYNHGLSSSQYQALAAICEALIPPIPL-PQD---SDDEAMCSF  2215
             M  ++CH  L+GGR    Y+HG SSSQ Q +A+ CE LIPP+P  PQ     +++A+ SF
Sbjct  1     MKGKQCHSSLKGGRISRPYSHGFSSSQIQTIASFCETLIPPLPYNPQHLSPCNNKALDSF  60

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             +SSSASQPPFP+EVAE++++R  P+A+ I R+V+ +LSTRLGSL+LCG VC D RWPF+H
Sbjct  61    FSSSASQPPFPNEVAELLVKRSNPEAMLIIRIVVFLLSTRLGSLVLCGRVCLDKRWPFVH  120

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             NFSEL LK+RE++L +WSRE+ +LPLRI F+ IK  C+FI+FSWTDEN  NPAWEAIG+ 
Sbjct  121   NFSELSLKQRESLLQRWSRESFLLPLRITFLLIKTMCFFIFFSWTDENCKNPAWEAIGYQ  180

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
              DT + P +    RPLEKGI+ETINE+  TLKESL KKG+ +TE    NT  IRCDVVIV
Sbjct  181   PDTRQTPSENHKERPLEKGIVETINESDETLKESLSKKGVPLTEDTKDNTFKIRCDVVIV  240

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAA+LA SGHKVVVLEKGHYFV EDYSGLEGPSL ELYE+G MLTT DGKVM
Sbjct  241   GSGCGGGVAAAILAKSGHKVVVLEKGHYFVPEDYSGLEGPSLNELYETGAMLTTDDGKVM  300

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             V AGT VGGGSA+NWSASI+TP +VLN+WS++ KIP FG+SEYQSAMDAVCKRIGVTE C
Sbjct  301   VMAGTTVGGGSAVNWSASIRTPTDVLNDWSVKHKIPWFGTSEYQSAMDAVCKRIGVTENC  360

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
             + EGLQNQ +R+GCENLGLKVE++PRN SE HYCGSCGYGC+TGDKKG DTT+LVDAVN 
Sbjct  361   ANEGLQNQAIRRGCENLGLKVENIPRNSSENHYCGSCGYGCKTGDKKGTDTTWLVDAVNA  420

Query  1134  GAVILTGCQAEKFILEEDETARKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPL  961
             GAVIL GC AE+FILE+D    K C+GVIA  +SK   K L IEARAT+S+CGSL TPPL
Sbjct  421   GAVILPGCTAERFILEDDMN-EKICIGVIATTESKKITKKLHIEARATISSCGSLLTPPL  479

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             LISSGLKNKNIG+NLHLHPVL AWGYFPESM+E++GKN++GGI+T++HK+V E T   AI
Sbjct  480   LISSGLKNKNIGTNLHLHPVLLAWGYFPESMSEIKGKNYEGGIMTAVHKMVPEETNAQAI  539

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             IEA +LGPA FA   PWTSG DMKERM KYSRT N+ ++ +D GSG+VKKAG+I+YR+D+
Sbjct  540   IEATALGPASFACFFPWTSGQDMKERMTKYSRTANLLALAKDQGSGEVKKAGKIKYRLDE  599

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
             IDK+NI+ G+R+ALRILVAAGAAEVGT+RSDGQKI CKGI  EELE FLD V ATGGP S
Sbjct  600   IDKENIKAGVRRALRILVAAGAAEVGTYRSDGQKISCKGITNEELEEFLDTVGATGGPSS  659

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
               E W +Y SAHQMGSCRMGA EEDGA+D NGECWEAKGLYVCDGSVLP+A+GVNPMITI
Sbjct  660   KGEQWAIYGSAHQMGSCRMGANEEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITI  719

Query  240   LSTAYCISNGLAKSLNSGK  184
              STAYCI+N +A+S++  K
Sbjct  720   QSTAYCIANRIAESMHKEK  738



>ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum tuberosum]
Length=734

 Score =  1019 bits (2634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/736 (68%), Positives = 608/736 (83%), Gaps = 9/736 (1%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSS  2203
             + E++CH  L+GGR NS Y HG SS+Q Q +++ CE L+PP       D+    SF++SS
Sbjct  2     VKEKECHSSLKGGRINSNYTHGFSSTQIQTISSFCETLVPPCNNKGIDDN----SFFASS  57

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
              ++PP+P+EVAE++++R  P+A+FI R+V+ +LSTRLGSLLLCG VC D RWPF+HNFSE
Sbjct  58    GARPPYPNEVAELLVKRSKPEALFIIRIVVFLLSTRLGSLLLCGRVCLDKRWPFVHNFSE  117

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV-DT  1846
             L LK REA+L +WSRET ++PLRI F+ IKI C+FI+FSWTDEN  NP WEAIG+H+ +T
Sbjct  118   LDLKDREALLQRWSRETFLIPLRITFLMIKIVCFFIFFSWTDENCKNPTWEAIGYHLPET  177

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
              E     +  RPLE+GI+ETINE+  TLKESL KKG+ + E    NT  I+CDV+IVGSG
Sbjct  178   TETLSVNKKERPLERGIVETINESDETLKESLSKKGVAIAEDTKDNTFKIKCDVLIVGSG  237

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAA +LA SG+KVVVLEKGHYFV EDYSGLEGPSL ELYE+G ML++ DGKVM+ A
Sbjct  238   CGGGVAAGILAKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELYETGAMLSSLDGKVMIMA  297

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             GT VGGGSA+NWSASI+TPN+VL +WS   KI  FG+SEYQSAMD VCKRIGVTE CS+E
Sbjct  298   GTTVGGGSAVNWSASIRTPNDVLKDWSENHKISWFGTSEYQSAMDTVCKRIGVTENCSEE  357

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
             GLQNQV+RKGCENLGLKV+ +PRN SE HYCGSCGYGC+TGDKKG D+T+LVDAVN GAV
Sbjct  358   GLQNQVIRKGCENLGLKVDKIPRNSSENHYCGSCGYGCKTGDKKGTDSTWLVDAVNAGAV  417

Query  1125  ILTGCQAEKFILEEDETARKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPLLIS  952
             ILTGC A++FILE D   RK CLGVIA  ++K   K L IEARAT+S+CGSLFTPPLLIS
Sbjct  418   ILTGCTAQRFILE-DGKMRKTCLGVIATTETKKIPKKLHIEARATISSCGSLFTPPLLIS  476

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEA  772
             SGL+NKNIG+NLHLHPVL AWGYFPESMAE++GKN++GGI+TS+HK++ E T   AI+EA
Sbjct  477   SGLQNKNIGTNLHLHPVLLAWGYFPESMAEIKGKNYEGGIMTSLHKMLPEETNAQAIVEA  536

Query  771   VSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDK  592
              ++GPA FA++ PWTSG DMKE+M KYSRTV + ++V+D G G+VKKAGRI+Y +D+IDK
Sbjct  537   TAMGPAAFASLFPWTSGQDMKEQMTKYSRTVTLLALVKDQGRGEVKKAGRIKYSLDRIDK  596

Query  591   DNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEE  412
             +NI+ GLR+ALRIL+AAGA EVGT+RSDGQKI C  +K EELE FLD V A  GPMS EE
Sbjct  597   ENIKAGLRRALRILIAAGAVEVGTYRSDGQKISCTDMKNEELEEFLDTVEAPEGPMSKEE  656

Query  411   NWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILST  232
             NWT+Y SAHQMGSCRMG+++EDGA+D NGECWEAKGLYVCDGSVLP+A+GVNPMITI ST
Sbjct  657   NWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQST  716

Query  231   AYCISNGLAKSLNSGK  184
             AYCI+  +A+SL++ K
Sbjct  717   AYCIAKRIAESLHNEK  732



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =  1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/736 (67%), Positives = 606/736 (82%), Gaps = 12/736 (2%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSS  2203
             + E +CH LL+GGR NS Y HG SSSQ Q ++A CE L+PP     ++D+    SF++SS
Sbjct  2     VKETECHSLLKGGRINSSYTHGFSSSQIQTISAFCETLVPPC---NNNDN----SFFASS  54

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
              + PP  +EVAE++++R  P+A+ I R+V+ +L+TRLGSLLLCG VC D RWPF+HNF+E
Sbjct  55    GAHPPSTNEVAELLVKRSKPEALLIIRIVVFLLTTRLGSLLLCGRVCLDKRWPFVHNFTE  114

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV-DT  1846
             L LK REA+L +WSRET ++PLRI F+ IKI   FI+FSWTDEN  NP WEAIG+H+ +T
Sbjct  115   LDLKDREALLQRWSRETFLIPLRITFLMIKIIYLFIFFSWTDENCKNPTWEAIGYHLPET  174

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
              E   + +  RPLE+GI+ETINE+  TLKESL KK + +TE    N   I CDV+IVGSG
Sbjct  175   TEALYENKKERPLERGIVETINESDETLKESLSKKDVVITEDAKDNIFKIECDVLIVGSG  234

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAA +LA SG+KVVVLEKGHYFV EDYSGLEGPSL ELYE+G ML++ DGKVM+ A
Sbjct  235   CGGGVAAGILAKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELYETGAMLSSLDGKVMIMA  294

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             GT VGGGSA+NWSASIKTPN+VL +WS+  KI  FG+SEYQSAMDAVCKRIGVTE CS+E
Sbjct  295   GTTVGGGSAVNWSASIKTPNDVLKDWSVNHKISWFGTSEYQSAMDAVCKRIGVTENCSEE  354

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
             GLQNQV+RKGCENLGLKVE +PRN SE HYCGSCGYGC+TGDKKG D+T+LVDAVN GAV
Sbjct  355   GLQNQVIRKGCENLGLKVEKIPRNSSENHYCGSCGYGCKTGDKKGTDSTWLVDAVNAGAV  414

Query  1125  ILTGCQAEKFILEEDETARKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPLLIS  952
             ILTGC AE+FILE D   RK CLGVIA  +SK   + L I+ARAT+S+CG+LFTPPLL+S
Sbjct  415   ILTGCTAERFILE-DGKMRKTCLGVIATTESKKITRKLHIKARATISSCGALFTPPLLLS  473

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEA  772
             SGL+NKNIG+NL+LHPVL AWGYFPESM+E++GKN++GGI+TS+H++V E T   AIIEA
Sbjct  474   SGLQNKNIGTNLYLHPVLLAWGYFPESMSEIKGKNYEGGIMTSLHEMVPEETNAQAIIEA  533

Query  771   VSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDK  592
              ++GPA FA++ PWTSG DMKE+M KYSRTV + ++V+D G G+VKKAGRI+Y +D+IDK
Sbjct  534   TAVGPASFASLFPWTSGQDMKEQMTKYSRTVTLLALVKDQGRGEVKKAGRIKYSLDRIDK  593

Query  591   DNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEE  412
             +NI+ GLR+ALRIL+AAGA EVGT+RSDGQKI CK IK EELE F+D V A  GPMS EE
Sbjct  594   ENIKAGLRRALRILIAAGAVEVGTYRSDGQKIKCKDIKNEELEEFVDTVEAPEGPMSKEE  653

Query  411   NWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILST  232
             NWT+Y SAHQMGSCRMG+++EDGA+D NGECWEAKGLYVCDGSVLP+A+GVNPMITI ST
Sbjct  654   NWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQST  713

Query  231   AYCISNGLAKSLNSGK  184
             AYCI+  +A+SL++ K
Sbjct  714   AYCIAKRIAESLHNEK  729



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/742 (63%), Positives = 579/742 (78%), Gaps = 12/742 (2%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMC-------S  2218
             E  CHPLLRGGRR S ++HG SS+Q Q+LAAICE+LIPP+PL +  DD           S
Sbjct  5     ESCCHPLLRGGRRESKFSHGFSSAQMQSLAAICESLIPPLPLEEIPDDHQALHSSSSSSS  64

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFI  2038
             ++++S SQPP PDEVAE++++R LP+ V   RL L +LS RLG+ LLCG +CFD +WPFI
Sbjct  65    YHTASGSQPPIPDEVAEMIVKRALPEGVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFI  124

Query  2037  HNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF  1858
             H FSE+ L +RE +L KWSR  L++ +R++FM +K+ C++ +FS  DEN  NPAW+AIGF
Sbjct  125   HKFSEMSLDKREQVLNKWSRGKLVITIRLMFMVVKMCCFYTFFSRIDENSRNPAWKAIGF  184

Query  1857  HVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvi  1678
              +D  E        RPL+KGIIET+ E+ +TL +SL KKGL V +    N   I+CDVVI
Sbjct  185   ELDKKEKLIKTPKERPLDKGIIETVYESDSTLVQSLTKKGLEVADDAENNIHRIKCDVVI  244

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSGCGGGVAAAVLA SG KVVVLEKG+YFV +DYS LEGPS+ ELYESGG++++ D  V
Sbjct  245   VGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELYESGGIMSSVDAMV  304

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
             M+ AG+ VGGGSA+NWSASI+TPNNVL EWS++ KIPL+ S +YQSAMD VCKRIGVTE 
Sbjct  305   MILAGSTVGGGSAVNWSASIRTPNNVLREWSVDHKIPLYASEDYQSAMDIVCKRIGVTES  364

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
             C+KE  QNQ+LRKGCENLGLKVESVPRN S  HYCG C YGC TGDKKG D+T+LVDAV 
Sbjct  365   CTKENFQNQILRKGCENLGLKVESVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVE  424

Query  1137  NGAVILTGCQAEKFILEEDETA--RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFT  970
              GAVILTGC+AEKFILE+D     RK+CLGV A S   N  + L IEA+  +SACGSL T
Sbjct  425   CGAVILTGCKAEKFILEKDNDGGRRKRCLGVQATSLSKNLKRKLEIEAKVIISACGSLLT  484

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ  790
             PPL++SSGLKN+NIG NLHLHPVL +WGYFP+  +E +GK ++GGIITSIHKVVSE    
Sbjct  485   PPLMVSSGLKNRNIGRNLHLHPVLLSWGYFPQHESEFKGKKYEGGIITSIHKVVSETANA  544

Query  789   AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
              AIIE   LGPA FA +SPW S LDMK++M KY+RT N+F++VRDH SG VK+ GRI Y 
Sbjct  545   RAIIETAVLGPASFATLSPWISRLDMKDKMEKYARTANLFALVRDHSSGVVKREGRIHYT  604

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
             +DQ+DK+NI  GLRQALRIL+AAGA EVGT+R+DGQ++ CKG+K E+LE FLD VV + G
Sbjct  605   LDQLDKENILAGLRQALRILIAAGAVEVGTYRNDGQRLKCKGVKEEDLEEFLDTVVTSAG  664

Query  429   PMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPM  250
             P + EE WT+Y SAHQMGSCRMGATEE+G +D NGE WEAKGL+VCD S+LP+A+GVNPM
Sbjct  665   PSAREELWTIYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDASLLPTAVGVNPM  724

Query  249   ITILSTAYCISNGLAKSLNSGK  184
             IT+ STAYCI+  +A+SL+  K
Sbjct  725   ITVESTAYCIAKKIAQSLDKQK  746



>ref|XP_011080081.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Sesamum indicum]
Length=742

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/745 (67%), Positives = 588/745 (79%), Gaps = 18/745 (2%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRN--SYNHGLSSSQYQALAAICEALIPPIPLPQDSD------DEAM  2224
             M   + H LLRGGRRN  SY+HG SSSQ Q+LAAIC+ LIPP+PL  + +       +  
Sbjct  1     MKGEEPHLLLRGGRRNCSSYSHGFSSSQIQSLAAICQTLIPPLPLDDNDNDDANLLHQPN  60

Query  2223  CSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP  2044
              SFY SS      PDEVAE++++R +P AVFI  LVL  LS+RLG+LLLCG++C D +WP
Sbjct  61    HSFYKSSG-----PDEVAELLVKRGIPAAVFIVSLVLKFLSSRLGTLLLCGWICLDWKWP  115

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             F+H+F EL LK+REAIL KWSRETL LPLRI F+ +KI C F++FSWTDEN +NPAWEAI
Sbjct  116   FVHSFCELTLKKREAILQKWSRETLFLPLRIAFLLLKIMCLFVFFSWTDENSSNPAWEAI  175

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
             G+ V+  E    ++  RPLEKGIIE +NE+  +LK+SL++KG+N+ E +N N   I+CDV
Sbjct  176   GYQVEAIERETKREKERPLEKGIIEIMNEDELSLKKSLVQKGINIAEDENENVYKIKCDV  235

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             VI+GSGCGGGVAAAVLA SG KV++LEKGHYFV EDYSGLEGP+  ELYESGGMLTTTDG
Sbjct  236   VIIGSGCGGGVAAAVLAKSGQKVLILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTTDG  295

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             K+MV AGT +GGGS+INWSA I+TP+ +L EWS E KI LFGS EYQSA+DAVC+RIGVT
Sbjct  296   KIMVMAGTALGGGSSINWSACIRTPDYILKEWSTENKIHLFGSHEYQSAVDAVCERIGVT  355

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             E C +EG QNQVLR+GCENLGLKVE VPRN S  HYCGSC YGCR GDKKG D+T+LVDA
Sbjct  356   ENCVQEGFQNQVLRRGCENLGLKVEPVPRNSSTYHYCGSCCYGCRRGDKKGTDSTWLVDA  415

Query  1143  VNNGAVILTGCQAEKFILEED--ETARKKCLGVIAKSKGNN--KILRIEARATVSACGSL  976
             V N AVILTGC+AE  +L  D  E  RK+CLGVIA ++  N  K L+IEAR TVSACGSL
Sbjct  416   VKNSAVILTGCKAEALMLVTDNKEKDRKRCLGVIATAENKNIRKKLQIEARVTVSACGSL  475

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TPPLLISSGL+NKNIG NLHLHPV   WGYFPES+ E++GK+ +GGI+TS+HKV SE  
Sbjct  476   LTPPLLISSGLQNKNIGKNLHLHPVSLVWGYFPESLVELKGKSFEGGILTSLHKVQSEQE  535

Query  795   KQ-AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRI  619
                 AI+EA +LGP  F A+ PW S  DM +RM KY+RT  +F++ RDHGSG+V+K G I
Sbjct  536   SDIQAIVEAAALGPGSFGALFPWVSRRDMNDRMTKYARTAVLFALPRDHGSGEVRKQGHI  595

Query  618   QYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVA  439
             +YR+  +DK+N++TGLR+ALRILV AGAAEVGTFRSDGQ+I CKG K E+LE FLD V A
Sbjct  596   KYRLSAVDKENLKTGLRRALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDTVTA  655

Query  438   TGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGV  259
              GGP S  E WTLYCSAHQMGSCRMGA EEDGA+D NGECWEAKGL+VCDGSVLPSA+GV
Sbjct  656   VGGPRSRSEYWTLYCSAHQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPSAVGV  715

Query  258   NPMITILSTAYCISNGLAKSLNSGK  184
             NPMITI STAYCIS  LA SL  GK
Sbjct  716   NPMITIQSTAYCISKRLADSLKEGK  740



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/748 (64%), Positives = 583/748 (78%), Gaps = 13/748 (2%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPL-------PQDSDD  2233
             E+ M  R+CHPLLRGGRR  SY+HG S S+ Q + AICEALIPPIPL        +    
Sbjct  5     EQTMKRRECHPLLRGGRRQGSYSHGFSLSEMQVVTAICEALIPPIPLGSLHVNGKESPPS  64

Query  2232  EAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDG  2053
             +++ SFY +S SQ P PDEVAE+++ + L   V + RL+L +LSTRLG+LL+CG + F  
Sbjct  65    KSIQSFYLASGSQKPIPDEVAELIVTKALWHGVLVVRLLLWMLSTRLGTLLICGTLSFGS  124

Query  2052  RWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAW  1873
             RWPF+  FSEL L++RE +L KWSR    + LR++F   KI C F +FS TDEN  NPAW
Sbjct  125   RWPFLCKFSELSLEKREEVLKKWSRARYQIHLRLMFAMFKIFCCFAFFSLTDENSTNPAW  184

Query  1872  EAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             +AIG+HVDT E        RPL+KGIIET+NE+ +TL +SL +KG  VTE    N   I 
Sbjct  185   DAIGYHVDTYESSHKTDKKRPLQKGIIETMNESDSTLVQSLTQKGFKVTEDPKRNLHKIE  244

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CDVV+VGSGCGGGVAA+VLA+SG KV+VLEKG+YF  EDYS +EGPSL +LYESGGML+T
Sbjct  245   CDVVVVGSGCGGGVAASVLASSGQKVIVLEKGNYFAPEDYSSVEGPSLNQLYESGGMLST  304

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DGKVM+ AG+ VGGGSA+NWSASIKTP++VL EW +  KIPLFGSS+Y SAMD V KR 
Sbjct  305   FDGKVMIMAGSTVGGGSAVNWSASIKTPSSVLREWFVGHKIPLFGSSDYLSAMDVVFKRN  364

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE C KEGLQNQVL+KGCENLGLKVESVPRN SE HYCGSCG+GCR GDK+G DTT+L
Sbjct  365   GVTENCVKEGLQNQVLQKGCENLGLKVESVPRNSSENHYCGSCGFGCRRGDKRGTDTTWL  424

Query  1152  VDAVNNGAVILTGCQAEKFILEED---ETARKKCLGVIAK--SKGNNKILRIEARATVSA  988
             VDAV++GAVILTGC A++F+LE++    T +KKCLGV+A+  SK   K L+IEA+ T+SA
Sbjct  425   VDAVDHGAVILTGCLAKRFMLEKNNHGRTKKKKCLGVMARAYSKNITKELQIEAKVTISA  484

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
             CGSL TPPL+ISSGLKN NIG NL LHPV  AWGYFPESM +++GK  +GGIITSIHKVV
Sbjct  485   CGSLLTPPLMISSGLKNPNIGKNLRLHPVTMAWGYFPESMPKLKGKAFEGGIITSIHKVV  544

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
             +E +   AIIE  +LGPA F ++ PW SGLDMK+RM KY+RT ++F+++RD GSG+VK  
Sbjct  545   TEKSDVQAIIETPALGPAAFGSLVPWVSGLDMKKRMVKYARTAHLFALIRDQGSGEVKSR  604

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             G I Y   + DK+N++ GL+QALRIL+AAGA EVGT R+DGQ+I CKGIK E+LE FL+ 
Sbjct  605   GMITYEFSKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEFLET  664

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             V   GG +SGEENWTLY SAHQMGSCRM +TE++GA+D NGE WEA+GLYVCDGSVLP+A
Sbjct  665   VTTAGGFLSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVLPNA  724

Query  267   IGVNPMITILSTAYCISNGLAKSLNSGK  184
             +GVNPMITI S AYC+S  +AKSLN GK
Sbjct  725   VGVNPMITIQSIAYCLSKKIAKSLNKGK  752



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/731 (63%), Positives = 586/731 (80%), Gaps = 5/731 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSAS  2197
             E+K H LLRGGRR +SY+HG SS+Q Q+LA++CEALIPP+   ++   +++ +FY +S S
Sbjct  5     EKKSHSLLRGGRRQSSYSHGYSSAQIQSLASMCEALIPPLIPNKNPLHKSLQTFYEASGS  64

Query  2196  QPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
             Q P PDE AE+V+++ LP A  +   VL ILS RLG+LLLCGF+CFD +WPF+H FSE+ 
Sbjct  65    QSPIPDETAEMVVKKALPPAASLVSWVLKILSFRLGTLLLCGFICFDWKWPFLHKFSEMS  124

Query  2016  LKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV  1837
             L++REA+L KWS++   +PLR+ F+ IK+ C+F +FS  DEN +NPAWEAIG+HVDT + 
Sbjct  125   LEKREAVLKKWSKQRRFVPLRLAFVLIKLFCFFTFFSRVDENSHNPAWEAIGYHVDTRKR  184

Query  1836  PPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgg  1657
                 +  RPL+ G+IET+ E  ++L +SLI+KGL VTE  N N   I+CD V+VGSGCGG
Sbjct  185   MTKTEKERPLDNGVIETMKETDSSLVQSLIQKGLEVTEDPNDNNYKIKCDAVVVGSGCGG  244

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GVAAAVLA SG KV+VLE+G+YFV++DYS LEGPS+ ELY+ GG+ +T DGK+M+ AG+ 
Sbjct  245   GVAAAVLAKSGQKVIVLEQGNYFVAQDYSSLEGPSMEELYKFGGISSTIDGKIMLLAGST  304

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGSA+NWSASI+TP++VL+EWS++ KIPLFGSSEYQSAMD VCKR+GVT+ C+KE  Q
Sbjct  305   VGGGSAVNWSASIRTPSSVLHEWSVDHKIPLFGSSEYQSAMDVVCKRLGVTDKCTKENFQ  364

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILT  1117
             NQ+LRKGC+NLGL++ SVPRN S  HYC  C YGC TG+KKG DTT+LVDAV  GAVILT
Sbjct  365   NQILRKGCQNLGLEIVSVPRNSSADHYCSFCCYGCPTGEKKGTDTTWLVDAVACGAVILT  424

Query  1116  GCQAEKFILE--EDETARKKCLGVIAK--SKGNNKILRIEARATVSACGSLFTPPLLISS  949
             GC+AEKF+LE  +D  ARKKCLGVIA+  SK   K L+IEA+ TVSACG+L TPPL+ISS
Sbjct  425   GCRAEKFVLENGKDGGARKKCLGVIARCSSKKITKKLKIEAKVTVSACGALSTPPLMISS  484

Query  948   GLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAV  769
             GL+N NIG NLHLHPVL  WGYFPE  +E +GK ++GGIITS+HKV+SEG    AIIE  
Sbjct  485   GLQNPNIGRNLHLHPVLLTWGYFPEDGSEFKGKMYEGGIITSLHKVISEGNNTRAIIETP  544

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
              LGPA FA + PW SG DMK+RM KY+RT ++F+MVRD GSG+VK+ G ++YR+ Q+DK+
Sbjct  545   VLGPATFATLFPWVSGSDMKDRMVKYARTSHLFAMVRDQGSGEVKEEGMVKYRLTQLDKE  604

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEEN  409
             N++ GLRQALRILVAAGA EVGT+RSDGQ+I CKG+K ++ E FLD V A GGP +  E+
Sbjct  605   NLQCGLRQALRILVAAGAVEVGTYRSDGQRIKCKGLKEKDFEEFLDTVTAVGGPGTRGEH  664

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
             WT+YCSAHQMGSCRMGA EE+GA+D NGE WEA+ L+VCDGSVLP+A GVNPMI+I STA
Sbjct  665   WTIYCSAHQMGSCRMGANEEEGAVDENGESWEAESLFVCDGSVLPTAAGVNPMISIESTA  724

Query  228   YCISNGLAKSL  196
             +CIS  + KSL
Sbjct  725   FCISTRIVKSL  735



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/737 (63%), Positives = 572/737 (78%), Gaps = 10/737 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDE-----AMCSFY  2212
             E  CHPLL+GGRR S ++HG SS+Q Q+LAAICEALIPP+ L +  DD      +  S++
Sbjct  5     ESSCHPLLKGGRRESKFSHGFSSAQMQSLAAICEALIPPLSLEEIPDDHQALHYSSSSYH  64

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
             ++S SQPP PDEVAE++++R  P+AV   RL L +LS RLG+ LLCG +CFD +WPFIH 
Sbjct  65    TASGSQPPIPDEVAEMIVKRAQPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHK  124

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FSE  L +RE +L KWSR  L++ +R++FM +K+ C++ +FS  DEN  NPAW+AIGF +
Sbjct  125   FSEXSLDKREQVLNKWSRGKLVITIRLMFMVVKMFCFYTFFSRIDENSRNPAWKAIGFDL  184

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             D  E        RPL+KGIIET+ E+ +TL +SL KKGL V +    N   I CDVVIVG
Sbjct  185   DKKEKLIKTPKERPLDKGIIETVYESDSTLVQSLTKKGLEVADDAANNIHRINCDVVIVG  244

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA SG KVVVLEKG+YFV +DYS LEGPS+ ELYESGG++ + D  VM+
Sbjct  245   SGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELYESGGIMASVDAMVMI  304

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSASI+TP+NVL EWS++ KIPL+ S +YQSAMD VCKRI VTE C+
Sbjct  305   LAGSTVGGGSAVNWSASIRTPHNVLREWSVDHKIPLYASEDYQSAMDIVCKRISVTEGCT  364

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +E  QNQ+LRKGCENLGLKVESVPRN S  HYCG C YGC TGDKKG D+T+LVDAV  G
Sbjct  365   EENFQNQILRKGCENLGLKVESVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVECG  424

Query  1131  AVILTGCQAEKFILEEDETA--RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPP  964
             AVILTGC+AEKFILE D     RK+CLGV A S   N  + L+IEA+ T+SACGSL TPP
Sbjct  425   AVILTGCKAEKFILESDNDGGRRKRCLGVQATSXSKNIKRKLKIEAKVTISACGSLLTPP  484

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAA  784
             L+ISSGLKN+NIG NLHLHPVL +WGYFP+  +E   K ++GGIITSIHKVVSE     A
Sbjct  485   LMISSGLKNRNIGRNLHLHPVLLSWGYFPQHESEFXXKKYEGGIITSIHKVVSETANARA  544

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             IIE   LGPA FA +SPW S LDMK++M KY+RT N+F++VRD  SG VK+ GR+ Y +D
Sbjct  545   IIETAVLGPASFATLSPWISRLDMKDKMEKYARTANLFALVRDXSSGVVKREGRVHYTLD  604

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM  424
             Q+DK+N+  GLRQALRIL+AAGA EVGT+R+DGQ+I CKG+K E+LE FLD VV + GP 
Sbjct  605   QLDKENLLAGLRQALRILIAAGAVEVGTYRNDGQRIKCKGVKEEDLEEFLDTVVTSAGPS  664

Query  423   SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMIT  244
             + EE WT+Y SAHQMGSCRMGATEE+G +D NGE WEAKGL+VCD S+LP+A+GVNPMIT
Sbjct  665   AREELWTIYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDASLLPTAVGVNPMIT  724

Query  243   ILSTAYCISNGLAKSLN  193
             I STAYCIS  +A+SL+
Sbjct  725   IESTAYCISKKIAQSLD  741



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/754 (63%), Positives = 583/754 (77%), Gaps = 19/754 (3%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPL-------PQDSDD  2233
             E+ M  R+CHPLLRGGRR  SY+HG S S+ Q + AICEALIPPIPL        +    
Sbjct  5     EQTMKRRECHPLLRGGRRQGSYSHGFSLSEMQVVTAICEALIPPIPLGSLHVNGKESPPS  64

Query  2232  EAMCSFYSSSASQPPFPDEV------AEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCG  2071
             +++ SFY +S SQ P PDEV      AE+++ + L   V + RL+L +LSTRLG+LL+CG
Sbjct  65    KSIQSFYLASGSQKPIPDEVTVVELVAELIVTKALWHGVLVVRLLLWMLSTRLGTLLICG  124

Query  2070  FVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDEN  1891
              + F  RWPF+  FSEL L++RE +L KWSR    + LR++F   KI C F +FS TDEN
Sbjct  125   TLSFGSRWPFLCKFSELSLEKREEVLKKWSRARYQIHLRLMFAMFKIFCCFAFFSLTDEN  184

Query  1890  YNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNA  1711
               NPAW+AIG+HVDT E        RPL+KGIIET+NE+ +TL +SL +KG  VTE    
Sbjct  185   STNPAWDAIGYHVDTYESSHKTDKKRPLQKGIIETMNESDSTLVQSLTQKGFKVTEDPKR  244

Query  1710  NTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYES  1531
             N   I CDVV+VGSGCGGGVAA+VLA+SG KV+VLEKG+YF  EDYS +EGPSL +LYES
Sbjct  245   NLHKIECDVVVVGSGCGGGVAASVLASSGQKVIVLEKGNYFAPEDYSSVEGPSLNQLYES  304

Query  1530  GGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMD  1351
             GGML+T DGKVM+ AG+ VGGGSA+NWSASIKTP++VL EW +  KIPLFGSS+Y SAMD
Sbjct  305   GGMLSTFDGKVMIMAGSTVGGGSAVNWSASIKTPSSVLREWFVGHKIPLFGSSDYLSAMD  364

Query  1350  AVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKG  1171
              V KR GVTE C KEGLQNQVL+KGCENLGLKVESVPRN SE HYCGSCG+GCR GDK+G
Sbjct  365   VVFKRNGVTENCVKEGLQNQVLQKGCENLGLKVESVPRNSSENHYCGSCGFGCRRGDKRG  424

Query  1170  VDTTYLVDAVNNGAVILTGCQAEKFILEED---ETARKKCLGVIAK--SKGNNKILRIEA  1006
              DTT+LVDAV++GAVILTGC A++F+LE++    T +KKCLGV+A+  SK   K L+IEA
Sbjct  425   TDTTWLVDAVDHGAVILTGCLAKRFMLEKNNHGRTKKKKCLGVMARAYSKNITKELQIEA  484

Query  1005  RATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIIT  826
             + T+SACGSL TPPL+ISSGLKN NIG NL LHPV  AWGYFPESM +++GK  +GGIIT
Sbjct  485   KVTISACGSLLTPPLMISSGLKNPNIGKNLRLHPVTMAWGYFPESMPKLKGKAFEGGIIT  544

Query  825   SIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGS  646
             SIHKVV+E +   AIIE  +LGPA F ++ PW SGLDMK+RM KY+RT ++F+++RD GS
Sbjct  545   SIHKVVTEKSDVQAIIETPALGPAAFGSLVPWVSGLDMKKRMVKYARTAHLFALIRDQGS  604

Query  645   GQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEEL  466
             G+VK  G I Y   + DK+N++ GL+QALRIL+AAGA EVGT R+DGQ+I CKGIK E+L
Sbjct  605   GEVKSRGMITYEFSKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDL  664

Query  465   ESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDG  286
             E FL+ V   GG +SGEENWTLY SAHQMGSCRM +TE++GA+D NGE WEA+GLYVCDG
Sbjct  665   EEFLETVTTAGGFLSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDG  724

Query  285   SVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             SVLP+A+GVNPMITI S AYC+S  +AKSLN GK
Sbjct  725   SVLPNAVGVNPMITIQSIAYCLSKKIAKSLNKGK  758



>ref|XP_002529832.1| electron carrier, putative [Ricinus communis]
 gb|EEF32533.1| electron carrier, putative [Ricinus communis]
Length=745

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/735 (63%), Positives = 578/735 (79%), Gaps = 12/735 (2%)
 Frame = -3

Query  2364  CHPLLRGG--RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDD------EAMCSFYS  2209
             CHPLLRGG  + N+YNHG SS+Q Q L+A CE LIPP+P+   S++      +A+ SFY 
Sbjct  7     CHPLLRGGIKKVNTYNHGFSSAQIQTLSAFCETLIPPLPVNNFSNELPFDKQKALLSFYK  66

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNF  2029
             +S S+ P PDEVAE+++ R L + V +   +L +LS RLG+LLLCGF+C +  WPFIH F
Sbjct  67    ASGSEQPIPDEVAELMVNRGLKEVVLVVDFLLKVLSFRLGTLLLCGFICLEWNWPFIHKF  126

Query  2028  SELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVD  1849
             SE+ L +RE I+ +W+++    PLR++FM +KI C + +FS TD+N  NPAWEAIG+H D
Sbjct  127   SEISLSKREDIVKRWAKQKYFFPLRVLFMAVKIFCSYTFFSRTDDNSENPAWEAIGYHKD  186

Query  1848  TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgs  1669
             T E     +  RPLEKGI+E  NE+  TL +SL++KG+ VTE  + NT  I+CDVVI+GS
Sbjct  187   TREKLTKSRKERPLEKGIVELANEDDLTLVKSLMQKGIQVTEDPDHNTYKIKCDVVIIGS  246

Query  1668  gcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVF  1489
             GCGGGVAAAVLA+SG KV+VLEKG+YFV EDYS +EGPS+ ELYESGG L T +GK+M+ 
Sbjct  247   GCGGGVAAAVLASSGQKVLVLEKGNYFVPEDYSSVEGPSMAELYESGGFLPTLNGKIMIL  306

Query  1488  AGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSK  1309
             AG+ VGGGSAINWSA IKTP+ VL EW ++ +IPLFGS +Y  AMD V KRIGVT+ CS 
Sbjct  307   AGSTVGGGSAINWSACIKTPDTVLKEWCVDYRIPLFGSPDYHYAMDVVQKRIGVTDNCSN  366

Query  1308  EGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGA  1129
             EG QNQVLR+GCENLGLKV+SVPRN S  HYCGSC YGCRTGDKKG D+T+LVDAV +GA
Sbjct  367   EGFQNQVLRRGCENLGLKVDSVPRNSSADHYCGSCCYGCRTGDKKGTDSTWLVDAVGSGA  426

Query  1128  VILTGCQAEKFILEEDET--ARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPL  961
             VILTG +AEKFILEED +  +RK+C+GVIAK+   N  K L+IEARAT+SACGSL TPPL
Sbjct  427   VILTGTRAEKFILEEDHSGRSRKRCIGVIAKTSNTNVTKKLQIEARATISACGSLLTPPL  486

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             +ISSGL N NIG NLHLHPV+ AWGYFPE ++++ GK ++GGIITS+HKVVSE +K  AI
Sbjct  487   MISSGLANPNIGRNLHLHPVIMAWGYFPEHISDLSGKIYEGGIITSVHKVVSEESKVCAI  546

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             +EA +LGPA +AA+SPW SG D K++M KY+RT N+F+++RD GSG+VK   +I++RM +
Sbjct  547   LEAPALGPASYAALSPWVSGQDFKDKMVKYARTANLFALIRDQGSGEVKLEKKIKHRMSR  606

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              D +N+R GLRQALRILV AGA EVGT+RSDGQ+I CKG+K  +LE FLD V A+GG  S
Sbjct  607   SDNENLRIGLRQALRILVGAGAVEVGTYRSDGQRIECKGVKETDLEEFLDTVTASGGLTS  666

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
              EE W +  SAHQM SCRMGATEE+GA+D NGE WEAK L+VCDGS+LPSA+G+NPMITI
Sbjct  667   KEEYWNMLFSAHQMSSCRMGATEEEGAVDENGESWEAKNLFVCDGSILPSAVGINPMITI  726

Query  240   LSTAYCISNGLAKSL  196
              STAYCIS  +A+S+
Sbjct  727   QSTAYCISKRIAESM  741



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/747 (62%), Positives = 584/747 (78%), Gaps = 17/747 (2%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLP-----------QDSDDE  2230
             E  CHPLLRGGRR S ++HG S +Q Q+LAAICEAL+PP+ L            +  DD+
Sbjct  5     ESSCHPLLRGGRRESKFSHGFSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPDDQ  64

Query  2229  AMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR  2050
             A+ S Y +S SQPP PDEVAE++++R LP+ +   +L L +LS RLG+LLLC   C   +
Sbjct  65    ALHSIYRASGSQPPIPDEVAELMVKRALPEVLEGMKLFLKMLSFRLGTLLLCRHRCLSWK  124

Query  2049  WPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWE  1870
             WPFIH+FSE+ L++RE +L KWSRE L+L LR++F+ +KI C++ +FSW DEN  NPAW+
Sbjct  125   WPFIHSFSEMSLEKREEVLKKWSREKLVLTLRLMFLVVKIFCFYTFFSWLDENSRNPAWK  184

Query  1869  AIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRC  1690
             A+G+ ++TN+        RPLE+GIIET+NE+ +TL +SL K+GL V++    N   I+C
Sbjct  185   AVGYDLNTNKKLIKTPKERPLEQGIIETMNESDSTLVQSLTKRGLRVSDDTTHNLHKIQC  244

Query  1689  DvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTT  1510
             DVVIVGSGCGGGVAAAVLA SG KV+V+EKG+YF+ +DYS LEGPS+ ELYESGG++++ 
Sbjct  245   DVVIVGSGCGGGVAAAVLAESGQKVIVVEKGNYFLPKDYSSLEGPSMNELYESGGIMSSV  304

Query  1509  DGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIG  1330
             DG +M+ AG+ VGGGSAINWSASI+TP+ VL+EWS++ K+ L+ SS+Y+SAMD VCKRI 
Sbjct  305   DGMIMILAGSTVGGGSAINWSASIRTPDTVLHEWSVDHKVRLYASSDYKSAMDVVCKRIR  364

Query  1329  VTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLV  1150
             VT+ C++E  QNQ+LRKGC+ LGLKV+ VPRN    HYCGSC YGC TG+K+G D+T+LV
Sbjct  365   VTDSCTEENFQNQILRKGCDTLGLKVDLVPRNSPGDHYCGSCNYGCPTGEKQGTDSTWLV  424

Query  1149  DAVNNGAVILTGCQAEKFILEEDET---ARKKCLGVIAKSKGNN--KILRIEARATVSAC  985
             DAV  GAVILTGC+AEKFILE D      RK+CLGV A S G N  K L+IEA+ T+SAC
Sbjct  425   DAVKCGAVILTGCKAEKFILENDSQGGGTRKRCLGVEATSLGKNIKKKLQIEAKVTISAC  484

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS  805
             GSL TPPL+ISSGLKN NIG+NLHLHPVL +WGYFPE  +E  G+ ++GGIITS+HKVVS
Sbjct  485   GSLLTPPLMISSGLKNPNIGTNLHLHPVLLSWGYFPEHESEFRGRTYEGGIITSLHKVVS  544

Query  804   EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
             + T   AIIE  +LGPA FA++SPW S LDMK+RM KY+RT ++F++VRD GSG VK+ G
Sbjct  545   DTTNVRAIIETPALGPASFASLSPWISRLDMKDRMEKYARTAHLFALVRDKGSGVVKREG  604

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
             RI Y +DQ+DK+N++ GLRQALRIL+AAGA EVGT+R+DGQ+I CKG K E+LE FLD V
Sbjct  605   RIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDTV  664

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
             VA  GP S EE WT+Y SAHQMGSCRM A+EE+G +D NGE WEAKGL+VCDGS+LP+AI
Sbjct  665   VAPAGPSSREELWTIYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAI  724

Query  264   GVNPMITILSTAYCISNGLAKSLNSGK  184
             GVNPMITI STAYCIS  +A+SL   K
Sbjct  725   GVNPMITIQSTAYCISKKIAESLEKEK  751



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/739 (64%), Positives = 587/739 (79%), Gaps = 11/739 (1%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIP----LPQDSDDEAMCSF  2215
             M  R+ HPLLRGGRR +SY+HG SSS+ ++LAAIC+ L+PP+P      Q S ++A+ SF
Sbjct  1     MKGRESHPLLRGGRRVSSYSHGFSSSEIESLAAICQTLVPPLPPETITKQHSHNQAIVSF  60

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             Y +SASQ P P EVAE++++R  P AVF+ RL+L +LS RLG+LLLCG++CFD  WPFIH
Sbjct  61    YKASASQHPIPHEVAELMVKRGQPQAVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIH  120

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             NFSE+ L++RE IL KWSRE  +LPLRIVF+ IK+ C F +F+ TDE   NPAWEAIG+H
Sbjct  121   NFSEISLEKREKILKKWSRERYLLPLRIVFVMIKMFCLFDFFARTDEKSENPAWEAIGYH  180

Query  1854  VDTNEVPPDQQTGRPLEKGIIETI--NENGTTLKESLIKKGLNVTESQNANTLTIRCDvv  1681
             VDT E     +  RPL+KGI+ET+  NEN  +L + L+  GL VT     N   I+CDVV
Sbjct  181   VDTREPSNKPRGERPLQKGIVETVHENENDHSLFQRLVDHGLQVTVDHEHNLFEIKCDVV  240

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             +VGSGCGGGVAAAVLA+SG KV+VLEKG+YFV+EDYS LEGPS+ ELYESGG+L+T DGK
Sbjct  241   VVGSGCGGGVAAAVLASSGQKVLVLEKGNYFVAEDYSSLEGPSMHELYESGGLLSTLDGK  300

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
              MVFAG+ VGGGSA+NWSA I+TP++VL +W +E KIPLFGS +Y++AMD V KRIGVTE
Sbjct  301   FMVFAGSAVGGGSAVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRAAMDKVSKRIGVTE  360

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
              C++EG QNQVLRKGCENLG KVESV RN  E+HYCGSC YGCRTGDKKG D T+LVDAV
Sbjct  361   HCTEEGFQNQVLRKGCENLGFKVESVARNTPEEHYCGSCNYGCRTGDKKGTDVTWLVDAV  420

Query  1140  NNGAVILTGCQAEKFIL--EEDETARKKCLGVIAKSKGNN--KILRIEARATVSACGSLF  973
             +NGAVIL G +AEKFIL   +D    KKCLGV A +   N  + L+I+A+AT+SACGSL 
Sbjct  421   DNGAVILAGFKAEKFILVDNKDSIRSKKCLGVTATALNKNVTRKLQIKAKATISACGSLL  480

Query  972   TPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTK  793
             TPPL+ISSGL+N NIG+NLHLHPVL AWGY P+ ++E++GK  +GGIITSIHKVVSE +K
Sbjct  481   TPPLMISSGLENPNIGTNLHLHPVLLAWGYIPDHVSELKGKTFEGGIITSIHKVVSEDSK  540

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
               AIIE+ ++GPA FAA  PW SG ++K+RM +Y R   +F++VRD GSG+VK  G+I+Y
Sbjct  541   VQAIIESPAMGPASFAASFPWISGRELKDRMLRYGRIAQLFALVRDQGSGEVKVEGKIKY  600

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             R+ + DK+N++TGLRQALRIL+AAGA EVGT+RSDG +I CKGIK E+LE F+  +   G
Sbjct  601   RLSKNDKENLKTGLRQALRILIAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVG  660

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             G  S  E+W++Y SAHQMGSCRMGATEEDGA+D NGE WEA+GL+VCDGSVLPSAIG+NP
Sbjct  661   GMASRGEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINP  720

Query  252   MITILSTAYCISNGLAKSL  196
             MITI ST+YCIS  +A SL
Sbjct  721   MITIESTSYCISKKIADSL  739



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/745 (62%), Positives = 579/745 (78%), Gaps = 13/745 (2%)
 Frame = -3

Query  2379  MNERKCHPLLRGG---RRNSYNHGLSSSQYQALAAICEALIPPIP---LPQDSDDEAMCS  2218
             M  RK HPLL GG    +  Y HG SSSQ Q+LAA+CEALIP +P   + Q SDD A+ S
Sbjct  1     MEGRKSHPLLSGGNLKEKPKYMHGFSSSQIQSLAAVCEALIPSLPTNGVNQISDDNALYS  60

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFI  2038
             +Y+SSASQ PFP+E AE++++R +P AV +  LVL  LSTR+G+LLLCG  C D +WPFI
Sbjct  61    YYTSSASQTPFPNETAELIVKRGIPKAVLVVSLVLKFLSTRIGTLLLCGSNCLDWKWPFI  120

Query  2037  HNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF  1858
             H FSEL + +RE+IL KWSR TL+LPLR VF  +K+ C++ +FS TDE   NPAWEAIG+
Sbjct  121   HKFSELSINKRESILQKWSRGTLVLPLRTVFFMLKVTCFYTFFSLTDEKSQNPAWEAIGY  180

Query  1857  HVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTES-QNANTLTIRCDvv  1681
             H++  E+    +  RPLEKG+IET  EN  TL+ESL++KGL V E+ ++ NTL I CDVV
Sbjct  181   HIEKVEISGQPEKERPLEKGVIETEKENKLTLRESLVQKGLKVAENPKDHNTLNIECDVV  240

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             IVGS CGGGVAAAVLA +G KVVVLEKGHYF +EDYS LEGPS+ E+Y SGG+ +T  GK
Sbjct  241   IVGSDCGGGVAAAVLAKAGLKVVVLEKGHYFTAEDYSELEGPSMNEMYASGGIFSTLHGK  300

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
              ++ AG+ VGGGSA+NWSASIKTP++VL EWS E+KI +FG +EYQSAMD V  RIGVTE
Sbjct  301   FILLAGSTVGGGSAVNWSASIKTPDHVLQEWSAEKKISMFGGAEYQSAMDEVWGRIGVTE  360

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
              C +EG QNQV+RKGCENLGLKVE V RN +E HYCGSCGYGCR G+KKG D+T+LVDAV
Sbjct  361   NCVEEGFQNQVVRKGCENLGLKVEGVARNSTENHYCGSCGYGCRRGEKKGTDSTWLVDAV  420

Query  1140  NNGAVILTGCQAEKFILEEDET--ARKKCLGVIA----KSKGNNKILRIEARATVSACGS  979
             NNGAVILTGC+AEKF+L +D+    RK+C GVIA    +S+     L IEA+A+V+ACG+
Sbjct  421   NNGAVILTGCKAEKFLLVKDKNLEQRKRCKGVIATVESESESTRMKLHIEAKASVAACGA  480

Query  978   LFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEG  799
             LFTPPLL+SSGLKNKNIG NLHLHPVLFAWGYFPES +++ GKN +GGIITS++KV++  
Sbjct  481   LFTPPLLVSSGLKNKNIGKNLHLHPVLFAWGYFPESGSQLRGKNFEGGIITSMNKVITGE  540

Query  798   TKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRI  619
                  I++    GPA +A   PW +G DMK+RM KYSRT  +F++VRD GSG+V++ GR+
Sbjct  541   PNFRTIVQTAGFGPASYAVFLPWVAGKDMKDRMSKYSRTALLFTLVRDVGSGEVREEGRV  600

Query  618   QYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVA  439
              Y++++ D++N++ GLRQ LRI++AAGAAEVGTF+++GQ++ C+G+  E++E FL+ V+A
Sbjct  601   SYKLNKFDEENLKAGLRQCLRIMIAAGAAEVGTFQNNGQRLECEGVGGEDVEKFLEKVMA  660

Query  438   TGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGV  259
              GGP SG + W  Y SAHQM SCRMGA E DGA+D NGE WE KGL+VCDGSVLP+A+GV
Sbjct  661   AGGPSSGGQYWNTYASAHQMSSCRMGADERDGAVDGNGESWEGKGLFVCDGSVLPTAVGV  720

Query  258   NPMITILSTAYCISNGLAKSLNSGK  184
             NPMITI STAYCIS  +A  L+  K
Sbjct  721   NPMITIESTAYCISKRIADYLDKEK  745



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/744 (63%), Positives = 582/744 (78%), Gaps = 25/744 (3%)
 Frame = -3

Query  2364  CHPLLRGGRR-----NSYNHGLSSSQYQALAAICEALIPPIPL-----------PQDSDD  2233
             CHPLLRGG +     NS+ HG SSSQ Q L A+CE +IP +P            PQ+S  
Sbjct  3     CHPLLRGGNKRSDKDNSFKHGFSSSQIQTLTAMCETIIPSLPHTSVTQQILSLHPQNS--  60

Query  2232  EAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDG  2053
               + SF+ +SASQPP PDEVAE++++R LP+AV + R+VL +LSTRLG+LL CG +C + 
Sbjct  61    --ILSFFGNSASQPPIPDEVAEIIVKRVLPEAVILIRVVLKLLSTRLGTLLFCGCLCLEW  118

Query  2052  RWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAW  1873
             +WPFIH FSE+ L++RE +L +WS E+    LR+VF+ IKIAC FI+F+ TD+N  NPAW
Sbjct  119   KWPFIHKFSEMSLEKREKLLQRWSTESYWTSLRVVFLLIKIACCFIFFTRTDDNAENPAW  178

Query  1872  EAIGFHVDTNEVP-PDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTI  1696
             EAIG++VDT E P    Q  RP++KGI+E    N +T+ + L +KGL V+E  + + L +
Sbjct  179   EAIGYNVDTREPPVHSSQEQRPIQKGIVECRMMNDSTVVQILEEKGLTVSEDVDQSVLKV  238

Query  1695  RCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLT  1516
             +CDVVIVGSGCGGGVAAA+LA+ GHKVV+LEKG+YF   DYS LEGPSL ELY SGGMLT
Sbjct  239   QCDVVIVGSGCGGGVAAAILASHGHKVVILEKGNYFAPGDYSSLEGPSLNELYLSGGMLT  298

Query  1515  TTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKR  1336
             T DGK++VF+G+ VGGGSA+NWSA IKTP++VLNEWS+  K+P+FGS +Y+SAM+ V KR
Sbjct  299   TLDGKMIVFSGSTVGGGSAVNWSACIKTPDSVLNEWSVNHKLPIFGSPDYKSAMNEVWKR  358

Query  1335  IGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTY  1156
             +GVTE CS+EG QNQVLRKGCE+LGLKVE VP N S+ HYCGSC YGCR GDKKG DTT+
Sbjct  359   LGVTEDCSEEGFQNQVLRKGCEHLGLKVEKVPTNSSKDHYCGSCCYGCRMGDKKGTDTTW  418

Query  1155  LVDAVNNGAVILTGCQAEKFILEEDETA--RKKCLGVIAK--SKGNNKILRIEARATVSA  988
             LVDAVNNGA+ILTGC+A KFILEE +    RK+C GV+A   SK  +K L+IE++ T+SA
Sbjct  419   LVDAVNNGAIILTGCKANKFILEETQNGEKRKRCHGVLATLLSKDVSKKLQIESKVTISA  478

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
             CGSL TPPLLISSGL+N NIG+NLHLHP L AWGYFPES   ++GK ++GGIITS+HKVV
Sbjct  479   CGSLSTPPLLISSGLQNSNIGTNLHLHPTLLAWGYFPESTPGLKGKCYEGGIITSLHKVV  538

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
             SE +   AIIEA +LGPA F+++ PW SGLD KER+ KY RT ++FS+VRD  SG+VKK 
Sbjct  539   SEKSNVHAIIEASALGPASFSSLMPWVSGLDFKERLVKYGRTASLFSLVRDKSSGEVKKE  598

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GR++YR++  DK+N++ GLRQ LRILVAAGA EVGT+RSDGQ++ CKG+K EE+E FLD 
Sbjct  599   GRVRYRLNNHDKENLKMGLRQCLRILVAAGAVEVGTYRSDGQRLNCKGVKEEEMEEFLDS  658

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             V+A GG  S  E+WT+Y  AHQM SCRMGA++EDGA+D NGE WEAKGLYVCDGSVLP+A
Sbjct  659   VIAPGGARSRTEHWTMYGCAHQMSSCRMGASKEDGAVDENGETWEAKGLYVCDGSVLPTA  718

Query  267   IGVNPMITILSTAYCISNGLAKSL  196
             +GVNPMITI S AYCIS  +A  L
Sbjct  719   LGVNPMITIESVAYCISTRIASVL  742



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/739 (64%), Positives = 586/739 (79%), Gaps = 11/739 (1%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIP----LPQDSDDEAMCSF  2215
             M  R+ HPLLRGGRR +SY+HG SSS+ ++LAAIC+ L+PP+P      Q S ++A+ SF
Sbjct  1     MKGRESHPLLRGGRRASSYSHGFSSSEIESLAAICQTLVPPLPPETITKQHSHNQAIVSF  60

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             Y +SASQ P P EVAE++++R  P AVF+ RL+L +LS RLG+LLLCG++CFD  WPFIH
Sbjct  61    YKASASQHPIPHEVAELMVKRGQPQAVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIH  120

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             NFSE+ L++RE IL  WSRE  +LPLR+VF+ IK+ C F +F+ TDE   NPAWEAIG+H
Sbjct  121   NFSEISLEKREKILKNWSRERYLLPLRVVFVMIKMFCLFYFFARTDEKSENPAWEAIGYH  180

Query  1854  VDTNEVPPDQQTGRPLEKGIIETI--NENGTTLKESLIKKGLNVTESQNANTLTIRCDvv  1681
             VDT E     +  RPL+KGI+ET+  NEN  +L + L+  GL VT     N   I+CDVV
Sbjct  181   VDTREPSNKPRGERPLQKGIVETVHENENDHSLFQCLVDHGLQVTVDHEHNLFEIKCDVV  240

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             +VGSGCGGGVAAAVLA+SG KV+VLEKG+YFV+EDYS LEGPS+ ELYESGG+L+T DGK
Sbjct  241   VVGSGCGGGVAAAVLASSGQKVLVLEKGNYFVAEDYSSLEGPSMLELYESGGLLSTLDGK  300

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
              MVFAG+ VGGGSA+NWSA I+TP++VL +W +E KIPLFGS +Y++AMD V KRIGVTE
Sbjct  301   FMVFAGSAVGGGSAVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRAAMDKVSKRIGVTE  360

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
              C++EG QNQVLRKGCENLG KVESV RN  E+HYCGSC YGCRTGDKKG D T+LVDAV
Sbjct  361   HCTEEGFQNQVLRKGCENLGFKVESVARNTPEEHYCGSCNYGCRTGDKKGTDVTWLVDAV  420

Query  1140  NNGAVILTGCQAEKFIL--EEDETARKKCLGVIAKSKGNN--KILRIEARATVSACGSLF  973
             +NGAVIL G +AEKFIL   +D    KKCLGV A +   N  + L+I+A+AT+SACGSL 
Sbjct  421   DNGAVILAGFKAEKFILVDNKDSIRSKKCLGVTATALNKNVTRKLQIKAKATISACGSLL  480

Query  972   TPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTK  793
             TPPL+ISSGL+N NIG+NLHLHPVL AWGY P+ ++E++GK  +GGIITSIHKVVSE +K
Sbjct  481   TPPLMISSGLENPNIGTNLHLHPVLLAWGYIPDHVSELKGKTFEGGIITSIHKVVSEDSK  540

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
               AIIE+ ++GPA FAA  PW SG ++K+RM +Y R   +F++VRD GSG+VK  G+I+Y
Sbjct  541   VQAIIESPAMGPASFAASFPWISGRELKDRMLRYGRIAQLFALVRDQGSGEVKVEGKIKY  600

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             R+ + DK+N++TGLRQALRILVAAGA EVGT+RSDG +I CKGIK E+LE F+  +   G
Sbjct  601   RLSKNDKENLKTGLRQALRILVAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVG  660

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             G  S  E+W++Y SAHQMGSCRMGATEEDGA+D NGE WEA+GL+VCDGSVLPSAIG+NP
Sbjct  661   GMASRGEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINP  720

Query  252   MITILSTAYCISNGLAKSL  196
             MITI ST+YCIS  +A SL
Sbjct  721   MITIESTSYCISKKIADSL  739



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/736 (63%), Positives = 571/736 (78%), Gaps = 10/736 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDE----AMCSFYS  2209
             E   HPLL+GGRR +SY HG SS+Q Q+LAAICE  +PP+PL    DD+    A+ +F+ 
Sbjct  4     EESGHPLLQGGRRRSSYTHGFSSAQIQSLAAICETFVPPLPLDAKFDDKQNSAALDAFHK  63

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNF  2029
             +S ++PPFPDEVA+ +M+R  P AV   +LVL ++S RLG+LLLCG+ C D +WPFIH F
Sbjct  64    ASGAEPPFPDEVADFLMKRGQPKAVSFAKLVLTLVSFRLGTLLLCGWDCCDWKWPFIHKF  123

Query  2028  SELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVD  1849
             SE+P++RRE IL+KWS +   LPLR VF  IK  C FI+FS TDEN  NPAW+AIG+ VD
Sbjct  124   SEIPVERREKILIKWSWKVHPLPLRAVFALIKTYCLFIFFSMTDENSGNPAWKAIGYQVD  183

Query  1848  TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgs  1669
               +     Q GRPL+KGIIET++E+ +T  +SL +KGL V E    N   I+CDVVIVGS
Sbjct  184   NRQKKAYPQ-GRPLQKGIIETMHEDDSTFVQSLTEKGLQVMEDPEHNVYKIKCDVVIVGS  242

Query  1668  gcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVF  1489
             GCGGGVAAAVLA+SG KVVV+EKG+YF  +DY+ LEGPS+ ELYESGG LTTT+GK+M+ 
Sbjct  243   GCGGGVAAAVLASSGQKVVVIEKGNYFAPQDYTSLEGPSMSELYESGGFLTTTNGKIMIM  302

Query  1488  AGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSK  1309
             AG+ VGGGSAINWSASIKTP NVL EW ++ KIP FGSSEY+ AMDAV KRIGVTE C++
Sbjct  303   AGSTVGGGSAINWSASIKTPKNVLREWCVDHKIPFFGSSEYEIAMDAVRKRIGVTENCTE  362

Query  1308  EGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGA  1129
             EG QNQVLRKGCE LGLKVE+VPRN ++ HYCGSC  GCRTGDKKG D+T+LVDAV  GA
Sbjct  363   EGFQNQVLRKGCEKLGLKVEAVPRNTADNHYCGSCNLGCRTGDKKGTDSTWLVDAVGCGA  422

Query  1128  VILTGCQAEKFIL--EEDETARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPL  961
             VILT C+A+KFIL    D   RKKCLGVIA S  K   K L IEA+ATVSACGSL TPPL
Sbjct  423   VILTACKADKFILVNNNDARRRKKCLGVIATSWNKKLTKKLHIEAKATVSACGSLLTPPL  482

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             +ISSGLKN NIG NLHLHPVL  WGYFPE  + ++GK ++GGIITS HKVVSE T   AI
Sbjct  483   MISSGLKNPNIGRNLHLHPVLVGWGYFPEDASGLKGKTYEGGIITSFHKVVSEETNVHAI  542

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             I+  +LGPA  AA+SPW SG + KERM +Y R  ++F+++RD GSG+V + G+I+YR  +
Sbjct  543   IQTPALGPASVAALSPWVSGSEFKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIRYRFSE  602

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
             +DK+N++ GLRQ LRI++AAGA EVGT RSDGQ+I CKG+  E L+ FLD V   GG  S
Sbjct  603   MDKENLKIGLRQVLRIIIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDDVPVVGGASS  662

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
              EE WT+Y SAHQMGSCR+GAT+E+GA+D NG+ WEA+GL+VCD SVLP+AIG+NPM+TI
Sbjct  663   KEEYWTMYVSAHQMGSCRIGATQEEGAVDENGQSWEAEGLFVCDASVLPTAIGINPMLTI  722

Query  240   LSTAYCISNGLAKSLN  193
              ST+YCISN +A  LN
Sbjct  723   QSTSYCISNKIADLLN  738



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/747 (61%), Positives = 578/747 (77%), Gaps = 17/747 (2%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLP-----------QDSDDE  2230
             E  CH LLRGGR+ S ++HG S +Q Q+LAAICEAL+PP+ L            +  DD+
Sbjct  5     ESSCHLLLRGGRKESKFSHGFSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPDDQ  64

Query  2229  AMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR  2050
             A+ S Y +S SQPP PDEVAE++++R LP+ +   +L L +LS RLG+LLLCG  C   +
Sbjct  65    ALHSIYRASGSQPPIPDEVAELMLKRALPEVMEGMKLFLKMLSFRLGTLLLCGHRCLSWK  124

Query  2049  WPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWE  1870
             WPFIH+FSE+ L++RE +L KWS+E L+L LR++F+ +KI C++ +FS  DEN  NPAW+
Sbjct  125   WPFIHSFSEMSLEKREEVLKKWSKEKLVLTLRLMFLVVKIFCFYTFFSRLDENSRNPAWK  184

Query  1869  AIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRC  1690
             A+G+ ++TN+        RPLE+GIIET+NE+ +T  +SL K+GL V++    N   I+C
Sbjct  185   AVGYDLNTNKKLIKTPKERPLEQGIIETLNESDSTFVQSLTKRGLQVSDDTTHNIHKIKC  244

Query  1689  DvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTT  1510
             DVVIVGSGCGGGVAAAVLA SG KV+V+EKG+YF+ +DYS LEGPS+ ELYESGG++++ 
Sbjct  245   DVVIVGSGCGGGVAAAVLAQSGQKVMVVEKGNYFLPKDYSSLEGPSMNELYESGGIMSSV  304

Query  1509  DGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIG  1330
             DG +M+ AG+ VGGGSAINWSASI+TP+ VL+EWS++ K+PL+ SS+Y+ AMD VCKRI 
Sbjct  305   DGMIMILAGSTVGGGSAINWSASIRTPDTVLHEWSVDHKVPLYASSDYKYAMDVVCKRIS  364

Query  1329  VTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLV  1150
             VT+ C++E  QNQ+LRKGC+ LGLKV+ VPRN    HYCGSC YGC TG+K+G D+T+LV
Sbjct  365   VTDSCTEENFQNQILRKGCDTLGLKVDLVPRNSPGDHYCGSCNYGCPTGEKQGTDSTWLV  424

Query  1149  DAVNNGAVILTGCQAEKFILEEDET---ARKKCLGVIAKSKGNN--KILRIEARATVSAC  985
             DAV  GAVILTGC+AEKFILE D      RK+CLGV A S   N  K L+IEA+ T+SAC
Sbjct  425   DAVKCGAVILTGCKAEKFILENDSQGGGTRKRCLGVEATSLSKNMKKKLQIEAKVTISAC  484

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS  805
             GSL TPPL+ISSGLKN NIG NLHLHPVL +WGYFPE  +E  G+ ++GGIITS+HKVVS
Sbjct  485   GSLLTPPLMISSGLKNPNIGRNLHLHPVLLSWGYFPEHESEFRGRTYEGGIITSLHKVVS  544

Query  804   EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
             + T   AIIE  +LGPA FA +SPW S LDMK+RM KY+RT ++F++VRD GSG VK+ G
Sbjct  545   DTTNVRAIIETPALGPASFATLSPWISRLDMKDRMEKYARTAHLFALVRDKGSGVVKREG  604

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
             RI Y +DQ+DK+N++ GLRQALRIL+AAGA EVGT+R+DGQ+I CKG K E+LE FLD V
Sbjct  605   RIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDSV  664

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
             VA  GP S EE WT Y SAHQMGSCRM A+EE+G +D NGE WEAKGL+VCDGS+LP+AI
Sbjct  665   VAAAGPSSREELWTTYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAI  724

Query  264   GVNPMITILSTAYCISNGLAKSLNSGK  184
             GVNPMITI STAYCIS  +A+SL   K
Sbjct  725   GVNPMITIQSTAYCISKKIAESLEKEK  751



>gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Erythranthe guttata]
Length=744

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/753 (61%), Positives = 580/753 (77%), Gaps = 33/753 (4%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIP--------------LPQ  2245
             M + + HPLLRGGRR +SY+HG S+SQ Q+L AIC  +IPP+               +  
Sbjct  1     MKKEEAHPLLRGGRRRSSYSHGFSASQIQSLTAICHTIIPPLTNLRAEVDDDDDDDVITG  60

Query  2244  DSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFV  2065
                   + +FYSS+      PDEVAE++++R +P AVFI  LVL  LS+RLG+L+LCG++
Sbjct  61    GDMSNHVQAFYSSNG-----PDEVAELIVKRGVPKAVFIVSLVLKFLSSRLGTLVLCGYI  115

Query  2064  CFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYN  1885
             CFD  WPF+  FSELPLK+RE++L  WSR+TL+LPLRI F+ +KI   FI+FSWTDEN +
Sbjct  116   CFDKNWPFVRTFSELPLKKRESVLQNWSRQTLLLPLRIAFLLLKIITLFIFFSWTDENSS  175

Query  1884  NPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETI-NENGTTLKESLIKKGLNVTESQN-A  1711
             NPAWEAIG+HV+  E+   Q+   PL+KG+IET+ NE+  +LKESL++KG++V E  N  
Sbjct  176   NPAWEAIGYHVE--EILEKQENEPPLKKGVIETMKNEDDASLKESLLQKGVSVIEDPNEK  233

Query  1710  NTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYES  1531
             NT  I+CDV IVGSG GGGVAAAVLA SG KV+++EKG+YF  +DYSGLEGPSL ELYES
Sbjct  234   NTFKIKCDVAIVGSGSGGGVAAAVLAKSGQKVIIIEKGNYFTPQDYSGLEGPSLSELYES  293

Query  1530  GGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMD  1351
             GG+L+T DGK+M+ AG+ VGGGS++NWSA I+TP+ VL EWS + K+PLF ++EY+SAMD
Sbjct  294   GGILSTEDGKIMIQAGSTVGGGSSVNWSACIRTPDYVLQEWSKQNKLPLFTTNEYKSAMD  353

Query  1350  AVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKG  1171
              VC+R+GVTE C +EG QN+VLRKG ENLGLK+E VPRN S  HYCGSC YGC+ GDKKG
Sbjct  354   DVCERLGVTENCVEEGFQNKVLRKGVENLGLKIEPVPRNSSADHYCGSCCYGCKRGDKKG  413

Query  1170  VDTTYLVDAVNNGAVILTGCQAEKFILEEDETARKKCLGVIAKSKGNN--KILRIEARAT  997
              ++T+LVDAVN GAVIL+GC+AEKF+L      + +C+GVIA S+  N  K L IEAR T
Sbjct  414   TESTWLVDAVNEGAVILSGCKAEKFVL-----VKNRCIGVIATSENKNIKKKLYIEARVT  468

Query  996   VSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIH  817
             +SACGSL TPPLLISSGLKNKNIGSNLHLHPV F WGYFPE  +E++GK  +GGI+TS+H
Sbjct  469   ISACGSLLTPPLLISSGLKNKNIGSNLHLHPVSFVWGYFPEPSSEIKGKCFEGGILTSLH  528

Query  816   KVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSG  643
             KV    E      +IE  +LGPA FA + PW S  ++ ERM KYSRT  +F++ RD G G
Sbjct  529   KVQQNQESDNFETVIEVSALGPASFAGLIPWASRQEINERMTKYSRTAVLFALTRDQGLG  588

Query  642   QVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELE  463
             +VK+ G ++YR+ +ID++NI+TGLR+ALRIL+AAGA EVGTFRSDGQ+I C+GIK EEL+
Sbjct  589   EVKRQGHVKYRLSKIDRENIKTGLRRALRILIAAGAEEVGTFRSDGQRIKCRGIKDEELD  648

Query  462   SFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGS  283
              FLD V A GGP S  E WT+YCSAHQMGSCRMG ++EDGA+D NGECWEAKGL+VCDGS
Sbjct  649   EFLDNVGAVGGPRSRSEYWTIYCSAHQMGSCRMGESDEDGAVDENGECWEAKGLFVCDGS  708

Query  282   VLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             VLPSA+GVNPM+TI STAYCIS  LA SL  GK
Sbjct  709   VLPSALGVNPMVTIQSTAYCISKRLAASLKKGK  741



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/738 (63%), Positives = 576/738 (78%), Gaps = 14/738 (2%)
 Frame = -3

Query  2364  CHPLLRGGRRNS---YNHGLSSSQYQALAAICEALIPPIPLPQD-SDDEAMCSFYSSSAS  2197
             CHPLLRGGRR     YNHGLS++Q   +AAIC+ALIP +PL +D S D+A+  FY++SAS
Sbjct  7     CHPLLRGGRRREEKGYNHGLSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSAS  66

Query  2196  QPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
             Q PFPDE AE++ +R +P+AV +   VL ILS RLG+LLLCG +  D +WPFI  FSE+ 
Sbjct  67    QLPFPDEAAELLYKRTVPEAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEIS  126

Query  2016  LKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV  1837
             L++RE I   W+RE   + LR+VF+ IK+ C++ +FS TD N  NP W+AIG+ VDT E 
Sbjct  127   LEKREQIFRNWTREKSWVALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGYQVDTKEK  186

Query  1836  PPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgg  1657
                ++  RPLEKG+IET+ E  +TL +SL +KGL VTE +  N   ++CDVVIVGSGCGG
Sbjct  187   LIRKE--RPLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNLYKVKCDVVIVGSGCGG  244

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GVAAAVLANSGHKVVVLEKG YFVS DYS LEGPS+ E YESGG++ + DGK+M+ AG+ 
Sbjct  245   GVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGST  304

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGSA+NWSASI+TP++VL EWS + KIPLFGSS+YQSAMD+VC+RIGVTE C KE  Q
Sbjct  305   VGGGSAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQ  364

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILT  1117
             NQ+L +GCE +G KVESV  N S   YCGSC YGCRTGDKKG D+T+LVD+V NGAVILT
Sbjct  365   NQILIQGCEKMGFKVESVAINSSADDYCGSCCYGCRTGDKKGTDSTWLVDSVGNGAVILT  424

Query  1116  GCQAEKFILE--EDETARKKCLGVIAKSKGNNKI---LRIEARATVSACGSLFTPPLLIS  952
             GC+AE+FILE  ++   +KKCLGVIA +   +K+   L+IE++ T+SACGSL TPPL+IS
Sbjct  425   GCKAERFILENVKNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGSLNTPPLMIS  484

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMA-EMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             SGLKN NIG NLHLHPV FAWGYFPE M     G N++GGIITSIHK  +E +    IIE
Sbjct  485   SGLKNPNIGRNLHLHPVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAEDSTPRFIIE  544

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               SLGP  F+A  PW SG DMK+RM KY+RT NIF+++RD GSG+VK  GR+ YR+D+ D
Sbjct  545   TPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLDKED  604

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+++R GLR+ALRILVAAGA EVGT+RSDGQ+I CKG+K E+LE FLD V   GGP S  
Sbjct  605   KESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRN  664

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             E WT++ +AHQM SCRMGA+EE+GA+D NGE WEA+GLYVCDGSVLPSA+GVNPM+TI S
Sbjct  665   EVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQS  724

Query  234   TAYCISNGLAKSLNSGKA  181
             T+YCI++ +A+SL  GKA
Sbjct  725   TSYCIASKIAESL--GKA  740



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/733 (62%), Positives = 571/733 (78%), Gaps = 8/733 (1%)
 Frame = -3

Query  2370  RKCHPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPLP--QDSDDEAMCSFYSSSA  2200
             R+C PLLRGGRR   Y HG SS++ Q+LA+ICE L+PP+PL   +    + + SFY +S 
Sbjct  3     RECDPLLRGGRREGKYTHGFSSAEMQSLASICEVLLPPLPLNSIEGQPSKGVQSFYQASG  62

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             SQ P PDE AE+ ++R L +AV + R+VLIILSTRLG+LLLCG + F  +WPFI+NFS +
Sbjct  63    SQHPIPDEGAELFVKRALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNFSSI  122

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
              L++RE IL +W R  L+ P+R+ F+ IK  C + +F+  DEN  N AWEAIG+H DT+ 
Sbjct  123   SLEKREKILQRWFRHRLLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIGYHTDTDG  182

Query  1839  VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcg  1660
                     RPL+KG++ET+ E  +TL +SL +KGL V +        I+CDVV+VGSGCG
Sbjct  183   NRSKVPKERPLQKGMVETMQETESTLVQSLNQKGLKVVKDPEQKLYKIKCDVVVVGSGCG  242

Query  1659  ggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGT  1480
             GGVAAAVLA+SGHKVVVLEKG+YF + DYS LEGPS+ +L+ESGG+L T DGK+M+ AG+
Sbjct  243   GGVAAAVLASSGHKVVVLEKGNYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGS  302

Query  1479  MVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGL  1300
              VGGGSAINWSASIKTP +VL EW+ + K+PLFGSS+Y SAMDAVC+RIGVTE C++EG 
Sbjct  303   TVGGGSAINWSASIKTPKSVLQEWAEDHKLPLFGSSQYFSAMDAVCERIGVTETCAEEGF  362

Query  1299  QNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVIL  1120
             QNQVLRKGCENLGLKV+ VPRN SEKHYCGSC YGCR+GDKKG D+T+LVDAV  GAVI+
Sbjct  363   QNQVLRKGCENLGLKVDLVPRNSSEKHYCGSCSYGCRSGDKKGTDSTWLVDAVACGAVII  422

Query  1119  TGCQAEKFILEEDE---TARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLI  955
             TGC+AE+FILE +E     RKKCLGVIAK+  NN    ++IEA+ T+SACGSL TPPL+I
Sbjct  423   TGCKAERFILETNEYGRVKRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLMI  482

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             SSGLKN++IG NLHLHPV   WGYFP+S +E EGK ++GGIITS+HKVVSE  +  AIIE
Sbjct  483   SSGLKNQHIGQNLHLHPVAMIWGYFPDSNSEFEGKAYEGGIITSMHKVVSEDCQVRAIIE  542

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +LGP  FAA+ PW SGLDMK+RM +Y RTV++F+MVRD G+G+VK  GRI Y +  ID
Sbjct  543   TPALGPGSFAALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNLSAID  602

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+N+R G+RQ LRIL+AAGA EVGT+RSDGQ++  KGI  +ELE FLD V A  GP S  
Sbjct  603   KENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAVEGPQSFV  662

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             + WT+  +AHQMGSCRMG +E++GA+D NGE WEA GL+VCDGSVLP+A+GVNPMITI S
Sbjct  663   DKWTITGTAHQMGSCRMGQSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQS  722

Query  234   TAYCISNGLAKSL  196
             TAYC+S  +A SL
Sbjct  723   TAYCLSKKIADSL  735



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/733 (62%), Positives = 571/733 (78%), Gaps = 8/733 (1%)
 Frame = -3

Query  2370  RKCHPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPLP--QDSDDEAMCSFYSSSA  2200
             R+C PLLRGGRR   Y HG SS++ Q+LA+ICE L+PP+PL   +    +A+ SFY +S 
Sbjct  3     RECDPLLRGGRREGKYTHGFSSAEMQSLASICEVLLPPLPLNSIEGQPSKAVQSFYQASG  62

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             SQ P PDE AE+ ++R L +AV + R+VLIILSTRLG+LLLCG + F  +WPFI+NFS +
Sbjct  63    SQHPIPDEGAELFVKRALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNFSSI  122

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
              L++RE IL +W +  L+ P+R+ F+ IK  C + +F+  DEN  N AWEAIG+H DT+ 
Sbjct  123   SLEKREKILQRWFKHRLLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIGYHTDTDG  182

Query  1839  VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcg  1660
                     RPL+KG++ET+ E  +TL +SL +KGL V +        I+CDVV+VGSGCG
Sbjct  183   NRSKVPKERPLQKGMVETMQETESTLVQSLNQKGLKVVKDPEQKLYKIKCDVVVVGSGCG  242

Query  1659  ggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGT  1480
             GGVAAAVLA+SGHKVVVLEKG YF + DYS LEGPS+ +L+ESGG+L T DGK+M+ AG+
Sbjct  243   GGVAAAVLASSGHKVVVLEKGTYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGS  302

Query  1479  MVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGL  1300
              VGGGSAINWSASIKTP +VL+EW+ E K+PLFGSS+Y SAMDAVC+RIGVTE C +EG 
Sbjct  303   TVGGGSAINWSASIKTPKSVLHEWAEEHKLPLFGSSQYFSAMDAVCERIGVTETCVEEGF  362

Query  1299  QNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVIL  1120
             QNQVL+KGCENLGLKV+ VPRN SEKHYCGSC YGCR+GDKKG D+T+LVDAV  GAVI+
Sbjct  363   QNQVLQKGCENLGLKVDLVPRNSSEKHYCGSCSYGCRSGDKKGTDSTWLVDAVACGAVII  422

Query  1119  TGCQAEKFILEEDE---TARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLI  955
             TGC+AE+FILE +E     RKKCLGVIAK+  NN    ++IEA+ T+SACGSL TPPL+I
Sbjct  423   TGCKAERFILETNEYGRVKRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLMI  482

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             SSGLKN++IG NLHLHPV   WGYFP+S +E EGK ++GGIITS+HKVVSE  +  AIIE
Sbjct  483   SSGLKNQHIGQNLHLHPVAMVWGYFPDSNSEFEGKAYEGGIITSMHKVVSEDCQVRAIIE  542

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +LGP  FAA+ PW SGLDMK+RM +Y RTV++F+MVRD G+G+VK  GRI Y +  ID
Sbjct  543   TPALGPGSFAALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNLSAID  602

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+N+R G+RQ LRIL+AAGA EVGT+RSDGQ++  KGI  +ELE FLD V A  GP S  
Sbjct  603   KENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAAEGPQSFV  662

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             + WT+  +AHQMGSCRMG +E++GA+D NGE WEA GL+VCDGSVLP+A+GVNPMITI S
Sbjct  663   DKWTITGTAHQMGSCRMGKSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQS  722

Query  234   TAYCISNGLAKSL  196
             TAYC+S  +A SL
Sbjct  723   TAYCLSKKIADSL  735



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/736 (63%), Positives = 575/736 (78%), Gaps = 9/736 (1%)
 Frame = -3

Query  2376  NERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD-DEAMCSFYSSSA  2200
              E   HPLLR  RR   NH  SSSQ +A+AA CEALIPP+PL ++S  D+++ SFY SSA
Sbjct  4     TEVPSHPLLRT-RRTDLNHDFSSSQMEAMAAFCEALIPPVPLFKESPLDQSLLSFYQSSA  62

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
              Q P PDEVA++++ R  P AVF+ +LVL +LS R+G+LLLCG VCFD RWPF   FSE+
Sbjct  63    FQAPIPDEVADLLVERANPKAVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEI  122

Query  2019  PLKRREAILLKWS--RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT  1846
              L++RE IL  WS       + LR+ FM IKI C F +FS  DE   N AW+ +G+ VDT
Sbjct  123   SLEKRERILKNWSMAHHKYTVLLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKGMGYKVDT  182

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQ-NANTLTIRCDvvivgs  1669
              +     Q  RPLE+G+IET NE+ +TL  SL +KGL V E + + N   I+CDVVIVGS
Sbjct  183   RKQLNHTQKERPLERGMIETGNEDDSTLLRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGS  242

Query  1668  gcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVF  1489
             GCGGGVAAAVLA SG KVVVLEKG+YFV+EDYS LEGPS+ ELYESGG+ +T DGKVM+ 
Sbjct  243   GCGGGVAAAVLAKSGLKVVVLEKGNYFVAEDYSSLEGPSMNELYESGGLKSTLDGKVMLL  302

Query  1488  AGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSK  1309
             AGT VGGGSAINWSASIKTP ++L+EWS + KIPL+GS +YQ AMDAVC RIGVTE C  
Sbjct  303   AGTTVGGGSAINWSASIKTPKSILDEWSTDYKIPLYGSIDYQLAMDAVCDRIGVTEECPV  362

Query  1308  EGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGA  1129
             E  QNQVLRKGCENLGLKV+SV RN S+ HYCGSC YGCR GDKKG DTT+LVDAV  GA
Sbjct  363   ESFQNQVLRKGCENLGLKVDSVSRNSSKDHYCGSCCYGCRVGDKKGTDTTWLVDAVEYGA  422

Query  1128  VILTGCQAEKFILEE--DETARKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPL  961
             VILTGCQA+KFIL+   + + RK+C+GVIA  +SK   K L IEA+AT+SACGSL TPPL
Sbjct  423   VILTGCQADKFILDNTNNTSKRKRCIGVIATPRSKNITKKLHIEAKATISACGSLLTPPL  482

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             LI+SGL+NKNIG+NLHLHPV   WGYFPE +++ +GK ++GG+ITS+HKVVS+ +   AI
Sbjct  483   LIASGLRNKNIGTNLHLHPVSLVWGYFPEELSDFKGKIYEGGLITSLHKVVSKYSNSHAI  542

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             IE  ++GPA FAA+ PWTSG +MK+ M KYSRT ++F+++RD G+G++K    ++YR++Q
Sbjct  543   IETPAVGPASFAALFPWTSGREMKDAMVKYSRTAHLFALIRDQGAGEIKVKANVKYRLNQ  602

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              DK+N+R GLRQALRIL+AAGA EVGT+RSDGQ+I C+G   EELE FLD V A GGP+S
Sbjct  603   TDKENLRIGLRQALRILIAAGATEVGTYRSDGQRIRCQGTNKEELEEFLDSVEAVGGPLS  662

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
              ++ WT+YCSAHQM SCRMG+T+E+GA+D NGE WEA+GL+VCDGSVLP+A+GVNPMITI
Sbjct  663   RQKYWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMITI  722

Query  240   LSTAYCISNGLAKSLN  193
              STAYCIS  +A+SLN
Sbjct  723   QSTAYCISKKIAESLN  738



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=743

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/738 (61%), Positives = 579/738 (78%), Gaps = 8/738 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQ  2194
             E   HPLL G R   ++HG S++Q Q+LAA+CEALIPP+ L  D+ D+A+ SFY +S S+
Sbjct  5     ENSHHPLLSGVRSGKFSHGFSAAQIQSLAAMCEALIPPLSL-DDTSDQALHSFYKASGSE  63

Query  2193  PPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPL  2014
             PP PDEVA+++ +R  P+AV +    L +LS RLG+LL+CG+ C D  WPFIHNF+E+ L
Sbjct  64    PPIPDEVADLIRKRGAPEAVGVLSFFLKVLSYRLGNLLVCGYPCLDKNWPFIHNFAEMSL  123

Query  2013  KRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVP  1834
             ++RE  L +WSRE  ++PLR++F+ +KI C+F +FS    +  NP+W+AIG++V+  E  
Sbjct  124   EKREEALQRWSREKRLIPLRLLFVVVKIFCFFCFFSRIVGDSQNPSWKAIGYNVNKREKL  183

Query  1833  PDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE-SQNANTLTIRCDvvivgsgcgg  1657
                   RPLEKGIIET+ +  +TL ESL KKG+ VT+ + +     I+CDVVIVGSGCGG
Sbjct  184   IKTPKERPLEKGIIETMKKTDSTLIESLTKKGIEVTDGAAHPQIHKIKCDVVIVGSGCGG  243

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GVAAAVLA SG KVVVLEKG+YFV +DYS LEGPS+ ELYESGG++ + DGK+M+ AG+ 
Sbjct  244   GVAAAVLAQSGQKVVVLEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMMILAGST  303

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGSA+NWSASI+TPN+VL EW ++ KIPLFGS +YQSAMDAVCKRIGVT+ C++E +Q
Sbjct  304   VGGGSAVNWSASIRTPNSVLEEWFVDHKIPLFGSPDYQSAMDAVCKRIGVTDSCTEENMQ  363

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILT  1117
             NQ+LRKGCE LGLKV+SVPRN S  HYCGSC YGC TGDK+G D+T+LVDAV  GAVILT
Sbjct  364   NQILRKGCEKLGLKVDSVPRNSSADHYCGSCNYGCPTGDKQGTDSTWLVDAVKCGAVILT  423

Query  1116  GCQAEKFILEEDE---TARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPLLIS  952
             GC+AE+FI+E D    T+RK+CLGV A S  K   K ++IEA+ T+SACGSL TPPL+I+
Sbjct  424   GCKAERFIMENDHQGGTSRKRCLGVQAISLCKNITKKIQIEAKVTISACGSLLTPPLMIT  483

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA-AIIE  775
             SGLKN NIG NLHLHPVL AWG FPE  +E +GK  +GGIITS+HKVVSE  +   AI+E
Sbjct  484   SGLKNPNIGRNLHLHPVLLAWGNFPEDSSEFKGKAFEGGIITSLHKVVSEDNQNVRAIVE  543

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +LGPA FA + PW SGLDMK+R+ KY+RT ++F++VRD GSG+V+   +I+YR+D+ D
Sbjct  544   TAALGPASFATLVPWVSGLDMKDRVAKYARTAHLFALVRDKGSGEVRAENKIEYRLDRSD  603

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+NI+ GLRQA+RIL+AAGA EVGT+R+DGQ+I CKG K E+LE FLD V+A GGP +  
Sbjct  604   KENIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGPRTRG  663

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             E WT+Y +AHQMGSC+MGATE++G +D NGE WEA+GL+VCDGS+LP+AIGVNPMITI S
Sbjct  664   EYWTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMITIQS  723

Query  234   TAYCISNGLAKSLNSGKA  181
             TAYC+S  +A SL   KA
Sbjct  724   TAYCVSKKIADSLKKEKA  741



>emb|CDP03771.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/753 (60%), Positives = 581/753 (77%), Gaps = 18/753 (2%)
 Frame = -3

Query  2388  EKKMNERKCHPLL--RGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS--------  2239
             E K +  + HPLL         Y+HG S SQ QAL+A+CEA +P +  P D+        
Sbjct  2     EGKESHHRHHPLLTRGRRGGGGYSHGFSPSQIQALSAVCEAFLPSLSPPSDAISHSQGDP  61

Query  2238  ---DDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGF  2068
                ++ A+  +Y +S SQ PFPDEVAE++++R LP+ + + +LVL +LSTRLG+LL+CG 
Sbjct  62    QLHNEAALEYYYKASGSQSPFPDEVAEILVKRGLPEGLSVVKLVLKLLSTRLGTLLVCGL  121

Query  2067  VCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENY  1888
             +C + +WPF+H FSELP+K+RE IL KWS ET ++PLRIVF+ IKI C +++FSWTDENY
Sbjct  122   ICLNWKWPFVHRFSELPVKKRETILQKWSTETFLIPLRIVFLMIKIMCCYVFFSWTDENY  181

Query  1887  NNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNAN  1708
              +   +AIG++ D  E     +  RPLEKG+IET+ EN +TLK SLI+KGL V E  N +
Sbjct  182   KSRTLDAIGYNTDAREDKIKPREERPLEKGVIETLYENDSTLKTSLIQKGLFVEEEPNED  241

Query  1707  TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESG  1528
                I+CDVVIVGSGCGGGVAAA+LA SGHKV+VLEKGHYFV EDYSGLEGPS  ELY SG
Sbjct  242   LYKIKCDVVIVGSGCGGGVAAAILAASGHKVLVLEKGHYFVPEDYSGLEGPSFEELYLSG  301

Query  1527  GMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDA  1348
               LTT DGKV++ AG+ VGGG+A+NWSASIKTP++VL EWS+++KIP +G+S YQSAMD 
Sbjct  302   AKLTTVDGKVLLLAGSTVGGGTAVNWSASIKTPDHVLKEWSVDRKIPFYGTSAYQSAMDE  361

Query  1347  VCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGV  1168
             V KRIGVT+ C+ E  QN+++++GCE LGL+   V RN SE HYCGSCGYGC+TGDKKG 
Sbjct  362   VFKRIGVTKNCTVESFQNEIIKQGCEKLGLEAGQVARNSSENHYCGSCGYGCKTGDKKGT  421

Query  1167  DTTYLVDAVNNGAVILTGCQAEKFIL--EEDETARKKCLGVIAKSKGNN---KILRIEAR  1003
              +T+LVDAVNNGAVILTGC+AEKFIL   ++E  R++C GVIA  +G N   + L IEAR
Sbjct  422   HSTWLVDAVNNGAVILTGCKAEKFILGNNKNEEMRRRCRGVIAAVEGRNITKRKLHIEAR  481

Query  1002  ATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITS  823
              T+SACGSL TPPLL+S+GLKNKNIG NLHLHPVLFAWGYFPES ++++G +++GGIIT 
Sbjct  482   VTISACGSLMTPPLLVSTGLKNKNIGHNLHLHPVLFAWGYFPESKSKIKGNSYEGGIITR  541

Query  822   IHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSG  643
             +HKV +  +    IIE+  LGP   A++ PW SG DMK++M KY+RT  IF+++RD GSG
Sbjct  542   LHKVQTGDSNNNCIIESAGLGPGACASLLPWISGNDMKDQMSKYARTARIFALIRDEGSG  601

Query  642   QVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELE  463
             +V++ GR+ Y ++++DK++++ GLRQ LRIL+AAGA EVGT+RSDGQ++ C GIK E++E
Sbjct  602   EVREEGRVTYHLNEMDKEHLKLGLRQCLRILIAAGAVEVGTYRSDGQRLRCDGIKKEDVE  661

Query  462   SFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGS  283
              FLD +VA  GP S  E WT+YCSAHQ+ SCRMG+TEEDGA+D NGE WEA+GL++CDGS
Sbjct  662   EFLDTIVADPGPKSAAEYWTIYCSAHQLSSCRMGSTEEDGAVDENGESWEAEGLFLCDGS  721

Query  282   VLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             V+PSAIGVNPMITI STA+CIS  +A+SL  GK
Sbjct  722   VIPSAIGVNPMITIQSTAFCISKKIAESLKQGK  754



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/738 (63%), Positives = 576/738 (78%), Gaps = 14/738 (2%)
 Frame = -3

Query  2364  CHPLLRGGRRNS---YNHGLSSSQYQALAAICEALIPPIPLPQD-SDDEAMCSFYSSSAS  2197
             CHPLLRGGRR     YNHGLS++Q   +AAIC+ALIP +PL +D S D+A+  FY++SAS
Sbjct  7     CHPLLRGGRRREEKGYNHGLSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSAS  66

Query  2196  QPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
             Q PFPDE AE++ +R +P+AV +   VL ILS RLG+LLLCG +  D +WPFI  FSE+ 
Sbjct  67    QLPFPDEAAELLYKRTVPEAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEIS  126

Query  2016  LKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV  1837
             L++RE I   W+RE   + LR+VF+ IK+ C++ +FS TD N  NP W+AIG+ VDT E 
Sbjct  127   LEKREQIFRNWTREKSWVALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGYQVDTKEK  186

Query  1836  PPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgg  1657
                ++  RPLEKG+IET+ E  +TL +SL +KGL VTE +  N   ++CDVVIVGSGCGG
Sbjct  187   LIRKE--RPLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNLYKVKCDVVIVGSGCGG  244

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GVAAAVLANSGHKVVVLEKG YFVS DYS LEGPS+ E YESGG++ + DGK+M+ AG+ 
Sbjct  245   GVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGST  304

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGSA+NWSASI+TP++VL EWS + KIPLFGSS+YQSAMD+VC+RIGVTE C KE  Q
Sbjct  305   VGGGSAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQ  364

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILT  1117
             NQ+L +GCE +GLKVESV  N S  HYCGSC YGCRTGDKKG D+T+LVD+V NGAVILT
Sbjct  365   NQILIQGCEKMGLKVESVAINSSADHYCGSCCYGCRTGDKKGTDSTWLVDSVGNGAVILT  424

Query  1116  GCQAEKFILEEDETARKK--CLGVIAKSKGNNKI---LRIEARATVSACGSLFTPPLLIS  952
             GC+AE+FILE  +   KK  CLGVIA +   +K+   L+IE++ T+SACGSL TPPL+IS
Sbjct  425   GCKAERFILENGKNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGSLNTPPLMIS  484

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMA-EMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             SGLKN NIG NLHLHPV FAWGYFPE M     G N++GGIITSIHK  +E +    IIE
Sbjct  485   SGLKNPNIGRNLHLHPVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAEDSTPRFIIE  544

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               SLGP  F+A  PW SG DMK+RM KY+RT NIF+++RD GSG+VK  GR+ YR+D+ D
Sbjct  545   TPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLDKED  604

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+++R GLR+ALRILVAAGA EVGT+RSDGQ+I CKG+K E+LE FLD V   GGP S  
Sbjct  605   KESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRN  664

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             E WT++ +AHQM SCRMGA+EE+GA+D NGE WEA+GLYVCDGSVLPSA+GVNPM+TI S
Sbjct  665   EVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQS  724

Query  234   TAYCISNGLAKSLNSGKA  181
             T+YCI++ +A+SL  GKA
Sbjct  725   TSYCIASKIAESL--GKA  740



>ref|XP_011080082.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Sesamum indicum]
Length=742

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/745 (65%), Positives = 575/745 (77%), Gaps = 18/745 (2%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRN--SYNHGLSSSQYQALAAICEALIPPIPLPQDSD------DEAM  2224
             M   + H LLRGGRRN  SY+HG SSSQ Q+LAAIC+ LIPP+PL  + +       +  
Sbjct  1     MKGEEPHLLLRGGRRNCSSYSHGFSSSQIQSLAAICQTLIPPLPLDDNDNDDANLLHQPN  60

Query  2223  CSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP  2044
              SFY SS      PDEVAE++++R +P AVFI  LVL  LS+RLG+LLLCG++C D +WP
Sbjct  61    HSFYKSSG-----PDEVAELLVKRGIPAAVFIVSLVLKFLSSRLGTLLLCGWICSDWKWP  115

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             F+H+F EL LK+REAIL KWSRETL LPLRI F+ +KI C F++FSWTDEN +NPAWEAI
Sbjct  116   FVHSFCELTLKKREAILQKWSRETLFLPLRIAFLLLKIMCLFVFFSWTDENSSNPAWEAI  175

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
             G+ V+  E     +  RPLEKGIIE +NE+ ++LKESL++KG+N  E ++ N   I+CD 
Sbjct  176   GYQVEATERETKYEKERPLEKGIIEIMNEDESSLKESLMQKGINFAEDEDENVYKIKCDA  235

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             VI+GSGCGGGV AAVLA SG KV++LEKGHYFV EDYSGLEGP+  ELYESGGMLTT DG
Sbjct  236   VIIGSGCGGGVTAAVLAKSGQKVLILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTQDG  295

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             K+MV AGT VGGGS +N S  I+TP+ +L EWS E KI LFGS EYQSAMDAVC+RIGVT
Sbjct  296   KIMVMAGTTVGGGSYMNLSHWIRTPDYILKEWSTESKIHLFGSHEYQSAMDAVCERIGVT  355

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             E C +EG QNQVLR+GCENLGL VE VPRN S  HYCGSC   CR GDKKG  +T+LVDA
Sbjct  356   ENCVQEGFQNQVLRRGCENLGLNVEPVPRNSSPDHYCGSCCSDCRRGDKKGTGSTWLVDA  415

Query  1143  VNNGAVILTGCQAEKFILEED--ETARKKCLGVIAKSKGNN--KILRIEARATVSACGSL  976
             V NGAVILTGC+AE  +L  D  E  RK CLGVIA ++  N  K ++IEAR T+SACGSL
Sbjct  416   VKNGAVILTGCKAETLMLVSDKKEKDRKSCLGVIAAAENKNIRKKIQIEARVTISACGSL  475

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TPPLLISSGL+NKNI  NLHLHPV   WGYFPES+ E++GK+  GGI TS+HKV SE  
Sbjct  476   LTPPLLISSGLENKNIRKNLHLHPVSLVWGYFPESLVELKGKSFGGGISTSLHKVQSEEK  535

Query  795   KQ-AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRI  619
                 AI++A +LGPA FA + PW S  DM +RM KY+RT  +F++ RD+GSG+V+K G I
Sbjct  536   SDIQAIVQAGALGPALFATLFPWVSRNDMNDRMTKYARTAVLFALSRDYGSGEVRKQGHI  595

Query  618   QYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVA  439
             +YR+  +DK+N++TGLR+ALRILV AGAAEVGTFRSDGQ+I CKG K E+LE FLD V A
Sbjct  596   KYRLSAVDKENLKTGLRRALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDAVTA  655

Query  438   TGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGV  259
              GGP +  E WTLYCSAHQMGSCRMGA EEDGA+D NGECWEAKGL+VCDGSVLP+A+GV
Sbjct  656   VGGPRTRSEYWTLYCSAHQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPTAVGV  715

Query  258   NPMITILSTAYCISNGLAKSLNSGK  184
             NPMITI STAYCIS  LA SL  GK
Sbjct  716   NPMITIQSTAYCISKRLADSLKEGK  740



>ref|XP_004289971.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=743

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/742 (61%), Positives = 584/742 (79%), Gaps = 10/742 (1%)
 Frame = -3

Query  2379  MNERKC--HPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSS  2206
             M ER+   HPLL G R + ++HG S++Q Q+LAA+CEALIPP+ L  D+ D+A+ SFY +
Sbjct  1     MEERENSHHPLLSGVRSSKFSHGFSAAQIQSLAAMCEALIPPLSL-DDTSDQALHSFYKA  59

Query  2205  SASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFS  2026
             S S+PP PDEVA+++ +R +P+AV +    L +LS RLG+LL+CG+ C D + PFIHNF+
Sbjct  60    SGSEPPIPDEVADLIKKRGVPEAVGLLSFFLKVLSYRLGTLLVCGYPCLDRKGPFIHNFA  119

Query  2025  ELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT  1846
             E+ L++RE  L +WSRE  ++PLR++F+ +KI C+F +FS    +  NP+W+AIG++V+ 
Sbjct  120   EMSLEKREEALQRWSREKRLIPLRLLFVVVKIFCFFCFFSRIVGDSQNPSWKAIGYNVNK  179

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE-SQNANTLTIRCDvvivgs  1669
              E        RPLEKGIIET+ +  +TL ESL KKG+ VT+ + +     I+CDVVIVGS
Sbjct  180   REKLIKTPKERPLEKGIIETMKKTDSTLIESLTKKGIEVTDGAAHPQIHKIKCDVVIVGS  239

Query  1668  gcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVF  1489
             GCGGGVAAAVLA SG KVVVLEKG+YFV +DYS LEGPS+ ELYESGG++ + DGK+M+ 
Sbjct  240   GCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMMIL  299

Query  1488  AGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSK  1309
             AG+ VGGGSA+NWSASI+TPN+VL EW ++ KIPLFGS +YQSAMDAVCKRIGVT+ C++
Sbjct  300   AGSTVGGGSAVNWSASIRTPNSVLEEWFVDHKIPLFGSPDYQSAMDAVCKRIGVTDSCTE  359

Query  1308  EGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGA  1129
             E +QNQ+LRKGCE LGLKV+SVPRN S  HYCGSC YGC TGDK+G D+T+LVDAV  GA
Sbjct  360   ENMQNQILRKGCEKLGLKVDSVPRNSSADHYCGSCNYGCPTGDKQGTDSTWLVDAVKCGA  419

Query  1128  VILTGCQAEKFILEEDE---TARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPP  964
             VILTGC+AE+FI+E D    T+RK+CLGV A S  K   K ++IEA+ T+SACGSL TPP
Sbjct  420   VILTGCKAERFIMENDHQGGTSRKRCLGVQAISLCKNITKKIQIEAKVTISACGSLLTPP  479

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA-  787
             L+I+SGLKN NIG NLHLHPVL AWG FPE  +E +GK  +GGIITS+HKVVSE  +   
Sbjct  480   LMITSGLKNPNIGRNLHLHPVLLAWGNFPEDSSEFKGKAFEGGIITSLHKVVSEDNQNVR  539

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             AI+E  +LGPA FA + PW SGLDMK+R+ KY+RT ++F++VRD GSG+V+   +I+YR+
Sbjct  540   AIVETAALGPASFATLVPWVSGLDMKDRVAKYARTAHLFALVRDKGSGEVRAENKIEYRL  599

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             D+ DK+NI+ GLRQA+RIL+AAGA EVGT+R+DGQ+I CKG K E+LE FLD V+A GGP
Sbjct  600   DRSDKENIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGP  659

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
              +  E WT+Y +AHQMGSC+MGATE++G +D NGE WEA+GL+VCDGS+LP+AIGVNPMI
Sbjct  660   RTRGEYWTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMI  719

Query  246   TILSTAYCISNGLAKSLNSGKA  181
             TI STAYC+S  +A SL   KA
Sbjct  720   TIQSTAYCVSKKIADSLKKEKA  741



>ref|XP_009369442.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=749

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/743 (63%), Positives = 575/743 (77%), Gaps = 14/743 (2%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDE--------AMC  2221
             E  CHPLLRGGRR S ++HG SS+Q Q+LAAICEAL+PP+  P+D  D+        +  
Sbjct  5     ESSCHPLLRGGRRESKFSHGFSSAQIQSLAAICEALLPPLS-PEDIPDDHNPLHSSFSSS  63

Query  2220  SFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPF  2041
             S+ ++SASQPP PDEVAE++++R LP+ V   R+ L +LS RLG+ LLCG  CFD +WPF
Sbjct  64    SYCTASASQPPIPDEVAELMVKRTLPEVVGGVRVFLKMLSLRLGTFLLCGKSCFDWKWPF  123

Query  2040  IHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIG  1861
             IH FSE+ L +RE +  KWSR+ L++ +R++FM IK+ C++ +FS  DEN  NPAW+AIG
Sbjct  124   IHKFSEMSLDKRELVRKKWSRQKLVITIRLMFMVIKMFCFYTFFSRVDENSRNPAWKAIG  183

Query  1860  FHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvv  1681
             + +D  E        RPLEKGIIET  E+ +TL ESL KKGL++T+    N   I+CDVV
Sbjct  184   YELDRKEKLIKTPKQRPLEKGIIETAYESDSTLVESLTKKGLDLTDDAVNNIHKIKCDVV  243

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             IVGSGCGGGVAAA+LA SG KVVVLEKG+YFV +DYS LEGPS+ ELYESGG++++ DG 
Sbjct  244   IVGSGCGGGVAAAILAQSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGIMSSVDGM  303

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
             VM+ AG+ VGGGSA+NWSASIKTP+NVL +WS++ KIPL+ S +Y+SAMD VCKRIGVTE
Sbjct  304   VMILAGSTVGGGSAVNWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTE  363

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
              C++E   NQ+LRKGCENLGLKV++VPRN S  HYCG C YGC TGDKKG D+T+LVDAV
Sbjct  364   SCTEENFPNQILRKGCENLGLKVDAVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAV  423

Query  1140  NNGAVILTGCQAEKFILEEDETA--RKKCLGVIAKSKGNN--KILRIEARATVSACGSLF  973
               GAVILTGC+AEKFILE D     RK+CLGV A S   N  + L+IEA  T+SACGSL 
Sbjct  424   KFGAVILTGCKAEKFILENDNEGGIRKQCLGVQATSLSKNIKRKLQIEANVTISACGSLC  483

Query  972   TPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTK  793
             TPPL+ISSGLKN+NIG NLHLHPVL AWGYFPE   E +GK+++GGIITS+HKVVS    
Sbjct  484   TPPLMISSGLKNRNIGRNLHLHPVLLAWGYFPEHEPEFKGKSYEGGIITSLHKVVSGTAN  543

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
                IIE   LGPA F+ + PWTS LDMK+ M KY+RT N+F+MVRD GSG VK+ GRI Y
Sbjct  544   VRTIIETAVLGPATFSTLFPWTSRLDMKDTMDKYARTANLFAMVRDRGSGTVKREGRIHY  603

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
              +DQ+DK+N++ GLRQ LRIL+AAGA EVGT+R+DGQ++ CKG++ E+LE FLD VVA  
Sbjct  604   TLDQLDKENLQVGLRQTLRILIAAGAVEVGTYRNDGQRMKCKGVEEEDLEEFLDTVVAAA  663

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             GP S EE WT Y SAHQMGSCRMG TEEDG +D NGE WEAKGL+VCDGS+LP+A+GVNP
Sbjct  664   GPSSREELWTTYSSAHQMGSCRMGTTEEDGGVDENGESWEAKGLFVCDGSLLPTAVGVNP  723

Query  252   MITILSTAYCISNGLAKSLNSGK  184
             MITI STAYCIS  +A+SL   K
Sbjct  724   MITIESTAYCISKRIAQSLEKQK  746



>ref|XP_009369441.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=746

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/740 (63%), Positives = 574/740 (78%), Gaps = 11/740 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDE-----AMCSFY  2212
             E  CHPLLRGGRR S ++HG SS+Q Q+L+AICEAL+PPI  P+D  D+     +  S+ 
Sbjct  5     ESSCHPLLRGGRRESKFSHGFSSAQIQSLSAICEALLPPIS-PEDIPDDHNPLHSSSSYC  63

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
             ++SASQPP PDEVAE++++R LP+ V   R+ L +LS RLG+ LLCG  CFD +W FI  
Sbjct  64    TASASQPPIPDEVAELMVKRTLPEVVGGVRVFLKMLSLRLGTFLLCGKCCFDWKWTFIDK  123

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FSE+ L +RE +L KWSR+  ++ +R++FM IK+ C++I+FS  DEN  NPAW+AIG+ +
Sbjct  124   FSEMSLDKREQVLKKWSRQKSVITIRLMFMVIKMFCFYIFFSRVDENSRNPAWKAIGYEL  183

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             D  E        RPLEKGIIET  E+ +TL ESL KKGL++T+    N   I+CDVVIVG
Sbjct  184   DRKEKLIKTPKQRPLEKGIIETAYESDSTLVESLTKKGLDLTDDAVNNIHKIKCDVVIVG  243

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA SG KVVVLEKG+YFV +DYS LEGPS+ ELYESGG++++ DG VM+
Sbjct  244   SGCGGGVAAAVLARSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGIMSSVDGMVMI  303

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSASIKTP+NVL +WS++ KIPL+ S +Y+SAMD VCKRIGVTE C+
Sbjct  304   LAGSTVGGGSAVNWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCT  363

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +E   NQ+LRKGCENLGLKV++VPRN S  HYCG C YGC TGDKKG D+T+LVDAV  G
Sbjct  364   EENFPNQILRKGCENLGLKVDAVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVKFG  423

Query  1131  AVILTGCQAEKFILEEDETA--RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPP  964
             AVILTGC+AEKFILE D     RK+CLGV A S   N  + L+IEA  T+SACGSL TPP
Sbjct  424   AVILTGCKAEKFILENDNEGGIRKQCLGVQATSLSKNIKRKLQIEANVTISACGSLCTPP  483

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAA  784
             L+ISSGLKN+NIG NLHLHPVL AWGYFPE   E +GK+++GGIITS+HKVVS       
Sbjct  484   LMISSGLKNRNIGRNLHLHPVLLAWGYFPEHEPEFKGKSYEGGIITSLHKVVSGTANVRT  543

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             IIE   LGPA F+ + PWTS LDMK+ M KY+RT N+F+MVRD GSG VK+ GRI Y +D
Sbjct  544   IIETAVLGPATFSTLFPWTSRLDMKDTMDKYARTANLFAMVRDRGSGTVKREGRIHYTLD  603

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM  424
             Q+DK+N++ GLRQ LRIL+AAGA EVGT+R+DGQ++ CKG++ E+LE FLD VVA  GP 
Sbjct  604   QLDKENLQVGLRQTLRILIAAGAVEVGTYRNDGQRMKCKGVEEEDLEEFLDTVVAAAGPS  663

Query  423   SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMIT  244
             S EE WT Y SAHQMGSCRMG TEEDG +D NGE WEAKGL+VCDGS+LP+A+GVNPMIT
Sbjct  664   SREELWTTYSSAHQMGSCRMGTTEEDGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMIT  723

Query  243   ILSTAYCISNGLAKSLNSGK  184
             I STAYCIS  +A+SL   K
Sbjct  724   IESTAYCISKRIAQSLEKQK  743



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/736 (63%), Positives = 570/736 (77%), Gaps = 9/736 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD-DEAMCSFYSSSAS  2197
             E   HPLLR  RR   NH  SSSQ +A+AA CEALIPP+PL  ++  D+ + SFY SSA 
Sbjct  5     ESTSHPLLRR-RRTDLNHDFSSSQMEAMAAFCEALIPPLPLFSETPLDQFLLSFYQSSAF  63

Query  2196  QPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
             Q P PDEVA++++ R  P AVF+ +LVL +LS R+G+LLLCG VCFD RWPF   FSE+ 
Sbjct  64    QAPIPDEVADLLVERANPKAVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEIS  123

Query  2016  LKRREAILLKWS--RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTN  1843
             L++RE IL  WS       + LR+ FM IKI C F +FS  DE   N AW+A+G+ VDT 
Sbjct  124   LEKREQILKNWSMAHHKYTVLLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKAMGYEVDTR  183

Query  1842  EVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQ-NANTLTIRCDvvivgsg  1666
             +     Q  RPLE+G+IET NE+ +TL  SL +KGL V E + + N   I+CDVVIVGSG
Sbjct  184   KQLNHTQKERPLERGMIETGNEDDSTLFRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGSG  243

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAAAVLA SG KVVVLEKG+YFV+EDYS LEGPS+ ELYESGG+ +T DGKVM+ A
Sbjct  244   CGGGVAAAVLAKSGLKVVVLEKGNYFVAEDYSSLEGPSMNELYESGGLKSTLDGKVMLLA  303

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             GT VGGGSAINWSASI+TP +VL+EWS + KIPL+GS +YQ AMDAVC RIGVT  C  E
Sbjct  304   GTTVGGGSAINWSASIRTPKSVLDEWSTDHKIPLYGSIDYQLAMDAVCDRIGVTRGCRVE  363

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
               QNQVLRKGCENLGLKV+SV RN SE HYCGSC YGCR GDKKG DTT+LVDAV  GAV
Sbjct  364   SFQNQVLRKGCENLGLKVDSVSRNSSEDHYCGSCCYGCRVGDKKGTDTTWLVDAVKCGAV  423

Query  1125  ILTGCQAEKFILEE--DETARKKCLGVIAK--SKGNNKILRIEARATVSACGSLFTPPLL  958
             ILTGC A+KFILE   + + +KKC+GVIA   SK   K L IEA+AT+SACGSL TPPLL
Sbjct  424   ILTGCHADKFILENTNNTSXKKKCIGVIATPLSKNVTKKLHIEAKATISACGSLLTPPLL  483

Query  957   ISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAII  778
             I+SGL+NKNIG+NLHLHPV   WGYFPE +++ +GK ++GG+IT +H VVS+ +   AII
Sbjct  484   IASGLRNKNIGTNLHLHPVSLVWGYFPEELSDFKGKIYEGGLITCLHNVVSKYSNSHAII  543

Query  777   EAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQI  598
             E  ++GPA FAA+ PWTSG +MK+ M KYSRT ++F++VRD G+G++K    ++YR++Q 
Sbjct  544   ETPAVGPASFAALFPWTSGREMKDAMVKYSRTAHLFALVRDQGAGEIKVKANVKYRLNQT  603

Query  597   DKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSG  418
             DK+N++ GLRQALRIL+AAGA E+GT+RSDGQ+I C+G K E+LE FLD V A GGP S 
Sbjct  604   DKENLKIGLRQALRILIAAGATEIGTYRSDGQRIRCQGTKKEDLEEFLDSVEAVGGPWSR  663

Query  417   EENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITIL  238
             ++ WT+YCSAHQM SCRMG+T+E+GA+D NGE WEA+GL+VCDGSVLP+A+GVNPMITI 
Sbjct  664   QKYWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMITIQ  723

Query  237   STAYCISNGLAKSLNS  190
             STAYCIS  +A+SLN+
Sbjct  724   STAYCISKKIAESLNN  739



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/738 (61%), Positives = 575/738 (78%), Gaps = 13/738 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGR--RNSYNHGLSSSQYQALAAICEALIPPI-PLP-----QDSDDEAMCSF  2215
             R+CHPLLRGGR   + YNHGLSS++ +AL+++CE + P + P+P     Q+   +AM +F
Sbjct  3     RECHPLLRGGRNRESKYNHGLSSAEMEALSSLCETIFPSLSPIPKFDGKQNQPTKAMQAF  62

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             Y +SASQ P PDE+AE++ +R L +AVF+ RLVL +LSTRLG+ LLCG +CF+ +WP+  
Sbjct  63    YRASASQTPMPDEMAELLTKRGLLEAVFLVRLVLWLLSTRLGTFLLCGSLCFEEKWPYFK  122

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             NFS +PL +RE +L KW +     P+R  F+ +KI   +++FS  DE  +NPAWEAI ++
Sbjct  123   NFSSIPLDKRERVLQKWFKHRFFTPIRAAFVYVKILILYVFFSRVDEKGDNPAWEAIEYN  182

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
             V  +E P      RPL+KG+I+T  E  +TL  SL +KGL VT+    N   I+CDVVIV
Sbjct  183   VGADESPDQVPKERPLQKGLIDTNQETASTLLHSLKEKGLRVTQDPRKNVYKIKCDVVIV  242

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAAVLA SG KV VLEKG+YF + DYSGLEGPS+ +LYESGG L TTD +++
Sbjct  243   GSGCGGGVAAAVLAASGQKVFVLEKGNYFTASDYSGLEGPSMDQLYESGGKLATTDAEML  302

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGGSA+NWSASIKTPN+VL EW+  QKIPLFGSSEY SAMDAVC RIGVTE C
Sbjct  303   IMAGSAVGGGSAVNWSASIKTPNSVLQEWTRNQKIPLFGSSEYFSAMDAVCTRIGVTESC  362

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              +EG QNQVLRKGCE+LG+ V++VPRN SE+HYCGSCGYGCR G+KKG D T+LVDAV++
Sbjct  363   GEEGFQNQVLRKGCESLGIPVKTVPRNSSERHYCGSCGYGCRKGEKKGTDRTWLVDAVDH  422

Query  1134  GAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFT  970
             GAVI+TGC+AE+F+LE +E     +KKC+GV AK   NN    L+IEA+ T+SACG+L T
Sbjct  423   GAVIITGCKAERFMLENNEGGSKRKKKCVGVTAKIVNNNIRTRLQIEAKVTISACGALLT  482

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ  790
             PPL+ISSGLKN+NIG NLHLHPVL AWGYFPES +E +GK ++GGIIT++H+V++  +  
Sbjct  483   PPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYEGGIITAVHEVLTGDSNA  542

Query  789   AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
              AIIE  +LGP+ FAA+ PW SG DMK+RM KY+RT ++ +++RD GSG+V   GRI Y 
Sbjct  543   RAIIETPALGPSSFAALYPWVSGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYN  602

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
             +D +DK+N++ GLRQALRILVAAGA EVGT RSDGQ+I C+GIK E+LE FLD V AT G
Sbjct  603   LDAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATAG  662

Query  429   PMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPM  250
             P+S  E+W LY SAHQMGSCRMG  +++GA+D NGE WEA+GL++CD SVLPSA+GVNPM
Sbjct  663   PLSLAEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFICDASVLPSAVGVNPM  722

Query  249   ITILSTAYCISNGLAKSL  196
             ITI STAYC+S  +A+SL
Sbjct  723   ITIQSTAYCLSKKIAESL  740



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/744 (61%), Positives = 572/744 (77%), Gaps = 14/744 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPLP-------QDSDDEAMCSF  2215
             R+CHPLLRGGR+  +Y+HG S  Q +AL+AICEA IP IP         + S ++++ SF
Sbjct  3     RQCHPLLRGGRKKGNYSHGFSYYQMEALSAICEAFIPSIPFDPLRATGGEGSPNKSVQSF  62

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             Y  S SQ P PDEVAE+++ R L  AVF+ + +L +LSTRLG+ LLCG + F   WPF++
Sbjct  63    YLVSGSQKPIPDEVAELLVSRSLWHAVFMVKFLLWMLSTRLGTSLLCGVLTFGCGWPFLY  122

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
              FSELPL++RE IL KWS       LR+ FM +K+ C   +FS T+EN  NPAW+AIG+H
Sbjct  123   KFSELPLEKREQILQKWSGARYHRHLRMFFMLLKVFCMLTFFSMTNENSENPAWDAIGYH  182

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
             VDT       +  RPLEKGIIET++E+ +TL +SL  KG  VT     N   I CDV+IV
Sbjct  183   VDTERRSYKTERKRPLEKGIIETVSESDSTLVQSLTIKGFKVTRGPRWNLHKIECDVIIV  242

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAAVLA+SG KV+VLEKG+YFV EDYS LEGPS  +LYESGG+L + DGK+M
Sbjct  243   GSGCGGGVAAAVLASSGQKVIVLEKGNYFVPEDYSSLEGPSFSQLYESGGILPSLDGKIM  302

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGGSA+NWSA IKTP++VL EW ++ KIPLFGSS+Y SAMD VC+R GVT+ C
Sbjct  303   MMAGSTVGGGSAVNWSACIKTPSSVLREWHMDHKIPLFGSSDYLSAMDTVCERNGVTDTC  362

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              +EG QNQVLR+GCENLGLK++ VPRN SE HYCGSCG+GCR GDK+G D+T+LVDAVN+
Sbjct  363   LEEGFQNQVLRRGCENLGLKIDPVPRNSSENHYCGSCGFGCRRGDKQGTDSTWLVDAVNH  422

Query  1134  GAVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFT  970
             GAVILTGC+A++FIL+ ++       KC+GVIA++   N    L+IEA+ T+SACGSL T
Sbjct  423   GAVILTGCKAKRFILKRNKFGSAKTMKCVGVIARTFSRNIRNKLQIEAKVTISACGSLLT  482

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ  790
             PPL+ISSGL+N NIG NLHLHPV+ AWGYFP+SM E +GK ++GGIITS+HKVV+E +  
Sbjct  483   PPLMISSGLRNPNIGKNLHLHPVMMAWGYFPDSMKEFKGKTYEGGIITSLHKVVTEKSDD  542

Query  789   A-AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
                IIE  +LGP  FAA+ PW SGLDMKE M KY+RT ++F++VRD GSG+VK  GRI Y
Sbjct  543   VCTIIETPALGPGSFAALFPWVSGLDMKECMVKYARTAHLFALVRDQGSGEVKIQGRITY  602

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             R+ ++DK+N++ GLR+ALRIL+AAGA EVGT RSDGQ+I C+GIK E+LE FLD V A  
Sbjct  603   RLSELDKENLKAGLRRALRILIAAGAVEVGTHRSDGQRIKCRGIKEEDLEEFLDTVSAVE  662

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             GPMS EE+WT+Y SAHQMGSCRM A E+DGA+D NGE WEA+GLYVCDGSV P+A+GVNP
Sbjct  663   GPMSREEHWTIYASAHQMGSCRMSAKEKDGAVDENGESWEAEGLYVCDGSVFPNALGVNP  722

Query  252   MITILSTAYCISNGLAKSLNSGKA  181
             MITI S AYC+S  +A+SL   K+
Sbjct  723   MITIQSIAYCLSKKIAESLEKDKS  746



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/732 (62%), Positives = 572/732 (78%), Gaps = 12/732 (2%)
 Frame = -3

Query  2361  HPLLRGGR--RNSYNHGLSSSQYQALAAICEALIPPIPLPQD-SDDEAMCSFYSSSASQP  2191
             HPLLRGGR     Y+HG  +SQ   LA+IC+ L P IPL ++ S DE + SFYS+S SQ 
Sbjct  5     HPLLRGGRGKEKGYSHGFLTSQMHVLASICDTLFPSIPLNKEVSQDENLSSFYSTSGSQF  64

Query  2190  PFPDEVAEVVM--RRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
             PFPDE AE+V+  ++  P+A+ + R +L ILS +LG+L LCG +C   +WPF+  FSE+ 
Sbjct  65    PFPDEAAELVLLFKKSAPEAIPLVRWILWILSFKLGTLFLCGTLCLHWKWPFVLKFSEIS  124

Query  2016  LKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV  1837
             L++RE IL KWS+E    PLR VF+ IKI  ++  FS TD N +NP W+AIG+ VDT E 
Sbjct  125   LEKREEILKKWSKENKWTPLRAVFVLIKIVFFYTLFSRTDVNGHNPMWKAIGYKVDTREK  184

Query  1836  PPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgg  1657
                ++  RPL++G++ET  E  +TL +SL +KGL VTE +  N   I+CDVVIVGSG GG
Sbjct  185   LKLKK--RPLQEGLVETTYETNSTLIQSLSEKGLEVTEDEEQNVYKIKCDVVIVGSGSGG  242

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GVAAA+LANSGHKV++LEKG YFVS+DYS LE  ++ ELYESGG++ T DGK+M+ AG+ 
Sbjct  243   GVAAAILANSGHKVIILEKGEYFVSQDYSSLESSAMNELYESGGIMPTLDGKMMILAGST  302

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGSAINW+A ++TP++V  EWS + K+PLF SS+YQSAMD+VC+RIGVT+ C+K+  Q
Sbjct  303   VGGGSAINWAACVRTPDSVKKEWSEKYKLPLFTSSDYQSAMDSVCRRIGVTDKCNKQSFQ  362

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILT  1117
             NQVLRKGCE +GLKVESV  N SE HYCGSC YGCRTGDKKG D+T+LVDAV NGAVILT
Sbjct  363   NQVLRKGCERIGLKVESVAVNASEDHYCGSCCYGCRTGDKKGTDSTWLVDAVENGAVILT  422

Query  1116  GCQAEKFILE--EDETARKKCLGVIAKSKGNNKI---LRIEARATVSACGSLFTPPLLIS  952
             GC+AEKFI+E  ++ET RK C GVIA +   +KI   L+IE++ T+S+CGSL TPPL+IS
Sbjct  423   GCRAEKFIIENGKNETKRKNCSGVIAATSWRSKITKKLQIESKVTISSCGSLLTPPLMIS  482

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEA  772
             SGL+N NIG NLHLHPV FAWGYFPE+M  + G NH+GGIITSIHKV++E +    IIEA
Sbjct  483   SGLQNPNIGRNLHLHPVQFAWGYFPENMTNLSGNNHEGGIITSIHKVLAENSTPKIIIEA  542

Query  771   VSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDK  592
              +LGP  F+ + PW SGLDMK+RM KY+RT N+F++VRD GSG+V+  G+I YR+DQ+D+
Sbjct  543   PALGPGSFSVLVPWISGLDMKDRMAKYARTANLFALVRDIGSGEVRSEGKISYRLDQMDR  602

Query  591   DNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEE  412
             +N+R GLR++LRILVAAGA EVGT+RSDGQKI C+GIK EELE FLD V   GGP S  E
Sbjct  603   ENLRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGGPRSRSE  662

Query  411   NWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILST  232
              WT++ SAHQMGSCRMG  EE+GA+D NGE WEAKGLYVCDGSVLPSA+GVNPM+TI ST
Sbjct  663   LWTMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMVTIQST  722

Query  231   AYCISNGLAKSL  196
             AYCI++ +A+SL
Sbjct  723   AYCIASKIAESL  734



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/738 (61%), Positives = 575/738 (78%), Gaps = 13/738 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGR--RNSYNHGLSSSQYQALAAICEALIPPI-PLP-----QDSDDEAMCSF  2215
             R+CHPLLRGGR   + YNHGLSS++ ++L+++CE ++P + P+P     Q+   +A+ +F
Sbjct  3     RECHPLLRGGRNRESKYNHGLSSAEMESLSSLCETILPSLSPIPKFDGKQNQPTKAVQAF  62

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             Y +SASQ P PDE+AE++ +R LP+AVF+ RLVL +LSTRLG+ LLCG +CF  +WP+  
Sbjct  63    YRASASQTPMPDEMAELLTKRGLPEAVFMVRLVLWLLSTRLGTFLLCGSLCFGEKWPYFK  122

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             NFS +PL +RE +L KW +     P+R  F+ +KI   +++FS  DE  +NPAWEAI ++
Sbjct  123   NFSSIPLDKRERVLQKWFKHRFFTPIRTAFVYVKILVLYVFFSRVDEKGDNPAWEAIEYN  182

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
               T+E P      RPL+KG+I+T  E  +TL  SL +KGL VT+    N   I+CDVVIV
Sbjct  183   AGTDENPDQVPKERPLQKGLIDTNQETDSTLLHSLKEKGLRVTQDPRKNLYKIKCDVVIV  242

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAAVLA SG KV VLEKG+YF + DYSGLEGPS+ +LYESGG L TTD +++
Sbjct  243   GSGCGGGVAAAVLAASGQKVFVLEKGNYFTATDYSGLEGPSMDQLYESGGKLATTDAEML  302

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGGSA+NWSASIKTPN+VL EW+  QKIPLFGSSEY SAMDAVC RIGVTE C
Sbjct  303   IMAGSAVGGGSAVNWSASIKTPNSVLQEWTGTQKIPLFGSSEYFSAMDAVCTRIGVTESC  362

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              +EG QNQVLRKGCE+LG+ V++VPRN SE+HYCGSCGYGC  G+KKG D T+LVDAV++
Sbjct  363   GEEGFQNQVLRKGCESLGIPVKTVPRNSSERHYCGSCGYGCLKGEKKGTDRTWLVDAVDH  422

Query  1134  GAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFT  970
             GAVILTGC+AE+F+LE++E     +KKC+GV AK   NN    L+IEA+ T+SACG+L T
Sbjct  423   GAVILTGCKAERFMLEKNEGGSKRKKKCVGVTAKIVNNNIRTRLQIEAKVTISACGALLT  482

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ  790
             PPL+ISSGLKN+NIG NLHLHPVL AWGYFPES +E +GK ++GGIIT++H+V++  +  
Sbjct  483   PPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYEGGIITAVHEVLTGDSNA  542

Query  789   AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
              AIIE  +LGP+ F A+ PW SG DMK+RM KY+RT ++ +++RD GSG+V   GRI Y 
Sbjct  543   RAIIETPALGPSSFVALCPWVSGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYN  602

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
             +D +DK+N++ GLRQALRILVAAGA EVGT RSDGQ+I C+GIK E+LE FLD V AT G
Sbjct  603   LDAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATAG  662

Query  429   PMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPM  250
             P+S  E+W LY SAHQMGSCRMG  +++GA+D NGE WEA+GL+VCD SVLPSA+GVNPM
Sbjct  663   PLSPVEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPM  722

Query  249   ITILSTAYCISNGLAKSL  196
             ITI STAYC+S  +A+SL
Sbjct  723   ITIQSTAYCLSKKIAESL  740



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/739 (62%), Positives = 562/739 (76%), Gaps = 10/739 (1%)
 Frame = -3

Query  2370  RKCHPLL-RGGRRNSYNHGLSSSQYQALAAICEALIPPI-PLPQDSD---DEAMCSFYSS  2206
             R  HPLL R GR   ++HG S+ Q Q+LAA+CE L+PP+ P   D D   +EA+ SF+ +
Sbjct  3     RDGHPLLSRVGREAGFSHGFSADQIQSLAAMCETLLPPLSPDSIDEDSPRNEAVYSFFRA  62

Query  2205  SASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFS  2026
             S SQ P PDE+AE + +R    A+ +  LVL ILS RLG+LLLCGF+C D RWPFI  F 
Sbjct  63    SGSQHPIPDEIAERLAKRGQRSALLVVSLVLKILSYRLGTLLLCGFLCLDWRWPFIRKFH  122

Query  2025  ELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT  1846
             E+PL+RRE +L +WSR+  ++PL++ F  +K+ C F +FS TDEN  NP+WEAIG+ VDT
Sbjct  123   EMPLERREIVLNRWSRQKKLIPLKVAFAMVKLFCLFHFFSRTDENSKNPSWEAIGYEVDT  182

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
              E P   +  RPLEKG IET+ E+G++L +SL  KGL V+E    N+  I+CD VI+GSG
Sbjct  183   QEKPVKSKRERPLEKGTIETMYESGSSLVQSLTGKGLKVSECSKTNSCNIKCDAVIIGSG  242

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAAAVLA SG KVVVLEKG YF  +DYS LE PS+ ++YESGG+L+T DGK M+ A
Sbjct  243   CGGGVAAAVLAQSGQKVVVLEKGDYFTPQDYSSLEAPSMNQMYESGGLLSTVDGKFMIMA  302

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             G+ VGGGSA+NWSASIKTP++VL+EWS++ KIPLFGS EY SAMDAVCKRIGVTE CS+E
Sbjct  303   GSTVGGGSAVNWSASIKTPSSVLHEWSVDHKIPLFGSPEYLSAMDAVCKRIGVTENCSEE  362

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
             G QNQ+LRKGC NLGL VE+VPRN  E HYCG C YGCR G+K+G D T+LVDAV +GAV
Sbjct  363   GFQNQILRKGCSNLGLHVETVPRNSPENHYCGWCCYGCRMGEKRGTDRTWLVDAVEHGAV  422

Query  1125  ILTGCQAEKFILE--EDETARKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPLL  958
             ILTGC+A+K ILE  +DE    +C GV A   S+   K LRIEA+ T+SACGSL TPPLL
Sbjct  423   ILTGCKADKLILETGDDEKVGHRCSGVTATVSSRDFFKKLRIEAKVTISACGSLLTPPLL  482

Query  957   ISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA-AI  781
             ISSGLKN NIG NL LHPVL  WGYFPE+     G+++ GGIITS+HKVVSE + +  AI
Sbjct  483   ISSGLKNPNIGRNLRLHPVLLVWGYFPENSTGYRGRSYDGGIITSVHKVVSEDSSEVQAI  542

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             IE  +LGP  FA++ PW SG ++K  M KYSRT ++F++VRD GSG VK+ G I YR+ Q
Sbjct  543   IETPALGPGSFASLFPWVSGAEVKNSMVKYSRTAHLFALVRDQGSGVVKEEGVITYRLSQ  602

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              DK+N++ GLRQALRIL+AAGA EVGT+RSDGQ+I C+G K E++E FLD +   GG  S
Sbjct  603   EDKENLKLGLRQALRILIAAGAVEVGTYRSDGQRIKCRGAKQEDIEEFLDSITTPGGLGS  662

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
              +E+WT+YCSAHQMGSCRMGA E  GA+D NGE WEAKGL+VCDGS+LPSA+GVNPMITI
Sbjct  663   RQEHWTMYCSAHQMGSCRMGANEGAGAVDENGESWEAKGLFVCDGSMLPSAVGVNPMITI  722

Query  240   LSTAYCISNGLAKSLNSGK  184
              STAYCIS  +A+SL   K
Sbjct  723   QSTAYCISKRIAESLRKEK  741



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/723 (63%), Positives = 566/723 (78%), Gaps = 11/723 (2%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPLPQD-SDDEAMCSFYSSSASQPPFPDEVAEVVMRR  2152
             YNHGLS++Q   +AAIC+ALIP +PL +D S D+A+  FY++SASQ PFPDE AE++ +R
Sbjct  1     YNHGLSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSASQLPFPDEAAELLYKR  60

Query  2151  FLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRET  1972
              +P+AV +   VL ILS RLG+LLLCG +  D +WPFI  FSE+ L++RE I   W+RE 
Sbjct  61    TVPEAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREK  120

Query  1971  LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGII  1792
               + LR+VF+ IK+ C++ +FS TD N  NP W+AIG+ VDT E    ++  RPLEKG+I
Sbjct  121   SWVALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGYQVDTKEKLIRKE--RPLEKGLI  178

Query  1791  ETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVV  1612
             ET+ E  +TL +SL +KGL VTE +  N   ++CDVVIVGSGCGGGVAAAVLANSGHKVV
Sbjct  179   ETMYETDSTLIQSLTEKGLEVTEDKRQNLYKVKCDVVIVGSGCGGGVAAAVLANSGHKVV  238

Query  1611  VLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKT  1432
             VLEKG YFVS DYS LEGPS+ E YESGG++ + DGK+M+ AG+ VGGGSA+NWSASI+T
Sbjct  239   VLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGGSAVNWSASIRT  298

Query  1431  PNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKV  1252
             P++VL EWS + KIPLFGSS+YQSAMD+VC+RIGVTE C KE  QNQ+L +GCE +GLKV
Sbjct  299   PDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQILIQGCEKMGLKV  358

Query  1251  ESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA  1072
             ESV  N S  HYCGSC YGCRTGDKKG D+T+LVD+V NGAVILTGC+AE+FILE  +  
Sbjct  359   ESVAINSSADHYCGSCCYGCRTGDKKGTDSTWLVDSVGNGAVILTGCKAERFILENGKNG  418

Query  1071  RKK--CLGVIAKSKGNNKI---LRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLH  907
              KK  CLGVIA +   +K+   L+IE++ T+SACGSL TPPL+ISSGLKN NIG NLHLH
Sbjct  419   MKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGSLNTPPLMISSGLKNPNIGRNLHLH  478

Query  906   PVLFAWGYFPESMA-EMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPW  730
             PV FAWGYFPE M     G N++GGIITSIHK  +E +    IIE  SLGP  F+A  PW
Sbjct  479   PVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAEDSTPRFIIETPSLGPGSFSAFVPW  538

Query  729   TSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRIL  550
              SG DMK+RM KY+RT NIF+++RD GSG+VK  GR+ YR+D+ DK+++R GLR+ALRIL
Sbjct  539   LSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLDKEDKESLRVGLRKALRIL  598

Query  549   VAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSC  370
             VAAGA EVGT+RSDGQ+I CKG+K E+LE FLD V   GGP S  E WT++ +AHQM SC
Sbjct  599   VAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSC  658

Query  369   RMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNS  190
             RMGA+EE+GA+D NGE WEA+GLYVCDGSVLPSA+GVNPM+TI ST+YCI++ +A+SL  
Sbjct  659   RMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYCIASKIAESL--  716

Query  189   GKA  181
             GKA
Sbjct  717   GKA  719



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/740 (61%), Positives = 572/740 (77%), Gaps = 14/740 (2%)
 Frame = -3

Query  2367  KCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQ-----DSDDEAMCSFYSS  2206
             +CHPLLRGGRR S Y HG S +Q QALAAICE LIP + L         DD A+  FYS+
Sbjct  4     ECHPLLRGGRRESRYGHGFSPAQIQALAAICETLIPSVSLDSINPKIPHDDPALHGFYSA  63

Query  2205  SASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFS  2026
             S SQP  PDEVAE++ +R     V +  +VL +LS RLG+L+LC   C    WPFI NFS
Sbjct  64    SGSQPSVPDEVAEILTKRAQRQVVVMVSIVLKMLSFRLGTLVLCWGSCLASTWPFILNFS  123

Query  2025  ELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT  1846
             E+P++RRE +L+ WSR+  ++PLR+VFM IKI C FI+++ TDEN NN AWEAIG+ VD 
Sbjct  124   EMPVERRERVLMNWSRQKFVVPLRVVFMMIKIYCLFIFYTRTDENSNNLAWEAIGYRVDK  183

Query  1845  NEVPPDQQTG--RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
              + P +      RPL++G++ET++E  ++L +SL +KGL VT+    N   I+CDVVI+G
Sbjct  184   RQKPNESHNKQERPLQRGLVETVHETDSSLIQSLTQKGLKVTQIPQHNAFKIKCDVVIIG  243

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA+SG KVVVLEKG+YFV +DYS LEGPSL +LYES  +L+T DGK++V
Sbjct  244   SGCGGGVAAAVLAHSGQKVVVLEKGNYFVPQDYSSLEGPSLDQLYESSALLSTVDGKIVV  303

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSA I+TP++VL EWS++ KI LFG+ +Y SAMDAVCK+IGVT+ C 
Sbjct  304   LAGSTVGGGSAVNWSACIRTPSHVLKEWSVDHKIRLFGTPDYGSAMDAVCKKIGVTQKCE  363

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QNQ+LRKGCE+LGLKVE+V RN SE H+CGSC YGCRTGDKKG D+T+LVDAV NG
Sbjct  364   QEGFQNQILRKGCESLGLKVEAVARNSSEGHFCGSCCYGCRTGDKKGTDSTWLVDAVENG  423

Query  1131  AVILTGCQAEKFILEEDETAR--KKCLGVIAKSKGNNKI---LRIEARATVSACGSLFTP  967
             AVILTGC+A+K ILE        KKCLGVIA S  N  +   L IEA+ T++AC ++ TP
Sbjct  424   AVILTGCKAKKLILENTPHGEKPKKCLGVIASSVLNKDVTKELHIEAKVTIAACSAVSTP  483

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSE-GTKQ  790
             PLLISSGLKN NIG NLHLHP  FAWGYFPE++  ++GK ++GGIITS+++VV E G   
Sbjct  484   PLLISSGLKNPNIGRNLHLHPCAFAWGYFPENLTGIQGKVYEGGIITSLNRVVLETGAPV  543

Query  789   AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
              AIIE  SLGP  F+A+ PWTSG +MKERMRKYSRT ++F++VRD GSG+V++ G+I Y 
Sbjct  544   PAIIETPSLGPGLFSALCPWTSGANMKERMRKYSRTAHLFTLVRDKGSGEVREEGKIVYN  603

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
             + + DK++++ GLRQALRIL+AAGA EVGT RSDGQ++ C+G K E++E FL+ +V +GG
Sbjct  604   LSEFDKEHMKIGLRQALRILIAAGAEEVGTHRSDGQRMKCQGTKEEDIEEFLNDIVISGG  663

Query  429   PMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPM  250
             P S EE W LYC AH MGSCR+GA+E DGA+D +GE WEAKGL+VCDGS++P+AIGVNPM
Sbjct  664   PTSREELWNLYCCAHPMGSCRIGASERDGAVDESGESWEAKGLFVCDGSLMPTAIGVNPM  723

Query  249   ITILSTAYCISNGLAKSLNS  190
             ITI STAYCI+  +A+SL+S
Sbjct  724   ITIESTAYCIAKKIAESLSS  743



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/741 (64%), Positives = 577/741 (78%), Gaps = 9/741 (1%)
 Frame = -3

Query  2391  REKKMNERKCHPLLRGG-RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDD---EAM  2224
             +E    E   HPLLRGG R+ SY+HG SSSQ QALA+ICE LIPP+ L   S +   EA+
Sbjct  3     KESNREEGHGHPLLRGGWRKGSYSHGFSSSQIQALASICETLIPPLHLESISKENPPEAL  62

Query  2223  CSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP  2044
              SFY +S SQ P PDE AE++ +R LP+ V +  +VL ILSTRLG+LLLCGF+C   +WP
Sbjct  63    YSFYKASGSQFPVPDEAAELLKKRGLPEGVMLVSIVLKILSTRLGTLLLCGFLCLGWKWP  122

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             FI  FSE+ L++RE +L  WSR+  + PLR+ F  +KI C+FI+FS TD+N  NPAW+AI
Sbjct  123   FILKFSEISLEKREQVLKNWSRQRFLFPLRLFFAIMKIFCFFIFFSRTDDNLENPAWDAI  182

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
             G+HV+T E        RP+ KGI+ET+ EN +TL +SL ++G+ V E Q  N   I+CDV
Sbjct  183   GYHVETKEYVKKPPKERPIRKGIVETMYENDSTLVQSLSQRGIKVIEDQK-NICKIKCDV  241

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             VI+GSGCGGGV AAVLA+SG+KV++LEKG+YF  EDYS LEGPS+ E YESGG+++T D 
Sbjct  242   VIIGSGCGGGVTAAVLASSGYKVLILEKGNYFEPEDYSSLEGPSMSEQYESGGVMSTIDA  301

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             KVM+ AG+ VGGGSA+NWSA+IKTPN++L EWS + K+PLFGSSEY SAMD V KRIGVT
Sbjct  302   KVMILAGSTVGGGSAVNWSAAIKTPNSILREWSTDHKLPLFGSSEYLSAMDTVWKRIGVT  361

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             E C++EG QNQVLRKGCENLGL VES+PRN SE HYCGSC YGC  GDK+G  +T+LVDA
Sbjct  362   EKCTEEGFQNQVLRKGCENLGLDVESIPRNSSENHYCGSCAYGCTRGDKQGTQSTWLVDA  421

Query  1143  VNNGAVILTGCQAEKFILEEDETARK--KCLGVIAKSKGNN--KILRIEARATVSACGSL  976
             V  GAVILTGC+AEK I +E +  RK  KC GVI  S   N  K L+IEAR TVSACGSL
Sbjct  422   VGCGAVILTGCKAEKLIFKEKKNGRKRRKCSGVIVASSSKNVTKKLQIEARVTVSACGSL  481

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TPPLL+SSGL+N +IG NLHLHPVL  WGYFPES + ++GK  +GG++TS+HKVVSE +
Sbjct  482   LTPPLLLSSGLENPHIGKNLHLHPVLMVWGYFPESQSGIKGKCFEGGLLTSLHKVVSEES  541

Query  795   KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQ  616
             +  AI+E  +LGPA FAA+ PW SGLDMKERM KYSRT  +F++ RD G+G+VK   RI+
Sbjct  542   RVQAIVEPTALGPASFAAIHPWVSGLDMKERMVKYSRTATLFALARDKGAGEVKVERRIK  601

Query  615   YRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVAT  436
             YR+   DK+N+R GLRQALRIL+AAGA EVGT+RSDGQ I CKG+K E +E FLDGVVA 
Sbjct  602   YRLHPADKENLRVGLRQALRILIAAGAVEVGTYRSDGQSIKCKGVKEEAVEEFLDGVVAG  661

Query  435   GGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVN  256
             GGP S  ++WTLYCSAHQMGSCRMGATEE+GA+D NGE WEAKGL+VCDGSVLPSA+G+N
Sbjct  662   GGPCSRGDHWTLYCSAHQMGSCRMGATEEEGAVDENGETWEAKGLFVCDGSVLPSAVGIN  721

Query  255   PMITILSTAYCISNGLAKSLN  193
             PMITI +TAYCIS  +A+SL 
Sbjct  722   PMITIQTTAYCISKRIAESLK  742



>ref|XP_004493801.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cicer arietinum]
Length=738

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/734 (62%), Positives = 572/734 (78%), Gaps = 13/734 (2%)
 Frame = -3

Query  2364  CHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPLPQD-SDDEAMCSFYSSSASQ  2194
             CHPLLRGGR+    Y+HGLS+SQ   +A+IC+ L P +PL +  S ++ + SFYS+S S 
Sbjct  4     CHPLLRGGRKTEKGYSHGLSTSQMHVMASICDTLFPSLPLNKHISQNQILSSFYSASGSH  63

Query  2193  PPFPDEVAEVVM--RRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
              PFPDE AE +M  ++ +P A+ + R +L+ILS RLG+LLLCG +C   +WPF+  F+E+
Sbjct  64    FPFPDEAAESLMLFKKSIPKAMPLVRWILLILSFRLGTLLLCGTLCLHWKWPFVLKFTEI  123

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
              L++RE IL  WSRE   +PLR+VF+ IK+  +F  FS  D N +NP W+AIG+ VDT E
Sbjct  124   SLEKREKILNNWSREKFWIPLRVVFVLIKLVFFFTLFSRVDVNGHNPMWKAIGYKVDTRE  183

Query  1839  VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcg  1660
                 +Q  RPL++G+IET  E+ +TL +SL +KGL VTE  + N   I+CDV IVGSG G
Sbjct  184   --KLKQKKRPLQEGLIETTYESDSTLIQSLTEKGLEVTEDVDHNLYKIKCDVAIVGSGSG  241

Query  1659  ggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGT  1480
             GGVAAA+LANSGHKV+VLEKG YFVS DYS LE  S+ ELYESGGM+ T DGK M+ AG+
Sbjct  242   GGVAAAILANSGHKVIVLEKGEYFVSHDYSSLESSSMKELYESGGMMPTVDGKTMILAGS  301

Query  1479  MVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGL  1300
              VGGGS+INW+A ++TP++V  EWS + K+ LF +S+Y+SAMD+VC+RIGVTE C+KE  
Sbjct  302   TVGGGSSINWAACVRTPDSVTKEWSKKYKLSLFATSDYRSAMDSVCRRIGVTEKCNKESF  361

Query  1299  QNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVIL  1120
             QNQVLRKGCE +GLKVESV  N SE HYCGSC +GCRTGDKKG D+T+LVDAVNNGAVI+
Sbjct  362   QNQVLRKGCEGIGLKVESVAVNSSEDHYCGSCCFGCRTGDKKGTDSTWLVDAVNNGAVII  421

Query  1119  TGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKI---LRIEARATVSACGSLFTPPLL  958
             TGC AEKFILE  +     RK C GVIA +   +KI   L+IE++ T+S+CGSLFTPPL+
Sbjct  422   TGCNAEKFILENGKNGTIKRKNCSGVIAAASNKSKITKKLQIESKVTISSCGSLFTPPLM  481

Query  957   ISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAII  778
             ISSGL+N NIG NLHLHPV FAWGYFPE M  + G N++GGIITSIHK+++E +    II
Sbjct  482   ISSGLQNSNIGRNLHLHPVQFAWGYFPEEMTNLIGNNYEGGIITSIHKILAENSTPKIII  541

Query  777   EAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQI  598
             EA +LGP  F+A+ PWTSGLDMKER+ KY+RT N+F++VRD GSG++K  GR+ YR+D+I
Sbjct  542   EAPALGPGSFSALIPWTSGLDMKERLVKYARTANLFALVRDKGSGEIKTEGRVSYRLDKI  601

Query  597   DKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSG  418
             DK+N+R GLRQ+LRILVAAGA EVGT+RSDGQ+I C+GIK ++LE FLD V   GGP S 
Sbjct  602   DKENLRVGLRQSLRILVAAGAVEVGTYRSDGQRIKCRGIKDKDLEEFLDNVAVVGGPRSR  661

Query  417   EENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITIL  238
              E WT++ SAHQMGSCRMGA EE+GA+D NGE WEAKGL+VCDGSVLPSA+GVNPMITI 
Sbjct  662   GEVWTVFSSAHQMGSCRMGANEEEGAVDENGESWEAKGLFVCDGSVLPSAVGVNPMITIQ  721

Query  237   STAYCISNGLAKSL  196
             STAYCI++ +A+SL
Sbjct  722   STAYCIASKIAESL  735



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/739 (61%), Positives = 561/739 (76%), Gaps = 14/739 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGR--RNSYNHGLSSSQYQALAAICEALIPPIPLP-------QDSDDEAMCS  2218
             R+CHPLL GGR   + YNHGLSS++  +LA++CE ++P +P P       Q    +A+ +
Sbjct  3     RQCHPLLSGGRTRESKYNHGLSSAEMDSLASLCETILPSLPPPVTTLDGKQHQPTKAVQA  62

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFI  2038
              Y +S SQ P PDE+AE++ +R LP+AVF+ RLVL +LSTRLG+ LLCG +CF  +W  I
Sbjct  63    LYRASGSQTPMPDEIAELLRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCI  122

Query  2037  HNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF  1858
              NFS + L +RE +L KW +      +RI F+ +K+ C F++FS   +N +NPAWEAI +
Sbjct  123   KNFSSISLDKREKVLQKWFKRRFFTAIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAIEY  182

Query  1857  HVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvi  1678
                T+E P      RPL+KG+I+T  E  +TL  SL +KGL VT     N   I+CDVVI
Sbjct  183   CAGTDENPDQVPKERPLQKGLIDTNQETDSTLLRSLTEKGLEVTRDPRRNLCKIKCDVVI  242

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSGCGGGVAAAVLA SG KV VLEKG+YF + DYSGLEGPSL +LYESGG+LT+ D  V
Sbjct  243   VGSGCGGGVAAAVLAASGQKVFVLEKGNYFTATDYSGLEGPSLAQLYESGGLLTSADAGV  302

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
             ++ AG+ VGGGS +NWSASIKTPN+VL EW+  QKIPLFGSSEY SAMD VC RIGVTE 
Sbjct  303   IIMAGSAVGGGSVVNWSASIKTPNSVLQEWTKNQKIPLFGSSEYLSAMDTVCARIGVTEN  362

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
             C  EG QNQVLRKGCE LG+ V++VPRN SE+HYCGSCGYGCR G+KKG D T+LVDAV+
Sbjct  363   CKVEGFQNQVLRKGCERLGVPVKTVPRNSSERHYCGSCGYGCRKGEKKGTDRTWLVDAVD  422

Query  1137  NGAVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKI--LRIEARATVSACGSLF  973
             NGAVILTGC+AE+FILE+++     +KKCLGVIAK   NN I  L+IEA+ T+SACG+L 
Sbjct  423   NGAVILTGCKAERFILEKNKGLGKRKKKCLGVIAKIINNNIITRLQIEAKVTISACGALL  482

Query  972   TPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTK  793
             TPPL+ISSGLKN+NIG NLHLHPVL AWGYFPES +E +GK + GGIIT++H+VV+  + 
Sbjct  483   TPPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYDGGIITAVHEVVAGDSN  542

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
               AI+E   LGP+ F+ + PW SG DMK RM KYSRT ++ +++RD GSG+V   GRI Y
Sbjct  543   VRAIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYSRTAHLITIIRDSGSGKVTTEGRISY  602

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
              ++  D+DN++ GLRQALRILVAAGA EVGT RSDGQ+I C+GIK E+LE FLD V ATG
Sbjct  603   YLNASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFLDTVYATG  662

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             G +S EE+W  Y SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLPSA+GVNP
Sbjct  663   GALSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNP  722

Query  252   MITILSTAYCISNGLAKSL  196
             MITI STAYC+S  +A+SL
Sbjct  723   MITIQSTAYCLSKKIAESL  741



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/739 (60%), Positives = 563/739 (76%), Gaps = 14/739 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGR--RNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDD-------EAMCS  2218
             R+CHPLL GGR   + +NHGLSS++  +LA++CE ++P +P P  + D       +A+ +
Sbjct  3     RECHPLLSGGRTRESKHNHGLSSAEMDSLASLCETILPSLPPPVTTFDGKQHLPTKAVQA  62

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFI  2038
              Y +SASQ P PDE+AE++ +R LP+AVF+ RLVL +LSTRLG+ LLCG +CF  +W  I
Sbjct  63    LYRASASQTPVPDEIAELLRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCI  122

Query  2037  HNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF  1858
              NFS + L +RE +L KW +     P+RI F+ +K+ C F++FS   +N +NPAWEAI +
Sbjct  123   QNFSSISLDKREKVLQKWFKRRFFTPIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAIEY  182

Query  1857  HVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvi  1678
                T+E P      RPL+KG+I+T  E  +TL  SL +KGL VT     N   I+CDVVI
Sbjct  183   CAGTDENPNQVSKERPLQKGLIDTNQETDSTLLRSLTEKGLEVTRDPRRNLCKIKCDVVI  242

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSGCGGGVAAAVLA SG KV VLEKG+YF + DYSGLEGPS+ +LYESGG+L + D  +
Sbjct  243   VGSGCGGGVAAAVLAASGQKVFVLEKGNYFTAADYSGLEGPSIAQLYESGGLLASADAGM  302

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
             ++ AG+ VGGGS +NWSASIKTPN+VL EW+  QKIPLFGS EY SAMD VC RIGVTE 
Sbjct  303   IIMAGSAVGGGSVVNWSASIKTPNSVLQEWTKNQKIPLFGSPEYFSAMDTVCARIGVTEN  362

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
             C  EG QNQVLRKGCE LG+ V++VPRN SE+HYCGSCGYGCR G+KKG D T+LVDAV+
Sbjct  363   CKVEGFQNQVLRKGCERLGVPVKTVPRNTSERHYCGSCGYGCRKGEKKGTDRTWLVDAVD  422

Query  1137  NGAVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKI--LRIEARATVSACGSLF  973
             +GAVILTGC+AE+F+LE+++     +KKCLGVIAK   +N I  L+IEA+ T+SACG+L 
Sbjct  423   HGAVILTGCKAERFLLEKNKGLGKRKKKCLGVIAKIINSNIITRLQIEAKVTISACGALL  482

Query  972   TPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTK  793
             TPPL+ISSGLKN+NIG NLHLHPVL AWGYFPES +E +GK + GGIIT++H+VV+  + 
Sbjct  483   TPPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYDGGIITAVHEVVAGDSN  542

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
               AI+E   LGP+ F+ + PW SG DMK RM KY+RT ++ +++RD GSG+V   GRI Y
Sbjct  543   VRAIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYARTAHLITIIRDSGSGKVTTEGRISY  602

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             ++D  D+DN++ GLRQALRILVAAGA EVGT RSDGQ+I C+GIK E+LE FLD V ATG
Sbjct  603   KLDASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATG  662

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             G +S EE+W  Y SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLPSA+GVNP
Sbjct  663   GALSMEEDWMFYSSAHQMGSCRMGIKEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNP  722

Query  252   MITILSTAYCISNGLAKSL  196
             MITI STAYC+S  +A+SL
Sbjct  723   MITIQSTAYCLSKKIAESL  741



>sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO2; AltName: Full=Long-chain 
fatty alcohol oxidase 2 [Lotus japonicus]
 emb|CAP15763.1| long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
Length=750

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/739 (62%), Positives = 567/739 (77%), Gaps = 19/739 (3%)
 Frame = -3

Query  2361  HPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPLP----QDSDDEAMCSFYSSSA  2200
             HPLL+GGRR    Y+HGLSSSQ   +AAICEAL P  PL     Q S D+A+ +FY++S 
Sbjct  10    HPLLKGGRRKEKGYSHGLSSSQMHVIAAICEALFPSQPLDSQNNQSSVDKALSAFYTASG  69

Query  2199  SQPPFPDEVAEVVMR--RFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFS  2026
             SQ P PDE AE++ +  R  P+A+ +   VL+ILS RLG+LLLCG +C D RWPFIH FS
Sbjct  70    SQAPLPDEAAELLFKFNRSFPEALSLVSWVLLILSFRLGTLLLCGTLCLDWRWPFIHKFS  129

Query  2025  ELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT  1846
             E+PL++RE IL +WSRE   +PLR+VF+  K+ C++  FS  D N +NP W+AIG+ VDT
Sbjct  130   EIPLEKREEILKRWSREKCWIPLRLVFVLTKLVCFYNLFSRADVNGHNPIWKAIGYQVDT  189

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
              E     Q  RPL++G+IET+ E  +TL +SL +KGL VTE    N   I+CD VIVGSG
Sbjct  190   RE--KLTQKKRPLQEGLIETMYETDSTLIQSLTEKGLEVTEDLEQNMYKIKCDAVIVGSG  247

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAAAVLANSGHKV++LEKG YFVS DYS LEGPS+ ELYESGG+L + DGK+M+ A
Sbjct  248   CGGGVAAAVLANSGHKVIILEKGEYFVSHDYSSLEGPSMNELYESGGILPSLDGKMMILA  307

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             G+ +GG SAINWSA I+TP++VL EWS + KIPLF S +YQSAMD VC+RIGVTE C+KE
Sbjct  308   GSTLGGXSAINWSACIRTPDSVLREWSEKHKIPLFASPDYQSAMDTVCRRIGVTENCNKE  367

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
               QNQ+LR+GC  +G KVE V  N S  HYCGSC YGCRTGDKKG ++T+LVDAV NGAV
Sbjct  368   SFQNQILRQGCAKIGFKVEPVAINSSADHYCGSCCYGCRTGDKKGTESTWLVDAVGNGAV  427

Query  1125  ILTGCQAEK--FILEEDE--TARKKCLGVIAKSKGNNKI---LRIEARATVSACGSLFTP  967
             ILTGC+AEK  F L++ +  T RK C GVIA +   +K+   L+IE++ T+SACGSL TP
Sbjct  428   ILTGCKAEKLNFTLKDGDNGTKRKTCSGVIASATWRSKVTKKLQIESKVTISACGSLSTP  487

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA  787
             PL+ISSGLKN NIG NLHLHP  FAWGYFPE M    G N++GGIITSIHKV  E +   
Sbjct  488   PLMISSGLKNPNIGKNLHLHPCQFAWGYFPEDMTNFSGNNYEGGIITSIHKVFEEDSTST  547

Query  786   A--IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
                IIEA +LGP  F+A+ PW SGLD+KERM KY+RT N+F++VRDHGSG+VK  GRI Y
Sbjct  548   PRIIIEAPALGPGSFSALVPWVSGLDVKERMVKYARTANLFALVRDHGSGEVKAEGRISY  607

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             ++D+ID+++++TGLR+ALRILVAAGA EVGT+RSDGQ+I C+GIK  +LE FLD V   G
Sbjct  608   KLDKIDRESLQTGLRKALRILVAAGAVEVGTYRSDGQRIKCRGIKESDLEEFLDSVRVVG  667

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             GP S  E WT++ SAHQM SCRM ATEE+GA+D NGE WEAKGLYVCDGSVLPSA+GVNP
Sbjct  668   GPSSRNEVWTVFTSAHQMTSCRMSATEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNP  727

Query  252   MITILSTAYCISNGLAKSL  196
             MITI STAYCI++ +A+SL
Sbjct  728   MITIQSTAYCIASNIAESL  746



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/737 (59%), Positives = 565/737 (77%), Gaps = 12/737 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPL-----PQDSDDEAMCSFY  2212
             R CHPLL G R  +  YNHGLSS++  ALA++CE  +PP+P       +D   +A+ SFY
Sbjct  3     RNCHPLLSGRRSKAEKYNHGLSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFY  62

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +S +Q P PD+VAE+V++R L + V + R+VL++LST+LG+L+LCG +C   +WP+I+N
Sbjct  63    KASGAQAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINN  122

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FS + L++RE +L KW +  +  P+RI F  +KI C F++FS  DEN  NPAWEAI +H 
Sbjct  123   FSSMSLEKREKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAIDYHA  182

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             + +E   + Q  RPLEKGI+ET+ E G+T+ +SL +KGL VT+    N   I+CDVVIVG
Sbjct  183   ENDEDVSEVQQERPLEKGIVETMYETGSTIVQSLTQKGLQVTKDSKQNVYKIKCDVVIVG  242

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA++G KVVV+EKG+YF  +DYS LEGPS  +LYESGG+L TTD  + +
Sbjct  243   SGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDASMTI  302

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSA IKTP ++L EW+ + K+PLFGS +Y SAMD V +RIGVTE C 
Sbjct  303   LAGSTVGGGSAVNWSACIKTPKSLLQEWAGQYKLPLFGSPDYLSAMDIVWERIGVTENCV  362

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QNQVLRKGC+NLGL VE +PRN SE HYCGSCG+GC++GDKKG D+T+LVDAVN+G
Sbjct  363   QEGFQNQVLRKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG  422

Query  1131  AVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKILR--IEARATVSACGSLFTP  967
             AVILTGC+AE+FILE+ +   T   KC GVIAK+  N+  ++  IE +AT+SACG+L TP
Sbjct  423   AVILTGCKAERFILEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATISACGALLTP  482

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA  787
             PL+ISSGLKN++IG NLHLHPVL AWGYFP+S  E +GKN++GGIITS HKVVS  ++  
Sbjct  483   PLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKVVSGDSEVR  542

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             A+IE     PA F+ + PW SG+D K+ M KYSRT ++ +++RD GSG+VK  GRI +++
Sbjct  543   ALIETPEFSPAKFSVLWPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             DQ+DK+N++ GLRQALRIL+AAGA EVGT RSDGQ++ C+GI  +E+E FLD V A  GP
Sbjct  603   DQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGP  662

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
              S  ENW +Y +AHQMGSCRMG  +++GA+D NG+ WEA+GLYVCD SV PSA+GVNPMI
Sbjct  663   KSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMI  722

Query  246   TILSTAYCISNGLAKSL  196
             TI STAYC+S  +A+SL
Sbjct  723   TIQSTAYCLSKRIAESL  739



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/737 (59%), Positives = 564/737 (77%), Gaps = 12/737 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPL-----PQDSDDEAMCSFY  2212
             R CHPLL G R  +  YNHGLSS++  ALA++CE  +PP+P       +D   +A+ SFY
Sbjct  3     RNCHPLLSGRRSKAEKYNHGLSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFY  62

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +S +Q P PD+VAE+V++R L +AV + R+VL++LST+LG+L+LCG +C   +WP+I+N
Sbjct  63    KASGAQAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINN  122

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FS + L++RE +L KW +  +  P+RI F+T+KI C F++F   DEN  NPAWEAI +HV
Sbjct  123   FSSMSLEKREKVLQKWFKNWIFTPVRIAFVTLKIFCLFVFFCQLDENGKNPAWEAIDYHV  182

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             + +E   + Q  RPLEKGI+ET+ E  +T+  SL +KGL VT+        I+CDVVIVG
Sbjct  183   ENDEDVSEVQQERPLEKGIVETMYETDSTIVHSLTQKGLQVTKDSKQKVYKIKCDVVIVG  242

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA++G KVVV+EKG+YF  +DYS LEGPS  +LYESGG+L TTD  + +
Sbjct  243   SGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDANMTI  302

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ +GGGSAINWSA IKTP ++L EW+ + K+PLFGS +Y SAMD V +RIGVTE C 
Sbjct  303   LAGSTIGGGSAINWSACIKTPKSLLQEWAGDYKLPLFGSPDYLSAMDIVWERIGVTENCV  362

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QNQVLRKGC+NLGL VE +PRN SE HYCGSCG+GC++GDKKG D+T+LVDAVN+G
Sbjct  363   QEGFQNQVLRKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG  422

Query  1131  AVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKILR--IEARATVSACGSLFTP  967
             AVILTGC+AE+FI+E+ +   T   KC GVIAK+  N+  ++  IE +AT+SACG+L TP
Sbjct  423   AVILTGCKAERFIIEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATISACGALLTP  482

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA  787
             PL+ISSGLKN++IG NLHLHPVL AWGYFP+S  E +GKN++GGIITS HKVVS  ++  
Sbjct  483   PLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKVVSADSEVR  542

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             A+IE     PA F+   PW SG+D K+ M KYSRT ++ +++RD GSG+VK  GRI +++
Sbjct  543   ALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             DQ+DK+N++ GLRQALRIL+AAGA EVGT RSDGQ++ C+GI  +E+E FLD V A  GP
Sbjct  603   DQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGP  662

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
              S  ENW +Y +AHQMGSCRMG  E++G +D NG+ WEA+GLYVCD SVLPSA+GVNPMI
Sbjct  663   KSPVENWMVYATAHQMGSCRMGVNEKEGGVDENGQSWEAEGLYVCDASVLPSAVGVNPMI  722

Query  246   TILSTAYCISNGLAKSL  196
             TI STAYC+S  +A+SL
Sbjct  723   TIQSTAYCLSKRIAESL  739



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/747 (59%), Positives = 582/747 (78%), Gaps = 19/747 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGRRN---SYNHGLSSSQYQALAAICEALIPPIPL--------PQDSDDEAM  2224
             R+ HP LRGGRR     Y+HG S SQ Q+LAA+CEA +P +P+         +D   +++
Sbjct  8     RQGHPRLRGGRRREKGDYSHGFSPSQIQSLAAMCEAFVPSLPMEEFHVTSGKEDPPTKSL  67

Query  2223  CSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP  2044
              +FY +S S+ P PDEVAE++++R L +A+ + +LVL +L+T+LG+L+LC  +   GR+P
Sbjct  68    QAFYRASGSEFPMPDEVAELMVKRGLKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFP  127

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             FI+ FS++P+++RE    +W++E    PLR+VF+ +K+ C +I++S T+EN  N +W AI
Sbjct  128   FINKFSDMPIEKREEAFKRWNKENFFTPLRLVFVMVKVFCLYIFYSMTNENSENQSWNAI  187

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
             G+ +   E P   QT RPLEKG+IET+++  ++L +SL KKGL V++    N   I+CDV
Sbjct  188   GYSLPIVEKPLKSQTERPLEKGVIETMDQTDSSLLQSLSKKGLAVSQDPIQNLYDIKCDV  247

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
              IVGSGCGGGVAAAVLA++GHKVVV+EKG+YF SEDY+ +E PS+ E+YE GG+L+TTDG
Sbjct  248   AIVGSGCGGGVAAAVLASAGHKVVVIEKGNYFTSEDYTSIEAPSMNEMYECGGILSTTDG  307

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             K+++ AG+ VGGGSA+NWSA IKTP+ VL EW+ E ++PLFGS++Y SAMD VCKR+GVT
Sbjct  308   KMLLMAGSTVGGGSAVNWSACIKTPDYVLKEWAEEHQLPLFGSTDYLSAMDTVCKRLGVT  367

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             E C++EG QN+VLRKGC NLGL+V+SVPRN SE H+CGSC YGCR GDK+G DTT+LVDA
Sbjct  368   ENCTEEGFQNKVLRKGCRNLGLQVDSVPRNASESHFCGSCSYGCREGDKRGTDTTWLVDA  427

Query  1143  VNNGAVILTGCQAEKFILEEDETA--RKKCLGVIAKSKGN--NKILRIEARATVSACGSL  976
             VN GAVI+TGC+AE+FILEE+E    +KKC+G+IAKS  +   K L+I+A+ T+SACGSL
Sbjct  428   VNCGAVIITGCKAERFILEENEPGKKKKKCVGLIAKSLSSMVTKKLKIQAKVTISACGSL  487

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-EMEGKNHQGGIITSIHKV-VSE  802
              TPPL+ISSGL N NIG NLHLHPV+FAWGYFP+S + E++G+  +GGIITS+HKV  +E
Sbjct  488   LTPPLMISSGLTNPNIGKNLHLHPVVFAWGYFPDSGSDELKGRAFEGGIITSLHKVKAAE  547

Query  801   GTKQA--AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
              +  +  AIIE   LGPA FAA+ PW SGL+ KERM +YSRT  +F++VRD GS +V++ 
Sbjct  548   DSDSSLRAIIETPGLGPAAFAALVPWVSGLETKERMTRYSRTAVLFALVRDRGSAKVERE  607

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GR+ YR D+ D++N+R GLR+ALRILVAAGA EVGT RSDGQ+I CKG+K EELE FLDG
Sbjct  608   GRVNYRFDRSDRENLRVGLRRALRILVAAGAVEVGTHRSDGQRIKCKGMKEEELEEFLDG  667

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             +   GGPMS  E WT+Y SAHQMGSCRMG +EE+G +D  GE WEA+GL+VCDGSVLP+A
Sbjct  668   IRTVGGPMSKSELWTMYASAHQMGSCRMGVSEEEGGVDEKGESWEAQGLFVCDGSVLPTA  727

Query  267   IGVNPMITILSTAYCISNGLAKSLNSG  187
             +G+NP+ITI STAYC+S G+A+SL  G
Sbjct  728   VGINPLITIQSTAYCLSKGIAESLKRG  754



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/746 (58%), Positives = 586/746 (79%), Gaps = 21/746 (3%)
 Frame = -3

Query  2361  HPLLRGGRRNS---YNHGLSSSQYQALAAICEALIPPIPL--------PQDSDDEAMCSF  2215
             HP LRGGRR     ++HG S SQ Q+LAA+CEA IP +P+         +D   +++ +F
Sbjct  12    HPRLRGGRRTEKGGHSHGFSPSQIQSLAAMCEAFIPSLPMEELHVSSGKEDPPTKSLQAF  71

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             Y +S S+ P PDEVAE++++R + +A+ + +LVL +L+T+LG+L+LC  +   GR+PFI+
Sbjct  72    YLASGSESPIPDEVAELLVKRGMKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFIN  131

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
              FS++P+++RE +L +W++E   +PLR+VF+ +KI C +I++S T+EN  N +W AIG+ 
Sbjct  132   KFSDMPIEKREEVLKRWNKEKNFVPLRMVFVMVKIFCLYIFYSMTNENSENQSWNAIGYS  191

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
             + T E PP  Q+ RPLEKGIIET+++  ++L +SL  KGL V++  N N   I+CDV IV
Sbjct  192   LPTEEKPPKSQSERPLEKGIIETMDQTDSSLLQSLTMKGLAVSQDPNQNLYEIKCDVAIV  251

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAAVLA++G KVVV+EKG+YF SEDY+ +E PS+ E+YESGG+L+T DGK+M
Sbjct  252   GSGCGGGVAAAVLASAGRKVVVIEKGNYFTSEDYTSIEAPSMNEMYESGGILSTLDGKIM  311

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGGSA+NWSA IKTP++VL EW+ E+++ LFGS++Y SAMDAVC+R+GVTE C
Sbjct  312   LLAGSTVGGGSAVNWSACIKTPDHVLKEWAGERRLRLFGSTDYLSAMDAVCRRLGVTENC  371

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
             ++EG QN+VLRKGCENLGL+V+SVPRN SE+H+CGSC YGCR GDK+G DTT+LVDAVN+
Sbjct  372   TEEGFQNKVLRKGCENLGLQVDSVPRNTSERHFCGSCCYGCREGDKRGTDTTWLVDAVNH  431

Query  1134  GAVILTGCQAEKFILEEDETAR---KKCLGVIAKSKGN--NKILRIEARATVSACGSLFT  970
             GAVI+TGC+AE+F+ +E+E  +   KKC+G+IAKS      K LRI+A+AT+SACGSL T
Sbjct  432   GAVIITGCKAERFVFKENEPGKKKTKKCVGLIAKSLSRMVTKKLRIQAKATISACGSLLT  491

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEME--GKNHQGGIITSIHKVVS---  805
             PPL+ISSGL N NIG NLHLHPV+FAWGYFP+S ++    G+  +GGIITS+HKV +   
Sbjct  492   PPLMISSGLTNSNIGRNLHLHPVVFAWGYFPDSASDHHHRGRAFEGGIITSLHKVKAVED  551

Query  804   EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
               +   AIIEA ++GPA FA++ PW SG D KERM +YSRT  +F++VRD GSG V+  G
Sbjct  552   SDSSLRAIIEAPAMGPASFASLVPWVSGQDSKERMARYSRTALLFALVRDRGSGTVEGEG  611

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
             R++YR D +D++N+R GLR+ALRILVAAGA EVGT RSDGQ++ CKGI+ ++LE FLDG+
Sbjct  612   RVKYRFDALDRENLREGLRRALRILVAAGAVEVGTHRSDGQRMKCKGIEEKDLEEFLDGI  671

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
              A GGPMS  E WTL+ SAHQ+GSCR+GA+EE+G +D +GE WEA+GL+VCD SVLPSA+
Sbjct  672   SAVGGPMSRRELWTLHASAHQIGSCRIGASEEEGGVDESGESWEAQGLFVCDASVLPSAV  731

Query  264   GVNPMITILSTAYCISNGLAKSLNSG  187
             G+NPMITI S AYC+S G+A+SL  G
Sbjct  732   GINPMITIQSVAYCLSKGIAESLKRG  757



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/737 (58%), Positives = 564/737 (77%), Gaps = 12/737 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPL-----PQDSDDEAMCSFY  2212
             R CHPLL G R  +  +NHGLSS++  +LA++CE  +P +P       +D   +A+ SFY
Sbjct  3     RNCHPLLSGRRSKAEKHNHGLSSAELLSLASLCEVFLPTLPSVSSEGKEDRPSQALESFY  62

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +S +Q P PD+VAE+V++R L + V + R+VL++LST+LG+L+LCG +C   +WP+I+N
Sbjct  63    KASGAQAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINN  122

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FS + L++RE +L KW +  +  P+RI F  +KI C F++FS  DEN  NPAWEAI +H 
Sbjct  123   FSSMSLEKREKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAIDYHA  182

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             + +E   + Q  RPLEKGI+ET+ E G+T+ +SL +KGL VT+    N   I+CDVVIVG
Sbjct  183   ENDEDVSEVQQERPLEKGIVETMYETGSTIVQSLTQKGLQVTKDSKQNVYKIKCDVVIVG  242

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA++G KVVV+EKG+YF  +DYS LEGPS  +LYESGG+L TTD  + +
Sbjct  243   SGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDASMTI  302

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSA IKTP ++L EW+ + K+PLFGS +Y SAMD V +RIGVTE C 
Sbjct  303   LAGSTVGGGSAVNWSACIKTPKSLLQEWAGQYKLPLFGSPDYLSAMDIVWERIGVTENCV  362

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QNQVLRKGC+NLGL VE +PRN SE HYCGSCG+GC++GDKKG D+T+LVDAVN+G
Sbjct  363   QEGFQNQVLRKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG  422

Query  1131  AVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKILR--IEARATVSACGSLFTP  967
             AVILTGC+AE+FILE+ +   T   KC GVIAK+  N+  ++  IE +AT+SACG+L TP
Sbjct  423   AVILTGCKAERFILEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATISACGALLTP  482

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA  787
             PL+ISSGLKN++IG NLHLHPVL AWGYFP+S  E +GKN++GGIITS HKVVS  ++  
Sbjct  483   PLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKVVSGDSEVR  542

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             A+IE     PA F+ + PW SG+D K+ M KYSRT ++ +++RD GSG+VK  GRI +++
Sbjct  543   ALIETPEFSPAKFSVLWPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             DQ+DK+N++ GLRQALRIL+AAGA EVGT RSDGQ++ C+GI  +E+E FLD V A  GP
Sbjct  603   DQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGP  662

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
              S  ENW +Y +AHQMGSCRMG  +++GA+D NG+ WEA+GLYVCD SV PSA+GVNPMI
Sbjct  663   KSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMI  722

Query  246   TILSTAYCISNGLAKSL  196
             TI STAYC+S  +A+SL
Sbjct  723   TIQSTAYCLSKRIAESL  739



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/749 (57%), Positives = 578/749 (77%), Gaps = 20/749 (3%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRR---NSYNHGLSSSQYQALAAICEALIPPIPL--------PQDSDD  2233
             M  R  HPLLRGGRR     Y HGLS++Q + L+A+C   +P +P+          ++ D
Sbjct  1     MERRGGHPLLRGGRRAEKGGYRHGLSAAQMRTLSAMCGTFVPTVPIEAACLGGGKDEAPD  60

Query  2232  EAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDG  2053
             EA+ +F+ +S S  P PDEVAE+++RR   +AV + +LVL +L+TRLG+L+LCG +    
Sbjct  61    EAVEAFFLASGSDSPVPDEVAELLVRRGQKEAVALVKLVLWVLATRLGTLVLCGSLSLSW  120

Query  2052  RWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAW  1873
             R+PFI+ FS++P+++RE IL+KW+RE   + LR+VF+ +K+ C ++++S T+E   N AW
Sbjct  121   RFPFINKFSDMPVEKREHILMKWNREKSFIFLRLVFVIVKVFCLYVFYSMTNEEEENRAW  180

Query  1872  EAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             +AIG++  + E P   +  RPLEKGIIET+++  ++L++SLI+KGL VT++   +T TI 
Sbjct  181   KAIGYNTPSEEKPHKSRGERPLEKGIIETMDKTDSSLRQSLIEKGLAVTDNPREHTYTIN  240

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CDVVI GSGCGGGVAAAVLA+SGHKVVV+EKG+YF +EDY+ LE PS+ +LYE+GG+L++
Sbjct  241   CDVVIAGSGCGGGVAAAVLASSGHKVVVVEKGNYFTAEDYTALEAPSMDQLYEAGGILSS  300

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              D K+M+ AG+ VGGGSA+NW+A ++TP+ VL EW+ E  + LF S  Y SAMD+VC R+
Sbjct  301   LDVKMMLMAGSTVGGGSAVNWAACVRTPDFVLREWAEEHHLRLFDSPTYTSAMDSVCARL  360

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE C+KEG QNQVLR+GC+NLGL+VESVPRN SE HYCG+C YGCR+GDK+G DTT+L
Sbjct  361   GVTEKCTKEGFQNQVLRRGCQNLGLEVESVPRNSSEDHYCGTCCYGCRSGDKRGTDTTWL  420

Query  1152  VDAVNNGAVILTGCQAEKFILEEDE-----TARKKCLGVIAKSKGN--NKILRIEARATV  994
             VDAV+ GAVI+T C+AE+FI+EED        +KKCLG+IA++  N   K LRIEA+AT+
Sbjct  421   VDAVDRGAVIITACKAERFIIEEDRQDSSSKKKKKCLGLIARTLNNAITKTLRIEAKATI  480

Query  993   SACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHK  814
             SACGSL TPPL+++SGL+N NIG NL LHPVL AWGYFPES+++++G   +GGIITS+HK
Sbjct  481   SACGSLLTPPLMVASGLRNPNIGKNLRLHPVLLAWGYFPESVSDLKGNIFEGGIITSLHK  540

Query  813   VVSEGTKQA--AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQ  640
             V +     A  +IIE   LGPA FA + PW SG DMKE+M +YSRT ++F++VRD G+G 
Sbjct  541   VKASENSNATRSIIETAVLGPASFATLFPWVSGKDMKEKMFRYSRTAHVFALVRDRGAGT  600

Query  639   VKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELES  460
             ++  GR++YR+D+ DK+N+R GLR+ALRILVAAGAAEVGT RSDGQ I CKG+K EELE 
Sbjct  601   IEGEGRLKYRLDRSDKENLREGLRRALRILVAAGAAEVGTHRSDGQTIKCKGMKEEELEE  660

Query  459   FLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSV  280
             FLDG+ + GGP S  + WTL+CSAHQMGSCRMGA+EE+G +D  GE WEA GL+VCDGSV
Sbjct  661   FLDGIDSVGGPRSRSDVWTLHCSAHQMGSCRMGASEEEGGVDERGESWEAGGLFVCDGSV  720

Query  279   LPSAIGVNPMITILSTAYCISNGLAKSLN  193
             +P+A+GVNPMITI + AYC+S G+A+ L 
Sbjct  721   VPTAVGVNPMITIQAIAYCLSEGIAEYLK  749



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/744 (60%), Positives = 564/744 (76%), Gaps = 19/744 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGR-----RNSYNHGLSSSQYQALAAICEALIPP---IPLPQDSDDEAMCSF  2215
             ++CHPLL GGR        Y+HG SS++ Q+LA+ICEAL+PP   I   Q + ++A+ SF
Sbjct  3     KECHPLLNGGRGYTGDDRKYSHGFSSAEMQSLASICEALLPPLYEIKGEQPTINKAVQSF  62

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             Y +SA+Q P PDEVA+++++R L +AV + R+VL IL T+LG+LLLCG +CF   WPF+H
Sbjct  63    YKTSAAQTPIPDEVAQLMVKRALIEAVVLVRVVLWILGTKLGTLLLCGSLCFGKTWPFVH  122

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             NFS L L++RE +L KW +   + P+R+ F+ IK  C +I+FS   EN  N  W+AIG+H
Sbjct  123   NFSSLSLEKREKVLQKWFKHRFLTPIRLAFVYIKFLCLYIFFSRVGENAENLIWQAIGYH  182

Query  1854  VDTNEVPPD------QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             V+T++          Q+  RPL+KGIIET+ E  TTL  SL +KG  V      N   ++
Sbjct  183   VETDDQDDQKNHSKMQEQERPLQKGIIETMLETDTTLLNSLAQKGFQVIHDCTKNIYNVK  242

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CDV++VGSGCGGGVAAAVLA+SGHKV+VLEKG+YF   DYS LE PS  +LYESGG+L T
Sbjct  243   CDVIVVGSGCGGGVAAAVLASSGHKVIVLEKGNYFTPSDYSSLEAPSHDQLYESGGILVT  302

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DGK+++ AG+ VGGGSAINWSA IKTPN VL EW+ + KI  FG SEY SAMD VC+RI
Sbjct  303   VDGKIVLQAGSTVGGGSAINWSACIKTPNYVLQEWNKDHKIKFFGGSEYLSAMDTVCERI  362

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GV E C +EG QNQVLRKGCENLGL V+ VPRN SEKHYCGSCGYGCR G+KKG D+T+L
Sbjct  363   GVIENCVEEGFQNQVLRKGCENLGLGVDFVPRNSSEKHYCGSCGYGCRKGEKKGTDSTWL  422

Query  1152  VDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNN--KILRIEARATVSA  988
             +DAV+ GAVI+TGC+AE+F+LE +++    +KKCLGV+AK   NN  K L+IEA+ T+SA
Sbjct  423   MDAVDYGAVIITGCKAERFVLETNKSGSKRKKKCLGVMAKPLSNNITKRLQIEAKVTISA  482

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
             CG+L TPPL++SSGLKNKNIG NLHLHPVL AWGYFP+S +E +GKN++GGIITS++KVV
Sbjct  483   CGALLTPPLMLSSGLKNKNIGQNLHLHPVLMAWGYFPDSNSEFKGKNYEGGIITSVYKVV  542

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
             S  +K  AIIE  +LGP  F+A+SPW SG D+K RM K+SRT ++ S++RD GSG V K 
Sbjct  543   SADSKVKAIIETPALGPGTFSALSPWVSGEDIKNRMLKFSRTAHLISIIRDKGSGVVTKG  602

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GR+ Y    +DK+NI+ GLRQALRIL+AAGA EVGT RSDG ++ CKGI  EELE FLD 
Sbjct  603   GRVSYEFSALDKENIKGGLRQALRILIAAGAIEVGTHRSDGLRLKCKGIDKEELEEFLDM  662

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             V+A  GP S  ENWT Y SAHQMGSCRMG   ++GA+D NGE WEA+ L+VCDGSVLPSA
Sbjct  663   VIANEGPQSLVENWTTYSSAHQMGSCRMGINAKEGAVDENGESWEAESLFVCDGSVLPSA  722

Query  267   IGVNPMITILSTAYCISNGLAKSL  196
             +GVNPMITI STAYC+S  +A SL
Sbjct  723   VGVNPMITIQSTAYCLSKRIADSL  746



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/742 (61%), Positives = 562/742 (76%), Gaps = 28/742 (4%)
 Frame = -3

Query  2379  MNER-KCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPL-PQDSDDEAMCS--F  2215
             M ER  CHPLLRGGRR   Y+HGLS+SQ   +A+IC  L P +PL P  ++     S  +
Sbjct  1     MEERVNCHPLLRGGRREKGYSHGLSTSQMHVMASICNTLFPSLPLNPLTNETSQPLSPCY  60

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
              ++SAS      E AE++ +R +P+A+ +   VL +LS RLG+LL+CG +C D +WPFIH
Sbjct  61    NNTSASH-----EAAELLHKRVVPEALSLVGWVLWMLSFRLGTLLICGRLCLDWKWPFIH  115

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
              FSE+ L++RE IL  WSRE   +PLR+VF+ IK+  +  +FS +DEN +NP W+AIG+ 
Sbjct  116   KFSEISLEKREEILRNWSREKRWVPLRLVFVLIKLIFFCTFFSRSDENGHNPVWKAIGYQ  175

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
             VDT +    ++  RPLEKG+IET++E   TL +SL +KGL V+E +  N   ++CDVVIV
Sbjct  176   VDTKKKLVRKE--RPLEKGLIETMHETDHTLMQSLAEKGLEVSEDKLQNLYKVKCDVVIV  233

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAAVLANSG KV+VLEKG YFVS DYS LEGPS+ ELYESGG+L++ DGK+M
Sbjct  234   GSGCGGGVAAAVLANSGQKVIVLEKGEYFVSHDYSSLEGPSMDELYESGGILSSLDGKMM  293

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGGSAINWSA I+TP++VL E            S+YQSAMD+VC+RIGVTE C
Sbjct  294   ILAGSTVGGGSAINWSACIRTPDSVLRE-----------CSDYQSAMDSVCRRIGVTEKC  342

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              KE  QN+VL +GCE +G KVESV  N S  HYCGSC YGCRTGDKKG D+T+LVDAV N
Sbjct  343   KKESFQNRVLIQGCEKMGFKVESVATNSSADHYCGSCCYGCRTGDKKGTDSTWLVDAVGN  402

Query  1134  GAVILTGCQAEKFILEE--DETARKKCLGVIAKSKGNNKI---LRIEARATVSACGSLFT  970
             GAVIL+GC+AE+FILE+  D   +KKCLGVIA +   +K+   L IE++ T+SACGSL T
Sbjct  403   GAVILSGCKAERFILEDGNDGMKKKKCLGVIAAATWRSKVTKKLLIESKVTISACGSLST  462

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ  790
             PPL+ISSGLKN NIG NLHLHPV FAWGYFPE M    G NH+GGIITSIHKV++E +  
Sbjct  463   PPLMISSGLKNPNIGRNLHLHPVQFAWGYFPEDMTNFSGNNHEGGIITSIHKVLAEDSTP  522

Query  789   AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
               IIE  +LGP  F+A+ PW SG DMK+RM KY+RT NIF+++RDHGSG+VK  GR+ YR
Sbjct  523   RFIIETPALGPGSFSALVPWLSGHDMKDRMAKYARTANIFALIRDHGSGKVKAEGRVTYR  582

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
             +DQ+DK+N+R GLR+ALRILVAAGA EVGT+RSDGQ+  C+G+K E+LE FLD V   GG
Sbjct  583   LDQVDKENLRIGLRKALRILVAAGAVEVGTYRSDGQRFKCRGVKEEDLEEFLDTVKIVGG  642

Query  429   PMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPM  250
             P S  E WT+  SAHQM SCRMGATEE+GA+D  GE WEAKGLYVCDGSVLP+A+GVNPM
Sbjct  643   PRSRNELWTVLTSAHQMTSCRMGATEEEGAVDETGESWEAKGLYVCDGSVLPTAVGVNPM  702

Query  249   ITILSTAYCISNGLAKSLNSGK  184
             +TI STAYCI++ +A+SLN  K
Sbjct  703   VTIQSTAYCIASKIAESLNKDK  724



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/746 (58%), Positives = 574/746 (77%), Gaps = 18/746 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPL--------PQDSDDEAMC  2221
             R+ HP L+GGRR    Y HG S SQ Q+LAA+CEA IP + +         +D   + + 
Sbjct  8     RQGHPRLQGGRREEGGYRHGFSPSQIQSLAAMCEAFIPSLSMEELHVSSGKEDPPTKNLQ  67

Query  2220  SFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPF  2041
             +FY +S S+ P PDEVAE++++R L +AV + +LVL +L+T+LG+L+LCG +   G +PF
Sbjct  68    AFYLASGSESPVPDEVAELMVKRGLREAVLLVKLVLWLLATKLGTLVLCGSLSLCGEFPF  127

Query  2040  IHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIG  1861
             I+ FS++ +++RE +L +W++E + +PLR+VF+ +K+ C  I++S T+EN  N +W AIG
Sbjct  128   INKFSDMSVEKREEVLKRWNKENIFIPLRMVFVMVKVFCLHIFYSMTNENSENLSWNAIG  187

Query  1860  FHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvv  1681
             + + T E PP  Q+ RPLEKGIIET+++N ++L  SL KKGL V++    N   IRCDV 
Sbjct  188   YSLPTEEKPPKSQSERPLEKGIIETMDQNDSSLLHSLTKKGLAVSQDPIQNMYRIRCDVA  247

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             IVGSGCGGGVAAAVLA++GHKVVV+EKG+YF SEDY+ +E PS+ E+YESGG+L+T DGK
Sbjct  248   IVGSGCGGGVAAAVLASAGHKVVVIEKGNYFTSEDYTSIEAPSMYEMYESGGILSTLDGK  307

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
             +M+ AG+ VGGGSA+NWSA IKTP+ VL EW+ E ++PLF S++Y S+MDAVCKR+GVTE
Sbjct  308   MMLLAGSTVGGGSAVNWSACIKTPDYVLKEWAEEHQLPLFRSTDYLSSMDAVCKRLGVTE  367

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
              C++EG QN+VLRKGC+NLGLKV+SVPRN SE H+CGSC YGCR+GDK+G DTT+LVDAV
Sbjct  368   NCTQEGFQNEVLRKGCQNLGLKVDSVPRNSSESHFCGSCCYGCRSGDKRGTDTTWLVDAV  427

Query  1140  NNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKILR--IEARATVSACGSL  976
             + GAVI+TGC+AE+F+  E+E     RKKC+G+IAKS  +   ++  IEA+ TVSACGSL
Sbjct  428   DCGAVIVTGCKAERFLFVENEPGGKKRKKCVGLIAKSLSHKVTMKLEIEAKVTVSACGSL  487

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TPPL+ +SGL N NIG NLHLHP + AWGYFP+S++++ GK  +GGIITS+H+V +   
Sbjct  488   LTPPLMKASGLTNPNIGRNLHLHPAVLAWGYFPDSVSDLRGKTFEGGIITSLHEVRARED  547

Query  795   KQA---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
               +   AIIE  ++GPA FA + PW SGLDMKERM +YSRT ++F++VRD G+G V+  G
Sbjct  548   SDSSLRAIIETPAVGPAAFATLVPWVSGLDMKERMARYSRTAHLFALVRDRGTGTVEGEG  607

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
              ++YR D +D++N+R GLR+ALRILVAAGA EVGT RSDGQ+I CKGIK  ELE FLDG+
Sbjct  608   MVRYRFDALDRENMREGLRRALRILVAAGAVEVGTHRSDGQRIQCKGIKEAELEEFLDGI  667

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
                GGP S  E WT YC AHQMGSCRMG +EE+G +D  GE WEA+GL+VCDGSVLPSA+
Sbjct  668   TMVGGPRSRNELWTFYCCAHQMGSCRMGVSEEEGGVDETGESWEAQGLFVCDGSVLPSAV  727

Query  264   GVNPMITILSTAYCISNGLAKSLNSG  187
             G+NPMITI S AYC+S G+AKSL  G
Sbjct  728   GINPMITIQSIAYCLSKGIAKSLRRG  753



>gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/744 (58%), Positives = 559/744 (75%), Gaps = 12/744 (2%)
 Frame = -3

Query  2370  RKCHPLLRG--GRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDE---AMCSFYSS  2206
             + CHPLL+G  G R  Y HG SS++ +AL++ICE ++PPI +P     E    + +F+ +
Sbjct  3     KDCHPLLKGKTGERK-YRHGFSSAEMKALSSICETVLPPISIPGKGGHEISKPVQAFFKA  61

Query  2205  SASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFS  2026
             S  + P PD++AE++++R + + + + RLVL+ LSTRLG+LLLCG +CF  +WP+++ FS
Sbjct  62    SGFENPVPDQIAELLVKRAIIEGLILVRLVLLALSTRLGTLLLCGSLCFGEKWPYLNTFS  121

Query  2025  ELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT  1846
              + L +RE I+ KW +     P+R+VF  IK+ C + +F+  DEN  NPAWEAIG+ VDT
Sbjct  122   SISLDKREKIMQKWFKNRFFTPIRLVFQLIKVGCLYTFFAQADENGKNPAWEAIGYSVDT  181

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
             +E+       RPL++GIIET+ EN +TL  +L +KGL VT+        I CDV IVGSG
Sbjct  182   DEIANQVPQERPLQEGIIETMQENESTLMHNLTQKGLKVTKDPKKKICKINCDVAIVGSG  241

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAAAVLA SG KV+VLEKG+YF ++DYSGLEGPS  +LYESG +L TTD  +M+ A
Sbjct  242   CGGGVAAAVLATSGQKVLVLEKGNYFTAKDYSGLEGPSHDQLYESGAILPTTDANLMIMA  301

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             G+ VGGGSAINWSA I TP ++L EWS   K+ LFG++EY SAM+ VC+RIGVT  C +E
Sbjct  302   GSAVGGGSAINWSACINTPQSLLQEWSENHKLKLFGTAEYLSAMETVCQRIGVTRNCVEE  361

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
             G QNQVLRKGCENLGL+V +VPRN SEKHYC SCGYGC TGDKKG DTT+LVDAVN+GAV
Sbjct  362   GFQNQVLRKGCENLGLEVNTVPRNSSEKHYCWSCGYGCPTGDKKGTDTTWLVDAVNHGAV  421

Query  1125  ILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNNKILR--IEARATVSACGSLFTPP  964
             ILTGC+AE+FILEE++      +KKCLGVIAK+  NN  LR  IEA+ T++ACG+L TPP
Sbjct  422   ILTGCKAERFILEENKKKGSRRQKKCLGVIAKTLNNNIHLRLQIEAKITIAACGALLTPP  481

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAA  784
             L+ISSGLKN NIG NLHLHPVL AWGYFP+S  +++GK H+GGIITS+HKV+S      A
Sbjct  482   LMISSGLKNPNIGQNLHLHPVLMAWGYFPDSNKDLKGKCHEGGIITSVHKVISNDNNLRA  541

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             IIE   LGP+ +  + PW SGLD+K+R+ KYSRT ++ ++VRD G+G+VK  GRI Y +D
Sbjct  542   IIETPQLGPSAYGVLCPWESGLDIKKRLVKYSRTAHLITIVRDRGAGKVKTEGRISYNLD  601

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM  424
               D +N++ GLRQ+LRILVAAGA EVGT RSDGQ++ C+GI  ++LE FLD V    G +
Sbjct  602   PFDMENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLQCQGITKKDLEEFLDTVFPCRGIL  661

Query  423   SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMIT  244
             S  ++W +Y SAHQMGSC+MG  E++GA+D NGE WEA+GL+VCD SVLPSA+GVNPMIT
Sbjct  662   SPVKDWMIYSSAHQMGSCKMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMIT  721

Query  243   ILSTAYCISNGLAKSLNSGKA*NL  172
             I STAYC+S G+A+SL      NL
Sbjct  722   IQSTAYCLSKGIAESLKETTTSNL  745



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/737 (58%), Positives = 561/737 (76%), Gaps = 12/737 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPL-----PQDSDDEAMCSFY  2212
             R CHPLL G R  +  +NHGLSS++  +LA++CE  +P +        +D   +A+ SFY
Sbjct  3     RNCHPLLSGRRSKAEKHNHGLSSAELLSLASLCEVFLPTLSSVSSEGKEDRPSQALESFY  62

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +S +Q P PD+VAE+V++R L +AV + R+VL++LST+LG+L+LCG +C   +WP+I+N
Sbjct  63    KASGAQAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINN  122

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FS + L++RE +L KW +  +  P+RI F  +K  C F++F   DEN  NPAWEAI +HV
Sbjct  123   FSSMSLEKREKVLQKWFKNWIFTPVRIAFFILKTFCLFVFFCQLDENGKNPAWEAIDYHV  182

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             + +E   + Q  RPLEKGI+ET+ E  +T+ +SL +KGL VT+    N   I+CDVVIVG
Sbjct  183   ENDEDVSEVQQERPLEKGIVETMYETDSTIVQSLTQKGLQVTKDSKQNVYKIKCDVVIVG  242

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA++G KVVV+EKG+YF  +DYS LEGPS  +LYESGG+L TTD  + +
Sbjct  243   SGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDASMTI  302

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSA IKTP ++L EW+ + K+PLFGS +Y SAMD V +RIGVTE C 
Sbjct  303   LAGSTVGGGSAVNWSACIKTPKSLLQEWAGDYKLPLFGSPDYLSAMDIVWERIGVTENCV  362

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QNQVL+KGC+NLGL VE +PRN SE HYCGSCG+GC++GDKKG D+T+LVDAVN+G
Sbjct  363   QEGFQNQVLQKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG  422

Query  1131  AVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKILR--IEARATVSACGSLFTP  967
             AVILTGC+AE+FILE+ +   T   KC GVIAK+  N+  ++  IE +AT+SACG+L TP
Sbjct  423   AVILTGCKAERFILEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATISACGALLTP  482

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA  787
             PL+ISSGLKN++IG NLHLHPVL AWGYFP+S  E +GKN++GGIITS HKVVS  ++  
Sbjct  483   PLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKVVSADSEVR  542

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             A+IE     PA F+   PW SG+D K+ M KYSRT ++ +++RD GSG+VK  GRI +++
Sbjct  543   ALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             DQ+DK+N++ GLRQALRIL+AAGA EVGT RSDGQ++ C+GI  +E+E FLD V A  GP
Sbjct  603   DQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQQLKCEGITEKEVEQFLDTVYAAEGP  662

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
              S  ENW +Y +AHQMGSCRMG  E++GA+D NG+ WEA+GLYVCD SV PSA+GVNPMI
Sbjct  663   KSPVENWMVYGTAHQMGSCRMGVNEKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMI  722

Query  246   TILSTAYCISNGLAKSL  196
             TI STAYC+S  +A+SL
Sbjct  723   TIQSTAYCLSKRIAESL  739



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/745 (60%), Positives = 562/745 (75%), Gaps = 15/745 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPL--------PQDSDDEAMCS  2218
             ++CHPLL GGRR+  Y+HG SS++ Q+LA++CEAL+P +PL         +   ++A+ S
Sbjct  3     KECHPLLSGGRRSGKYSHGFSSAEMQSLASVCEALLPALPLNDFCFEGKEEQRTNKAVQS  62

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFI  2038
             F+ +S +Q P PDEVAE++++R   +AV + R+VL +LSTRLG+LLLCG +CF  RWPFI
Sbjct  63    FHKASGAQTPIPDEVAELLVKRAFIEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFI  122

Query  2037  HNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF  1858
              NFS LPL +RE +L KW +   + P+R+ F+ IK  C +I+FS  D+N  NP W+AIG+
Sbjct  123   LNFSSLPLAKRERLLQKWFKHRFLTPIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIGY  182

Query  1857  HVDTNEVP-PDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvv  1681
             HVD ++   P     RPL+KG+IETI E  TTL  SL +KGL V      N   I+CDVV
Sbjct  183   HVDIDDQNIPTAPKERPLQKGMIETIYETDTTLLHSLAEKGLTVRHDPQENLYKIKCDVV  242

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             +VGSGCGGGVAAAVLA+SG KV+VLEKG+YF   DYS LEGPS  ++YE GG+  T DGK
Sbjct  243   VVGSGCGGGVAAAVLASSGQKVIVLEKGNYFTHSDYSSLEGPSQDQMYELGGIFATIDGK  302

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
             +++ AG+ VGGGSA+NWSA I+TP+NVL EW+ +  I  FG  EY SAMD VC+RIGVT+
Sbjct  303   LVIQAGSTVGGGSAVNWSACIRTPDNVLEEWAKDHDIRFFGEPEYVSAMDTVCERIGVTD  362

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
              C +EG QNQVLRKGCENLGL V+ VPRN SEKHYCGSCGYGCR G+KKG D+T+L+DAV
Sbjct  363   NCVEEGFQNQVLRKGCENLGLGVDFVPRNSSEKHYCGSCGYGCRKGEKKGTDSTWLLDAV  422

Query  1140  NNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNN--KILRIEARATVSACGSL  976
             ++GAVILTGC+AEKF+LE  ++    +KKC GV+AKS  NN  K L+IEA+ T+SACG+L
Sbjct  423   DHGAVILTGCRAEKFVLENIKSGSLRKKKCSGVMAKSLSNNISKKLQIEAKVTISACGAL  482

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TP L+ISSGLKNKNIG NLHLHPVL AWGYFPES +E +GK ++GGIITS+HKV S  +
Sbjct  483   LTPLLMISSGLKNKNIGRNLHLHPVLMAWGYFPESNSEFKGKIYEGGIITSVHKVASADS  542

Query  795   KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQ  616
             K  AIIE  +LGP  F+++ PW SG D+K+RM KY RT ++ S++RD GSG V K GR+ 
Sbjct  543   KLRAIIETPALGPGAFSSLCPWESGEDIKKRMLKYGRTCHLISIIRDRGSGIVMKGGRVS  602

Query  615   YRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVAT  436
             Y  +  DK+N+  GLRQALRIL+AAGA EVGT RSDG +I CKGI+ E+LE FLD V A 
Sbjct  603   YEFEASDKENLEAGLRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAE  662

Query  435   GGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVN  256
              GP S  ENWT Y SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLPSA+GVN
Sbjct  663   KGPQSLVENWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVN  722

Query  255   PMITILSTAYCISNGLAKSLNSGKA  181
             PMITI STAYC+S  +A SL   ++
Sbjct  723   PMITIQSTAYCLSKRIAGSLKKKQS  747



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/738 (58%), Positives = 563/738 (76%), Gaps = 8/738 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQ--DSDDEAMCSFYSSS  2203
             E+K HPLLRGGRR + Y+HG SSS+ + L +ICE ++PP+P  +  + +   +   + +S
Sbjct  2     EKKSHPLLRGGRRETKYSHGFSSSEMETLTSICETILPPLPQNEIPEKNSHNIQYLHKAS  61

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
             ASQ P PDE AEVVM+R   +A+ + R +L ILSTR+G+LLLCG  CF  +WP+I+ F +
Sbjct  62    ASQYPIPDECAEVVMKRGFLEAIILVRGLLRILSTRIGTLLLCGSFCFVQKWPYINKFCD  121

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTN  1843
             +PL++RE +L KW +   + P+R+ FM IK  C +I+F+   E+  N AW+ IG+ VD  
Sbjct  122   IPLEKREIVLQKWFKNRFLTPVRLAFMFIKFLCLYIFFTQVGEDSKNQAWDDIGYQVDNE  181

Query  1842  EVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgc  1663
             E   +    RPLEKGI+E I E  +T+ +SL++KGL V +    N   ++CDVVIVGSGC
Sbjct  182   EKHSETAEERPLEKGIVEAIYETESTIVKSLVQKGLKVIDDTKNNMYKVQCDVVIVGSGC  241

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGVAA+VLA+SGHKV+VLEKG+Y+   DYS LEGPS+ ++YESGG+L+T D K+M+ AG
Sbjct  242   GGGVAASVLASSGHKVIVLEKGNYYTKSDYSSLEGPSMNQMYESGGILSTLDAKIMIMAG  301

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGGSAINWSA IKTP+ V+ EW  ++++P+F S EY SAMD VC+RIGVTE C++EG
Sbjct  302   STVGGGSAINWSACIKTPDCVIQEWGDDKRLPIFQSPEYVSAMDKVCERIGVTENCTQEG  361

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
             LQNQ+LRKGCENLGL+VE V RN SE HYCGSC YGCR G+KKG DTT+LVDAV++GAVI
Sbjct  362   LQNQILRKGCENLGLEVEGVARNTSENHYCGSCCYGCRRGEKKGTDTTWLVDAVDSGAVI  421

Query  1122  LTGCQAEKFILEEDE---TARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPLL  958
             +TGC+AE+FILE+++   T  KKCLGVIA S  K   K + IEA+ T+SACGSL TPPL+
Sbjct  422   ITGCKAERFILEKNKYGKTRDKKCLGVIATSTNKDITKRICIEAKVTISACGSLLTPPLM  481

Query  957   ISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAII  778
             ISSGL+N NIG NLHLHPV+ AWGYFPES ++++GK ++GGIITS+HKV S  +   AII
Sbjct  482   ISSGLRNPNIGRNLHLHPVIMAWGYFPESDSDLKGKIYEGGIITSVHKVGSYDSNVRAII  541

Query  777   EAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQI  598
             EA +LGP  FAA+ PWTSG D+K R+ KYSRT ++F+MV+D GSG+V+  GRI Y  +  
Sbjct  542   EATALGPGSFAALCPWTSGEDLKNRLLKYSRTAHLFAMVKDVGSGEVRSDGRISYTFNAT  601

Query  597   DKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSG  418
             DK++++ GL+QALRIL+AAGA EVGT RSDGQ++ CKG   +E+E+FL+ V A  GP S 
Sbjct  602   DKESLKQGLKQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLNTVTAAEGPKSL  661

Query  417   EENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITIL  238
              +N+T Y SAHQMGSCRMG +E+DGA+D NGE WEA GL+VCD SVLP A+GVNPMITI 
Sbjct  662   VKNFTTYSSAHQMGSCRMGMSEKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMITIQ  721

Query  237   STAYCISNGLAKSLNSGK  184
             STAYC+S  +A+ +  GK
Sbjct  722   STAYCLSKKIAEMIKEGK  739



>gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea]
Length=724

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/733 (60%), Positives = 560/733 (76%), Gaps = 22/733 (3%)
 Frame = -3

Query  2361  HPLLRGGR---RNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQP  2191
             H LL+G +   R   +HG SSSQ Q+LAAIC+ LIPP+     +D     + +SS    P
Sbjct  1     HTLLKGKKKQPRRRSSHGFSSSQIQSLAAICQTLIPPL-----ADHGNKAAPHSSFFDSP  55

Query  2190  PFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP-FIHNFSELPL  2014
                +EVAE++++R +P AVF+  LVL +LSTRLG+LLLCGF C D R P F+  FSEL L
Sbjct  56    SGSEEVAELLVKRGVPQAVFVVGLVLWVLSTRLGTLLLCGFTCLDWRSPPFLPTFSELQL  115

Query  2013  KRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV  1837
              +REA+L +WSR+    LPLRI F+ +KI  +F +FS TDEN  NPAWE+IG+H++T  V
Sbjct  116   SKREAVLQRWSRQGGTFLPLRITFLLVKIMSFFTFFSRTDENSQNPAWESIGYHIETPVV  175

Query  1836  PPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVT--ESQNANTLTIRCDvvivgsgc  1663
                    RPL+ GIIETI E+      SL +KGL V   E  + + L + CDVV+VGSGC
Sbjct  176   VERPLQRRPLQNGIIETITES------SLRQKGLRVITEEDDDDDYLNVDCDVVVVGSGC  229

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GG VAAA+LA SGHKVVVLEKGHYF ++DYSGLEGPSL ELYESG +L+T  G++M+ AG
Sbjct  230   GGSVAAAILAKSGHKVVVLEKGHYFAAQDYSGLEGPSLSELYESGAVLSTLGGELMIMAG  289

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGGSAINWSA I+TP+++L+EWS    +PL+ + EYQSAMDAVC+RIGVT+ C +EG
Sbjct  290   STVGGGSAINWSACIRTPDHILDEWSKTHNLPLYRTREYQSAMDAVCERIGVTDACDEEG  349

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
              QNQVLR+GCE+LGLKV+SVPRN    HYCGSCGYGCR G K+G D+T+LVDAV+N AVI
Sbjct  350   FQNQVLRRGCESLGLKVDSVPRNSPSDHYCGSCGYGCRRGAKRGADSTWLVDAVDNSAVI  409

Query  1122  LTGCQAEKFIL--EEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLISS  949
             +TGC+AE+FIL  +E+E  RK+C+GVIA ++   K L+I AR T+SACGSL TPPLLISS
Sbjct  410   MTGCKAERFILAKDENEKTRKRCIGVIATAENIEKKLKINARVTISACGSLSTPPLLISS  469

Query  948   GLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA--AIIE  775
             GLKNKNIG NLHLHPV F WGYFPE+   ++G +++GGIITSIHKV SE  K A  AI+E
Sbjct  470   GLKNKNIGRNLHLHPVSFIWGYFPETDTRLKGTSYEGGIITSIHKVQSEERKPAVQAIVE  529

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
             A SLGP  F+++ PWTS  +M +RMRKYSRT  +F++VRD GSG+VKK  +IQY++ ++D
Sbjct  530   AASLGPGAFSSLFPWTSRNNMDDRMRKYSRTAVLFTLVRDEGSGEVKKLKQIQYKLSEVD  589

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+N++TG+R+ALRIL+AAGA E GTFRSDGQ+I CKG   + +E FLD VVA  GP +  
Sbjct  590   KENLKTGMRRALRILIAAGATEAGTFRSDGQRIWCKGTNDDAVEEFLDTVVAADGPRTKS  649

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
               W +Y SAHQMGSCRMG  E++GA+D  GE WEAKGL+VCDGS+LP+A+GVNPM++IL+
Sbjct  650   MFWNIYGSAHQMGSCRMGRNEDEGAVDERGESWEAKGLFVCDGSLLPTAVGVNPMVSILA  709

Query  234   TAYCISNGLAKSL  196
             TAYC++N +A+S+
Sbjct  710   TAYCVANRIAESM  722



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/737 (58%), Positives = 556/737 (75%), Gaps = 7/737 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQ-DSDDEAMCSFYSSSA  2200
             E+K HPLLRGGRR + Y+HG SSS+ + L +ICE ++PP+PL     +++ + +F+  S 
Sbjct  2     EKKAHPLLRGGRRETKYSHGFSSSEIETLTSICETILPPLPLNSLQENNKKIQNFHKVSG  61

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             SQ P PDEVAE+VM+R   +A  + R +L ILSTR+GSLLLCG  CF   WP+I+ FS++
Sbjct  62    SQYPIPDEVAEIVMKRAFFEARMLVRGLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDI  121

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
              L +RE ++ KW       P+R+ F+ +K  C +I+F+   E+  NPAW+ IG+ VD  E
Sbjct  122   SLDKREIVMQKWFNNRFFTPVRLAFVFVKFLCLYIFFTQVGEDSKNPAWDDIGYQVDNEE  181

Query  1839  VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcg  1660
                +    RPL+KGIIETI E  +T+ +SL++KGL VTE    N   ++CDVVIVGSGCG
Sbjct  182   NSSETPDERPLQKGIIETIYETESTIVKSLVEKGLKVTEDTKNNMYKVQCDVVIVGSGCG  241

Query  1659  ggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGT  1480
             GGVAA+VLA+SG KVVVLEKG+YF   DYS LEGPS  ++YESGG+ +T DGKVM+ AG+
Sbjct  242   GGVAASVLASSGQKVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGIFSTLDGKVMILAGS  301

Query  1479  MVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGL  1300
              VGGGSA+NWSA IKTP++++ EW  +++I +F + EY SAMD VC+RI VTE C++EGL
Sbjct  302   TVGGGSAVNWSACIKTPDSIIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGL  361

Query  1299  QNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVIL  1120
             QNQ+L+KGCE LGL+VE V RN SE HYCGSC YGCR G+KKG DTT+LVDAV+ GAVI+
Sbjct  362   QNQILQKGCERLGLEVEGVARNSSEDHYCGSCCYGCRRGEKKGTDTTWLVDAVDCGAVII  421

Query  1119  TGCQAEKFILEEDE---TARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPLLI  955
             TGC+AE+FILE  +   T  KKCLGVI+ S  K   K + IEA+ T+SACGSL TPPL+I
Sbjct  422   TGCKAERFILENKKYGKTRSKKCLGVISTSMNKDITKSICIEAKVTISACGSLLTPPLMI  481

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             SSGLKN+NIG NLHLHPV+ AWGYFPES ++++GK ++GGIITS+HKV S  +   AIIE
Sbjct  482   SSGLKNRNIGRNLHLHPVIMAWGYFPESNSDLKGKIYEGGIITSVHKVGSHDSNVRAIIE  541

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
             A +LGP  FAA+ PWTSG D+K R+ KY RT ++F+MV+D GSG+V+  GRI Y  +  D
Sbjct  542   APALGPGSFAALCPWTSGEDIKNRLLKYDRTAHLFAMVKDVGSGEVRSEGRINYTFNGTD  601

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K++++ GLRQALRIL+AAGAAEVGT RSDGQ+I CKG   + LESFLD V A  GP S  
Sbjct  602   KESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGPKSLV  661

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             +++T YCSAHQMGSCRMG  E+D A+D NGE WEA+GL+VCD SVLP A+GVNPMITI S
Sbjct  662   KDFTTYCSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQS  721

Query  234   TAYCISNGLAKSLNSGK  184
             TAYC+S  +A+ +  G+
Sbjct  722   TAYCLSKKIAEMIKDGR  738



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/746 (58%), Positives = 553/746 (74%), Gaps = 14/746 (2%)
 Frame = -3

Query  2379  MNERKCHPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD--------DEA  2227
             M   +CHPLLR GGR   Y+HG SSS+ +AL  +CEA IPP+PL    D         EA
Sbjct  1     MERDQCHPLLREGGRETKYSHGFSSSELEALTGMCEAFIPPLPLNNSPDIVGKDGKTKEA  60

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRW  2047
             + SFY SS +Q P PD+VAE+V++R   +AV + R++LIILSTRLG+LLLCG +CF  +W
Sbjct  61    IQSFYKSSGAQYPNPDKVAELVVKRGFMEAVMLVRILLIILSTRLGTLLLCGALCFGKKW  120

Query  2046  PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             P+I+ FS++P+  RE ++ KW +   + P+R+ F+ IK  C + +F+   E++ NPAWEA
Sbjct  121   PYINKFSDIPVDNREKVIQKWLKHKFLTPIRLPFVLIKFLCLYAFFTQVWEDFKNPAWEA  180

Query  1866  IGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
             + + VD  +        +PL KG++ET +E  +T+  SL++KGL V E        I+CD
Sbjct  181   MDYQVDNRKDSSTTPHEKPLMKGMVETTHETESTIVSSLVQKGLRVAEDPKEKLYKIKCD  240

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
             VVIVGSGCGGGVAAAVLA SG KVVV+EKG+YF   DYS LEGPS+ ELYESGG+L T D
Sbjct  241   VVIVGSGCGGGVAAAVLAKSGQKVVVIEKGNYFTKTDYSSLEGPSMNELYESGGILATLD  300

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
             GK+++ AG+ VGGGSA+NWSA +KTP +VL EW+ + +IPLF SS+Y SAMD V +RIGV
Sbjct  301   GKLLMLAGSTVGGGSAVNWSACLKTPMSVLQEWAKDCQIPLFTSSQYVSAMDTVSQRIGV  360

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             TE CS+EG QNQ+LR+GCE LGL+VESVPRN SE HYCGSC YGCRTGDKKG D+T+LVD
Sbjct  361   TEKCSEEGFQNQILRQGCEKLGLEVESVPRNSSENHYCGSCNYGCRTGDKKGTDSTWLVD  420

Query  1146  AVNNGAVILTGCQAEKFILEEDETARK---KCLGVIAKSKGNNKILRI--EARATVSACG  982
             AV+ GAVI+TGC+AEKF+LE+++  R    KCLGVIAK    +   RI  EA+ T+SACG
Sbjct  421   AVDCGAVIITGCKAEKFVLEKNKYGRSRKSKCLGVIAKCLNGDITKRICIEAKVTISACG  480

Query  981   SLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSE  802
             SL TPPL+ISSGL N++IG NLHLHPVL AWGYFPES + ++GK ++GGIITS+HKV S+
Sbjct  481   SLLTPPLMISSGLTNQHIGRNLHLHPVLMAWGYFPESDSVLKGKIYEGGIITSVHKVGSD  540

Query  801   GTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGR  622
              +   A+IE+ +LGP  FAA+ PW SGL+ K+R+ KY+RT ++FSM+RD GSG+V+  GR
Sbjct  541   DSGVRALIESPALGPGSFAALRPWESGLETKKRILKYARTAHLFSMIRDRGSGEVRAEGR  600

Query  621   IQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVV  442
             I Y  D  DK+NI  GLRQAL ILVAAGA EVGT +S+GQK  CKG    ELE FLD V 
Sbjct  601   ISYTFDATDKENITAGLRQALMILVAAGAVEVGTLQSNGQKFKCKGTSERELEEFLDEVT  660

Query  441   ATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIG  262
             A  GP S  +NWT Y SAHQMGSCRMG +E+  A+D NGE WEA+ L+VCD SVLP A+G
Sbjct  661   AAEGPKSLVQNWTTYFSAHQMGSCRMGKSEKVSAVDENGESWEAEDLFVCDASVLPGAVG  720

Query  261   VNPMITILSTAYCISNGLAKSLNSGK  184
             VNPMITI STA+C+SN +A+ L   K
Sbjct  721   VNPMITIQSTAFCLSNKIAEILKERK  746



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/739 (58%), Positives = 557/739 (75%), Gaps = 13/739 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSD-------DEAMCSF  2215
             R+CHPLLRGGRR + Y+HG S+S+ + L +ICE L+PPIPL    +       D++  +F
Sbjct  3     RECHPLLRGGRRETKYSHGFSTSELEILTSICEVLLPPIPLMNSQENSTKNEVDQSYEAF  62

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
              ++S SQ P PDEVAE++ +R   +A  + R  L ILSTRLG+LL+CG   FD +WP++ 
Sbjct  63    CNASGSQYPVPDEVAELIKKRGSWEAKILVRATLRILSTRLGTLLICGSHSFDKKWPYLK  122

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
              FSE+ L++RE ++ KW R  L+ P+R+ F+ IK    +++F+   E+  NPAW+A+ + 
Sbjct  123   KFSEISLEKREKVVQKWFRNRLLTPVRLAFVFIKFLVLYVFFTQVGEDAKNPAWKAMDYR  182

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
             VD +E   D    RPLE+G++ET +E   T   SL  KGL VT++   +   ++CDVVIV
Sbjct  183   VDVDEKLRDAPKERPLEQGMVETRHETDLTFANSLAAKGLKVTQNAQRSMYKVKCDVVIV  242

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAAVL+ +G KVVVLEKG+Y+ S+DYS LEGPS+ ELYESGG+L+T DGK M
Sbjct  243   GSGCGGGVAAAVLSRAGLKVVVLEKGNYYTSKDYSALEGPSMSELYESGGLLSTLDGKTM  302

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGGSA+NWSA IKTP+ VL+EW   QK+PLF SSEY +AM+ VC RIGVTE C
Sbjct  303   ILAGSTVGGGSAVNWSACIKTPDFVLDEWGNGQKLPLFSSSEYIAAMEKVCGRIGVTEKC  362

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              KEG QNQ+LRKGCE LGLK + V RN SE H+CGSC YGC  GDKKG DTT+LVDAVN 
Sbjct  363   DKEGFQNQILRKGCEKLGLKADPVARNSSEGHFCGSCCYGCIRGDKKGTDTTWLVDAVNC  422

Query  1134  GAVILTGCQAEKFILEEDE--TARKK-CLGVIAKSK--GNNKILRIEARATVSACGSLFT  970
             GAVI++GC+AE+F++E+ +  +ARKK CLGVIAKSK     +++ IEAR T+SACGSL T
Sbjct  423   GAVIISGCKAERFVIEDKKYGSARKKRCLGVIAKSKIADTEQMIHIEARVTISACGSLLT  482

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ  790
             PPLLI SGLKN+NIG NLHLHPVL AWGYFPE+ +++EGK ++GGIITS+HKV  +    
Sbjct  483   PPLLIKSGLKNRNIGRNLHLHPVLMAWGYFPETSSDIEGKIYEGGIITSVHKVGQDAKNL  542

Query  789   AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
              AIIE+  LGP  FAA+ PW SG+++K R+ KY+RT ++FSM+RD GSG+V   GRI Y+
Sbjct  543   RAIIESPILGPGQFAALCPWESGVEIKNRILKYARTAHLFSMIRDRGSGEVMLEGRINYK  602

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
             +D+ DK+N++ GLR+ALRIL+AAGA EVGT +SDGQK+ CKGI  +E+E FLD V+A  G
Sbjct  603   LDKYDKENMKVGLRRALRILIAAGAVEVGTHQSDGQKLKCKGITEKEVEKFLDNVIAEDG  662

Query  429   PMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPM  250
             P S  E WT Y SAHQMGSCRM  +E+DGA+D NGE WEA+GL+VCD SVLP A+GVNPM
Sbjct  663   PKSMVEKWTTYSSAHQMGSCRMAKSEKDGAVDENGESWEAEGLFVCDASVLPGAVGVNPM  722

Query  249   ITILSTAYCISNGLAKSLN  193
             ITI +T+YC+S  +A+ L 
Sbjct  723   ITIQTTSYCLSKKIAEKLK  741



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/731 (59%), Positives = 567/731 (78%), Gaps = 17/731 (2%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPL--------PQDSDDEAMCSFYSSSASQPPFPDEV  2173
             Y+HG S SQ Q+LAA+CEALIP +P+         +D   +++ +FY +S S+ P PDEV
Sbjct  26    YSHGFSPSQIQSLAAMCEALIPSLPMEELHVSSGKEDPPTKSLQAFYLASGSESPVPDEV  85

Query  2172  AEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAIL  1993
             AE++++R L +AV + +LVL +L+T+LG+L+LCGF+   G +PFI+ FS++P+++RE +L
Sbjct  86    AELLVKRGLREAVLLVKLVLWLLATKLGTLVLCGFLSLRGGFPFINKFSDMPVEKREEVL  145

Query  1992  LKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGR  1813
              +W++E   +PLR+VF+ +K+ C+ I++S T+EN  N +W AIG+ + T E P   Q  R
Sbjct  146   KRWNKENFFIPLRMVFVMVKVFCFHIFYSMTNENSENLSWNAIGYSLPTEEKPRKSQRER  205

Query  1812  PLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlA  1633
             PLEKGIIET+++   +L ESL KKGL V++    N   IRCDV IVGSGCGGGVAAAVLA
Sbjct  206   PLEKGIIETMDQTDASLLESLAKKGLTVSQDPMQNIYRIRCDVAIVGSGCGGGVAAAVLA  265

Query  1632  NSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAIN  1453
             ++G KVVV+EKG+YF SEDY+ +E PS+ ELYESGG+ +T DGKVM+ AG+ VGGGSA+N
Sbjct  266   SAGRKVVVIEKGNYFTSEDYTSIEAPSMYELYESGGIHSTVDGKVMLLAGSTVGGGSAVN  325

Query  1452  WSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGC  1273
             W+A IKTP++VL EW+ E+++PLF S++Y SAMDAVC+R+GVTE CS+EG QN+VLRKGC
Sbjct  326   WAACIKTPDHVLREWAEERQLPLFTSTDYLSAMDAVCRRLGVTESCSEEGFQNKVLRKGC  385

Query  1272  ENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFI  1093
             +NLGL+V+SVPRN SE H+CGSC YGCR GDK+G D T+LVDAV+ GA ILTGC+AE+F+
Sbjct  386   QNLGLRVDSVPRNSSESHFCGSCCYGCRAGDKRGTDATWLVDAVDCGAAILTGCKAERFV  445

Query  1092  LEEDETA---RKKCLGVIAKSKGN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNI  928
               E+E     RKKC+G+IA+S  +   K L IEA+ T+SACGSL TPPL+I+SGL N NI
Sbjct  446   FVENEPGEKKRKKCVGLIARSSSHKVTKKLEIEAKVTISACGSLLTPPLMIASGLANPNI  505

Query  927   GSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA---AIIEAVSLGP  757
             G NL LHP   AWGYFP+S++++ G+  +GGIITS+H+V ++    A   AIIE  +LGP
Sbjct  506   GRNLRLHPAALAWGYFPDSVSDLRGRAFEGGIITSLHEVRAQENSDASLRAIIETPALGP  565

Query  756   AGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK-KAGRIQYRMDQIDKDNIR  580
             A FA + PW SG DMKERM +YSRT ++F++VRD GSG V+ K G ++YR D +D++N+R
Sbjct  566   AAFATLVPWVSGRDMKERMARYSRTAHLFALVRDRGSGTVEGKEGIVRYRFDGLDRENMR  625

Query  579   TGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTL  400
              GLR+ALRILVAAGA EVGT RSDGQ+I CKGIK E+LE FLDG+ A GGP S  E WT+
Sbjct  626   EGLRRALRILVAAGAVEVGTHRSDGQRIKCKGIKEEDLEEFLDGITAVGGPRSRSELWTI  685

Query  399   YCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCI  220
             Y SAHQMGSCRMG +EE+G +D  GE WEA+GL+VCDGSVLP+A+G+NPMITI S AYC+
Sbjct  686   YGSAHQMGSCRMGVSEEEGGVDERGESWEAQGLFVCDGSVLPTALGINPMITIQSVAYCL  745

Query  219   SNGLAKSLNSG  187
             S G+A+SL  G
Sbjct  746   SKGIAESLGRG  756



>ref|XP_008382898.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2 
[Malus domestica]
Length=674

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/669 (63%), Positives = 524/669 (78%), Gaps = 4/669 (1%)
 Frame = -3

Query  2178  EVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREA  1999
             +VAE++++R LP+ V   R+ L +LS RLG+ LLCG  CFD +WPFIH F+E+ L +RE 
Sbjct  3     QVAELMVKRSLPEVVGGVRVFLKMLSLRLGTFLLCGKCCFDWKWPFIHKFAEMSLDKREQ  62

Query  1998  ILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQT  1819
             +L KWSR+ L++ +R++FM +K+ C++ +FS  DEN  NPAW+AIG+ +D  E       
Sbjct  63    VLKKWSRQKLVITIRLMFMVVKMFCFYTFFSRVDENSRNPAWKAIGYELDRKEKLIKTPK  122

Query  1818  GRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaav  1639
              RPLEKGIIET  E+ +TL ESL KKGL++ +    N   I+CDVVIVGSGCGGGVAAAV
Sbjct  123   ERPLEKGIIETAYESDSTLVESLTKKGLDLADDAVNNIHKIKCDVVIVGSGCGGGVAAAV  182

Query  1638  lANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSA  1459
             LA SG KVVVLEKG+YFV +DYS LEGPS+ ELYESGG+L++ DG VM+ AG+ VGGGSA
Sbjct  183   LAQSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGILSSVDGMVMILAGSTVGGGSA  242

Query  1458  INWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRK  1279
             +NWSASIKTP+NVL +WS++ KIPL+ S +Y+SAMD VCKRIGVTE C++E   NQ+LRK
Sbjct  243   VNWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCTEENFPNQILRK  302

Query  1278  GCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEK  1099
             GCENLGLKV++VP N S  HYCG C YGC TGDKKG D+T+LVDAV  GAVILTGC+AEK
Sbjct  303   GCENLGLKVDAVPXNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVKFGAVILTGCKAEK  362

Query  1098  FILEEDETA--RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKN  931
             FILE D     RK+CLGV A S   N  + L+IEA  T+SACGSL TPPL+ISSGLKN+N
Sbjct  363   FILENDNEGGIRKQCLGVQATSLSKNIKRKLQIEANVTISACGSLLTPPLMISSGLKNRN  422

Query  930   IGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAG  751
             IG NLHLHPVL AWGYFPE   E +GK+++GGIITS+HKVVS       IIE  ++GPA 
Sbjct  423   IGRNLHLHPVLLAWGYFPEHEPEFKGKSYEGGIITSLHKVVSGTANVRTIIETAAVGPAT  482

Query  750   FAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGL  571
             F+ + PWTS LDMK+ M KY+RT N+F++VRD GSG VK+ GRI Y +DQ+DK+N++ GL
Sbjct  483   FSTLFPWTSRLDMKDTMEKYARTANLFALVRDRGSGAVKREGRIHYTLDQLDKENLQVGL  542

Query  570   RQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCS  391
             RQ LRIL+AAGA EVGT+R+DGQ+I CKG++ E+LE FLD VVA  GP + EE WT Y S
Sbjct  543   RQTLRILIAAGAVEVGTYRNDGQRIKCKGVEEEDLEVFLDTVVAAAGPSAREELWTTYSS  602

Query  390   AHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNG  211
             AHQMGSCRMGATEE+G +D NGE WEAKGL+VCDGS+LP+A+GVNPMITI STAYCIS  
Sbjct  603   AHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMITIESTAYCISKR  662

Query  210   LAKSLNSGK  184
             +A+SL   K
Sbjct  663   IAQSLEKQK  671



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/737 (58%), Positives = 555/737 (75%), Gaps = 7/737 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQ-DSDDEAMCSFYSSSA  2200
             E+K H LLRGGRR + Y+HG SSS+ Q L +ICE ++PPIPL     +++ + +F+  S 
Sbjct  2     EKKAHHLLRGGRRETKYSHGFSSSEIQTLTSICETILPPIPLNSLQKNNKKIQNFHKVSG  61

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             SQ P PDEVAE+VM+R   +A  + R +L ILSTR+GSLLLCG  CF   WP+I+ FS++
Sbjct  62    SQYPIPDEVAEIVMKRGFFEARMLVRSLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDI  121

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
              L +RE ++ KW       P+R+ F+ +K  C +I+F+   E+ NNPAW+ IG+ VD  E
Sbjct  122   SLDKREIVMQKWFNNRFFTPVRLAFVFVKFLCLYIFFTQVGEDSNNPAWDDIGYQVDNEE  181

Query  1839  VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcg  1660
                +    RPL+KGIIETI E  +++ +SL++KGL VTE    N   ++CDVVIVGSGCG
Sbjct  182   NSSETPDERPLQKGIIETIYETESSIVKSLVEKGLKVTEDTTNNMYKVQCDVVIVGSGCG  241

Query  1659  ggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGT  1480
             GGVAA+VLA+SG KVVVLEKG+YF   DYS LEGPS  ++YESGG+L+T DGKVM+ AG+
Sbjct  242   GGVAASVLASSGQKVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGILSTLDGKVMILAGS  301

Query  1479  MVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGL  1300
              VGGGSA+NWSA IKTP++V+ EW  +++I +F + EY SAMD VC+RI VTE C++EGL
Sbjct  302   TVGGGSAVNWSACIKTPDSVIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGL  361

Query  1299  QNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVIL  1120
             QNQ+LRKGCE LGL+VE V RN SE HYCGSC YGCR G+KKG DTT+LVDAV+ GAVI+
Sbjct  362   QNQILRKGCERLGLEVEGVARNSSEDHYCGSCCYGCRRGEKKGTDTTWLVDAVDCGAVII  421

Query  1119  TGCQAEKFILEEDE---TARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPLLI  955
             TGC+AE+FILE+ +   T  KKCLGVI+ S  K   K + IEA+ T+SACGSL TPPL+I
Sbjct  422   TGCKAERFILEKKKYGKTRSKKCLGVISTSMNKDITKSICIEAKVTISACGSLLTPPLMI  481

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             SSGLKN+NIG NLHLHPV+ AWGYFPES + ++GK ++GGIITS+HKV S  +   AIIE
Sbjct  482   SSGLKNRNIGRNLHLHPVIMAWGYFPESNSGLKGKIYEGGIITSVHKVGSYDSNVRAIIE  541

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
             A +LGP  FAA+ PWTSG D+K R+  Y RT ++F+MV+D GSG+V+  GRI Y  + +D
Sbjct  542   APALGPGSFAALCPWTSGEDIKNRLLNYDRTAHLFAMVKDVGSGEVRSEGRISYTFNGMD  601

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K++++ GLRQALRIL+AAGAAEVGT RSDGQ+I C G   + LESFL+ V A  GP S  
Sbjct  602   KESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCTGQSEKALESFLETVTAAEGPKSLV  661

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             +++T Y SAHQMGSCRMG  E+D A+D NGE WEA+GL+VCD SVLP A+GVNPMITI S
Sbjct  662   KDFTTYSSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQS  721

Query  234   TAYCISNGLAKSLNSGK  184
             TAYC+S  +A+ +  G+
Sbjct  722   TAYCLSKKIAEMIKDGR  738



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
Length=738

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/736 (57%), Positives = 550/736 (75%), Gaps = 9/736 (1%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPL-PQDSDDEAMCSFYSSS  2203
             M   +CHPLLRG     + HG S+++   L +IC+ L+PP+P     +   A  +FY  S
Sbjct  2     MRRSECHPLLRGTGTGKFTHGFSTAEMDTLTSICDTLLPPLPFNSPTTTTPAEKAFYQVS  61

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
              +Q P P+EVAE   +R L + V + R+VL IL+TRLG+LLLCG +CF  +WPF+  FSE
Sbjct  62    GAQSPIPEEVAETARKRGLIEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVCKFSE  121

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTN  1843
             +PL++RE  L +W +  +  P+R     IK+   +++FS  D N +NP+WEAI +  + +
Sbjct  122   MPLEKREEALRRWFKNKVFTPVRAALALIKLVFLYVFFSRVDVNGDNPSWEAIKYVPEID  181

Query  1842  EVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgc  1663
             E P      RPLEKGIIE  NE  ++ K+SL++KG+ +    + +TL++ CDVV+VGSGC
Sbjct  182   EHPSKSSDARPLEKGIIEPNNETESSFKKSLLQKGIRIA-GDDGHTLSVECDVVVVGSGC  240

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGVAAA+LA+SG KV++LEKG+YF++ DYS LEGPSL +LYE+G +  T DGKV++ AG
Sbjct  241   GGGVAAAILASSGQKVMILEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGKVLILAG  300

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGGSA+NWSASIKTP++VL EW+   KIP FG+SEYQ AMDAVCKRIGV+E C +EG
Sbjct  301   STVGGGSAVNWSASIKTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEG  360

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
              QNQVLRKGCENLGLKVE VPRN +  HYCGSCGYGCR G+K+G D+T+LVDAVN+GAVI
Sbjct  361   FQNQVLRKGCENLGLKVEKVPRNSTTGHYCGSCGYGCRKGEKQGTDSTWLVDAVNHGAVI  420

Query  1122  LTGCQAEKFILEEDETA---RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLL  958
             +T C+AE+FILE ++     + KCLGVIA    +N  K L I+A+AT+SACG+L TPPL+
Sbjct  421   ITNCKAERFILERNKNGSMKKSKCLGVIANVWSDNITKKLHIKAKATISACGALLTPPLM  480

Query  957   ISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ--AA  784
             ISSGL+NK+IG NLHLHPVL  WGYFPES +  +GK+++GGIITS+HKVVSE +K     
Sbjct  481   ISSGLRNKHIGRNLHLHPVLMTWGYFPESNSGFKGKSYEGGIITSVHKVVSEESKSNPKT  540

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             IIE   LGP   A + PW SGLD+K+RM KYSRT +  ++VRD GSG V+  GR+ Y + 
Sbjct  541   IIETPLLGPGSCAVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLS  600

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM  424
             + D++N++ GLRQ+LRILVAAGA EVGT RSDGQ++ CKGI  EELE FLD V A GG +
Sbjct  601   EEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLL  660

Query  423   SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMIT  244
             S  ++W +Y SAHQMGSC++G +E +GAID NGE WEA+GL+VCD SVLP+A+GVNPMIT
Sbjct  661   SLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMIT  720

Query  243   ILSTAYCISNGLAKSL  196
             I STAYCISN +A  L
Sbjct  721   IQSTAYCISNRIAALL  736



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/742 (56%), Positives = 548/742 (74%), Gaps = 17/742 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLP----QDSDD---EAMCSF  2215
             ++CHPLLRGGR+ N +  G SSS+ ++LA+ICE ++PP+P+     +  DD   E +  F
Sbjct  3     KECHPLLRGGRKDNKFRQGFSSSEMESLASICEVILPPLPMDALKIKKHDDVSIEDVEFF  62

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
             +++SAS  P P EVAE++ +R L +AV + R+VL +L+TRLG+ LLCG +CF  +WPFI+
Sbjct  63    WNTSASHYPIPHEVAEILSKRSLIEAVILIRVVLWLLATRLGTFLLCGLLCFSEKWPFIN  122

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             NFS + LK+RE ++  W +   I P+R+ F  +K+ C F YF+W DEN +NPAW+AIG+ 
Sbjct  123   NFSSMSLKKRERVMQWWLKNRFITPIRLAFAYLKVLCLFAYFTWVDENGDNPAWKAIGYE  182

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
             V  +E  P+   GR LEKGI+ET++E  +TL++SL +KGLNVT     N L ++CD ++V
Sbjct  183   VSADEKLPNSSNGRLLEKGIVETMHETNSTLQQSLTEKGLNVTLDSRNNILKVKCDAIVV  242

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAA+VL+ +GHKVVVLEKG+YF   DYS LEGPS+ +LYE+GG+L + D +++
Sbjct  243   GSGCGGGVAASVLSGAGHKVVVLEKGNYFAPRDYSSLEGPSMDQLYETGGILASVDSRIL  302

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGGSA+NWSA IKTP+ VL EWS    + LF +SEY SAM+ VC+RIGVTE C
Sbjct  303   LLAGSTVGGGSAVNWSACIKTPHEVLKEWSENHNLSLFSTSEYLSAMETVCERIGVTESC  362

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
             + EG QNQVLRKGC+NLGLKV+ VPRN S  H+CGSCGYGC  G+K+G   T+LVDAV N
Sbjct  363   THEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHFCGSCGYGCPKGEKQGTQDTWLVDAVEN  422

Query  1134  GAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKI--LRIEARATVSACGSLFT  970
             GAVI+TGC+AE+F+LE +      +KKCLGV+AK+  +     L+IEA+ T+SA G+L T
Sbjct  423   GAVIITGCKAERFLLENNRNGSGRKKKCLGVLAKALSSRVTMKLQIEAKVTISAGGALLT  482

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ  790
             PPL+ISSGLKNKNIG NLHLHPVL  WGYFPES +E++GK  +GGIITS+HKV S  +  
Sbjct  483   PPLMISSGLKNKNIGKNLHLHPVLMTWGYFPESTSELKGKIFEGGIITSVHKVPSRDSNS  542

Query  789   ----AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGR  622
                  AIIE  SLGP  FA++ PW SGLD KERM  Y RT ++ +++RD   GQV   GR
Sbjct  543   YSDTRAIIETPSLGPGSFASLCPWESGLDFKERMLNYPRTAHLITIIRDKACGQVTTEGR  602

Query  621   IQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVV  442
             + Y++   DK+N++ GL+QALRIL AAGA EVGT RSDGQ++ C  +   E+  F+D V 
Sbjct  603   VSYKLSAFDKENMKCGLQQALRILKAAGAVEVGTHRSDGQRVKCGEVSENEMAEFIDSVC  662

Query  441   ATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIG  262
                G +S  ENW +Y SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD S+LP+A+G
Sbjct  663   PMEGALSPGENWNIYTSAHQMGSCRMGMNEKEGAVDENGESWEAQGLFVCDASLLPTAVG  722

Query  261   VNPMITILSTAYCISNGLAKSL  196
             VNPMITI STAYCISN +   L
Sbjct  723   VNPMITIQSTAYCISNRVVDYL  744



>ref|XP_009137800.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Brassica rapa]
Length=744

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/734 (60%), Positives = 536/734 (73%), Gaps = 8/734 (1%)
 Frame = -3

Query  2361  HPLLRGGRRNS---YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQP  2191
             HPLLR  +R     Y+HG S SQ Q L+ IC+ L+PP P    ++  A+ SF  +S SQP
Sbjct  10    HPLLRSKKRQGEGGYSHGFSISQIQTLSFICQTLLPPPPPETTAEQNAVDSFNVASGSQP  69

Query  2190  PFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLK  2011
             PF DEVAE++++    +AV + R++L ILS R G+L LCG +C    WPF+H FS+LPL 
Sbjct  70    PFTDEVAEMIVKNGRSEAVKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVHKFSDLPLD  129

Query  2010  RREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVP  1834
             +RE IL  WSR++ L LPLRI F   K    F +FS  D+N  NPA EAIG+ +DT E+ 
Sbjct  130   KREEILRMWSRQSGLFLPLRITFFLAKFYTLFSFFSQRDQNMKNPALEAIGYSIDTTEMR  189

Query  1833  PDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcggg  1654
              D +  RPLEKGIIET NE+  T+++SL +KG++V    N N   IRCDVVIVGSG GGG
Sbjct  190   KDDEAPRPLEKGIIETKNESDVTIRQSLTQKGVHVARDDNDNIHRIRCDVVIVGSGSGGG  249

Query  1653  vaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMV  1474
             VAAA LA +G KV+VLEKG+YF S DYSGLEGPS+ ELYE G ++TT DGK MV AG+ V
Sbjct  250   VAAANLAKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTV  309

Query  1473  GGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQN  1294
             GGG+A+NWSASI+TP++VL EWS E KI  FGS EYQ AMD V +R+GVTE C KEGLQN
Sbjct  310   GGGTAVNWSASIRTPDHVLKEWSEESKIEFFGSQEYQLAMDEVVRRLGVTERCVKEGLQN  369

Query  1293  QVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTG  1114
             QVLR+GCE LGLKV SVPRN  E HYCGSCGYGCR G K G D T+LVDAV NGAVILTG
Sbjct  370   QVLREGCERLGLKVVSVPRNSPEDHYCGSCGYGCREGGKNGTDKTWLVDAVENGAVILTG  429

Query  1113  CQAEKFILEEDETARKK--CLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSG  946
              +AE+F+  ++E  +KK  C+GVIA S G    K + IEAR TVS+ GSL TPPL+ SSG
Sbjct  430   VKAERFVFTDNEGKKKKKRCVGVIASSVGGKIEKKVMIEARVTVSSAGSLLTPPLMRSSG  489

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVS  766
             L+N+NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H V    +   AI+E   
Sbjct  490   LENRNIGRNLKLHPVLMTWGYFPEKGSEFSGKMYEGGIITSVHHVHDAESGCRAILETPL  549

Query  765   LGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDN  586
              GPA +A +SPW SG D+KERM KY RT ++F++VRD+GSG+V K   + YR  + D++N
Sbjct  550   AGPASYAGLSPWVSGADLKERMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDREN  609

Query  585   IRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENW  406
             +R GLRQALR+LVAAGA EVGT+RSDGQ+I C+G+  E +E FLDGV A GG  +  E W
Sbjct  610   LRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGMTREAMEEFLDGVDAVGGVSTKGEYW  669

Query  405   TLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAY  226
             T Y SAHQMGSCRMG T E+GA+D  GE WEA+GL+VCDGSVLPSA+GVNPMITI STAY
Sbjct  670   TTYFSAHQMGSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAY  729

Query  225   CISNGLAKSLNSGK  184
             CIS  +  SL  GK
Sbjct  730   CISTRIVASLTEGK  743



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/736 (57%), Positives = 549/736 (75%), Gaps = 9/736 (1%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAM-CSFYSSS  2203
             M   +CHPLLRG R   + H  S+++ ++L +IC+ ++PP+P    +   A   +FY+ S
Sbjct  1     MRRSECHPLLRGTRTGKFTHEFSTAEMESLTSICDTVLPPLPFNSPTTSTAAERAFYAVS  60

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
              +Q P PDEVAE+  +R L + V + R+VL IL+TRLG+LLLCG +CF  +WPF+  FSE
Sbjct  61    GAQSPIPDEVAEMARKRGLVEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVWKFSE  120

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTN  1843
             +PLK RE  L +W +  +  P+R     IK+   +I+FS  D N +NP+WEAI +  + +
Sbjct  121   MPLKNREEALRRWFKNKVFTPIRAALALIKLVSLYIFFSRVDVNGDNPSWEAIKYVPEID  180

Query  1842  EVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgc  1663
             E P      RPL+KGIIE  NE  ++ K+SL++KG+ +    + +TL++ CDVV+VGSGC
Sbjct  181   EHPSKSSDVRPLQKGIIEPNNETESSFKKSLLQKGIRIA-GDDGHTLSVECDVVVVGSGC  239

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGVAAA+LA+SG KV+VLEKG+YF + DYS LEGPSL +LYE+GG+  T DGK+++ AG
Sbjct  240   GGGVAAAILASSGQKVMVLEKGNYFTASDYSSLEGPSLEQLYEAGGIFATDDGKMLILAG  299

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGGSA+NWSASI+TP++VL EW+   KIP FG+SEYQ AMDAVCKRIGV+E C +EG
Sbjct  300   STVGGGSAVNWSASIRTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEG  359

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
              QNQVLRKGCENLGLKVE V RN    HYCGSCGYGCR G+K+G D+T+LVD+VN+GAVI
Sbjct  360   FQNQVLRKGCENLGLKVEKVARNSPTGHYCGSCGYGCRKGEKQGTDSTWLVDSVNHGAVI  419

Query  1122  LTGCQAEKFILEEDETA---RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLL  958
             +T C+AE+FIL  ++     + KCLGVIA    +N  K L I+A+AT+SACG+L TPPL+
Sbjct  420   ITNCKAERFILARNKNGSMRKSKCLGVIANVWSDNITKKLHIKAKATISACGALLTPPLM  479

Query  957   ISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ--AA  784
             ISSGL+NK+IG NLHLHPVL  WGYFPES +  +GK+++GGIITS+HKVVSE +K     
Sbjct  480   ISSGLRNKHIGRNLHLHPVLMTWGYFPESDSGFKGKSYEGGIITSVHKVVSEESKSNPKT  539

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             IIE   LGP   A + PW SGLD K+RM KYSRT +  ++VRD GSG V+  GR+ Y + 
Sbjct  540   IIETPLLGPGSCAVLVPWVSGLDTKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLS  599

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM  424
             + D++N++ GLRQ+LRILVAAGA EVGT RSDGQ++ CKGI  EELE FLD V A GG +
Sbjct  600   EEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDNVSAEGGLL  659

Query  423   SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMIT  244
             S   NW +Y SAHQMGSC++G +E++GA+D NGE WEA+GL+VCD SVLP+A+GVNPMIT
Sbjct  660   SLSRNWNVYTSAHQMGSCKIGVSEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMIT  719

Query  243   ILSTAYCISNGLAKSL  196
             I STAYCISN +A  L
Sbjct  720   IQSTAYCISNRIAALL  735



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/733 (59%), Positives = 533/733 (73%), Gaps = 8/733 (1%)
 Frame = -3

Query  2361  HPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPP  2188
             HPLLR  +R    Y+HG S SQ Q L+ IC+ L+PP P    ++  A+ SF  +S SQPP
Sbjct  10    HPLLRSKKRQEGGYSHGFSISQIQTLSVICQTLLPPPP-ETTAEQNAVDSFKVASGSQPP  68

Query  2187  FPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKR  2008
             F DEVAE++++    +AV +F+++  +L+ R G+L LCG +C    WPF+  FSELPL +
Sbjct  69    FTDEVAEMIVKNGRSEAVKVFKIISTVLAYRFGTLFLCGSLCLAKDWPFVLKFSELPLDK  128

Query  2007  REAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPP  1831
             RE IL  WSR++   LPLRI F   K    F +FS  DEN  NPA EAIG+ +DT E+  
Sbjct  129   REEILRMWSRQSGFFLPLRITFFLAKFYTLFSFFSQRDENMKNPALEAIGYSIDTTEMRK  188

Query  1830  DQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggv  1651
             + +T RPLE+GIIET NE+  T+++SL +KG++V    N N   IRCDVVIVGSG GGGV
Sbjct  189   EDETPRPLERGIIETKNESDVTIRQSLTQKGVHVAREDNDNIHRIRCDVVIVGSGSGGGV  248

Query  1650  aaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVG  1471
             AAA LA +G KV+VLEKG+YF S DYSGLEGPS+ ELYE G ++TT DGK MV AG+ VG
Sbjct  249   AAANLAKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVG  308

Query  1470  GGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQ  1291
             GG+A+NWSASI+TP++VL EWS E KI  FGS EYQ AMD V +R+GVTE C KEGLQNQ
Sbjct  309   GGTAVNWSASIRTPDHVLREWSEESKIEFFGSQEYQLAMDEVTRRLGVTERCVKEGLQNQ  368

Query  1290  VLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGC  1111
             VLR GCE LGL+V SVPRN  E HYCGSCGYGCR G K G D T+LVDAV NGAVI+TG 
Sbjct  369   VLRGGCERLGLEVVSVPRNSPEDHYCGSCGYGCRGGGKNGTDKTWLVDAVENGAVIMTGV  428

Query  1110  QAEKFILEEDETARKK--CLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGL  943
             +AE+F+  ++E  +KK  C+GVIA S G    K   IEAR TVS+ GSL TPPL+ SSGL
Sbjct  429   KAERFVFTDNEGKKKKKRCVGVIASSVGGKVEKKFMIEARVTVSSAGSLLTPPLMRSSGL  488

Query  942   KNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSL  763
             +N+NIG NL LHPVL  WGYFPE+ +E  GK ++GGIITS+H V    +   AI+E    
Sbjct  489   ENRNIGRNLKLHPVLMTWGYFPENGSEFSGKMYEGGIITSVHHVHDGESGCRAILETPLA  548

Query  762   GPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNI  583
             GPA +A +SPW SG D+KERM KY RT ++F++VRD+GSG+V K   + YR  + D++N+
Sbjct  549   GPASYAGLSPWVSGADLKERMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDRENL  608

Query  582   RTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWT  403
             R GLRQALR+LVAAGA EVGT+RSDGQ+I C+GI  E +E FLD V A GG  +  E WT
Sbjct  609   RVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGITREAMEEFLDSVDAVGGVSTKGEYWT  668

Query  402   LYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYC  223
              Y SAHQMGSCRMG T E+GA+D  GE WEA+GL+VCDGSVLPSA+GVNPMITI STAYC
Sbjct  669   TYFSAHQMGSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYC  728

Query  222   ISNGLAKSLNSGK  184
             IS  +  SL  GK
Sbjct  729   ISTRIVASLTEGK  741



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/739 (58%), Positives = 562/739 (76%), Gaps = 10/739 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIP---LPQDSDDEAMCSFYSS  2206
             E+K HPLLRGGRR + Y+HG SSS+ + L +ICE ++PP+P   +P++ + + +   + +
Sbjct  2     EKKSHPLLRGGRRETKYSHGFSSSEMETLTSICETILPPLPQNEIPEN-NSQNIQYLHRA  60

Query  2205  SASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFS  2026
             S SQ P PDE AEVVM+R   +A+ + R +L ILSTR G+LLLCG  CF  +WP+I+ F 
Sbjct  61    SGSQYPIPDECAEVVMKRGFSEAIILLRGLLRILSTRFGTLLLCGSFCFVQKWPYINKFC  120

Query  2025  ELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT  1846
             ++PL++RE +L KW +   + P+R+ F+ IK    +I+F+   E+  N AW+ IG+ VD 
Sbjct  121   DIPLEKREIVLQKWFKNRFLTPVRLAFLFIKFLSLYIFFTQVGEDSKNQAWDDIGYQVDN  180

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
              E   +    RPLEKGI+ETI E  +T+ +SL++KGL V E    N   ++CDVVIVGSG
Sbjct  181   EEKHSETAEERPLEKGIVETIYETESTVVKSLVQKGLKVIEDTKNNMYKVQCDVVIVGSG  240

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAA+VLA+SG+KV+VLEKG+Y+   DYS LEGPS+ ++YESGG+L+T + K+M+ A
Sbjct  241   CGGGVAASVLASSGNKVIVLEKGNYYTKSDYSSLEGPSMNQMYESGGILSTLNAKIMIMA  300

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             G+ VGGGSAINWSA +KTP++V+ EW  ++++P+F S EY S MD VC+RIGVTE C++E
Sbjct  301   GSTVGGGSAINWSACLKTPDSVIQEWGDDKRLPIFQSPEYVSVMDKVCERIGVTENCTQE  360

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
             GLQNQ+LRKGCENLGL+VE V RN SE HYCGSC YGCR G+KKG DTT+LVDAV  GAV
Sbjct  361   GLQNQILRKGCENLGLEVEGVARNSSENHYCGSCCYGCRRGEKKGTDTTWLVDAVECGAV  420

Query  1125  ILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKILRI--EARATVSACGSLFTPPL  961
             I+TGC+AE+FILE+++   T  KKCLGVIA S   +   RI  EA+ T+SACGSL TPPL
Sbjct  421   IITGCKAERFILEKNKYGKTRDKKCLGVIATSTNKDITKRICIEAKVTISACGSLLTPPL  480

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             +ISSGLKN NIG NLHLHPV+ AWGYFPES +  +GK ++GGIITS+HKV S  +   AI
Sbjct  481   MISSGLKNPNIGRNLHLHPVIMAWGYFPESKSNFKGKIYEGGIITSVHKVESYDSNVRAI  540

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             IEA +LGP  FAA+ PWTSG D+K R+ KYSRT ++F+MV+D GSG+V+  GRI Y+ + 
Sbjct  541   IEAPALGPGSFAALCPWTSGEDLKNRLLKYSRTAHLFAMVKDVGSGKVRSDGRISYKFNA  600

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
             +DK++++ GLRQALRIL+AAGA EVGT RSDGQ++ CKG   +E+E+FLD V A  GP S
Sbjct  601   MDKESLKQGLRQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLDTVTAAEGPKS  660

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
               +N+T Y SAHQMGSCRMG +++DGA+D NGE WEA GL+VCD SVLP A+GVNPMITI
Sbjct  661   LVKNFTTYSSAHQMGSCRMGMSKKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMITI  720

Query  240   LSTAYCISNGLAKSLNSGK  184
              STAYC+S  +A+++  GK
Sbjct  721   QSTAYCLSKKIAETIKEGK  739



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/750 (58%), Positives = 545/750 (73%), Gaps = 16/750 (2%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSF  2215
             E +    + H LLR  +R    YNHG SSSQ Q+LA IC+ L+PP P    ++ +A+ SF
Sbjct  3     EDRRRRSRGHHLLRSKKRQGGYYNHGFSSSQIQSLAVICQTLLPPPPPVTTTEQQALDSF  62

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
               +S +QPPF DEVAE++++     AV I R++L ILS R G+LLLCG +C D  WPF+H
Sbjct  63    NVASRAQPPFSDEVAEMIVKNGRSQAVKILRIILTILSFRFGTLLLCGSLCLDKDWPFVH  122

Query  2034  NFSELPLKRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF  1858
              FSELPL +RE +L KWSR++  +LPLRI F   K    F +FS TDEN  NPA EAIG+
Sbjct  123   KFSELPLDKREEVLRKWSRQSGFLLPLRITFFLTKFYTLFYFFSQTDENLKNPALEAIGY  182

Query  1857  HVDT-----NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
              + T     N+   ++ T RPLE GIIET +E   T+ +SLI+KG++V    +     IR
Sbjct  183   SIATTETSSNKTRKEEGTRRPLEAGIIETKHETDITITQSLIEKGVHVARDDDNGVHRIR  242

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CD VIVGSG GGGVAAA LA +G KV+VLEKG+YF ++DYS LEGPS+ ELYE GG++TT
Sbjct  243   CDAVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFAAQDYSALEGPSMQELYEKGGLMTT  302

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DGK M+ AG+ VGGG+A+NWSASI+TP++VL EWS   KI  FGS EYQSAMD V +RI
Sbjct  303   VDGKFMILAGSTVGGGTAVNWSASIRTPDHVLQEWSERSKIEFFGSQEYQSAMDEVTRRI  362

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE C KEG QNQVLR+GCE LGLKV SVPRN  E HYCGSCGYGCR G K G D T+L
Sbjct  363   GVTERCVKEGFQNQVLREGCERLGLKVVSVPRNSPEDHYCGSCGYGCREGYKNGTDRTWL  422

Query  1152  VDAVNNGAVILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVS  991
             VDAV NGAVILTG +AE+FIL E+  +    +K+C+GVIA S G    K   IEAR TVS
Sbjct  423   VDAVENGAVILTGVKAERFILVENTNSGNERKKRCVGVIASSVGGKMEKKFMIEARVTVS  482

Query  990   ACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV  811
             + GSL TPPL++SSGL+N+NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H +
Sbjct  483   SAGSLLTPPLMLSSGLENRNIGRNLRLHPVLMTWGYFPEESSEFSGKMYEGGIITSVHHI  542

Query  810   VSEGTKQA-AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK  634
              ++G K   AI+E   +GPA FA +SPW SG D++ERM KY RT ++F++VRD+GSG+V 
Sbjct  543   -NDGEKGCRAILENPLIGPASFAGLSPWVSGADLEERMMKYGRTAHVFALVRDNGSGEVM  601

Query  633   KAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL  454
             K   ++YR  + DK+N+R G+RQALR+LVAAGA E+GT+RSDGQ++ C+G+  E +E FL
Sbjct  602   KESEVRYRTSKKDKENLRVGIRQALRVLVAAGAVEIGTYRSDGQRMKCEGVTREAVEEFL  661

Query  453   DGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLP  274
             D V A GG  +  E WT Y SAHQMGSCRMG TEE+GA+D NGE WEA+GL+VCDGSVLP
Sbjct  662   DRVDADGGVSTNREYWTTYFSAHQMGSCRMGHTEEEGAVDENGESWEAEGLFVCDGSVLP  721

Query  273   SAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             SA+GVNPMITI S AYCIS  +  SL   K
Sbjct  722   SAVGVNPMITIQSAAYCISKRIVDSLQRQK  751



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/742 (58%), Positives = 541/742 (73%), Gaps = 24/742 (3%)
 Frame = -3

Query  2361  HPLLRGGRRNS-----YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSAS  2197
             HPLLR  +R       YNHG S SQ  +LAAIC+ L+PP      SD ++  SF  +S++
Sbjct  15    HPLLRSKKREEEQVGYYNHGFSPSQIHSLAAICQTLLPP------SDQQSFDSFNVASST  68

Query  2196  QPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
             QPPF DEVAE++++    +AV + R++L+ILS R G+LLLCG +C D  WPF+  FSELP
Sbjct  69    QPPFTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSELP  128

Query  2016  LKRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
             L RRE IL KWSR++  +LP RI F   K    F +FS TDEN  NPA EAIG+ +DT +
Sbjct  129   LDRREEILRKWSRKSGFLLPFRITFFLSKFYTLFYFFSQTDENQKNPALEAIGYSLDTAD  188

Query  1839  VPPDQQTG-----RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
                +++T      RPL++GI+ET++E+  T+ ++L +KG+ V +    N   IRCD V+V
Sbjct  189   ASSNKKTEADEKRRPLQRGIVETMHESDITITQTLTEKGVYVAKDDGENVHRIRCDAVVV  248

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSG GGGVAAA LA +G KV+VLEKG+YF ++DYSGLEGPS+ ELYE GG LT+ DGK M
Sbjct  249   GSGSGGGVAAANLAKAGLKVLVLEKGNYFAAQDYSGLEGPSMLELYEKGGFLTSVDGKFM  308

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             + AG+ VGGG+AINWSASI+TP++VL EWS E KI  FGS EY++AMD V  RIGVT+ C
Sbjct  309   ILAGSAVGGGTAINWSASIRTPDHVLQEWSEESKIKFFGSQEYKTAMDEVTTRIGVTDKC  368

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              K+G QNQVLRKGCE LGL+VESVPRN  E HYCG CGYGCR GDK G D T+LVDAV N
Sbjct  369   VKDGFQNQVLRKGCERLGLQVESVPRNSHEDHYCGLCGYGCRAGDKNGTDQTWLVDAVEN  428

Query  1134  GAVILTGCQAEKFILEEDETA-----RKKCLGVIAKSKGNN--KILRIEARATVSACGSL  976
             GAVILTG +AE+FIL ++  +     +K+C+GVIA S G    K   IEAR TVS+ GSL
Sbjct  429   GAVILTGIKAERFILVDNTDSSSNERQKRCVGVIASSVGGKIGKKFMIEARVTVSSAGSL  488

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TPPL++SSGLKN+NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H +    +
Sbjct  489   LTPPLMLSSGLKNQNIGRNLTLHPVLMTWGYFPEKDSEFSGKMYEGGIITSLHHMNDAES  548

Query  795   KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQ  616
                AI+E   +GPA +A +SPW SG D+KERM KY+RT ++F++VRD GSG+V K   I 
Sbjct  549   GCKAILENPLIGPASYAGLSPWVSGADLKERMMKYARTAHLFALVRDIGSGEVMKENEIT  608

Query  615   YRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVAT  436
             YR  + D++N+R GLRQALR+L+AAGAAEVGT+RSDGQ+I C+G   E +E FLD V A 
Sbjct  609   YRTTKKDRENLRAGLRQALRVLIAAGAAEVGTYRSDGQRIKCEGTSREAIEEFLDEVDAV  668

Query  435   GGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVN  256
             GG  +  E WT Y SAHQM SCRMGAT E+GA+D NGE +EA+GL+VCDGSVLPSA+GVN
Sbjct  669   GGVSTKGEYWTTYFSAHQMSSCRMGATAEEGALDENGESFEAEGLFVCDGSVLPSAVGVN  728

Query  255   PMITILSTAYCISNGLAKSLNS  190
             PMITI STAYCIS  +  SL S
Sbjct  729   PMITIQSTAYCISTRIVDSLQS  750



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/749 (57%), Positives = 567/749 (76%), Gaps = 22/749 (3%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPL------PQDSDDE---  2230
             M  ++CHPLLRGGR +S Y HG S+++ ++LA+ICE ++PP+P+       +D  D+   
Sbjct  1     MTRKECHPLLRGGRGDSKYKHGFSAAEMESLASICEVVLPPLPMDALKIRKEDQIDDYDS  60

Query  2229  --AMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFD  2056
               ++ SF+  SAS+ P P EVAE++ +R L +AV + R+VL +L+TRLG+LLLCGF+C  
Sbjct  61    SKSLKSFWDISASRYPIPHEVAEMLTKRSLIEAVILIRVVLWLLATRLGTLLLCGFLCLG  120

Query  2055  GRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPA  1876
              +WP+++NFS + L++RE ++ KW +   + P+R+ F  IK+ C F++FSW DEN +NPA
Sbjct  121   EKWPYVNNFSNISLEKREMVMQKWLKHRFLTPIRLAFAYIKVLCLFVFFSWVDENGDNPA  180

Query  1875  WEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTI  1696
             W+AIG+ V  +E   +    RPLEKGIIET+NE+ + L++SL  KGLNVT    +N L +
Sbjct  181   WKAIGYEVPADENLTNASKTRPLEKGIIETMNESDSALQQSLANKGLNVTLDSKSNILKV  240

Query  1695  RCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLT  1516
             +CD ++VGSGCGGGVAAAVL+++G+KVVVLEKG+YF ++DYS LEGPS+ +LYE+GG+L 
Sbjct  241   KCDALVVGSGCGGGVAAAVLSSAGYKVVVLEKGNYFSTQDYSSLEGPSMNQLYETGGILA  300

Query  1515  TTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKR  1336
             + D +V+V AG+ VGGGSA+NWSA IKTP+ VLNEWS   K+P F S EY SAM+ VC+R
Sbjct  301   SVDSRVLVLAGSTVGGGSAVNWSACIKTPHKVLNEWSENHKLPFFSSQEYLSAMETVCER  360

Query  1335  IGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTY  1156
             IGVTE C++EG QNQVLRKGC+NLGLKV+ VPRN S  HYCGSCGYGC  G+K+G   T+
Sbjct  361   IGVTENCTQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYCGSCGYGCPKGEKQGTQATW  420

Query  1155  LVDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKI---LRIEARATV  994
             LVDAV   AVI+TGC+AE+F+LE + +    +KKCLGV+AK+  N+++   L+IEA+ T+
Sbjct  421   LVDAVERDAVIITGCKAERFLLESNRSGNGRKKKCLGVMAKAL-NSRVTMKLQIEAKVTI  479

Query  993   SACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM-AEMEGKNHQGGIITSIH  817
             SA G+L TPPLLISSGLKNKNIG NLHLHPVL  WGYFPES  +E +GK ++GGIITS+H
Sbjct  480   SAGGALLTPPLLISSGLKNKNIGKNLHLHPVLMTWGYFPESNDSEFKGKVYEGGIITSVH  539

Query  816   KVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSG  643
             KV S    +   AIIE  SLGPA FAA+ PW SGLD KERM  Y RT ++ +++RD   G
Sbjct  540   KVPSTDSNSDSRAIIETPSLGPASFAALCPWESGLDFKERMLNYPRTSHLITIIRDMACG  599

Query  642   QVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELE  463
             QV   GRI Y++++IDK+N++ GL+QAL+IL+AAGA EVGT RSDGQ++ C GI   E++
Sbjct  600   QVSTEGRISYKLNEIDKENMKAGLKQALKILIAAGAVEVGTHRSDGQRLKCDGIGENEVQ  659

Query  462   SFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGS  283
              FLD V    G +S  E W +Y SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD S
Sbjct  660   EFLDSVCPMEGALSPGEYWNIYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDAS  719

Query  282   VLPSAIGVNPMITILSTAYCISNGLAKSL  196
             VLPSA+GVNPMIT+ STAYCISN +A  L
Sbjct  720   VLPSAVGVNPMITVQSTAYCISNRIADYL  748



>gb|KFK29401.1| hypothetical protein AALP_AA7G128800 [Arabis alpina]
Length=745

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/737 (59%), Positives = 542/737 (74%), Gaps = 17/737 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQ  2194
             R  HPLLR  +R   Y+HG S SQ Q+LA IC+ L+PP P  Q  +D    SF  +S SQ
Sbjct  7     RGPHPLLRSKKREGGYSHGFSHSQIQSLAVICQTLLPP-PSQQAIND----SFKVASGSQ  61

Query  2193  PPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPL  2014
             PPF DEVA+++++    +AV + R++L+ILS RLG+LLLCG +C D  WPF+  FS+LPL
Sbjct  62    PPFTDEVADMIVKNGRGEAVKVLRIILMILSFRLGTLLLCGSLCLDKNWPFVLKFSQLPL  121

Query  2013  KRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV  1837
               RE IL KWS ++  +LP RI F   K    F +FS TDEN  NPA EAIG+ VDT+  
Sbjct  122   DTREEILRKWSTQSGFLLPFRITFFLAKFYTLFYFFSQTDENLKNPALEAIGYCVDTSSS  181

Query  1836  PPDQQTGR--PLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgc  1663
                Q   +  PLE GIIET +EN  T+ +SLI+KGL+V    N +   IRCD V+VGSG 
Sbjct  182   KKSQVDEKRPPLESGIIETKHENDITITKSLIEKGLHVARDDNVHR--IRCDAVVVGSGS  239

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGVAAA LA +G KVVVLEKG+YF ++DYSGLE PS+ ELYE  G+LTT DGK M+ AG
Sbjct  240   GGGVAAANLAKAGFKVVVLEKGNYFAAQDYSGLEAPSMLELYEKSGLLTTIDGKFMILAG  299

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGG+A+NWSASI+TP++VL EWS E K+  FGS EYQSAMD V +RIGVTE C K+G
Sbjct  300   STVGGGTAVNWSASIRTPDHVLQEWSEESKLKFFGSQEYQSAMDEVTRRIGVTERCVKDG  359

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
              QNQ+LRKGCE LGL+V+SVPRN  + HYCGSCGYGCRTG+K G D T+LVDA+ NGAVI
Sbjct  360   FQNQILRKGCERLGLEVDSVPRNSPDDHYCGSCGYGCRTGEKNGTDRTWLVDAIENGAVI  419

Query  1122  LTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPL  961
             LTG +AE+FILE++ ++    +K+C+GVIA S G    K L IEAR TVS+ GSL TPPL
Sbjct  420   LTGIKAERFILEDNTSSSNGRKKRCVGVIASSIGGKIGKKLMIEARVTVSSAGSLLTPPL  479

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             ++SSGL+N+NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H +    +   AI
Sbjct  480   MLSSGLENRNIGRNLRLHPVLMTWGYFPEKGSEFSGKMYEGGIITSVHHMNDTESGCRAI  539

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             +E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V K   + YR  +
Sbjct  540   LENPLMGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDSGSGEVMKESEVTYRTTK  599

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              D++N+R GLRQALR+LVAAGA EVGT+RSDGQ+I C+GI  E +E FLDGV A GG  +
Sbjct  600   KDRENLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGISKEAMEEFLDGVDAVGGVST  659

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
               E WT Y SAHQMGSCRMG + E+GA+D+NGE WEA+GL+VCDGSVLPSA+GVNPMITI
Sbjct  660   KGEYWTSYFSAHQMGSCRMGHSTEEGALDDNGESWEAEGLFVCDGSVLPSAVGVNPMITI  719

Query  240   LSTAYCISNGLAKSLNS  190
              STAYCIS  +   L +
Sbjct  720   QSTAYCISTRIVHLLQT  736



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/745 (58%), Positives = 550/745 (74%), Gaps = 15/745 (2%)
 Frame = -3

Query  2373  ERKC--HPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPLP---QDSDDE---AMC  2221
             E KC   P L G ++   Y+HG  S++ Q LA++ E   P +P     Q  D +   A+ 
Sbjct  2     EGKCKEQPWLNGEKKEPKYSHGFCSAEIQTLASVAEVFFPSLPPDSWFQGKDTQPSKAVQ  61

Query  2220  SFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPF  2041
             SF  +SASQPPFPDEVAE++ +R   ++V + R+VL++L TR+GSLLLCG  C    WP 
Sbjct  62    SFLKASASQPPFPDEVAELLGKRAFIESVIVVRIVLMLLWTRVGSLLLCGRQCLGKEWPI  121

Query  2040  IHNFSELPLKRREAILLKWSRETLIL-PLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             I++F  + L++RE ++  W +   +  P+R  F+ +K+ C F+YFS   E+  NPAWEAI
Sbjct  122   INDFGSMGLEKREKVMQNWLKHGFLFTPIRAAFIYLKVFCLFVYFSRVGEDGENPAWEAI  181

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
             G++VD  E  P  +  RPL+KG+IET++E  +TL  SL +KGL VTE    N   I+CD 
Sbjct  182   GYNVDKVEDQPQARKERPLQKGMIETVHEKDSTLYRSLSQKGLLVTEDTQQNVYRIKCDA  241

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             VI+GSGCGGGVAAA+LA SG KVVV+EKG+YF S DYS  EGPS+ +LYESGG+L + DG
Sbjct  242   VIIGSGCGGGVAAAMLAGSGLKVVVVEKGNYFTSTDYSPFEGPSMDKLYESGGILPSLDG  301

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             ++++ AG+ VGGGSA+NWSA IKTP +VL EW+ + KIPLFGS+EY SAM+ VC+RIGVT
Sbjct  302   QLLILAGSTVGGGSAVNWSACIKTPKSVLKEWAEDCKIPLFGSNEYVSAMETVCERIGVT  361

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
               C +EG QNQVLRKGCENLG+KVE VPRN SE HYCGSCG+GCR GDKKG D T+LVDA
Sbjct  362   HDCKEEGFQNQVLRKGCENLGVKVEKVPRNSSESHYCGSCGFGCRRGDKKGTDRTWLVDA  421

Query  1143  VNNGAVILTGCQAEKFILEEDE--TARK-KCLGVIAKSKGNN--KILRIEARATVSACGS  979
             VNN AVI+TGC+A++FILE +   + RK KCLGVIAK    N  K L IEA+ T+SACG+
Sbjct  422   VNNNAVIITGCKADRFILERNNVGSVRKLKCLGVIAKPSNQNITKELHIEAKVTISACGA  481

Query  978   LFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEG  799
             L TP L+ SSGLKN+NIG NLHLHPVL AWGYFP S ++ +GK ++GGIITS+HKVV   
Sbjct  482   LLTPLLMHSSGLKNRNIGQNLHLHPVLMAWGYFPNSDSKFKGKAYEGGIITSVHKVVGND  541

Query  798   TKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRI  619
              K  AIIE  SLGPA ++AV PW SGLDMK RM K+SRT ++ +++RD GSG+V   GR+
Sbjct  542   NKVQAIIETPSLGPAQYSAVCPWVSGLDMKARMLKFSRTAHMITIIRDQGSGKVHAGGRV  601

Query  618   QYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVA  439
              Y+ +++D+ N+R GLRQ+LRILVAAGA EVGT RSDGQ+I CKGI  EEL+ FLD V  
Sbjct  602   TYKFEEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRIRCKGISNEELDEFLDSVSM  661

Query  438   TGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGV  259
                P+   ENW ++ +AHQMGSCRMG  E++GA+D NGE WEA+GL+VCD S+LPSA+GV
Sbjct  662   LTSPLCTGENWVVHTTAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASILPSAVGV  721

Query  258   NPMITILSTAYCISNGLAKSLNSGK  184
             NPMIT+ STAYC+S  +A+SL   K
Sbjct  722   NPMITVQSTAYCLSKKIAESLRQQK  746



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/715 (61%), Positives = 541/715 (76%), Gaps = 14/715 (2%)
 Frame = -3

Query  2298  QALAAICEALIPPIPL--------PQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLP  2143
             Q+LA++CEAL+P +PL         +   D+A+ SF+ +S +Q P PDEVAE++++R   
Sbjct  2     QSLASVCEALLPALPLNDFCFEGKEEQPTDKAVQSFHQASGAQTPIPDEVAELLVKRAFI  61

Query  2142  DAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLIL  1963
             +AV + R+VL +LSTRLG+LLLCG +CF  RWPFI NFS LPL +RE +L KW +   + 
Sbjct  62    EAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWFKHRFLT  121

Query  1962  PLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV-PPDQQTGRPLEKGIIET  1786
             P+R+ F+ IK  C +I+FS  D+N  NP W+AIG+HVDT++   P     RPL+KGIIET
Sbjct  122   PIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIGYHVDTDDQNTPTAPKERPLQKGIIET  181

Query  1785  INENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVL  1606
             I E  TTL  S  +KGL V          I+CDVV+VGSGCGGGVAAAVLA+SG KVVVL
Sbjct  182   IYETDTTLLHSFAEKGLTVRHDPQEKLYKIKCDVVVVGSGCGGGVAAAVLASSGQKVVVL  241

Query  1605  EKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPN  1426
             EKG+Y+   DYS LEGPS  ++YESGG+  T DGK+++ AG+ VGGGSA+NWSA I+TP+
Sbjct  242   EKGNYYTHSDYSSLEGPSQDQMYESGGIFATIDGKLVIQAGSTVGGGSAVNWSACIRTPD  301

Query  1425  NVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVES  1246
             NVL EW+ + +I  FG  EY SAMD VC+RIGVT+ C +EG QNQVLRKGCENLGL V+ 
Sbjct  302   NVLEEWAKDHEIRFFGEPEYVSAMDTVCERIGVTDNCVEEGFQNQVLRKGCENLGLGVDF  361

Query  1245  VPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA--  1072
             VPRN SEKHYCGSCGYGCR G+KKG D+T+L+DAV++GAVILTGC+AEKF+LE  ++   
Sbjct  362   VPRNSSEKHYCGSCGYGCRKGEKKGTDSTWLLDAVDHGAVILTGCRAEKFVLENIKSGSL  421

Query  1071  -RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPV  901
              +KKC GV+ KS  NN  K L+IEA+ T+SACG+L TPPL+ISSGLKNKNIG NLHLHPV
Sbjct  422   RKKKCSGVMGKSLSNNISKKLQIEAKVTISACGALLTPPLMISSGLKNKNIGRNLHLHPV  481

Query  900   LFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSG  721
             L AWGYFPES +E +GK ++GGIITS+HKV S  +K  AIIE  +LGP  F+++ PW SG
Sbjct  482   LMAWGYFPESNSEFKGKIYEGGIITSVHKVASVDSKVKAIIETPALGPGAFSSLCPWVSG  541

Query  720   LDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAA  541
              D+K+RM KY RT ++ S++RD GSG V K GR+ Y  +  DK+N+  GLRQALRIL+AA
Sbjct  542   EDIKKRMLKYGRTCHLISIIRDRGSGIVMKGGRVSYEFEASDKENLEAGLRQALRILIAA  601

Query  540   GAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMG  361
             GA EVGT RSDG +I CKGI+ E+LE FLD V A  GP S  ENWT Y SAHQMGSCRMG
Sbjct  602   GAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAEKGPQSLVENWTTYSSAHQMGSCRMG  661

Query  360   ATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
               E++GA+D NGE WEA+GL+VCD SVLPSA+GVNPMITI STAYC+S  +A SL
Sbjct  662   INEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLSKRIAGSL  716



>ref|XP_010433200.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Camelina sativa]
Length=748

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/747 (58%), Positives = 538/747 (72%), Gaps = 22/747 (3%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRNS---YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCS  2218
             E+     + H LLR  +R     YNHG S SQ Q+LA IC+ L+PP P       ++  S
Sbjct  2     EEDGRRNRGHALLRSKKREEEEGYNHGFSPSQIQSLAVICQTLLPPSP------KQSFDS  55

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFI  2038
             F   S++QPPF DEVAE++++    +AV + R++L++LS R G+LLLCG +CFD  WPF+
Sbjct  56    FNVVSSTQPPFTDEVAEMIVKNGRSEAVKVLRIILMVLSFRFGTLLLCGSLCFDKSWPFV  115

Query  2037  HNFSELPLKRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIG  1861
               FSELPL RRE IL KWSR++  +LP RI F   K    F +FS TDEN  NPA EAIG
Sbjct  116   LKFSELPLDRREEILRKWSRQSGYLLPFRITFFLAKFYTLFYFFSHTDENMKNPALEAIG  175

Query  1860  FHVD------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLT  1699
             F +D      +N+     +  RPLE GIIET++E+  T+ +SLI+KG++     + N   
Sbjct  176   FCLDPKDSSISNKKSEADEKRRPLESGIIETLHESDITITQSLIEKGVHAARDDDENVHR  235

Query  1698  IRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGML  1519
             IRCDVV+VGSG GGGVAAA LA +G KV+VLEKG+YF ++DYSGLEGPS+ ELYE GG L
Sbjct  236   IRCDVVVVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFL  295

Query  1518  TTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCK  1339
             TT DGK MV AG+ VGGG+AINWSASI+TP++VL EWS   KI  FGS EY++AMD V  
Sbjct  296   TTVDGKFMVLAGSAVGGGTAINWSASIRTPDHVLQEWSEGSKIKFFGSQEYKTAMDQVTT  355

Query  1338  RIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTT  1159
             RIGVTE C K+G QNQVLRKGCE LGL+VESVPRN SE HYCG CGYGCR G K G D T
Sbjct  356   RIGVTEKCVKDGFQNQVLRKGCERLGLQVESVPRNSSEDHYCGLCGYGCRAGHKNGTDRT  415

Query  1158  YLVDAVNNGAVILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARAT  997
             +LVDAV NGAVILTG +AE+FIL ++ ++    +K+C+GVIA S G    K   IEAR T
Sbjct  416   WLVDAVENGAVILTGIKAERFILVDNTSSSKERQKRCVGVIASSVGGKIGKKFIIEARVT  475

Query  996   VSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIH  817
             VS+ GSL TPPL++SSGLKN+NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H
Sbjct  476   VSSAGSLLTPPLMLSSGLKNQNIGRNLRLHPVLMTWGYFPEKDSEFSGKMYEGGIITSLH  535

Query  816   KVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQV  637
              +    +   AI+E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V
Sbjct  536   YMNDAESGCKAILENPLIGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDIGSGEV  595

Query  636   KKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESF  457
              K   + YR  + D++N+R GLRQALR+L+AAGA EVGT+RSDGQ++ C+G   E +E F
Sbjct  596   MKENEVTYRTTKKDRENLRAGLRQALRVLIAAGAVEVGTYRSDGQRMKCEGTTRESIEEF  655

Query  456   LDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVL  277
             LD V   GG  +  E WT Y SAHQM SCRMGATEE+GA+D NGE WEA+GL+VCDGSVL
Sbjct  656   LDEVDVVGGVSTKGEYWTSYFSAHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGSVL  715

Query  276   PSAIGVNPMITILSTAYCISNGLAKSL  196
             PSA+GVNPMITI STAYCI+  +  SL
Sbjct  716   PSAVGVNPMITIQSTAYCIATRIVNSL  742



>ref|XP_010438427.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=745

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/745 (58%), Positives = 536/745 (72%), Gaps = 21/745 (3%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYS  2209
             E+     + H LLR  +R  YNHG S SQ  +LA IC+ L+PP      S  ++  SF  
Sbjct  2     EEDGRRNRGHRLLRSKKREGYNHGFSPSQIHSLAVICQTLLPP------SGKQSFDSFNV  55

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNF  2029
              S++QPPF DEVAE++++    +AV + R++L+ILS R G+LLLCG +C D  WPF+  F
Sbjct  56    VSSTQPPFTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKF  115

Query  2028  SELPLKRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             SELPL RRE IL KWSR++  +LP RI F   K    F +FS TDEN  NPA EAIGF +
Sbjct  116   SELPLDRREEILKKWSRQSGYLLPFRITFFLAKFYTLFYFFSHTDENLKNPALEAIGFCL  175

Query  1851  DTNE-------VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             DT +       +  D++  RPLE GI+ET++E+  T+ ++LI+KG++     + N   IR
Sbjct  176   DTKDSSSSNKKIEADEKR-RPLESGIVETLHESDITITQTLIEKGVHAARDDDENVHRIR  234

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CDV+IVGSG GGGVAAA LA +G KV+VLEKG+YF ++DYSGLEGPS+ ELYE GG LTT
Sbjct  235   CDVIIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLTT  294

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DGK MV AG+ VGGG+AINWSASI+TP++VL EWS   KI  FGS EY++AMD V  RI
Sbjct  295   VDGKFMVLAGSAVGGGTAINWSASIRTPDHVLQEWSEGSKIKFFGSQEYKTAMDEVKTRI  354

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE C K+G QNQVLRKGCE LGLKVESVPRN  E HYCG CGYGCR G K G D T+L
Sbjct  355   GVTEKCVKDGFQNQVLRKGCERLGLKVESVPRNSREDHYCGLCGYGCRAGHKNGTDRTWL  414

Query  1152  VDAVNNGAVILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVS  991
             VDAV NGAVILTG +AE+FIL ++ ++    +K+C+GVIA S G    K   IEAR TVS
Sbjct  415   VDAVENGAVILTGIKAERFILVDNTSSSKERQKRCVGVIASSVGGKIGKKFIIEARVTVS  474

Query  990   ACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV  811
             + GSL TPPL++SSGLKN+NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H +
Sbjct  475   SAGSLLTPPLMLSSGLKNQNIGRNLRLHPVLMTWGYFPEKDSEFSGKMYEGGIITSLHNM  534

Query  810   VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
                 +   AI+E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V K
Sbjct  535   NDAESGCKAILENPLIGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDIGSGEVMK  594

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                + YR    D++N+R GLR ALR+L+AAGA EVGT+RSDGQ+I C+G   E +E FLD
Sbjct  595   ENEVTYRTTTKDRENLRAGLRLALRVLIAAGAVEVGTYRSDGQRIKCEGTTREAMEEFLD  654

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
              V A GG  +  E WT Y SAHQM SCRMGATEE+GA+D NGE WEA+GL+VCDGSVLPS
Sbjct  655   EVDAVGGVSTKGEYWTSYFSAHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGSVLPS  714

Query  270   AIGVNPMITILSTAYCISNGLAKSL  196
             A+GVNPMITI STAYCIS  +  SL
Sbjct  715   AVGVNPMITIQSTAYCISTRIVNSL  739



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/739 (56%), Positives = 552/739 (75%), Gaps = 14/739 (2%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRN--SYNHGLSSSQYQALAAICEALIPPIPLP------QDSDDEAM  2224
             M  ++CHPLL+GGR     Y H  SS+  +ALA++CEAL+PPI             ++A+
Sbjct  1     MERKECHPLLKGGRTKGGKYKHDFSSANMEALASMCEALLPPIESEYLDKKGMKPTNKAI  60

Query  2223  CSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP  2044
               F+  S S    P +VAE+++ R LP+A+ + R++L +LSTRLG+LLLCG +C + +WP
Sbjct  61    HLFWKLSGSHLSVPHQVAEMLVERALPEALTLIRVILSMLSTRLGTLLLCGSLCLNKKWP  120

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             FI+NFS + L+ RE ++ KW +   + P+R+VF+ IK+ C  ++FS  +EN  N AWEAI
Sbjct  121   FINNFSNISLENREKVIQKWLKHRFLTPVRLVFIYIKVLCLIVFFSRCNENGENQAWEAI  180

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
             G+ V+++E   +    RPLEKGI+E +NE+  +L +SL +KGL +      N L ++CDV
Sbjct  181   GYEVESDENTSNDHKERPLEKGIVEAMNEDNLSLPQSLSQKGLEIEIDAKNNILKVKCDV  240

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             VIVGSGCGGGVAAAVLA SG KV+VLEKG+YF   DYS LEGPSL ELYE GG   + DG
Sbjct  241   VIVGSGCGGGVAAAVLAKSGLKVLVLEKGNYFTQNDYSSLEGPSLNELYELGGTFASCDG  300

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
              + + AG+ VGGGSA+NWSASI+TP+ VL EWS   K+PLF S EY SAMD VCKRIGVT
Sbjct  301   NIAILAGSTVGGGSAVNWSASIRTPDYVLKEWSENHKLPLFSSHEYVSAMDMVCKRIGVT  360

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             + C +EGLQNQVLRKGCE LGL+V+ VPRN S+ HYCGSC YGCR G+K+G D T+L DA
Sbjct  361   DTCVEEGLQNQVLRKGCEKLGLQVDYVPRNSSQHHYCGSCNYGCRKGEKQGTDVTWLADA  420

Query  1143  VNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKI--LRIEARATVSACGS  979
             V++GAVILT C+A+KFIL +++     RKKCLG++A     N    L++EA+AT+S+CG+
Sbjct  421   VDDGAVILTRCKAKKFILVDNKEGCVRRKKCLGLMANFLTENITWRLQVEAKATISSCGA  480

Query  978   LFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEG  799
             L TPPL+ISSGLKNKNIG+NLHLHPVL  WGYFP+S+++++G++++GGIITSIHKV+S+ 
Sbjct  481   LSTPPLMISSGLKNKNIGNNLHLHPVLMTWGYFPDSISDLKGRSYEGGIITSIHKVLSDD  540

Query  798   TKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRI  619
             +K  AIIE  +L P  F+ + PW SG   KERM +YSR V+  ++++D   G+VK  GRI
Sbjct  541   SKVKAIIETPALAPGTFSTLFPWESGFGFKERMLRYSRMVHFITIIQDKSCGEVKSEGRI  600

Query  618   QYRMD-QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVV  442
             +Y +D + DK+NI+ GL+QALRIL+AAGA EVGT RSDGQ+I C G   +EL  F++ V 
Sbjct  601   KYELDEEFDKENIKDGLQQALRILIAAGAVEVGTHRSDGQRIACSGSNEKELNKFVESVY  660

Query  441   ATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIG  262
             ATGGPMS  ENW++Y SAHQMGSCR+G TE++GA+D NG+ WEA+GL+VCD S+LP+AIG
Sbjct  661   ATGGPMSHGENWSIYASAHQMGSCRVGVTEKEGAVDENGQSWEAEGLFVCDSSLLPTAIG  720

Query  261   VNPMITILSTAYCISNGLA  205
             VNPMITI S AYCI+N +A
Sbjct  721   VNPMITIQSVAYCIANRIA  739



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/660 (65%), Positives = 525/660 (80%), Gaps = 7/660 (1%)
 Frame = -3

Query  2163  VMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKW  1984
             +++R LP+ V + + VL +LS RLG+LLLCGF+CFD  WPF H FSEL +K+RE ILLKW
Sbjct  1     MVKRGLPEIVKVVKSVLKVLSFRLGTLLLCGFICFDWNWPFFHKFSELSVKKREEILLKW  60

Query  1983  SRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGRPLE  1804
             SR+  I PLR  F+ ++I C + +FS TDEN  NPAWEAIG+H D  E    ++  RPL+
Sbjct  61    SRQKYIFPLRAAFVAVRIFCLYTFFSRTDENSENPAWEAIGYHKDNREKLRREE--RPLQ  118

Query  1803  KGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSG  1624
             KGI+E  NE+ +T+ +SLI+KGL VTE        I+CDVVIVGSGCGGGVAAAVLA+SG
Sbjct  119   KGIVELANEDDSTILQSLIEKGLEVTEDSEHKICKIKCDVVIVGSGCGGGVAAAVLASSG  178

Query  1623  HKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSA  1444
              KV+VLEKG+YFV+EDYS LEGPS+ ELYESGG+L+T +GKVM+ AG+ VGGGSAINWSA
Sbjct  179   LKVLVLEKGNYFVAEDYSSLEGPSMAELYESGGILSTLNGKVMILAGSTVGGGSAINWSA  238

Query  1443  SIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENL  1264
              I+TP+ VL EWSL+ KI  +GSS+YQ AMDAV KRIGVT+ C  E  QNQVLRKGCENL
Sbjct  239   CIRTPDYVLREWSLDHKIRFYGSSDYQYAMDAVSKRIGVTDNCLNESFQNQVLRKGCENL  298

Query  1263  GLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEE  1084
             GLKVESV RN S  HYCGSC +GCRTGDKKG D+T+LVDAV+  A I+TGC+AEK ILE+
Sbjct  299   GLKVESVARNSSADHYCGSCNFGCRTGDKKGTDSTWLVDAVSCNATIITGCKAEKLILED  358

Query  1083  DETA--RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNL  916
             D T   +KKCLGVIA++   N  K L+IEARATVSACGSL TPPL+ISSGL N NIGSNL
Sbjct  359   DTTGNRKKKCLGVIARAANTNITKKLQIEARATVSACGSLLTPPLMISSGLLNPNIGSNL  418

Query  915   HLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVS  736
             HLHPV+ AWGYFPE  ++ +GK+++GGIITS+H+V+SE +K  AII+  +LGP+ +AA+S
Sbjct  419   HLHPVVVAWGYFPEHESDFKGKSYEGGIITSMHRVISEESKVRAIIQTPALGPSSYAALS  478

Query  735   PWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALR  556
             PW SG D K++M KY RT  +F+++RD GSG+VK  GRI++  +Q DK+N++ GLRQALR
Sbjct  479   PWVSGQDFKDKMVKYPRTAGLFALIRDQGSGEVKAEGRIKHWQNQFDKENLKIGLRQALR  538

Query  555   ILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMG  376
             ILV AGA EVGT+RSDGQKI CKGI+ ++LE FLD  V   G  S EE+WTL  SAHQMG
Sbjct  539   ILVGAGAVEVGTYRSDGQKIACKGIQDKDLEDFLD-TVTVSGLTSKEEHWTLLFSAHQMG  597

Query  375   SCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             SCRMGATE++GA+D NGE WEAK L+VCDGSVLP+AIGVNPMITI STAYCIS  + +SL
Sbjct  598   SCRMGATEKEGAVDENGESWEAKDLFVCDGSVLPTAIGVNPMITIQSTAYCISRKIVESL  657



>ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Fragaria vesca 
subsp. vesca]
Length=765

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/757 (59%), Positives = 565/757 (75%), Gaps = 24/757 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS------YNHGLSSSQYQALAAICEALIPPIPL-----------PQD  2242
             ++CHPLLRGG +        Y H LSS + +ALA++CEAL+PP+P             + 
Sbjct  3     KECHPLLRGGSKGGGEDGKVYRHRLSSGEMEALASVCEALLPPLPFGDPASYYEGKNEEL  62

Query  2241  SDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVC  2062
             S  +A+ SFY +S +Q   PDEVA+++++R   +A+ + R+VL ILSTRLGSLLLCG +C
Sbjct  63    SGTKAVQSFYQASGAQSGIPDEVADLLVKRAFTEAIILVRVVLWILSTRLGSLLLCGSLC  122

Query  2061  FDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNN  1882
                +WPFIH FS LPL++RE +L  W R   + P+R+ F+ IKI C F +FS  DEN  N
Sbjct  123   LGDKWPFIHKFSCLPLEKRERVLQWWFRHWFLTPIRLAFLYIKILCVFTFFSRVDENAEN  182

Query  1881  PAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTL  1702
             PAW+AIG+ V+    P      R L KGIIET+ +  T+L +SL  KGL VT     N  
Sbjct  183   PAWKAIGYEVEPAANPEKVPEERSLHKGIIETMYQTDTSLLDSLADKGLKVTHDSKNNLY  242

Query  1701  TIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGM  1522
              I+CDVVIVGSGCGGGVAAAVLA+SG KV+VLEKG+YF + DYS LEGPS  +LYESGG+
Sbjct  243   KIKCDVVIVGSGCGGGVAAAVLASSGQKVIVLEKGNYFTASDYSSLEGPSQDQLYESGGI  302

Query  1521  LTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVC  1342
             L T DGKVM+ AG+ VGGGSA+NWSA I+ P+++L EW+ +QKI  FG SEY SAM+AV 
Sbjct  303   LATFDGKVMLQAGSTVGGGSAVNWSACIRPPDSLLQEWAKDQKIAFFGGSEYVSAMNAVW  362

Query  1341  KRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDT  1162
             +RIGVTE C +EG QNQVLRKGCE LGL V   PRN SEKHYCGSCGYGC+ G+KKG DT
Sbjct  363   ERIGVTESCVEEGFQNQVLRKGCETLGLDVHFTPRNSSEKHYCGSCGYGCKKGEKKGTDT  422

Query  1161  TYLVDAVNNGAVILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARA  1000
             T+LVDAV++GAVIL+GC+AE+F+L +   +    +KKCLGV+AKS  NN  K L+IEA+ 
Sbjct  423   TWLVDAVDHGAVILSGCKAERFVLAKSYKSGSMRKKKCLGVVAKSLSNNITKRLQIEAKV  482

Query  999   TVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM-AEMEGKNHQGGIITS  823
             T+SACG+L TPPL+ISSGLKN++IG NLHLHPVL AWGYFP+S+ +E +GK+++GGIITS
Sbjct  483   TISACGALLTPPLMISSGLKNRHIGRNLHLHPVLMAWGYFPDSINSEFKGKSYKGGIITS  542

Query  822   IHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSG  643
             +H+VVSE +K  AIIE  +LGP  FAA+ PW SGLDMK+RM ++SRT ++ +++RD GSG
Sbjct  543   VHEVVSEDSKPRAIIETPALGPGSFAALCPWESGLDMKKRMLRFSRTAHLITIIRDKGSG  602

Query  642   QVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELE  463
              ++  GR  Y +D  DK+N++ G+RQALRIL+AAGA EVGT RSDG ++ C+GI  E LE
Sbjct  603   VIRTEGRASYELDVSDKENMKAGMRQALRILIAAGAVEVGTHRSDGLRLKCEGIDKEGLE  662

Query  462   SFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGS  283
              FLD V A  GP S  E WT Y SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCDGS
Sbjct  663   EFLDKVSAEEGPQSLVEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGS  722

Query  282   VLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA*NL  172
             VLPSA+GVNPMITI STAY +S  LA+SL + K+ N+
Sbjct  723   VLPSAVGVNPMITIESTAYYLSKRLAESLRNQKSSNV  759



>emb|CDO99261.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/746 (60%), Positives = 557/746 (75%), Gaps = 14/746 (2%)
 Frame = -3

Query  2379  MNERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSD--------DEA  2227
             M   +CHP LRGGRR + Y+HG SSS+ +AL  ICEA IPP+PL    D         EA
Sbjct  1     MENDQCHPSLRGGRRETKYSHGFSSSELEALTGICEAFIPPLPLNNSPDIVGKDGKTKEA  60

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRW  2047
             + SFY SS +Q P PDEVAE+ ++R   +AV + RL+LIILSTRLG+LLLCG +CF  +W
Sbjct  61    IQSFYKSSGAQYPIPDEVAELAVKRGFLEAVILVRLLLIILSTRLGTLLLCGTLCFGEKW  120

Query  2046  PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             P+I+ FS++P++ RE ++ KW +   + P+R+ F+ IK  C + +F+   ++  NPAWEA
Sbjct  121   PYINKFSDIPVENREKVIQKWFKHRFLTPIRLPFVFIKFLCLYAFFTQVWDDLKNPAWEA  180

Query  1866  IGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
             + + VD  +        +PL KG++ET +E  +T+  SL++KGL V E        I+CD
Sbjct  181   MDYQVDNRKDSSTTPHEKPLMKGMVETTHETESTIVSSLVQKGLRVKEVPKEKLYKIKCD  240

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
             VVIVGSGCGGGVAAAVLA SG KVVV+EKG+YF   DYS LEGPS+ ELYESGG+L T D
Sbjct  241   VVIVGSGCGGGVAAAVLAKSGQKVVVIEKGNYFTKTDYSSLEGPSMNELYESGGILATLD  300

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
             GK+M+ AG+ VGGGSA+NWSA IKTP +VL EW+ + +IPLF SS+Y SAMD V +RIGV
Sbjct  301   GKMMLLAGSTVGGGSAVNWSACIKTPMSVLQEWANDCQIPLFTSSQYISAMDTVSQRIGV  360

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             TE CS+EG QNQ+LR+GCE LGL+VESVPRN SE HYCGSC YGCRTGDKKG D+T+LVD
Sbjct  361   TEKCSEEGFQNQILRRGCEKLGLEVESVPRNSSENHYCGSCNYGCRTGDKKGTDSTWLVD  420

Query  1146  AVNNGAVILTGCQAEKFILEEDETARK---KCLGVIAKSKGNN--KILRIEARATVSACG  982
             AV  GAVI+TGC+ EKF+LE+++  R    KCLGVIAK    +    L IEA+ T+SACG
Sbjct  421   AVACGAVIITGCKTEKFVLEKNKYGRSRKSKCLGVIAKCLNGDIRNRLCIEAKVTISACG  480

Query  981   SLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSE  802
             SL TPPL+ISSGL N++IG NLHLHPVL AWGYFPES +E++GK ++GGIITS+HKV S+
Sbjct  481   SLLTPPLMISSGLTNQHIGRNLHLHPVLMAWGYFPESDSELKGKIYEGGIITSVHKVGSD  540

Query  801   GTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGR  622
              +   A+IE+ +LGPA FAA+ PW SGL+ K+RM KY+RT ++FSM+RD GSG+V+  GR
Sbjct  541   DSSVRALIESPALGPASFAALRPWESGLESKKRMLKYARTAHLFSMIRDRGSGEVRSEGR  600

Query  621   IQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVV  442
             I +  D  DK+N+  GLRQALRILVAAGA EVGT +SDGQK  CKG    ELE FLD V 
Sbjct  601   ISHTFDATDKENLTAGLRQALRILVAAGAVEVGTLQSDGQKFKCKGTSEGELEEFLDEVT  660

Query  441   ATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIG  262
             A GGP S  +NWT Y SAHQMGSCRMG +E+ GA+D NGE WEA+GL+VCD SVLP A+G
Sbjct  661   AAGGPKSLVQNWTTYFSAHQMGSCRMGKSEKVGAVDENGESWEAEGLFVCDASVLPGAVG  720

Query  261   VNPMITILSTAYCISNGLAKSLNSGK  184
             VNPMITI STAYC+SN +A+ L   K
Sbjct  721   VNPMITIQSTAYCLSNKIAEILKERK  746



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/748 (57%), Positives = 538/748 (72%), Gaps = 16/748 (2%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFY  2212
             E+     + HPLLR  +R + YNHG S SQ Q+LA IC+ L+PP      ++ +A+ SF 
Sbjct  2     EEDRRRNRGHPLLRSMKREDGYNHGFSPSQIQSLAVICQTLLPP---ETTAEQQALNSFN  58

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +S++QPPF +EVAE++++    +AV + +++LIILS R G+LLLCG +C D  WPF+  
Sbjct  59    VASSTQPPFTEEVAEMIVKNGRSEAVKVLKIILIILSFRFGTLLLCGSLCLDKSWPFVLK  118

Query  2031  FSELPLKRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
             FS+LPL +RE IL KWSR++  +LP RI F   K    F +FS TDEN  NPA E IG+ 
Sbjct  119   FSQLPLDKREEILRKWSRQSGFLLPFRITFFLAKFYTLFYFFSQTDENLKNPALETIGYC  178

Query  1854  VDTNEVPPDQQTG-----RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRC  1690
             +D  E   ++++      RPLE GIIET +E+  T+ +SLI KG++V      N   IRC
Sbjct  179   LDGIETSSNKKSEADKRRRPLETGIIETTHESDVTITQSLIGKGVHVARDDGDNVHRIRC  238

Query  1689  DvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTT  1510
             D V+VGSG GGGVAAA LA +G KV+VLEKG+YF  +DYSGLEGPS+ ELYE  G+LTT 
Sbjct  239   DAVVVGSGSGGGVAAANLAKAGFKVLVLEKGNYFAPQDYSGLEGPSMLELYEKSGLLTTV  298

Query  1509  DGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIG  1330
             DGK M+ AG+ VGGG+A+NWSASI+TP++VL EWS   KI  FGS EYQSAMD V  RIG
Sbjct  299   DGKFMLLAGSTVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVMTRIG  358

Query  1329  VTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLV  1150
             VTE C K+G QNQVLRKGCE LGL+VESVPRN  E HYCG CGYGCR G K G D T+LV
Sbjct  359   VTERCVKDGFQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDRTWLV  418

Query  1149  DAVNNGAVILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVSA  988
             DAV NGAVILTG +AE+F+L ++ ++    +K+C+GVIA S G    K   IEAR T S+
Sbjct  419   DAVENGAVILTGIKAERFVLVDNTSSSNERKKRCVGVIASSVGGKIGKKFIIEARMTASS  478

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
              GSL TPPL++SSGLKN NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H + 
Sbjct  479   AGSLLTPPLMLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMN  538

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
                +   AI+E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V K 
Sbjct  539   DAESGCRAILENPLIGPASYAGLSPWVSGADLKERMIKYGRTAHVFALVRDIGSGEVMKE  598

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
               + YR  + D++N+R GLRQALR+ VAAGA EVGT+RSDGQ++ C+GI  E +E FLD 
Sbjct  599   SEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQRMKCEGITKEAMEEFLDE  658

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             V A GG  +  E WT Y SAHQMGSCRMGAT E+GA+D  GE WEA+GL+VCDGSVLPSA
Sbjct  659   VDAVGGVSTKGEYWTTYFSAHQMGSCRMGATAEEGALDEIGESWEAEGLFVCDGSVLPSA  718

Query  267   IGVNPMITILSTAYCISNGLAKSLNSGK  184
             +GVNPMITI STAYCIS+ +  SL S +
Sbjct  719   VGVNPMITIQSTAYCISSKIVDSLQSKR  746



>ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
Length=747

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/742 (59%), Positives = 550/742 (74%), Gaps = 15/742 (2%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPLPQDSDDE----AMCSFYS  2209
             + CHPLLRG    +  Y HG SS++  +LA++C  + PPI   Q  + E    A+  F+ 
Sbjct  3     KDCHPLLRGKTEETKKYRHGFSSAEMDSLASLCHTIWPPISAAQHHNQEPANPAVQEFFK  62

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNF  2029
             +S SQ P PDEVAE++  R L +AV + RLVL++LSTRLG+LLL G +CF  +WPFI+ F
Sbjct  63    ASGSQYPLPDEVAELIAMRGLIEAVMVVRLVLLLLSTRLGTLLLSGSLCFGEKWPFINKF  122

Query  2028  SELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVD  1849
             S +P+++RE +L KW R   + P+R+ F  +K  C  ++F+  DEN NNPAWEAIG+ V 
Sbjct  123   SSIPVEKREKVLQKWLRHRFLTPIRLAFFYVKAICLHVFFTQIDENGNNPAWEAIGYKVQ  182

Query  1848  TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgs  1669
               E        RPLEKGI+ET++E+ +T   S+ +KGL V      N   I+CDVVIVGS
Sbjct  183   NEENATQVPKERPLEKGIVETMHESDSTFLNSIAQKGLKVAHVPGHNLCKIKCDVVIVGS  242

Query  1668  gcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVF  1489
             GCGGGVAAAVLA SG KV+VLEKG+YF ++D+SGLEGPS   LYE+GG++ + D K ++ 
Sbjct  243   GCGGGVAAAVLAASGQKVLVLEKGNYFTAKDFSGLEGPSYNHLYEAGGLMPSADAKFIIL  302

Query  1488  AGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSK  1309
             AG++VGGGSA+NWSA I TPN VL EW+   KI LFGS EY SAMD VCKRIGVTE C +
Sbjct  303   AGSVVGGGSAVNWSACINTPNYVLKEWAENHKIQLFGSPEYLSAMDIVCKRIGVTENCVE  362

Query  1308  EGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGA  1129
             EG QNQV+RKGCENLGL++ +VPRN SEKHYCGSCGYGC+TGDKKG D+T+LVDAVNNGA
Sbjct  363   EGFQNQVIRKGCENLGLEINTVPRNSSEKHYCGSCGYGCQTGDKKGTDSTWLVDAVNNGA  422

Query  1128  VILTGCQAEKFILEEDETA------RKKCLGVIAKSKGNNKI---LRIEARATVSACGSL  976
             VILTGC+AE+FILEE+         +KKCLGVIAK   N+ I   L+IEAR T+SACG+L
Sbjct  423   VILTGCKAERFILEENNKKSGGSQRKKKCLGVIAKILKNDNIWMRLQIEARVTISACGAL  482

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TPPL+ISSGL N NIG NLHLHPVL  WGYFP+S    +GK+ +GGIITS+HKV SE +
Sbjct  483   STPPLMISSGLNNPNIGRNLHLHPVLMTWGYFPDSNTVFKGKSFEGGIITSVHKVASEDS  542

Query  795   KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQ  616
                AIIE   LGPA FAA+ PW S LD KER+ KYSRT N+ +++RD GSG+VK  GRI 
Sbjct  543   NVRAIIETPQLGPASFAALCPWESALDFKERLLKYSRTANLITIIRDRGSGEVKSEGRIA  602

Query  615   YRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVAT  436
             Y  D +D +N++ GLRQ+LRILVAAGA EVGT RSDGQ++ C+GI  ++LE FLD V   
Sbjct  603   YNFDALDIENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLKCQGITKKQLEEFLDTVSPP  662

Query  435   GGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVN  256
              GP+S  ++W  Y SAHQ+GSCRMG +E++GA+D NGE WEA+GL+VCD SVLPSAIGVN
Sbjct  663   RGPLSPGKDWVAYTSAHQLGSCRMGISEKEGAVDENGESWEAEGLFVCDASVLPSAIGVN  722

Query  255   PMITILSTAYCISNGLAKSLNS  190
             PMITI STAYC+S  ++K L +
Sbjct  723   PMITIQSTAYCLSERISKYLRT  744



>emb|CDY51703.1| BnaA03g58930D [Brassica napus]
Length=737

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/732 (59%), Positives = 533/732 (73%), Gaps = 11/732 (2%)
 Frame = -3

Query  2361  HPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS-DDEAMCSFYSSSASQPPF  2185
             HPL  G     Y+HG S SQ Q L+ IC+ L+PP P P+ + + EA+ SF  +S SQPPF
Sbjct  10    HPLEGG-----YSHGFSISQIQTLSFICQTLLPPPPPPESTAEQEAVDSFNVASGSQPPF  64

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
              DEVAE++++    +AV + R++L ILS R G+L LCG +C    WPF+  FS+LPL +R
Sbjct  65    TDEVAEMIVKNGRSEAVKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVLKFSDLPLDKR  124

Query  2004  EAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPD  1828
             E IL  WSR++ L LPLRI F   K    F +FS  D+N  NPA EAIG+ +DT E+  D
Sbjct  125   EEILRMWSRQSGLFLPLRITFFLAKFYTLFSFFSQRDQNMKNPALEAIGYSIDTTEMSKD  184

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggva  1648
              +  RPLEKGIIET NE+  T+++SL +KG++V    N N   IRCDVVIVGSG GGGVA
Sbjct  185   DEAPRPLEKGIIETKNESDVTIRQSLTQKGVHVARDDNDNIHRIRCDVVIVGSGSGGGVA  244

Query  1647  aavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGG  1468
             AA LA +G KV+VLEKG+YF S DYSGLEGPS+ ELYE G ++TT DGK MV AG+ VGG
Sbjct  245   AANLAKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGG  304

Query  1467  GSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQV  1288
             G+A+NWSASI+TP++VL EWS E KI  FGS EYQ AMD V +R+GVTE C KEGLQNQV
Sbjct  305   GTAVNWSASIRTPDHVLKEWSEESKIEFFGSQEYQLAMDEVVRRLGVTERCVKEGLQNQV  364

Query  1287  LRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQ  1108
             LR+GCE LGL+V SVPRN  E HYCGSCGYGCR G K G D T+LVDAV NGAVI+TG +
Sbjct  365   LREGCERLGLEVVSVPRNSPEDHYCGSCGYGCREGGKNGTDKTWLVDAVENGAVIMTGVK  424

Query  1107  AEKFILEEDETARKK--CLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLK  940
             AE+F+  ++E  +KK  C+GVIA S G    K   IEAR TVS+ GSL TPPL+ +SGL+
Sbjct  425   AERFVFTDNEGKKKKKRCVGVIASSVGGKIEKKFMIEARVTVSSAGSLLTPPLMRTSGLE  484

Query  939   NKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLG  760
             N+NIG NL LHPVL  WGYFPE  +E  GK ++GGII+S+H V    +   AI+E    G
Sbjct  485   NRNIGRNLKLHPVLMTWGYFPEKGSEFSGKMYEGGIISSVHHVHDGESGCRAILETPLAG  544

Query  759   PAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIR  580
             PA +A +SPW SG D+K+RM KY RT ++F++VRD+GSG+V K   + YR  + D++N+R
Sbjct  545   PASYAGLSPWVSGADLKDRMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDRENLR  604

Query  579   TGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTL  400
              GLRQALR+LVAAGA EVGT+RSDGQ+I C+GI  E +E FLDGV A GG  +  E WT 
Sbjct  605   VGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGITREAMEEFLDGVDAVGGVSTKGEYWTT  664

Query  399   YCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCI  220
             Y SAHQM SCRMG T E+GA+D  GE WEA+GL+VCDGSVLP+A+GVNPMITI STAYCI
Sbjct  665   YFSAHQMCSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPTAVGVNPMITIQSTAYCI  724

Query  219   SNGLAKSLNSGK  184
             S  +  SL  GK
Sbjct  725   STRIVASLTEGK  736



>gb|AAM63097.1| unknown [Arabidopsis thaliana]
Length=748

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/737 (58%), Positives = 533/737 (72%), Gaps = 16/737 (2%)
 Frame = -3

Query  2361  HPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPF  2185
             HPLLR  +R   YNHG S SQ Q+LA IC+  +PP      S+ +A+ SF+ +S++QPPF
Sbjct  11    HPLLRSKKRGEGYNHGFSPSQIQSLAVICQTFLPP---ETTSEQQAVNSFHVASSTQPPF  67

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
              DEVAE++++    +AV + R++L+ILS R G+LLLCG +C D  WPF+  FS+LPL +R
Sbjct  68    TDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKR  127

Query  2004  EAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPD  1828
             EAIL  WSR++  +LP RI F   K    F +FS TDEN  NPA EAIG+ +D  E   +
Sbjct  128   EAILRNWSRQSGFLLPFRITFFLAKFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSN  187

Query  1827  QQTG-----RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgc  1663
             +++      RPLEKGIIET++E+  T+ +SL +KG++V      N   IRCD V+VGSG 
Sbjct  188   KKSEADEKRRPLEKGIIETMHESDLTITQSLTEKGVHVARDDGDNVYRIRCDAVVVGSGS  247

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGVAAA LA +G KV+VLEKG+YF + DYSGLE PS+ ELYE GG+LTT DGK M+ AG
Sbjct  248   GGGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAG  307

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGG+A+NWSASI+TP++VL EWS   KI  FGS EYQSAMD V  RIGVTE C K G
Sbjct  308   SAVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHG  367

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
              QNQVLRKGCE LGL+VESVPRN  E HYCG CGYGCR G K G D T+LVDAV NGAVI
Sbjct  368   FQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDQTWLVDAVENGAVI  427

Query  1122  LTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPL  961
             LTG +AE+F+L ++ ++    +K+C+GV A S G    K   IEAR TVS+ GSL TPPL
Sbjct  428   LTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPL  487

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             ++SSGLKN NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H +    +   AI
Sbjct  488   MLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDTESGCKAI  547

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             +E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V     + YR  +
Sbjct  548   LENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENEVTYRTTK  607

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              D++N+R GLRQALR+ VAAGA EVGT+RSDGQK+ C+ I  E +E FLD V A GG  +
Sbjct  608   KDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCEAITKEAMEEFLDEVDAVGGVGT  667

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
               E WT Y SAHQMGSCRMG T E+GA+D NGE WEA+GL+VCDGS+LPSA+GVNPMITI
Sbjct  668   KGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMITI  727

Query  240   LSTAYCISNGLAKSLNS  190
              STAYCIS+ +  SL +
Sbjct  728   QSTAYCISSKIVDSLQN  744



>ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
 sp|Q94BP3.2|FAO4B_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4B; AltName: Full=Long-chain 
fatty alcohol oxidase 4B [Arabidopsis thaliana]
 emb|CAB81445.1| putative protein [Arabidopsis thaliana]
 emb|CAC87644.1| alcohol oxidase [Arabidopsis thaliana]
 gb|AAN71941.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85508.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
Length=748

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/737 (58%), Positives = 533/737 (72%), Gaps = 16/737 (2%)
 Frame = -3

Query  2361  HPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPF  2185
             HPLLR  +R   YNHG S SQ Q+LA IC+  +PP      S+ +A+ SF+ +S++QPPF
Sbjct  11    HPLLRSKKRGEGYNHGFSPSQIQSLAVICQTFLPP---ETTSEQQAVNSFHVASSTQPPF  67

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
              DEVAE++++    +AV + R++L+ILS R G+LLLCG +C D  WPF+  FS+LPL +R
Sbjct  68    TDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKR  127

Query  2004  EAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPD  1828
             EAIL  WSR++  +LP RI F   K    F +FS TDEN  NPA EAIG+ +D  E   +
Sbjct  128   EAILRNWSRQSGFLLPFRITFFLAKFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSN  187

Query  1827  QQTG-----RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgc  1663
             +++      RPLEKGIIET++E+  T+ +SL +KG++V      N   IRCD V+VGSG 
Sbjct  188   KKSEADEKRRPLEKGIIETMHESDVTITQSLTEKGVHVARDDGDNVYRIRCDAVVVGSGS  247

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGVAAA LA +G KV+VLEKG+YF + DYSGLE PS+ ELYE GG+LTT DGK M+ AG
Sbjct  248   GGGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAG  307

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGG+A+NWSASI+TP++VL EWS   KI  FGS EYQSAMD V  RIGVTE C K G
Sbjct  308   SAVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHG  367

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
              QNQVLRKGCE LGL+VESVPRN  E HYCG CGYGCR G K G D T+LVDAV NGAVI
Sbjct  368   FQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDQTWLVDAVENGAVI  427

Query  1122  LTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPL  961
             LTG +AE+F+L ++ ++    +K+C+GV A S G    K   IEAR TVS+ GSL TPPL
Sbjct  428   LTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPL  487

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             ++SSGLKN NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H +    +   AI
Sbjct  488   MLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDTESGCKAI  547

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             +E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V     + YR  +
Sbjct  548   LENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENEVTYRTTK  607

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              D++N+R GLRQALR+ VAAGA EVGT+RSDGQK+ C+ I  E +E FLD V A GG  +
Sbjct  608   KDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCEAITKEAMEEFLDEVDAVGGVGT  667

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
               E WT Y SAHQMGSCRMG T E+GA+D NGE WEA+GL+VCDGS+LPSA+GVNPMITI
Sbjct  668   KGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMITI  727

Query  240   LSTAYCISNGLAKSLNS  190
              STAYCIS+ +  SL +
Sbjct  728   QSTAYCISSKIVDSLQN  744



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/746 (57%), Positives = 554/746 (74%), Gaps = 23/746 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGR-RNSYNHGLSSSQYQALAAICEALIPPIPLP-----------QDSDDEA  2227
             ++CHPLLRGGR  N Y HG S+++ ++L +ICE ++PP+P+             DS +++
Sbjct  3     KECHPLLRGGRGDNKYKHGFSTAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKS  62

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRW  2047
             + SF   SAS+ P P EVAE++ +R L + V + R+VL +L+TRLG+LLLCGF+C    W
Sbjct  63    LQSFLDISASRYPIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENW  122

Query  2046  PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             P+I+ FS + L++RE I+ KW +   + P+R+ F  IK+ C F++FSW DEN +NPAW+A
Sbjct  123   PYINKFSNISLEKREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKA  182

Query  1866  IGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
             IG+ V  +E   +    RPLEKGIIET+NE+ +TL++SL  KGLNVT    +N L ++CD
Sbjct  183   IGYEVPADEKMTNTSNTRPLEKGIIETMNESDSTLQQSLANKGLNVTLDSKSNILKVKCD  242

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
              ++VGSGCGGGVAAAVL+++GHKVVVLEKG+YF  +DYS LEGPS+ +LYE+GG+L + D
Sbjct  243   ALVVGSGCGGGVAAAVLSSAGHKVVVLEKGNYFTPQDYSSLEGPSMNQLYETGGILASVD  302

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
              +V+V AG+ VGGGSA+NWSA IKTP+ VL EWS   K+P F S EY SAM+ VC+RIGV
Sbjct  303   SRVLVLAGSTVGGGSAVNWSACIKTPHKVLKEWSESHKLPFFSSQEYLSAMENVCERIGV  362

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             TE CS+EG QNQVLRKGC+NLGLKV+ VPRN S  HYC SCGYGC  G+K+G   T+L D
Sbjct  363   TENCSQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYC-SCGYGCPKGEKQGTQDTWLAD  421

Query  1146  AVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKI---LRIEARATVSAC  985
             AV   AVI+TGC+AE+F+LE + +    +KKCLGV AK+  N++I   L+IEA+ T+SA 
Sbjct  422   AVERDAVIITGCKAERFLLESNRSGNGRKKKCLGVTAKTL-NSRITMKLQIEAKVTISAG  480

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM-AEMEGKNHQGGIITSIHKVV  808
             G+L TPPLLISSGLKNKNIG NLHLHPVL  WGYFPES  +E +GK ++GGIITS+HKV 
Sbjct  481   GALLTPPLLISSGLKNKNIGKNLHLHPVLMTWGYFPESNDSEFKGKVYEGGIITSVHKVP  540

Query  807   S--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK  634
             S    +   AIIE   LGPA FAA+ PW SG D KERM  Y RT ++ +++RD   GQV 
Sbjct  541   SPDSNSDSRAIIETPLLGPASFAALCPWESGQDFKERMLNYPRTSHLITIIRDMACGQVT  600

Query  633   KAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL  454
               GRI Y+++++DK+N++ GL+QALRIL+AAGA EVGT RSDGQ++ C GI   E++ FL
Sbjct  601   TEGRISYKLNEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFL  660

Query  453   DGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLP  274
             D V    G +S  E W +Y SAHQMGSCRMG +E++GA+D NGE WEA+GL+VCD SVLP
Sbjct  661   DSVCPMEGALSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDASVLP  720

Query  273   SAIGVNPMITILSTAYCISNGLAKSL  196
             SA+GVNPMIT+ STAYCISN +   L
Sbjct  721   SAVGVNPMITVQSTAYCISNRIVDYL  746



>gb|AAK64154.1| unknown protein [Arabidopsis thaliana]
Length=748

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/737 (58%), Positives = 533/737 (72%), Gaps = 16/737 (2%)
 Frame = -3

Query  2361  HPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPF  2185
             HPLLR  +R   YNHG S SQ Q+LA IC+  +PP      S+ +A+ SF+ +S++QPPF
Sbjct  11    HPLLRSKKRGEGYNHGFSPSQIQSLAVICQTFLPP---ETTSEQQAVNSFHVASSTQPPF  67

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
              DEVAE++++    +AV + R++L+ILS R G+LLLCG +C D  WPF+  FS+LPL +R
Sbjct  68    TDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLRFSQLPLDKR  127

Query  2004  EAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPD  1828
             EAIL  WSR++  +LP RI F   K    F +FS TDEN  NPA EAIG+ +D  E   +
Sbjct  128   EAILRNWSRQSGFLLPFRITFFLAKFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSN  187

Query  1827  QQTG-----RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgc  1663
             +++      RPLEKGIIET++E+  T+ +SL +KG++V      N   IRCD V+VGSG 
Sbjct  188   KKSEADEKRRPLEKGIIETMHESDVTITQSLTEKGVHVARDDGDNVYRIRCDAVVVGSGS  247

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGVAAA LA +G KV+VLEKG+YF + DYSGLE PS+ ELYE GG+LTT DGK M+ AG
Sbjct  248   GGGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAG  307

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGG+A+NWSASI+TP++VL EWS   KI  FGS EYQSAMD V  RIGVTE C K G
Sbjct  308   SAVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHG  367

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVI  1123
              QNQVLRKGCE LGL+VESVPRN  E HYCG CGYGCR G K G D T+LVDAV NGAVI
Sbjct  368   FQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDQTWLVDAVENGAVI  427

Query  1122  LTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPL  961
             LTG +AE+F+L ++ ++    +K+C+GV A S G    K   IEAR TVS+ GSL TPPL
Sbjct  428   LTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPL  487

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAI  781
             ++SSGLKN NIG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H +    +   AI
Sbjct  488   MLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDTESGCKAI  547

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             +E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V     + YR  +
Sbjct  548   LENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENEVTYRTTK  607

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              D++N+R GLRQALR+ VAAGA EVGT+RSDGQK+ C+ I  E +E FLD V A GG  +
Sbjct  608   KDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCEAITKEAMEEFLDEVDAVGGVGT  667

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
               E WT Y SAHQMGSCRMG T E+GA+D NGE WEA+GL+VCDGS+LPSA+GVNPMITI
Sbjct  668   KGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMITI  727

Query  240   LSTAYCISNGLAKSLNS  190
              STAYCIS+ +  SL +
Sbjct  728   QSTAYCISSKIVDSLQN  744



>ref|XP_010102592.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
 gb|EXB93709.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
Length=742

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/743 (59%), Positives = 548/743 (74%), Gaps = 26/743 (3%)
 Frame = -3

Query  2370  RKCHPLLR------GGRRNS--YNHGLSSSQYQALAAICEALIPPIPL-----PQDSDDE  2230
             R+CHPLLR      GG R    ++HG S+++ ++LA+ICEA IPP+PL      +D   +
Sbjct  3     RECHPLLRERRIGLGGERKQEKWSHGFSAAEMESLASICEAFIPPLPLNSLEGKEDPPSK  62

Query  2229  AMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR  2050
             A+ SFYSSSASQ P P EVAE ++RR + +   I +L+L++LSTRLG+LLLCG +CF  +
Sbjct  63    AVQSFYSSSASQNPIPHEVAEFIVRRAIIEGFLIVKLLLLLLSTRLGTLLLCGPLCFCEK  122

Query  2049  WPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWE  1870
             W FIHNFS +PL++RE +L KW R   + P+R+ F+ IK+ C   +FS  DEN  N  +E
Sbjct  123   WTFIHNFSRMPLEKREKVLQKWLRHKFLTPIRLAFLYIKVVCLHTFFSRLDENGENQTYE  182

Query  1869  AIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRC  1690
             AIG+++ + E+ P     RPLEKGIIETI +  +TL  SL  KGLNVTE    N   I+C
Sbjct  183   AIGYNIKSEEILPKTPKERPLEKGIIETIYKTDSTLLHSLHLKGLNVTEDTEQNLYKIKC  242

Query  1689  DvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTT  1510
             DVVIVGSGCGGGVA       G          Y   E  S  +     +LYE+GG   + 
Sbjct  243   DVVIVGSGCGGGVAGGPPQAKG--------SLYLRRETISLPQITPPQKLYENGGTFASL  294

Query  1509  DGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIG  1330
              GK+ + AGT VGGGS +NWSASI+TP +VLNEW+ E +I LFGSSEY SAMD V +R+G
Sbjct  295   CGKMAIMAGTAVGGGSVVNWSASIRTPKSVLNEWAEENRISLFGSSEYDSAMDIVFERLG  354

Query  1329  VTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLV  1150
             VTE C +EG QNQVLRKGCENLGL+V+ VPRN SE HYCGSCG+GCR+GDKKG D T+LV
Sbjct  355   VTEKCQEEGFQNQVLRKGCENLGLEVDFVPRNSSENHYCGSCGFGCRSGDKKGTDLTWLV  414

Query  1149  DAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGN--NKILRIEARATVSAC  985
             DAV NGAVIL+GC+AE+F+LE++      +KKCLGVIAKS GN   + L+IEA+ T+SAC
Sbjct  415   DAVENGAVILSGCKAERFVLEKNSNGAKRKKKCLGVIAKSGGNGVQRRLQIEAKVTISAC  474

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS  805
             G+L+TPPL+ISSGLKNKNIG NLHLHPVL +WGYFPES ++ +GK ++GGIITS+HKVVS
Sbjct  475   GALYTPPLMISSGLKNKNIGRNLHLHPVLMSWGYFPESNSDFKGKCYEGGIITSVHKVVS  534

Query  804   EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
             E ++  AIIE  +LGPA +AA+ PWTSGLDMK RM KYSRT ++ +++RD GSG+VKK G
Sbjct  535   EDSRVMAIIETPALGPASYAALVPWTSGLDMKNRMMKYSRTAHLITIIRDRGSGEVKKEG  594

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
             R+ + +D  DK+N+  GLRQALRILVAAGA EVGT RSDGQ+I CKGI   EL+ FLD V
Sbjct  595   RVSFELDDTDKENMTAGLRQALRILVAAGAVEVGTHRSDGQRIKCKGINKNELDEFLDSV  654

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
              A GG M   E WT Y SAHQ+GSCRMG  E++GA+D NGE WEA+GL+VCD SVLPSA+
Sbjct  655   YAVGGAMEMSECWTNYGSAHQLGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPSAV  714

Query  264   GVNPMITILSTAYCISNGLAKSL  196
             GVNPMITI STAYC+S  +A+SL
Sbjct  715   GVNPMITIQSTAYCLSKKIAESL  737



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/756 (56%), Positives = 553/756 (73%), Gaps = 22/756 (3%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQ--DSDDEA---  2227
             E+KM  R+CHPLL G R NS Y HG S ++ ++L +ICE ++P +P+      DDE+   
Sbjct  7     ERKM-RRECHPLLSGVRENSKYKHGFSVAEMESLTSICEVVLPSLPMDDALTKDDESSKD  65

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRW  2047
             + SF++ SAS  P PDEVAE++++  + +AV + R++L +L+TRLG+LL+CG +C   +W
Sbjct  66    VQSFFNISASMYPIPDEVAEMLVKSGVTEAVILIRVILWLLATRLGTLLICGLLCLSKKW  125

Query  2046  PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             PFI+NFS L L +RE I+ +  +   + P R+ F  IK+ C F++FSW DEN +NPAW+A
Sbjct  126   PFINNFSSLSLDKREKIVQRALKLRFLTPFRLAFAYIKVLCLFVFFSWVDENGDNPAWKA  185

Query  1866  IGFHVDT-NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRC  1690
             IG+ V T +E   +    RPLEKGIIE ++E+ TTL++SL  KGLNVT     N L I+C
Sbjct  186   IGYEVSTADEKMTNDTKKRPLEKGIIEIMHEHDTTLQQSLSNKGLNVTLDSKNNILKIKC  245

Query  1689  DvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTT  1510
             D V+VGSGCGGGVAA+VL+ +G+KVVVLEKG+YFV +DYS LEGPS+ + YE GGML + 
Sbjct  246   DAVVVGSGCGGGVAASVLSKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYEKGGMLASV  305

Query  1509  DGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIG  1330
             D ++++FAG+ VGGGSA+NWSA I+TP NVL EWS E K+PLF + EY SAM+ VC+RIG
Sbjct  306   DSRIVLFAGSTVGGGSAVNWSACIRTPQNVLKEWSDEHKLPLFETLEYLSAMETVCERIG  365

Query  1329  VTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLV  1150
             V E C++EG QNQVLRKGC+NLGLKV+ VPRN    HYCGSCGYGC  G+K+G   T+LV
Sbjct  366   VNENCTQEGFQNQVLRKGCQNLGLKVDYVPRNSPGNHYCGSCGYGCPKGEKQGTQATWLV  425

Query  1149  DAVNNGAVILTGCQAEKFILEE-----DETARKKCLGVIAKS--KGNNKILRIEARATVS  991
             DAV+ GAVI+TGC+AE+F+ E      +    KKCLGV+AK+   G    L+ EA+ T+S
Sbjct  426   DAVDKGAVIITGCKAERFLFENNYRNANTRKNKKCLGVLAKTLNSGVTMKLQFEAKVTIS  485

Query  990   ACGSLFTPPLLISSGL-KNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHK  814
             A G+L TPPL+ISSGL KNKNIG NLHLHPVL  WGYFPES ++ +GK ++GGIITS+H+
Sbjct  486   AGGALLTPPLMISSGLTKNKNIGRNLHLHPVLMTWGYFPESKSDFKGKANEGGIITSVHR  545

Query  813   V-----VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHG  649
             V         +   AIIE   LGP+ FA++ PW SGLD K+RM KY RT ++ +++RD  
Sbjct  546   VPSSSNDDSISDTRAIIETPLLGPSSFASIYPWESGLDFKQRMLKYPRTAHLITIIRDKA  605

Query  648   SGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKI-CCKGIKTE  472
             SGQVK  GRI Y+++ ID++N+R GL+Q LRIL+AAGA EVGT RSDGQ+I C +    +
Sbjct  606   SGQVKTEGRISYKLNSIDRENMRAGLQQGLRILIAAGAVEVGTHRSDGQRIKCNENTGEK  665

Query  471   ELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVC  292
             E+E F+D V    G +   ENW LY SAHQMGSCRMG  E++GA+D NGE WEA+GL+VC
Sbjct  666   EIEEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVC  725

Query  291   DGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             D SVLP+A+GVNPMITI STA+CISN +   L  G+
Sbjct  726   DASVLPTAVGVNPMITIQSTAFCISNRIVDFLRKGQ  761



>ref|XP_010548742.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=729

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/739 (59%), Positives = 545/739 (74%), Gaps = 32/739 (4%)
 Frame = -3

Query  2361  HPLLRGGR-RNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPF  2185
             HPLLR  +   +Y+HG S +Q Q+LAAIC  L+PP P        ++ SF+S    QP  
Sbjct  10    HPLLRWRKVEGAYSHGFSLAQIQSLAAICRTLLPPPP--------SLDSFHS----QPSL  57

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
             PDEV E++ R   P+AV + R+VL ILS+RLGSLLLCG +C D +WPF+H FS+LPL  R
Sbjct  58    PDEVGEMMARHGRPEAVAVVRIVLKILSSRLGSLLLCGTLCIDAKWPFLHTFSQLPLHTR  117

Query  2004  EAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPD  1828
             EAIL  WS+++ + +PLRI F+ +K  C F +F+  DEN  NPAWE+IG+ VDT E    
Sbjct  118   EAILRAWSKQSGVFVPLRITFLLVKFFCLFYFFARADENSKNPAWESIGYRVDTRERGWK  177

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggva  1648
             ++  RPLEKGIIET++E+  ++++SL+ KG++V E       TIRCDVV+VGSGCGGGVA
Sbjct  178   EE--RPLEKGIIETVDEDDISIRQSLLDKGVHVAEDN-----TIRCDVVVVGSGCGGGVA  230

Query  1647  aavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGG  1468
             AA LA +G KVVVLEKG+YF   DYS LEGPS+ ELYE  G++TT DGK MV AG+ VGG
Sbjct  231   AANLAMAGLKVVVLEKGNYFSPRDYSSLEGPSMAELYEKSGLMTTVDGKFMVLAGSTVGG  290

Query  1467  GSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQV  1288
             GSA+NWSASI+TP++VL EWS E KI LF S EY SAMD V  R+G+TE C +EG QNQV
Sbjct  291   GSAVNWSASIRTPDHVLQEWSTEHKIKLFNSQEYHSAMDQVMTRLGITESCEREGFQNQV  350

Query  1287  LRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQ  1108
             LRKGCE LGLKVE VPRN    HYCGSCGYGCRTGDK G D T+LVDAV+NGAVILTG +
Sbjct  351   LRKGCERLGLKVEPVPRNSPRDHYCGSCGYGCRTGDKNGTDRTWLVDAVDNGAVILTGIK  410

Query  1107  AEKFILEED-------ETARKKCLGVIAKSKGN--NKILRIEARATVSACGSLFTPPLLI  955
             AEKFILE+           RK+C+GVIA S G    K L +EARAT+SA GSL TPPL++
Sbjct  411   AEKFILEDSNDNSNGRHQRRKRCVGVIASSLGGKIKKKLWLEARATISAAGSLLTPPLML  470

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV--VSEGTKQAAI  781
             SS L+N +IG NL LHPVL  WGYFPE  +E  GK ++GGIITS+H V     G+   A+
Sbjct  471   SSKLENPHIGRNLRLHPVLMTWGYFPEEGSEFSGKMYEGGIITSVHHVTGTESGSGSRAV  530

Query  780   IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQ  601
             +E   +GPA +A + PW S  D K+RM +Y RT ++F++VRD+GSG+V K G ++YR+ Q
Sbjct  531   LETPLIGPASYAGLVPWVSAADFKDRMVRYGRTAHVFALVRDNGSGEVVKEGDVKYRLSQ  590

Query  600   IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS  421
              DK+++R GLRQALRIL+AAGAAEVGT+RSDGQ++ C+G+  E +E FLD V A GG  +
Sbjct  591   KDKESLRVGLRQALRILIAAGAAEVGTYRSDGQRMKCEGLTAEAMEEFLDSVDAVGGVRT  650

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
               E+WT Y SAHQMGSCRMGA+  +GA+D NG+ WEA+GL+VCDGSVLPSAIG+NPMITI
Sbjct  651   RGEHWTTYFSAHQMGSCRMGASAGEGAVDENGQSWEAEGLFVCDGSVLPSAIGINPMITI  710

Query  240   LSTAYCISNGLAKSLNSGK  184
              STAYCIS  +A SL  G+
Sbjct  711   QSTAYCISRRIAISLQKGR  729



>ref|XP_010447958.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=750

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/739 (58%), Positives = 530/739 (72%), Gaps = 23/739 (3%)
 Frame = -3

Query  2361  HPLLRG---GRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQP  2191
             H LLR    G    YNHG S SQ Q+LA IC+ L+PP      S  ++  SF   S++QP
Sbjct  12    HALLRSKNRGEEEGYNHGFSPSQIQSLAVICQTLLPP------SGKQSFDSFNVVSSTQP  65

Query  2190  PFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLK  2011
             PF DEVAE++++    +AV + R++L++LS R G+LLLCG +C D  WPF+  FSELPL 
Sbjct  66    PFTDEVAEMIVKNGRSEAVKVLRIILMVLSFRFGTLLLCGSLCLDKSWPFVLKFSELPLD  125

Query  2010  RREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVP  1834
             RRE IL KWSR++  +LP RI F   K    F +FS TDEN  NPA EAIGF +DT +  
Sbjct  126   RREEILRKWSRQSGFLLPFRITFFLAKFYTLFYFFSHTDENLKNPALEAIGFCLDTKDSS  185

Query  1833  PD-------QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
              +        +  RPLE GIIET++E+  T+ ++LI KG++     + N   IRCDVVIV
Sbjct  186   SNSNKKSEADEKRRPLESGIIETLHESDITITQTLIGKGVHAARDDDENVHRIRCDVVIV  245

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSG GGGVAAA LA +G KV+VLEKG+YF ++DYSGLEGPS+ ELYE GG LTT DGK M
Sbjct  246   GSGSGGGVAAANLAKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLTTVDGKFM  305

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             V AG+ VGGG+AINWSASI+TP+ VL EWS   KI  FGS EY++AMD V  RIGVTE C
Sbjct  306   VLAGSAVGGGTAINWSASIRTPDYVLEEWSEGSKIKFFGSKEYKTAMDEVTTRIGVTEKC  365

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              KEG QNQVLRKGCE LGLKVESVPRN  E HYCG CGYGC  G K G D T+LVDAV N
Sbjct  366   VKEGFQNQVLRKGCERLGLKVESVPRNSREDHYCGLCGYGCTAGHKNGTDGTWLVDAVEN  425

Query  1134  GAVILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVSACGSLF  973
             GAVILTG +AE+FIL ++ ++    +K+C+GVIA S G    K   IEAR TVS+ GSL 
Sbjct  426   GAVILTGIKAERFILVDNNSSSKERQKRCVGVIASSVGGKIGKKFIIEARVTVSSAGSLL  485

Query  972   TPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTK  793
             TPPL++SSGLKN+NIG NL LHPVL  WGYFPE  ++  GK ++GGIITS+H +    + 
Sbjct  486   TPPLMLSSGLKNQNIGRNLRLHPVLMTWGYFPEKDSDFSGKMYEGGIITSLHYMNDAESG  545

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
               AI+E   +GPA +A +SPW SG D+KERM KY RT ++F++VRD GSG+V K   + Y
Sbjct  546   CKAILENPLIGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDIGSGEVMKENEVTY  605

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             R  + D++N+R GLRQALR+L+AAGA EVGT+RSDGQ++ C+G   E +E FLD V A G
Sbjct  606   RTTKKDRENLRAGLRQALRVLIAAGAVEVGTYRSDGQRMKCEGTTREAMEEFLDEVDAVG  665

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             G  +  E WT Y SAHQM SCRMGATEE+GA+D NGE WEA+GL+VCDGSVLPSA+GVNP
Sbjct  666   GVSTKGEYWTSYFSAHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGSVLPSAVGVNP  725

Query  252   MITILSTAYCISNGLAKSL  196
             MITI STAYCIS  +  S+
Sbjct  726   MITIQSTAYCISTRIVNSI  744



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/746 (57%), Positives = 553/746 (74%), Gaps = 23/746 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGR-RNSYNHGLSSSQYQALAAICEALIPPIPLP-----------QDSDDEA  2227
             ++CHPLLRGGR  N Y HG S+++ ++L +ICE ++PP+P+             DS +++
Sbjct  3     KECHPLLRGGRGDNKYKHGFSAAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKS  62

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRW  2047
             + SF   SAS+ P P EVAE++ +R L + V + R+VL +L+TRLG+LLLCGF+C    W
Sbjct  63    LQSFLDISASRYPIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENW  122

Query  2046  PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             P+I+ FS + L++RE I+ KW +   + P+R+ F  IK+ C F++FSW DEN +NPAW+A
Sbjct  123   PYINKFSNISLEKREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKA  182

Query  1866  IGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
             IG+ V  +E   +    RPLEKGIIET+NE+ +TL++SL  KGLNVT    +N L ++CD
Sbjct  183   IGYEVPADEKMTNTSNTRPLEKGIIETMNESDSTLQQSLANKGLNVTLDSKSNILKVKCD  242

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
              ++VGSGCGGGVAAAVL+++GHKVVVLEKG+YF  +DYS LEGPS+ +LYE+GG+L + D
Sbjct  243   ALVVGSGCGGGVAAAVLSSAGHKVVVLEKGNYFTPQDYSSLEGPSMNQLYETGGILASVD  302

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
              +V+V AG+ VGGGSA+NWSA IKTP+ VL EWS   K+P F S EY SAM+ VC+RIGV
Sbjct  303   SRVLVLAGSTVGGGSAVNWSACIKTPHKVLKEWSESHKLPFFSSQEYLSAMENVCERIGV  362

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             TE CS+EG QNQVLRKGC+NLGLKV+ VPRN S  HYC SCGYGC  G+K+G   T+L D
Sbjct  363   TENCSQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYC-SCGYGCPKGEKQGTQDTWLAD  421

Query  1146  AVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKI---LRIEARATVSAC  985
             AV   AVI+TGC+AE+F+LE + +    +KKCLGV AK+  N++I   L+IEA+ T+SA 
Sbjct  422   AVERDAVIITGCKAERFLLESNRSGNGRKKKCLGVTAKTL-NSRITMKLQIEAKVTISAG  480

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM-AEMEGKNHQGGIITSIHKVV  808
             G+L TPPLLISSGLKNKNIG NLHLHPVL  WGYFPES  +E +G  ++GGIITS+HKV 
Sbjct  481   GALLTPPLLISSGLKNKNIGKNLHLHPVLMTWGYFPESNDSEFKGNVYEGGIITSVHKVP  540

Query  807   S--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK  634
             S    +   AIIE   LGPA FAA+ PW SG D KERM  Y RT ++ +++RD   GQV 
Sbjct  541   SPDSNSDSRAIIETPLLGPASFAALCPWESGQDFKERMLNYPRTSHLITIIRDMACGQVT  600

Query  633   KAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL  454
               GRI Y+++++DK+N++ GL+QALRIL+AAGA EVGT RSDGQ++ C GI   E++ FL
Sbjct  601   TEGRISYKLNEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFL  660

Query  453   DGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLP  274
             D V    G +S  E W +Y SAHQMGSCRMG +E++GA+D NGE WEA+GL+VCD SVLP
Sbjct  661   DSVCPMEGALSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDASVLP  720

Query  273   SAIGVNPMITILSTAYCISNGLAKSL  196
             SA+GVNPMIT+ STAYCISN +   L
Sbjct  721   SAVGVNPMITVQSTAYCISNRIVDYL  746



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/744 (59%), Positives = 557/744 (75%), Gaps = 16/744 (2%)
 Frame = -3

Query  2379  MNERKCH-PLLRGGRRNS----YNHGLSSSQYQALAAICEALIPPIPL------PQDSDD  2233
             M E +C  PLL G RR+     Y HGLSS++ Q LA+I EA+ P +         Q+   
Sbjct  1     MGEGQCQQPLLNGERRDRGKRRYAHGLSSAEVQTLASIGEAVFPSLKPNSDFEGKQNQPR  60

Query  2232  EAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDG  2053
             +A+ SF  +SAS+ P PDEVA+++++R   +   + R+VL++LSTRLG+LLLCG +C   
Sbjct  61    KAVQSFLEASASESPIPDEVAQLLVKRTFMETRILLRVVLLLLSTRLGTLLLCGSLCLGD  120

Query  2052  RWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAW  1873
             +WP+I+ FS +PL+ RE +L  W +  L   +RI F+ +K+AC +++FS   EN +NPAW
Sbjct  121   KWPYINYFSCMPLENREKVLQMWFKSWLFTLVRIAFIYLKVACLYVFFSRVGENNDNPAW  180

Query  1872  EAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             EAIG+ VD  E        RPL+KG+IET++E  +TL +SL +KGL VTE    N   I+
Sbjct  181   EAIGYQVDNVENSKQVSKERPLQKGMIETMHEKDSTLLQSLTQKGLQVTEDTERNVYKIK  240

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CD VIVGSGCGGGVAAA+LA+SG KVVVLEKG YF   DYS  EGPS+ +LYESGG+L +
Sbjct  241   CDAVIVGSGCGGGVAAAILASSGLKVVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPS  300

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DG++++ AG+ VGGGSAINWSASIKTP ++L EW+ + ++PLFGS EY SAMD VC+RI
Sbjct  301   IDGQMLILAGSTVGGGSAINWSASIKTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERI  360

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE C +EG QNQ+LRKGC+NLGL+VE+VPRN SE HYCGSCG+GCR GDKKG D T+L
Sbjct  361   GVTENCKEEGFQNQILRKGCKNLGLEVENVPRNSSESHYCGSCGFGCRRGDKKGTDRTWL  420

Query  1152  VDAVNNGAVILTGCQAEKFILEEDETARK---KCLGVIAKSKGNN--KILRIEARATVSA  988
             VDAV+NGAVILTGC+AEKFILE+++   K   KCLGVIAK+   N  K L IEA+ T+SA
Sbjct  421   VDAVSNGAVILTGCKAEKFILEKNKICSKRKLKCLGVIAKTSNKNITKKLHIEAKVTISA  480

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
             CG+LFTP L+ SSGLKN+NIG NLHLHPVL AWGYFP+S +E +GK ++GGIITS+HKVV
Sbjct  481   CGALFTPLLMHSSGLKNRNIGRNLHLHPVLMAWGYFPDSDSEFKGKVYEGGIITSVHKVV  540

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
             +   K  AIIE  SLGPA +AA+ PW SGLDMK RM  +SRT ++ +++RD GSG+V   
Sbjct  541   AADNKVRAIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAG  600

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GR+ Y+ D +D+ N+++GLRQALRILVAAGA EVGT RSDGQ I CKGI  +ELE FL+ 
Sbjct  601   GRVTYKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLES  660

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             V    GPM   E W  + SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLP A
Sbjct  661   VSPVEGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGA  720

Query  267   IGVNPMITILSTAYCISNGLAKSL  196
             IGVNPMIT+ STAYC+S  +A+SL
Sbjct  721   IGVNPMITVQSTAYCLSKRIAESL  744



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/737 (58%), Positives = 558/737 (76%), Gaps = 12/737 (2%)
 Frame = -3

Query  2373  ERKCHPLLRGGRR-NSYN-HGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSA  2200
             +R CHPLLRGGRR N Y  H LSS++ ++L++ICEAL+PP+ L   +  + +  F+ +S 
Sbjct  2     KRDCHPLLRGGRRCNKYTPHILSSAEMESLSSICEALLPPLQL-DSTKSKTVQHFWKASG  60

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             SQ   P E+AE++++R L +A+ + R++L +LSTRLG+LLLCG +C   +WPFI++FS L
Sbjct  61    SQFSIPHEIAEILIKRALKEALILLRVILWLLSTRLGTLLLCGTLCLSKKWPFINSFSNL  120

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
              L  RE +L KW +   + P+R+VF+ IK+ C+F++FS  D+N  NPAWEAIG+ VD++ 
Sbjct  121   SLDNREKVLQKWFKHRFLTPIRLVFIYIKVLCFFVFFSQCDDNGENPAWEAIGYQVDSDG  180

Query  1839  VPPDQQTGR--PLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
             +       R  PLEKGI+E + E+  +L +SLI+KGL V      NTL I+CDVVIVGSG
Sbjct  181   ITTTSNVHRERPLEKGIVEAMKESNLSLPKSLIEKGLEVAIDSKNNTLNIKCDVVIVGSG  240

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
             CGGGVAA++LA+SG KV+VLEKG+YF   DYS LEGPSL ELYE GG   + DGK+ +  
Sbjct  241   CGGGVAASILASSGLKVLVLEKGNYFTPNDYSSLEGPSLNELYELGGTFASRDGKMAILT  300

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             GT VGGGSA+NW+ASI+TP+ VL EW  + K+ LF S EY SAMD VCKRIGVT+ C +E
Sbjct  301   GTTVGGGSAVNWAASIRTPDFVLEEWGKDHKLSLFSSHEYLSAMDMVCKRIGVTDKCIEE  360

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
             GLQNQVLRKGC+NLGL V+ VPRN SE+HYCGSC YGC  G+K+G + T+LVDAV++GAV
Sbjct  361   GLQNQVLRKGCKNLGLPVDYVPRNSSERHYCGSCNYGCTRGEKQGTEVTWLVDAVDHGAV  420

Query  1125  ILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNNKI--LRIEARATVSACGSLFTPP  964
             ILTG +AE+FIL +        RKKCLGV+A    NN    L++EA+ TVSACG+LFTPP
Sbjct  421   ILTGTKAERFILGKKNKGGGVRRKKCLGVMANVVTNNITWRLKVEAKVTVSACGALFTPP  480

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEG-TKQA  787
             L+ISSGLKNK+IG NLHLHPVL +WGYFP+S +E++GK ++GGIITS+HKVVSE  +K  
Sbjct  481   LMISSGLKNKHIGKNLHLHPVLMSWGYFPDSNSELKGKCYEGGIITSVHKVVSEDYSKVK  540

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             AI+E  +LGP   + + PW SGLD K+RM KYSRTV++ +++RD G G+V+  GR+ Y +
Sbjct  541   AIVETPALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSEGRVHYEL  600

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             D+ DK+NIR G++QALRIL+AAGA EVGT RSDG +I C G   +ELE F++ V AT G 
Sbjct  601   DESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATEGL  660

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
             MS EE W++Y SAHQMGSCRMG +E++GA+D NG  WEA+GL+VCD S+LP+AIGVNPMI
Sbjct  661   MSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMI  720

Query  246   TILSTAYCISNGLAKSL  196
             TI STAYC++  +A  L
Sbjct  721   TIQSTAYCVAKRIAAFL  737



>gb|AGC65582.1| fatty alcohol oxidase [Simmondsia chinensis]
Length=721

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/687 (60%), Positives = 519/687 (76%), Gaps = 6/687 (1%)
 Frame = -3

Query  2250  PQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCG  2071
             P  +   A+ +F+S+  S+PP P+ VAE++ RR LP+AV   R+ L +LSTR+G+LLLCG
Sbjct  25    PSAARKIAIRAFFSAPGSRPPIPEAVAELMKRRALPEAVVAVRVALRLLSTRIGTLLLCG  84

Query  2070  FVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDEN  1891
             F     +WPF+  FS++ L +RE IL  WS+++    LR+VF+ IK+ C F++FS TDEN
Sbjct  85    FRSLTWKWPFLLKFSQIQLHKREKILQSWSKQSFWTSLRVVFLLIKVVCCFVFFSQTDEN  144

Query  1890  YNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNA  1711
               NPAWEAIG+++D+ E     Q  RPL+KGI+E  N +   L  SL +K + VTE    
Sbjct  145   SKNPAWEAIGYNLDSRECSTKPQEERPLQKGIVECTNTDNDNLLRSLKEKCVEVTEDHEK  204

Query  1710  NTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYES  1531
             N   ++CDVVIVGSGCGGGVAA VLA+SG KV+V+EKG+YF   DYS LEGPSL ELY S
Sbjct  205   NMFKVKCDVVIVGSGCGGGVAAGVLASSGLKVLVIEKGNYFAPGDYSSLEGPSLDELYVS  264

Query  1530  GGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMD  1351
             GGMLTT DGK+++F+G+ VGGGSAINWSASI+TP+ V+ EWS+  ++P+F SS+Y+ AMD
Sbjct  265   GGMLTTLDGKMLLFSGSTVGGGSAINWSASIRTPDPVIKEWSVNHRLPIFNSSDYRLAMD  324

Query  1350  AVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKG  1171
              VCKRIGVTE C++EG QNQVLR+GCENLGL+VE VPRN SE HYCGSC YGCR GDKKG
Sbjct  325   EVCKRIGVTEKCTEEGFQNQVLRQGCENLGLEVEKVPRNSSENHYCGSCTYGCRLGDKKG  384

Query  1170  VDTTYLVDAVNNGAVILTGCQAEKFILEEDETA--RKKCLGVIAKSKGNN--KILRIEAR  1003
              DTT+LVDAV +GAV+LTGC+AEKF+LE+ +T   +KKC G+IA     N  K L+IEAR
Sbjct  385   TDTTWLVDAVEHGAVVLTGCKAEKFVLEDVKTGTRKKKCTGIIAAVSDKNVTKKLQIEAR  444

Query  1002  ATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITS  823
              ++SACGS+ TPPLL SSGL+N NIG+NLHLHPVL AWGYFPES   ++GK+ +GGIITS
Sbjct  445   VSISACGSVLTPPLLKSSGLRNPNIGANLHLHPVLLAWGYFPESANSVKGKSFEGGIITS  504

Query  822   IHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHG  649
             +HKV S+  K+   AIIEA  LGPA F+++ PW SG DMKERM KY RT N+F++VRD  
Sbjct  505   LHKVTSDPEKRNIHAIIEAPGLGPAAFSSLIPWVSGRDMKERMVKYDRTANLFALVRDQS  564

Query  648   SGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEE  469
             +G+ ++ G+        DK N++ GLRQ LRIL+AAGAAEVGT+RSDGQ++ CKG+K  E
Sbjct  565   TGESQRRGKDSISFKDFDKQNLKIGLRQCLRILIAAGAAEVGTYRSDGQRMRCKGVKAGE  624

Query  468   LESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCD  289
             LE FLD V+A GGP S  E W +Y SA QMGS RMG   E G +D+NGE WE +GLYVCD
Sbjct  625   LEEFLDTVIAPGGPRSRTEEWPIYASALQMGSFRMGDAAETGPVDSNGESWEPEGLYVCD  684

Query  288   GSVLPSAIGVNPMITILSTAYCISNGL  208
             GS LP+A GVNPMITI STAYCIS+ +
Sbjct  685   GSFLPTAFGVNPMITIQSTAYCISSAI  711



>ref|XP_007144044.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
 gb|ESW16038.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
Length=741

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/737 (57%), Positives = 552/737 (75%), Gaps = 11/737 (1%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNSYN--HGLSSSQYQALAAICEALIPPIPL----PQDSDDEAMCSFY  2212
             +R+CHP+LRGGRR S N    L S++ ++L +ICEA  PP+ L      +S  +A+  F+
Sbjct  2     KRECHPVLRGGRRGSRNTTDPLPSAEMESLTSICEAFFPPLQLEHLDKHNSKTKAVQHFW  61

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              SSASQ P P E A+++++R L +A+   RL+L +LSTRLG+LLLCG +C   +WP IHN
Sbjct  62    KSSASQFPIPQETADMLIKRALKEALIFVRLILWMLSTRLGTLLLCGTLCLSKKWPCIHN  121

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FS + L  RE +L KW +     P+R+ F+ +K+ C F++FS  DE   NPAWEA+G+ V
Sbjct  122   FSNISLDNREKVLQKWFKHRFFTPIRLAFLYVKVLCLFVFFSQCDEKGQNPAWEAVGYKV  181

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             DT+ +    Q  RPLEKGI+E  NE+  +L +SL +KGL V+     N L I+CDVVIVG
Sbjct  182   DTDGITKQVQKERPLEKGIVEGRNESDWSLPKSLGEKGLEVSVDAGNNVLGIKCDVVIVG  241

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAA LA+SG KV+VLEKG+Y+ S DYS LEGPSL ELYE GG   + DG + +
Sbjct  242   SGCGGGVAAATLASSGLKVLVLEKGNYYTSSDYSSLEGPSLNELYELGGTFASWDGNMAI  301

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NW+ASI+TP++VL EW  E K+ LF S EY SAMD VCKRIGVT+ C 
Sbjct  302   LAGSTVGGGSAVNWAASIRTPDSVLKEWEKEHKLSLFSSHEYLSAMDMVCKRIGVTDKCV  361

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EGLQNQVLRKGC+NLGL+V+ VPRN SE+HYCGSC YGC  GDK+G + T+LVDAV++ 
Sbjct  362   EEGLQNQVLRKGCKNLGLQVDYVPRNSSERHYCGSCNYGCTRGDKQGTEVTWLVDAVDHD  421

Query  1131  AVILTGCQAEKFILEEDETAR---KKCLGVIAKSKGNNKI--LRIEARATVSACGSLFTP  967
             AVILTG +AE+FIL  ++  R   KKCLGV+A    NN    L++EA+ TVSACG+L TP
Sbjct  422   AVILTGTKAERFILGNNKGGRVRKKKCLGVMANVLTNNITWRLKVEAKVTVSACGALLTP  481

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA  787
             PL+ISSGLKNK+IG NLH+HPVL +WGYFP+S ++++GK ++GGIITS+HKVVSE +   
Sbjct  482   PLMISSGLKNKHIGKNLHMHPVLMSWGYFPDSNSDLKGKCYEGGIITSVHKVVSEDSNVK  541

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             AI+E  +LGPA  + + PW SG D KERM KYSRTV++ +++RD G G V+  GR+ Y +
Sbjct  542   AIVETPALGPAVLSTLLPWVSGSDFKERMLKYSRTVHLITIIRDKGCGVVRSEGRVHYDL  601

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             D+ DK+NIR G++QALRIL+AAGA EVGT RSDGQ+I C G   +ELE F++ + ATGG 
Sbjct  602   DESDKENIRDGVKQALRILIAAGAVEVGTHRSDGQRIECNGNNEKELERFVESIYATGGS  661

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
             MS EE W++Y SAHQMGSC+MG +E++GA+D NG  WEA+GL+VCD S+LP+AIGVNPMI
Sbjct  662   MSQEEKWSIYSSAHQMGSCKMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMI  721

Query  246   TILSTAYCISNGLAKSL  196
             TI STAYC++  +A  L
Sbjct  722   TIQSTAYCVAKRIAAFL  738



>ref|XP_010526493.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=761

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/756 (57%), Positives = 549/756 (73%), Gaps = 24/756 (3%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRR--NSYNHGLSSSQYQALAAICEALIPPIPL-------PQDSD  2236
             E +   R+ HPLLR   R    Y+HG S  Q Q+L+AIC  L+P +P         QD  
Sbjct  2     EDERRRRRGHPLLRWRTRAEGDYSHGFSQGQIQSLSAICHTLLPSLPPPPPETLSDQDKT  61

Query  2235  D-EAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCF  2059
             +  A+ SFY ++ASQPP PDEVAE+++R   P+A+ + ++ L ILS+RLGSLLLCG +CF
Sbjct  62    NFPALVSFYRATASQPPIPDEVAEMMVRHGRPEAIMVVKIALKILSSRLGSLLLCGTLCF  121

Query  2058  DGRWPFIHNFSELPLKRREAILLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNN  1882
             D +WPF+H FSELPL  RE I+  WS++  L +PLRI F+ +K    F YFS +D    N
Sbjct  122   DSKWPFLHTFSELPLNVREEIMRTWSKQGGLFVPLRITFLLVKFFSMFYYFSQSDGRSKN  181

Query  1881  PAWEAIGFHVDTNEVPPDQ-QTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANT  1705
             PAWEAIG+ VDT E   D+ +  RPL+KGIIET  EN  T+++SLI +G++V E ++ + 
Sbjct  182   PAWEAIGYTVDTREGSWDETEEERPLDKGIIETAQENDVTIRQSLINRGVHVAEEEDDDG  241

Query  1704  L-TIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESG  1528
             +  IRCD V++GSG GGGVAAA LA +G  V+VLEKG+YF   DYS LEGPSL ELYE  
Sbjct  242   VHKIRCDAVVIGSGSGGGVAAANLAKAGLNVIVLEKGNYFTPRDYSSLEGPSLVELYEKS  301

Query  1527  GMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDA  1348
             G+LTT DGK M+ AG+ VGGGS +NWSASI+TP++VL EWS E KI LF S EYQSAMD 
Sbjct  302   GILTTVDGKFMILAGSAVGGGSTVNWSASIRTPDHVLREWSAENKINLFTSREYQSAMDE  361

Query  1347  VCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGV  1168
             V +RIGV E C ++G QNQVLRKGCE LGLKV+ VPRN    HYCGSCGYGCRTGDKKG 
Sbjct  362   VIRRIGVEERCGRDGFQNQVLRKGCERLGLKVDPVPRNSPGDHYCGSCGYGCRTGDKKGT  421

Query  1167  DTTYLVDAVNNGAVILTGCQAEKFILEEDETA-------RKKCLGVIAKSKGN--NKILR  1015
             D T+LVDAV+ GAVILTG +AE+FILE++  +       RK+C+GV+A S G    K L 
Sbjct  422   DQTWLVDAVDYGAVILTGIKAERFILEDNNNSDSSYNGRRKRCVGVVAGSLGGKMKKKLW  481

Query  1014  IEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGG  835
             IEAR ++SA GSL TPPL+ISSGLKN +IG NL LHPVL  WGYFPE  +E +GK ++GG
Sbjct  482   IEARVSISAAGSLLTPPLMISSGLKNPHIGRNLRLHPVLMTWGYFPEEGSEFQGKMYEGG  541

Query  834   IITSIHKVVSEGTKQA--AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMV  661
             IITS+H V    +K    A++E   +GPA +A + PW S  D KERM +Y RT ++F++V
Sbjct  542   IITSVHHVRDAESKSGSRAVLETPLIGPASYAGLVPWVSAADFKERMVRYGRTAHVFALV  601

Query  660   RDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGI  481
             RD+GSG+V K G + YR+ Q+DK+ +  GLRQALRIL+AAGA EVGT+RSDGQ++ CKG+
Sbjct  602   RDNGSGEVVKEGDVTYRLSQLDKERLSVGLRQALRILIAAGAVEVGTYRSDGQRMKCKGL  661

Query  480   KTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
               + +E FLD V A GG  +  E+WT Y SAHQMGSCRMGA+  +GA+D NGE WE +GL
Sbjct  662   TKQAMEEFLDSVDAVGGVRTRGEHWTTYFSAHQMGSCRMGASAGEGAVDENGESWETQGL  721

Query  300   YVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             +VCDGSVLPSA+G+NPMITI ST+YCIS  +A+SL 
Sbjct  722   FVCDGSVLPSAVGINPMITIQSTSYCISTRIAESLQ  757



>ref|XP_004505474.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=762

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/750 (55%), Positives = 545/750 (73%), Gaps = 26/750 (3%)
 Frame = -3

Query  2367  KCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQDSDDEA------------  2227
             KCHPLLRG R NS Y HG S ++ ++L +ICE ++P +P+   +  +             
Sbjct  4     KCHPLLRGVRENSKYKHGFSVAEMESLTSICEVVLPSLPVDAMNQRKDDQHDDDDESRKH  63

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRW  2047
             + SF + SASQ P P EVAE +++R L +AV + R+VL +L+TRLG+LLLCGF+C    W
Sbjct  64    VQSFLNLSASQYPIPHEVAEALVKRGLIEAVMLIRVVLWLLATRLGTLLLCGFLCLSKEW  123

Query  2046  PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             PF++ FS + L +RE I+ +W +   + P+R+ F  IK+ C+F++FSW DEN +NP W+A
Sbjct  124   PFVNKFSSMSLDKREKIVQRWLKHRFLTPIRVAFGYIKVLCHFVFFSWVDENGDNPTWKA  183

Query  1866  IGFHVDTNEVPPD---QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTI  1696
             IG+ V  NE   +   +   RPLEKGIIET++E+ +TL++SL  KGLNV      N L I
Sbjct  184   IGYEVSPNEKMTNVSKESEERPLEKGIIETMHEHDSTLQKSLSDKGLNVIVDSKNNILKI  243

Query  1695  RCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLT  1516
             +CD V+VGSG GGGVAA+VL+N+G+KV+VLEKG+YFV +DYS LEGPS+ + YE GGML 
Sbjct  244   KCDAVVVGSGSGGGVAASVLSNAGYKVIVLEKGNYFVPKDYSSLEGPSMNQQYECGGMLV  303

Query  1515  TTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKR  1336
             + D +++V AG+ VGGGSAINWSA +KTP  V+ EWS + K+ +F S EY SAM+ VC+R
Sbjct  304   SADSRILVLAGSTVGGGSAINWSACLKTPQEVIKEWSEKHKLSMFSSLEYLSAMETVCER  363

Query  1335  IGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTY  1156
             IGV + C++EG QNQVLRKGC+NLGLKV+ VPRN S  HYCGSCGYGC  G+K G   T+
Sbjct  364   IGVNQNCTQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYCGSCGYGCPKGEKLGTQVTW  423

Query  1155  LVDAVNNGAVILTGCQAEKFILEEDETARKK--CLGVIAKSKGNNKI---LRIEARATVS  991
             LVDAV  GAVI+TGC+AEKF+ + +   RKK  CLGV+AK+  N ++   L+IEA+ TVS
Sbjct  424   LVDAVEKGAVIITGCKAEKFLFQTNNNTRKKKSCLGVLAKTLNNTRVTMKLQIEAKVTVS  483

Query  990   ACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM-AEMEGKNHQGGIITSIHK  814
             +CG+L TPPL+I+SGLKNKNIG NLHLHPVL  WGYFPES   +++GK ++GGIITS+HK
Sbjct  484   SCGALLTPPLMITSGLKNKNIGRNLHLHPVLMTWGYFPESKNLDLKGKVYEGGIITSVHK  543

Query  813   VVSEGTKQA---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSG  643
             ++S     +   AIIE   +GPA FA++ PW SGLD K+RM  YSRT +  +++RD   G
Sbjct  544   LLSSNDSNSYTRAIIETPLIGPASFASMCPWESGLDFKQRMLNYSRTSHFITIIRDSSCG  603

Query  642   QVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELE  463
             +V   GRI Y++++IDK+NIR+GL+QALRIL+AAGA EVGT RSDGQ+I C      E+E
Sbjct  604   KVTSEGRISYKLNEIDKENIRSGLQQALRILIAAGADEVGTHRSDGQRIKCSEKSEIEIE  663

Query  462   SFLDGVVAT-GGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDG  286
              F++ V    G  + G E W +Y SAHQMGSCRMG  E++G +D NGE WEA+GL+VCD 
Sbjct  664   EFIESVCPMEGALLPGNEKWNIYTSAHQMGSCRMGVNEKEGGVDENGESWEAEGLFVCDA  723

Query  285   SVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             SVLP+A+GVNPMIT+ STAYCISN +   L
Sbjct  724   SVLPTAVGVNPMITVQSTAYCISNRIVDYL  753



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/748 (56%), Positives = 555/748 (74%), Gaps = 19/748 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQ----------DSDDEAM  2224
             R+ HPLLRGGR +S Y HG S+++ ++LA++CE ++PP+P+            D D + +
Sbjct  3     REFHPLLRGGRGHSKYKHGFSAAEMESLASMCEVVLPPLPMDAFKSRKEDQAGDDDTKLL  62

Query  2223  CSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP  2044
              SF   S S+ P P EVAE++    L +A+ + R+VL +L+TRLG+LLLCGF+C   +WP
Sbjct  63    QSFCDISGSRYPIPHEVAELLTNTSLIEALILVRVVLWMLATRLGTLLLCGFLCLGEKWP  122

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             +I+NFS + L++RE I+ KW +   + P+R+ F+ +K+ C + +FS  DEN +NPAW+AI
Sbjct  123   YINNFSNMSLEKREKIVQKWLKHRFLTPIRLAFVYVKVLCLYSFFSMVDENGDNPAWKAI  182

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
             G+ V  NE   +    RPLEKG IET++E+ +TL++SL KKGLNVT    +N L ++CD 
Sbjct  183   GYEVSDNEKQNNVSNNRPLEKGTIETMHESDSTLQQSLAKKGLNVTLDFKSNILKVKCDA  242

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             V+VGSGCGGGVAAAVL+++GHKVVVLEKG+YF  +DYS LEGPS+ +LYE+GG+L + D 
Sbjct  243   VVVGSGCGGGVAAAVLSSAGHKVVVLEKGNYFSPQDYSSLEGPSMKQLYETGGILASADS  302

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             +V++ AG+ VGGGSA+NWSA IKTP+ VL +WS   K+P F S EY SAM+ VC+RIGVT
Sbjct  303   RVLILAGSTVGGGSAVNWSACIKTPHKVLKDWSEGHKLPFFSSQEYLSAMETVCERIGVT  362

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             E C++EG QNQVLRKGC+NLGLKV+ V RN S  HYCGSCGYGC  G+K+G   T+LVDA
Sbjct  363   ENCTQEGFQNQVLRKGCQNLGLKVDYVARNSSGNHYCGSCGYGCPKGEKQGTQATWLVDA  422

Query  1143  VNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAK--SKGNNKILRIEARATVSACGS  979
             V+ GAVI+TGC+AEK +LE + +    +KKCLGV+AK  +K     L+IEA+ T+S+ G+
Sbjct  423   VDKGAVIITGCKAEKLLLESNRSGNGRKKKCLGVVAKVLNKVVTMKLQIEAKVTISSGGA  482

Query  978   LFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPES-MAEMEGKNHQGGIITSIHKVVSE  802
             L TP LLISSGL NKNIG NLHLHPVL  WGYFPES  +E +GK ++GGIITS+HKV S 
Sbjct  483   LLTPSLLISSGLHNKNIGRNLHLHPVLMTWGYFPESNNSEFKGKVYEGGIITSVHKVPST  542

Query  801   GTK--QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
              +K    AIIE  SLGPA FAA+ PW SGLD KERM  Y RT ++ +++RD   GQV   
Sbjct  543   DSKSDSRAIIETPSLGPACFAALFPWESGLDFKERMLNYPRTAHLITIIRDMACGQVTSE  602

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GRI Y++++ID++N+R G++QALRIL+AAGA EVGT RSDGQ++ C G+  ++++ FLD 
Sbjct  603   GRIIYKLNEIDRENMRAGMQQALRILIAAGAVEVGTHRSDGQRLRCSGVSEDKVQEFLDS  662

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             V    G +S  + W LY SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLP+A
Sbjct  663   VCPMEGALSPGDKWNLYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPTA  722

Query  267   IGVNPMITILSTAYCISNGLAKSLNSGK  184
             +GVNPMITI STAYCISN +   L  G+
Sbjct  723   VGVNPMITIQSTAYCISNRIVDYLGRGQ  750



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/729 (56%), Positives = 538/729 (74%), Gaps = 20/729 (3%)
 Frame = -3

Query  2319  GLSSSQYQALAAICEALIPPIPLPQD---SDD-----EAMCSFYSSSASQPPFPDEVAEV  2164
             G+++++ ++L + CEA++PP+  P++    DD     EA+ SF+S+S S+ P   E  E+
Sbjct  15    GITTAEMESLGSFCEAVLPPVSPPEEYSAGDDHCRNKEALRSFFSTSGSRTPVVRESIEL  74

Query  2163  VMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKW  1984
             + +R   +   + RLVL +L+TRLG+LL+CG  C   RWPF+  FSEL L++RE +L K 
Sbjct  75    ITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQ  134

Query  1983  SRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQQTGRPL  1807
              R  ++ P+R  F+ IK+A  F +FSW   N  NPAWEAIG++V+TNE  P +    RPL
Sbjct  135   FRNWILTPIRAAFVYIKVAFLFCFFSWVSPNGENPAWEAIGYNVNTNENKPSETHRERPL  194

Query  1806  EKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANS  1627
             EKG++ET+ E   TL ESL + GL      + +T+ I+CD V+VGSG GGGVAA+VLA +
Sbjct  195   EKGMVETMQETEQTLLESLAQMGLEA--ETDHDTIRIKCDAVVVGSGSGGGVAASVLAKA  252

Query  1626  GHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWS  1447
             G KVVV+EKG Y+    Y   EGP + +LYE+GG+L T DG +MV AG  VGGGSA+NWS
Sbjct  253   GLKVVVMEKGSYYTPSTYPSTEGPGMDKLYENGGILPTIDGNMMVLAGATVGGGSAVNWS  312

Query  1446  ASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCEN  1267
             A IKTP +VL EWS ++ IPL+ + EY SAM+ V +R+GVTE C  EG QNQVLRKGCEN
Sbjct  313   ACIKTPKSVLQEWSEDRNIPLYATKEYVSAMELVWERMGVTETCELEGFQNQVLRKGCEN  372

Query  1266  LGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILE  1087
             LG+ VE+V RN SE+HYCGSCGYGCR GDKKG D T+LVDAV++GAVILTGC+AE+FILE
Sbjct  373   LGINVENVARNSSERHYCGSCGYGCRQGDKKGSDRTWLVDAVSHGAVILTGCKAERFILE  432

Query  1086  ED--ETARKK--CLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIG  925
              +     RKK  CLGVIAKS   N  K ++IEAR T+SA GSL TPPL+I SGLKN++IG
Sbjct  433   NNGNNVGRKKMKCLGVIAKSLNGNIAKKIKIEARVTISASGSLLTPPLMIKSGLKNRHIG  492

Query  924   SNLHLHPVLFAWGYFPESMAE---MEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPA  754
              NLHLHPVL  WGYFP+  +     +GK+++GGIITS+ KV+SE ++  AIIE  +LGPA
Sbjct  493   KNLHLHPVLMTWGYFPDKASSSFYFKGKSYEGGIITSMSKVLSEDSEVRAIIETPALGPA  552

Query  753   GFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTG  574
              F+ + PWTSGLDMK+RM +YSRT N+ ++VRD GSG+V+  GRI Y +D++D++NI  G
Sbjct  553   SFSVLCPWTSGLDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVVDKVDRENITAG  612

Query  573   LRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYC  394
             LRQ+LRIL+AAGA EVGT RSDGQK+ CKG+  + ++ FLD V A  GP +  ENW++Y 
Sbjct  613   LRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKSIDEFLDSVSAEEGPKAMTENWSVYS  672

Query  393   SAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             SAHQMGSCR+G  E++GAID NGE WEA  L+VCDGSVLPSA+GVNPMITI+STAYCI+ 
Sbjct  673   SAHQMGSCRIGVDEDEGAIDLNGESWEADKLFVCDGSVLPSAVGVNPMITIMSTAYCIAT  732

Query  213   GLAKSLNSG  187
              + KS+ +G
Sbjct  733   RIVKSMTTG  741



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/729 (56%), Positives = 527/729 (72%), Gaps = 19/729 (3%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIPLPQDS---------DDEAMCSFYSSSASQPPFPDEVAEV  2164
             +++++ + LA+ CEA+ PP+  PQ+            EA+ SFYS+SASQ P   +  E+
Sbjct  15    ITAAEMETLASFCEAVFPPVAPPQEELSGAGDNNHRKEALRSFYSTSASQTPILCQSMEL  74

Query  2163  VMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKW  1984
             + +R   +A  + RL+L +L++RLG+LL+CG  C   RWPF+  FSEL L++RE ++ K 
Sbjct  75    LTKRATMEACLVTRLILFLLASRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVIQKQ  134

Query  1983  SRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQ-TGRPL  1807
              R  ++ P+R  F+ IK+   F +FS       NPAWEAIG+HV+ +E  P +    RPL
Sbjct  135   FRNWILTPIRAGFVYIKVIFLFCFFSRVSPKGENPAWEAIGYHVNLDENKPSETYKARPL  194

Query  1806  EKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANS  1627
             EKGI+ET+NE   TL ESL +KGL      + +T+ I+CD V++GSG GGGVAA+VLA S
Sbjct  195   EKGIVETMNETEQTLLESLARKGLEADHDMDQDTIRIKCDAVVIGSGSGGGVAASVLAKS  254

Query  1626  GHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWS  1447
             G KVVVLEKG Y+   DY   EGP + +LYE+GG+L T DG +MV AG  VGGGSA+NWS
Sbjct  255   GLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNLMVLAGATVGGGSAVNWS  314

Query  1446  ASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCEN  1267
             A IKTP +VL EWS +QKIP +G+ EY SAMD V KR+GVTE C  E  QNQ+LRKGCEN
Sbjct  315   ACIKTPKSVLQEWSEDQKIPFYGTKEYVSAMDVVWKRMGVTEKCEMESFQNQILRKGCEN  374

Query  1266  LGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILE  1087
             +G+ VE+VPRN SE HYCGSCGYGCR GDKKG D T+LVDAV++GAV+LTGC+AE+FILE
Sbjct  375   IGVNVENVPRNSSEGHYCGSCGYGCRQGDKKGSDQTWLVDAVSHGAVVLTGCKAERFILE  434

Query  1086  EDET----ARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIG  925
             +  +     + KCLGV+AKS   N  K L IEA+ TVSA GSL TPPL+ISSGL+N+NIG
Sbjct  435   KKGSNVGGKQMKCLGVMAKSLNGNIAKKLIIEAKVTVSAGGSLLTPPLMISSGLRNRNIG  494

Query  924   SNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPA  754
              NLHLHP L +WGYFPE   S    +GK+++GGIITS+ KV SE ++  AIIE  SLGP 
Sbjct  495   RNLHLHPTLMSWGYFPEKKSSSLSFKGKSYEGGIITSVSKVFSEDSEVRAIIETASLGPG  554

Query  753   GFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTG  574
              F+ + PWTSGLDMK RM +YSRT ++ ++VRD GSG+VK  GRI+Y +D+ DK NI  G
Sbjct  555   SFSVLFPWTSGLDMKTRMARYSRTASLITIVRDRGSGEVKTEGRIRYVVDKTDKGNIIAG  614

Query  573   LRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYC  394
             LRQ+LRIL+AAGA EVGT RSDG+ + CKG+    +E FLD V +  GP    E W +YC
Sbjct  615   LRQSLRILIAAGAEEVGTHRSDGKILKCKGVDENSIEEFLDSVSSEEGPKGMTEKWNIYC  674

Query  393   SAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             SAHQMGSCR+G  E++GAID NGE WEA+ L+VCD S LPSA+GVNPMIT++STAYCIS 
Sbjct  675   SAHQMGSCRIGENEKEGAIDLNGESWEAERLFVCDASALPSAVGVNPMITVMSTAYCIST  734

Query  213   GLAKSLNSG  187
              +AKS+ +G
Sbjct  735   RIAKSMTTG  743



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/746 (55%), Positives = 539/746 (72%), Gaps = 21/746 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPLPQ--DSDDEA---MCSFYS  2209
             R+CHPLL G R N  Y HG S ++ ++L +ICE + P +P+      DDE+   + SF++
Sbjct  3     RECHPLLSGMRENRKYKHGFSVAEMESLTSICEVMFPSLPMDDALTKDDESSKDVQSFFN  62

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNF  2029
              SAS+ P PDEVAE+  +R + +AV + R++L +L+TRLG+LL+CG +C   +WPFI+NF
Sbjct  63    ISASKYPIPDEVAEMFEKRAVIEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNF  122

Query  2028  SELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVD  1849
             S L L +RE I+ +  +   + P R+ F+ IKI C F++FSW DEN +NPAW+AIG+ V 
Sbjct  123   SSLSLDKREKIVQRGLKHKFLTPFRLAFVYIKILCLFVFFSWVDENGDNPAWKAIGYEVS  182

Query  1848  T-NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             T +E   +    RPLEKGIIE ++E+ TTL++SL  KGLNVT     N L I+CD V+VG
Sbjct  183   TADEKMINDTKKRPLEKGIIEIMHEHDTTLQQSLSNKGLNVTLDSKNNILKIKCDAVVVG  242

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAA+VL+ +G+KVVVLEKG+YFV +DYS LEGPS+ + YE+GG+L + D ++++
Sbjct  243   SGCGGGVAASVLSKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYENGGILASIDSRILI  302

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSA IKTP  VL EWS + K+ LF S EY SAM+ VC+RIGV E C+
Sbjct  303   LAGSTVGGGSAVNWSACIKTPEKVLKEWSEKHKLSLFDSIEYLSAMETVCERIGVNENCT  362

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QNQVLRKGC+NLGLKV+ VPRN    HYCGSCGYGC  G+K+G   T+LVDAV+ G
Sbjct  363   QEGFQNQVLRKGCQNLGLKVDYVPRNSPGNHYCGSCGYGCPKGEKQGTQATWLVDAVDKG  422

Query  1131  AVILTGCQAEKFILEE-----DETARKKCLGVIAKS--KGNNKILRIEARATVSACGSLF  973
             AVI+TGC+AE+F+ E      +    KKCLGV+AK+   G    L+ EA+ T+SA G+L 
Sbjct  423   AVIITGCKAERFLFENNYRNANTRKNKKCLGVLAKTLNSGVTMKLQFEAKVTISAGGALL  482

Query  972   TPPLLISSGL-KNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV-----  811
             TPPL+ISSGL KNKNIG NLHLHPVL  WGYFPES ++ +GK ++GGIITS+H+V     
Sbjct  483   TPPLMISSGLTKNKNIGRNLHLHPVLMTWGYFPESKSDFKGKANEGGIITSVHRVPSSSN  542

Query  810   VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
                 +   AIIE   LGP+ F+A+ PW SGLD K+RM  Y RT +  +++RD   GQV  
Sbjct  543   DDSISDTRAIIETPLLGPSSFSALYPWESGLDYKQRMLNYPRTAHFITIIRDKAGGQVTT  602

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTE-ELESFL  454
               RI Y+++ IDK+N+R G++QALRIL+AAGA EVGT RS GQ+I C    +E E+E F+
Sbjct  603   ERRISYKLNSIDKENMRAGIQQALRILIAAGAVEVGTHRSGGQRIKCNENTSEKEIEEFI  662

Query  453   DGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLP  274
             D V    G +   ENW LY SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLP
Sbjct  663   DSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLP  722

Query  273   SAIGVNPMITILSTAYCISNGLAKSL  196
             +A+GVNPMITI STA+CISN +   L
Sbjct  723   TAVGVNPMITIQSTAFCISNRIVDFL  748



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/722 (57%), Positives = 531/722 (74%), Gaps = 20/722 (3%)
 Frame = -3

Query  2298  QALAAICEALIPPIPLPQD---SDD-----EAMCSFYSSSASQPPFPDEVAEVVMRRFLP  2143
             ++LA+ CEA++PP+  P++    DD     E + SF+ +S S+ P   E  E++ +R   
Sbjct  2     ESLASFCEAVLPPVSPPEEYCGGDDHYRNKETLRSFFFTSGSRTPVVRESIELITKRGTV  61

Query  2142  DAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLIL  1963
             +   + RLVL +L+TRLG+LL+CG  C   RWPF+  FSEL L++RE +L K  R  L+ 
Sbjct  62    ETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNWLLT  121

Query  1962  PLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQQTGRPLEKGIIET  1786
             P+R  F+ IK+A  F +FS    N  NPAWEAIG++V TNE  P +    RPL+KG++ET
Sbjct  122   PIRAAFVYIKVAFLFCFFSRVSPNGENPAWEAIGYNVITNENKPSETHKERPLQKGMVET  181

Query  1785  INENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVL  1606
             + E   TL ESL +KGL      + +T+ I+CD V+VGSG GGGVAA+VLA +G KVVV+
Sbjct  182   MQETDQTLLESLAQKGLEA--ETDHDTIRIKCDAVVVGSGSGGGVAASVLAKAGMKVVVM  239

Query  1605  EKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPN  1426
             EKG Y+    Y   EGP + +LYE+GG+L T DG +MV AG  VGGGSA+NWSA IKTP 
Sbjct  240   EKGSYYTPSTYPSTEGPGMDKLYENGGILPTIDGNMMVLAGATVGGGSAVNWSACIKTPK  299

Query  1425  NVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVES  1246
             +VL EWS ++KIPL+ + EY SAM+ V KRIGVTE C  EG QNQVLRKGCENLG+ VE+
Sbjct  300   SVLQEWSEDRKIPLYATKEYVSAMELVWKRIGVTERCELEGFQNQVLRKGCENLGINVEN  359

Query  1245  VPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDET---  1075
             V RN SE+HYCGSCGYGCR GDKKG D T+LVDAV++GAVILTGC+AE+FILE++     
Sbjct  360   VARNSSERHYCGSCGYGCRQGDKKGSDRTWLVDAVSHGAVILTGCKAERFILEKNGNNVG  419

Query  1074  -ARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHP  904
               +KKCLGV+AKS   N  K ++IEAR TVSA GSL TPPL+I SGLKN++IG NLHLHP
Sbjct  420   RKKKKCLGVMAKSLNGNIAKKIKIEARVTVSAAGSLLTPPLMIKSGLKNRHIGKNLHLHP  479

Query  903   VLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSP  733
             VL  WGYFP+   S    +G++++GGIITS+ KV+SE ++  AIIE  +LGPA F+ + P
Sbjct  480   VLMTWGYFPDKESSSFNFKGRSYEGGIITSMSKVLSEDSEVRAIIETPALGPASFSVLCP  539

Query  732   WTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRI  553
             WTSGLDMK+RM +YSRT N+ ++VRD GSG+V+  GRI Y +D+ID++NI  GLRQ+LRI
Sbjct  540   WTSGLDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVVDKIDRENITAGLRQSLRI  599

Query  552   LVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGS  373
             L+AAGA EVGT RSDGQK+ CKG+  + +E FLD V A  GP +  ENW++Y SAHQMGS
Sbjct  600   LIAAGAEEVGTHRSDGQKLICKGVDEKSIEEFLDSVSAEEGPKAMTENWSVYSSAHQMGS  659

Query  372   CRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             CR+G  E++GAID +GE WEA  L+VCDGSVLPSA+GVNPMITI+STAYCIS  + KS+ 
Sbjct  660   CRIGVDEDEGAIDLDGESWEADKLFVCDGSVLPSAVGVNPMITIMSTAYCISTRIVKSMT  719

Query  192   SG  187
              G
Sbjct  720   IG  721



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/727 (57%), Positives = 535/727 (74%), Gaps = 20/727 (3%)
 Frame = -3

Query  2319  GLSSSQYQALAAICEALIPPIPLPQD---SDD-----EAMCSFYSSSASQPPFPDEVAEV  2164
             G+++++ ++LA+ CEA++PP+  P++    DD     E + SF+ +S S+ P   E  E+
Sbjct  14    GITTAEMESLASFCEAVLPPVSPPEEYSGGDDHYRNKETLRSFFFTSGSRTPVVRESIEL  73

Query  2163  VMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKW  1984
             + +R   +   + RLVL +L+TRLG+LL+CG  C   RWPF+  FSEL L++RE +L K 
Sbjct  74    ITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQ  133

Query  1983  SRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQQTGRPL  1807
              R  L+ P+R  F+ IK+A  F +FS    N  N AWEAIG++V+TNE  P +    RPL
Sbjct  134   FRNWLLTPIRAAFVYIKVAFLFCFFSRVSPNGENLAWEAIGYNVNTNENKPSETHKERPL  193

Query  1806  EKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANS  1627
             EKG++ET+ E   TL ESL +KGL      + +T+ I+CD V+VGSG GGGVAA+VLA +
Sbjct  194   EKGMVETMQETEQTLVESLAQKGLEA--ETDHDTIRIKCDAVVVGSGSGGGVAASVLAKA  251

Query  1626  GHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWS  1447
             G KVVV+EKG Y+    Y   EGP + +LYE+GG+L T DG +MV AG  VGGGSA+NWS
Sbjct  252   GMKVVVMEKGSYYTPSTYPSTEGPGMNKLYENGGILPTIDGNMMVLAGATVGGGSAVNWS  311

Query  1446  ASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCEN  1267
             A IKTP +VL EWS ++KIPL+ + EY SAM+ V KRIGVTE C  EG QNQVLRKGCEN
Sbjct  312   ACIKTPKSVLQEWSEDRKIPLYATKEYVSAMELVWKRIGVTETCELEGFQNQVLRKGCEN  371

Query  1266  LGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILE  1087
             LG+ VE+V RN SE+HYCGSCGYGCR GDKKG D T+LVDAV++GAVILTGC+AE+FILE
Sbjct  372   LGINVENVARNSSERHYCGSCGYGCRQGDKKGSDRTWLVDAVSHGAVILTGCKAERFILE  431

Query  1086  ED--ETARKK--CLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIG  925
             ++     RKK  CLGV+AKS   N  K ++IEAR TVSA GSL TPPL+I SGLKN++IG
Sbjct  432   KNGNNVGRKKMKCLGVMAKSLNGNIAKKIKIEARVTVSAAGSLLTPPLMIKSGLKNRHIG  491

Query  924   SNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPA  754
              NLHLHPVL  WGYFP    S    +G++++GGIITS+ KV+SE ++  AIIE  +LGPA
Sbjct  492   KNLHLHPVLMTWGYFPNKESSSFNFKGRSYEGGIITSMSKVLSEDSEVRAIIETPALGPA  551

Query  753   GFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTG  574
              F+ + PW SGLDMK+RM +YSRT N+ ++VRD GSG+V+  GRI Y +D+ID++NI  G
Sbjct  552   SFSVLCPWISGLDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVVDKIDRENITAG  611

Query  573   LRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYC  394
             LRQ+LRIL+AAGA EVGT RSDGQK+ CKG+  + +E FLD V A  GP +  ENW++Y 
Sbjct  612   LRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKLIEEFLDSVSAEEGPKAMTENWSVYS  671

Query  393   SAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             SAHQMGSCR+G  E++GAID +GE WEA  L+VCDGSVLPSA+GVNPMITI+STAYCIS 
Sbjct  672   SAHQMGSCRIGVDEDEGAIDLDGESWEADKLFVCDGSVLPSAVGVNPMITIMSTAYCIST  731

Query  213   GLAKSLN  193
              + KS+N
Sbjct  732   RIVKSIN  738



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/733 (56%), Positives = 537/733 (73%), Gaps = 19/733 (3%)
 Frame = -3

Query  2337  RNSYNHGLSSSQYQALAAICEALIPPIPLPQD---SDD-----EAMCSFYSSSASQPPFP  2182
             RN     +++++ ++LA+ CEA++PP+P P++    DD     EA+ SFY++  SQ P  
Sbjct  8     RNFGQREITAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVA  67

Query  2181  DEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRRE  2002
              +  +++++R   +A    RLVL +L+TRLG+LL+CG  C    WPF+  FSEL L++RE
Sbjct  68    RQTIDLIIKRGTMEAYLAARLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELSLEKRE  127

Query  2001  AILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQ  1825
              +L K  R   + P+R  F+ IK+A  F +FS    N  NPAWEAIG+ V+ +E  P + 
Sbjct  128   RVLQKQFRNWFLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIGYRVNLDENKPSET  187

Query  1824  QTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaa  1645
             Q  RPLEKG++ET+ E   TL ESL +KGL      +A  + I+CD V+VGSG GGGVAA
Sbjct  188   QKERPLEKGVVETMKETEQTLLESLTQKGLESDTDHDA--IRIKCDAVVVGSGSGGGVAA  245

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
             +VLA +G KVVV+EKG Y    DY   EG  + +LYE+GG+L + DG +M+ AG  VGGG
Sbjct  246   SVLAKAGLKVVVMEKGSYCTESDYPPFEGHGMEKLYENGGILPSIDGCLMILAGATVGGG  305

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWSA IKTP +VL EWS + KIPLFG+ EY SAMD + KR+GVTE C KEG QNQVL
Sbjct  306   SAVNWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLMWKRMGVTETCEKEGFQNQVL  365

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQA  1105
             RKGCENLG+ V++V RN SEKHYCGSCGYGCR G+KKG D T+LVDAV++GAV+LTGC+A
Sbjct  366   RKGCENLGINVQNVARNSSEKHYCGSCGYGCRQGEKKGSDRTWLVDAVSHGAVVLTGCKA  425

Query  1104  EKFILEEDETARK-----KCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSG  946
             E+FILE +    +     KCLGV+AKS   N  K ++IEA+ TVSA GSL TPPL+ISSG
Sbjct  426   ERFILENNGNKNRGGKKMKCLGVLAKSLNGNIAKKIKIEAKVTVSAAGSLLTPPLMISSG  485

Query  945   LKNKNIGSNLHLHPVLFAWGYFPES-MAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAV  769
             L+N++IG NLHLHPVL AWG+FP+   +  +GK+++GGIITS+ KV+SE ++  AIIE  
Sbjct  486   LRNRHIGKNLHLHPVLMAWGFFPDKESSSFKGKSYEGGIITSMSKVLSEDSEVRAIIETP  545

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
             +LGPA F+ + PWTSG+DMK+RM +YSRT N+ ++VRD GSG+VK  GRI Y +D+ DK+
Sbjct  546   ALGPASFSVLCPWTSGVDMKKRMSRYSRTANLITIVRDRGSGEVKTEGRISYVVDKTDKE  605

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEEN  409
             N+R GLRQ+LRIL+AAGA EVGT RSDGQK+ CKG+  + +E FLD V A  GP +  E 
Sbjct  606   NLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGPKAMTEK  665

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
             W +Y SAHQMGSCR+G  E++GA+D NGE WEA+ L+VCDGSVLPSA+GVNPMITI+STA
Sbjct  666   WGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDGSVLPSAVGVNPMITIMSTA  725

Query  228   YCISNGLAKSLNS  190
             YCIS  + KS+ +
Sbjct  726   YCISTRIVKSMTT  738



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/735 (56%), Positives = 540/735 (73%), Gaps = 21/735 (3%)
 Frame = -3

Query  2337  RNSYNHGLSSSQYQALAAICEALIPPIPLPQD---SDD-----EAMCSFYSSSASQPPFP  2182
             RN  +  +++++ ++LA+ CEA++PP+P P++    DD     EA+ SFY++  SQ P  
Sbjct  8     RNFGHREVTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVA  67

Query  2181  DEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRRE  2002
              +  +++++R   +A    RLVL +L+TRLG+LL+CG  C    WPF+  FSEL L++RE
Sbjct  68    RQTIDLIIKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEKRE  127

Query  2001  AILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQ  1825
              +L K  R   + P+R  F+ IK+A  F +FS    N  NPAWEAIG+ V+ +E  P + 
Sbjct  128   RVLQKQFRNWFLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIGYRVNLDENKPSET  187

Query  1824  QTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaa  1645
             +  RPLEKG++ET+ E   TL ESL +KGL      +A  + I+CD V+VGSG GGGVAA
Sbjct  188   RKERPLEKGVVETMKETEQTLLESLTQKGLEADTDHDA--IRIKCDAVVVGSGSGGGVAA  245

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
             +VLA +G KV+V+EKG Y+   DY   EG  + +LYE+GG+L + DG +M+ AG  VGGG
Sbjct  246   SVLAKAGLKVIVMEKGSYYTESDYPPFEGHGMEKLYENGGILPSIDGCLMILAGATVGGG  305

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWSA IKTP +VL EWS + KIPLFG+ EY SAMD V KR+GVTE C KEG QNQVL
Sbjct  306   SAVNWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLVWKRMGVTETCEKEGFQNQVL  365

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQA  1105
             RKGCENLG+ V++V RN SEKHYCGSCGYGCR G+KKG D T+LVDAV++GAV+LTGC+A
Sbjct  366   RKGCENLGINVQNVARNSSEKHYCGSCGYGCRQGEKKGSDRTWLVDAVSHGAVVLTGCKA  425

Query  1104  EKFILEEDETARK-----KCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSG  946
             E+FILE++    +     KCLGV++KS   N  K ++IEA+ TVSA GSL TPPL+ISSG
Sbjct  426   ERFILEKNGNKNRGGKKMKCLGVLSKSLNGNIAKKIKIEAKVTVSAAGSLLTPPLMISSG  485

Query  945   LKNKNIGSNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             L+N++IG NLHLHPVL AWGYF +   S +  +GK+++GGIITS+ KV+SE ++  AIIE
Sbjct  486   LRNRHIGKNLHLHPVLMAWGYFSDKESSSSNFKGKSYEGGIITSMSKVLSEDSEVRAIIE  545

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +LGPA F+ + PWTSG+DMK+RM +YSRT N+ ++VRD GSG+VK  GRI Y +D+ D
Sbjct  546   TPALGPASFSVLCPWTSGVDMKKRMSRYSRTANLITIVRDRGSGEVKTEGRISYVVDKTD  605

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+N+R GLRQ+LRIL+AAGA EVGT RSDGQK+ CKG+  + +E FLD V A  GP +  
Sbjct  606   KENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGPKAMT  665

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             E W +Y SAHQMGSCR+G  E++GA+D NGE WEA+ L+VCDGSVLPSA+GVNPMITI+S
Sbjct  666   EKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDGSVLPSAVGVNPMITIMS  725

Query  234   TAYCISNGLAKSLNS  190
             TAYCIS  + KS+ +
Sbjct  726   TAYCISTRIVKSMTT  740



>gb|KFK39637.1| hypothetical protein AALP_AA3G269600 [Arabis alpina]
Length=744

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/729 (58%), Positives = 539/729 (74%), Gaps = 21/729 (3%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIPLP----QDSDD-----EAMCSFYSSSASQPPFPDEVAEV  2164
              ++++ ++LA+ CEA++PP+P P       DD     E++ SFYS+S SQ P   +  E+
Sbjct  15    FTATEMESLASFCEAVLPPVPPPPEELSGEDDHHRKKESLRSFYSTSGSQTPILRQTIEL  74

Query  2163  VMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKW  1984
             +++R   +A  + RLVL +L+TRLG+LL+CG  C   RWPF+  FSEL L+RRE ++ K 
Sbjct  75    IVKRGTIEAYLMSRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLERRERVIQKQ  134

Query  1983  SRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQQTGRPL  1807
              +  L+ P R  F+ +K A  F +FS    N  NPAWEAIG+ V+  E  P +    RPL
Sbjct  135   FKNWLLTPFRAAFVYLKSAFLFCFFSRVSSNGENPAWEAIGYCVNLEENKPSETHKERPL  194

Query  1806  EKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANS  1627
             EKG++ET+ E   TL ESL +KGL V    +A  + I+CD VIVGSG GGGVAA+VLA S
Sbjct  195   EKGMVETMKETNQTLLESLAQKGLEVDHDTDA--IRIKCDAVIVGSGSGGGVAASVLAKS  252

Query  1626  GHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWS  1447
             G KVVV+EKG YF   DY+  EGPS+ ++YE+GG+L + DG  MV AG  VGGGSA+NWS
Sbjct  253   GLKVVVMEKGSYFTPLDYTPFEGPSVEKMYENGGVLPSLDGNFMVLAGATVGGGSAVNWS  312

Query  1446  ASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCEN  1267
             A IKTP +VL EWS +QKIPLF + EY SAM+ VCKRIGVTE C  E  QNQ+LRKGCEN
Sbjct  313   ACIKTPKSVLQEWSEDQKIPLFATKEYVSAMELVCKRIGVTEKCETESFQNQILRKGCEN  372

Query  1266  LGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILE  1087
             LG+ VE+VPRN SE+HYCGSCG+GCR GDKKG D T+LVDAV++GAVILTGC+AE+FILE
Sbjct  373   LGINVENVPRNSSERHYCGSCGHGCRQGDKKGSDRTWLVDAVSHGAVILTGCKAERFILE  432

Query  1086  EDET----ARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIG  925
             ++       + KCLGV+AKS   N  K ++IEA+ TVSA GSL TPPL+ISSGLKN++IG
Sbjct  433   KNNNRVGGKKMKCLGVMAKSLNGNITKKIKIEAKVTVSAAGSLLTPPLMISSGLKNQHIG  492

Query  924   SNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPA  754
              NLHLHPVL AWGYFPE   S  + +GK+++GGIITS+ KV+SE ++  AIIE  +LGPA
Sbjct  493   KNLHLHPVLMAWGYFPEKESSNYDFKGKSYEGGIITSVSKVLSEDSEVRAIIETPALGPA  552

Query  753   GFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTG  574
              F+A+ PWTSGLDMK RM +YSRT N+ ++VRD GSG+VK  GRI+Y +D+ D++N++ G
Sbjct  553   SFSALCPWTSGLDMKRRMSRYSRTANLITIVRDCGSGEVKTEGRIRYTVDKTDRENLKAG  612

Query  573   LRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYC  394
             LRQ+LRIL+AAGA EVGT  SDGQ++ CKG+  + +E FLD V A  GP S  ENW +Y 
Sbjct  613   LRQSLRILIAAGAEEVGTNTSDGQRLICKGVDEKSIEEFLDSVNAEEGPKSMTENWNVYS  672

Query  393   SAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             SAHQMGSCR+G  E++GA+D NGE WEA+ L+VCDGSVLPSAIGVNPMITI+STAYCIS 
Sbjct  673   SAHQMGSCRIGEDEKEGALDLNGESWEAEKLFVCDGSVLPSAIGVNPMITIMSTAYCIST  732

Query  213   GLAKSLNSG  187
              + +S+  G
Sbjct  733   RITQSMTKG  741



>gb|KHG08529.1| Long-chain-alcohol oxidase FAO2 [Gossypium arboreum]
Length=684

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/671 (61%), Positives = 514/671 (77%), Gaps = 12/671 (2%)
 Frame = -3

Query  2361  HPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPF  2185
             HPLLRGGRR  +Y HG SS+Q ++LAA CEALIPP+PL       ++ +FY +S ++PP 
Sbjct  12    HPLLRGGRRKTTYTHGFSSAQIRSLAATCEALIPPLPLDSAHQASSLDAFYKASGAEPPL  71

Query  2184  PDEVAEVVMRRFLPDAVFIF-RLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKR  2008
             PDEVAE++++R +   V  F ++VL ++S RLG+LLLCG+ C D +WPFIH FSELP++R
Sbjct  72    PDEVAEMMVKRVVEPRVLSFVKVVLAVISFRLGALLLCGWDCCDWKWPFIHKFSELPVER  131

Query  2007  REAILLKWSRE-TLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPP  1831
             RE IL+KWS      LPLR VF  IK  C FI+FS TDEN  NP+W+AIG++VD  +   
Sbjct  132   REKILMKWSSNGHHRLPLRAVFALIKTYCLFIFFSMTDENSENPSWKAIGYNVDKRQKRV  191

Query  1830  DQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggv  1651
                 GR   KGIIET++E+ +T  +SL +KGL VTE  + N   I+CDVVIVGSGCGGGV
Sbjct  192   SSPHGR---KGIIETMHEDDSTFVQSLTEKGLQVTEDPDHNVFKIKCDVVIVGSGCGGGV  248

Query  1650  aaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVG  1471
             AAAVLA+SGHKVVV+EKG+YF + DY+ LEGPS+ ELYE GG LTTT+GK M+ AG+ VG
Sbjct  249   AAAVLASSGHKVVVIEKGNYFATTDYTSLEGPSMSELYEYGGFLTTTNGKFMIMAGSTVG  308

Query  1470  GGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQ  1291
             GGSAINWSASIKTPNNVL EWSL  KIPLF SSEY++AMDAV +R+GVTE C++EGLQNQ
Sbjct  309   GGSAINWSASIKTPNNVLKEWSLGHKIPLFRSSEYENAMDAVYQRLGVTENCTEEGLQNQ  368

Query  1290  VLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGC  1111
             VLRKGCENLGLKVE+VPRN  + HYCGSC  GCRTGDKKG  TT+LVDA   GAVILT C
Sbjct  369   VLRKGCENLGLKVEAVPRNSPQDHYCGSCNLGCRTGDKKGTATTWLVDAQGCGAVILTAC  428

Query  1110  QAEKFIL---EEDETARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSG  946
             +A++ IL    ED   RKKCLGV+A S   N  K L+ EA+ T+SACGSL TPPL+ISSG
Sbjct  429   KADRLILANNNEDARRRKKCLGVVATSLNKNLTKKLQFEAKTTISACGSLLTPPLMISSG  488

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA-AIIEAV  769
             LKN NIG NLHLHP L AWGYFPE    ++GK+++GGIITS H++VSE +    AII+A 
Sbjct  489   LKNPNIGRNLHLHPALVAWGYFPEDETGIKGKSYEGGIITSFHRIVSEESNNVHAIIQAP  548

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
             +LGPA FAA+SPW SG ++KERM +Y R  ++F+++RD GSG+V + G+I+YR+ ++DK+
Sbjct  549   ALGPASFAAISPWVSGRELKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIKYRLSEVDKE  608

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEEN  409
             N++ GLRQ LR+L+AAGA EVGT+RSDGQ+I CKG+  E L+ FLD V   GG  S +E 
Sbjct  609   NLKIGLRQVLRVLIAAGAVEVGTYRSDGQRIKCKGLTEESLQEFLDNVPVVGGLSSKDEY  668

Query  408   WTLYCSAHQMG  376
             WTLY +A Q+G
Sbjct  669   WTLYITAQQIG  679



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/747 (56%), Positives = 535/747 (72%), Gaps = 17/747 (2%)
 Frame = -3

Query  2379  MNERKCHPLLRGG--RRNSYNHGLSSSQYQALAAICEALIPPIPLP-----QDSDDEAMC  2221
             M  ++ H  LR    ++N     LSSS+ ++L +ICE   PP+  P      D  + ++ 
Sbjct  1     MKGKQSHARLRKSWEKKNYDRQLLSSSEMESLISICETFFPPLDPPSKLDHHDQINNSIK  60

Query  2220  SFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPF  2041
              F+ SSASQ P P+EVAEV+  R L +AV + R+VL ++STRLG+LLLCGF+CF   WP+
Sbjct  61    YFFQSSASQKPIPNEVAEVMKDRGLVEAVILVRVVLWLISTRLGTLLLCGFLCFGKEWPY  120

Query  2040  IHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIG  1861
             I  FS LP++RRE IL  WS      PLR+VF  +K  C +  FS  D++ +NPAWEAI 
Sbjct  121   ITKFSHLPIERRERILKNWSSHRFFSPLRLVFYFLKSLCLYFCFSLVDDHAHNPAWEAID  180

Query  1860  FHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvv  1681
             +  DT       Q  RPLE GIIET  E  TTL +SL  KGL+VTE    N   I+CDVV
Sbjct  181   YKPDTTNSKAINQE-RPLENGIIETFYETPTTLLQSLTSKGLSVTEDHIDNLYRIKCDVV  239

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             IVGSGCGGGVAAA+LA +G KVVVLEKG+Y+ + DYS LEGPS+ EL E GGM+ TTDG 
Sbjct  240   IVGSGCGGGVAAAILAGAGQKVVVLEKGNYYTAPDYSSLEGPSMDELLEKGGMIPTTDGA  299

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
             VM+ AG+ VGGG+A+NWSA++ TP+ VL EWS E  + LFGS +Y+ AM +V +R+GVT 
Sbjct  300   VMLLAGSTVGGGTAVNWSAALNTPDPVLKEWSEEHGLSLFGSPQYKFAMQSVTQRLGVTT  359

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
              C KEG QNQVLRKGCENLGL+ + VPRN SE HYCGSC YGCR+ DK+G D T+LVDAV
Sbjct  360   ECVKEGFQNQVLRKGCENLGLEADRVPRNSSESHYCGSCYYGCRSADKQGTDVTWLVDAV  419

Query  1140  NNGAVILTGCQAEKFILEEDETARK-KCLGVIAKSKGN--NKILRIEARATVSACGSLFT  970
             N GAVI+TGC+AEK  L +    R+ +C+GV+A+S  N   + L+IEA+ T+SACGSL T
Sbjct  420   NLGAVIITGCKAEKLRLVKHGRRRENRCIGVVARSLNNEIKRELQIEAKVTISACGSLRT  479

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPES--MAEMEGKNHQGGIITSIHKVVSEGT  796
             PPLL+SSGL+NK IG NLHLHP L  WGYFP     +E EGK+++GG+ITS H+V+ +  
Sbjct  480   PPLLMSSGLRNKKIGKNLHLHPSLMVWGYFPPQGPTSEFEGKSYEGGLITSAHRVILDQR  539

Query  795   KQA---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
               +   A+IE  +LGPA  AA+SPW SG D+K+RM +YSRT ++F MVRD GSG+VK   
Sbjct  540   PNSMPRALIETPALGPAACAALSPWESGNDIKKRMLRYSRTAHLFVMVRDKGSGEVKSER  599

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
             RI Y + Q D++N+  GLR+AL+IL+AAGA EVGT+RSDGQ+I C G   EE+E FL  V
Sbjct  600   RISYELTQEDRENMTAGLRRALKILIAAGAVEVGTYRSDGQRIECIGKNEEEIEEFLGSV  659

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
              AT GPM+    W +YC+AHQMGSCRM   E +GA+D NGE WEA+GL+VCDGSVLPSA+
Sbjct  660   SATKGPMAA-CFWAVYCTAHQMGSCRMSKRENEGAVDENGESWEAEGLFVCDGSVLPSAV  718

Query  264   GVNPMITILSTAYCISNGLAKSLNSGK  184
             GVNPMITI STAYCI+  LA+SL  G+
Sbjct  719   GVNPMITIQSTAYCIAKKLAESLKKGE  745



>dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/751 (55%), Positives = 525/751 (70%), Gaps = 16/751 (2%)
 Frame = -3

Query  2397  FKREKKMNERKCHPLLRGG--RRNSYNHGLSSSQYQALAAICEALIPPIP-----LPQDS  2239
              + +KK   R+ HPLLRGG  R   Y HG S++Q  AL A+C AL+P +P     L    
Sbjct  1     MEEDKKQRRRRGHPLLRGGGPRSEPYTHGFSATQMMALTAVCGALVPSLPPDGHHLAMAD  60

Query  2238  DDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCF  2059
             + +A+  F  +SA+ PP PDEVA+++    L +A+ + R VL +L TRLG+L LCG  C 
Sbjct  61    NGKAVREFLLASAADPPVPDEVAQLMSAMCLREALALVRTVLWLLGTRLGTLALCGARCL  120

Query  2058  DGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNP  1879
                 PF+H F+E+P+ RRE  L +WSRET+I PLR+ F+ +K+ C ++++SWTD+N  NP
Sbjct  121   SWSSPFVHRFAEMPVDRREDALRRWSRETMIPPLRLFFLLVKVYCLYVFYSWTDDNSENP  180

Query  1878  AWEAIGFHVDTNEVPPDQQTG---RPLEKGIIETINENGTTLKESLIKKGLNVTESQNAN  1708
              W+AIG+   T+E    ++     RPLE G++ETI++   +L  SL +KGL VTE    N
Sbjct  181   HWQAIGYSPPTDEAAEQEEQASIKRPLEDGVVETIHQTDASLPTSLAEKGLAVTEDAARN  240

Query  1707  TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESG  1528
                I CDVVIVGSGCGGGVAAAVLA +GHKVVV+EKG+YF + DY+ +EGPS+ +LYE G
Sbjct  241   VCRIECDVVIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTARDYTSIEGPSMSQLYEYG  300

Query  1527  GMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDA  1348
             G ++T  G  ++ AG+ VGGGSA+NWSA IKTP++V  EW+    +PLF  SEY +AMD 
Sbjct  301   GFMSTLSGSGLLLAGSTVGGGSAVNWSACIKTPDSVRKEWAAAHGLPLFDKSEYTAAMDV  360

Query  1347  VCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGV  1168
             V KR+GVT  C +EG QN+VLRKGCE LG  VE V RN SE H+CGSCGYGCRTGDK+G 
Sbjct  361   VFKRLGVTSGCKEEGRQNKVLRKGCEKLGYNVEPVSRNSSEGHFCGSCGYGCRTGDKRGT  420

Query  1167  DTTYLVDAVNNGAVILTGCQAEKFILEEDETAR-KKCLGVIAKSKGN--NKILRIEARAT  997
             DTT+LVDAV+ GAVILTG +AEK +  +    R K+C GV+A S      + L + A+ T
Sbjct  421   DTTWLVDAVSRGAVILTGSKAEKLLFTDAAGKRGKRCAGVVAASSNPAITRKLEVRAKVT  480

Query  996   VSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFP-ESMAEMEGKNHQGGIITSI  820
             V+A GSL TP LL  SGLKN +IG NLHLHP+  AWGYFP + M E++GK ++GGIITS+
Sbjct  481   VAAGGSLLTPVLLRGSGLKNPHIGKNLHLHPIAMAWGYFPPDKMPELKGKMYEGGIITSL  540

Query  819   HKVVSEGT--KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGS  646
             HKV ++G      AI+E   +GPA      PW SG DMKERM  Y RTV+IFS+VRDHGS
Sbjct  541   HKVEADGDGLPHRAILETPLMGPAAAGTQFPWVSGRDMKERMLNYGRTVHIFSLVRDHGS  600

Query  645   GQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEEL  466
             G V    RI Y +D +D++N R GLR+ALRILVAAGA EVGT RSDGQK+ CKG   EE+
Sbjct  601   GTVHGERRIAYHLDPVDRENQREGLRRALRILVAAGATEVGTHRSDGQKLRCKGATDEEV  660

Query  465   ESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDG  286
             E FLDGV    GP S  E W+L C+AHQMGSCRM AT  DGA+D  GE WE + LYVCDG
Sbjct  661   EEFLDGVSGVRGPQSKSEKWSLCCTAHQMGSCRMAATAGDGAVDTRGESWEVERLYVCDG  720

Query  285   SVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             SVLP A+GVNPMITI S AYC++ G+A+ L 
Sbjct  721   SVLPGAVGVNPMITIQSVAYCLATGIAEQLR  751



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/667 (60%), Positives = 511/667 (77%), Gaps = 8/667 (1%)
 Frame = -3

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             VAE   +R L + V + R+VL IL+TRLG+LLLCG +CF  +WPF+  FSE+PL++RE  
Sbjct  2     VAETARKRGLIEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEA  61

Query  1995  LLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTG  1816
             L +W +  +  P+R     IK+   +++FS  D N +NP+WEAI +  + +E P      
Sbjct  62    LRRWFKNKVFTPVRAALALIKLVFLYVFFSRVDVNGDNPSWEAIKYVPEIDEHPSKSSDA  121

Query  1815  RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavl  1636
             RPLEKGIIE  NE  ++ K+SL++KG+ +    + +TL++ CDVV+VGSGCGGGVAAA+L
Sbjct  122   RPLEKGIIEPNNETESSFKKSLLQKGIRIA-GDDGHTLSVECDVVVVGSGCGGGVAAAIL  180

Query  1635  ANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAI  1456
             A+SG KV++LEKG+YF++ DYS LEGPSL +LYE+G +  T DGKV++ AG+ VGGGSA+
Sbjct  181   ASSGQKVMILEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGKVLILAGSTVGGGSAV  240

Query  1455  NWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKG  1276
             NWSASIKTP++VL EW+   KIP FG+SEYQ AMDAVCKRIGV+E C +EG QNQVLRKG
Sbjct  241   NWSASIKTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEGFQNQVLRKG  300

Query  1275  CENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKF  1096
             CENLGLKVE VPRN +  HYCGSCGYGCR G+K+G D+T+LVDAVN+GAVI+T C+AE+F
Sbjct  301   CENLGLKVEKVPRNSTTGHYCGSCGYGCRKGEKQGTDSTWLVDAVNHGAVIITNCKAERF  360

Query  1095  ILEEDETA---RKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKN  931
             ILE ++     + KCLGVIA    +N  K L I+A+AT+SACG+L TPPL+ISSGL+NK+
Sbjct  361   ILERNKNGSMKKSKCLGVIANVWSDNITKKLHIKAKATISACGALLTPPLMISSGLRNKH  420

Query  930   IGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGP  757
             IG NLHLHPVL  WGYFPES +  +GK+++GGIITS+HKVVSE +K     IIE   LGP
Sbjct  421   IGRNLHLHPVLMTWGYFPESNSGFKGKSYEGGIITSVHKVVSEESKSNPKTIIETPLLGP  480

Query  756   AGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRT  577
                A + PW SGLD+K+RM KYSRT +  ++VRD GSG V+  GR+ Y + + D++N++ 
Sbjct  481   GSCAVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLSEEDRENLKK  540

Query  576   GLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLY  397
             GLRQ+LRILVAAGA EVGT RSDGQ++ CKGI  EELE FLD V A GG +S  ++W +Y
Sbjct  541   GLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLLSLSKDWNVY  600

Query  396   CSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCIS  217
              SAHQMGSC++G +E +GAID NGE WEA+GL+VCD SVLP+A+GVNPMITI STAYCIS
Sbjct  601   TSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCIS  660

Query  216   NGLAKSL  196
             N +A  L
Sbjct  661   NRIAALL  667



>ref|XP_006406028.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
 gb|ESQ47481.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
Length=746

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/735 (56%), Positives = 536/735 (73%), Gaps = 22/735 (3%)
 Frame = -3

Query  2334  NSYNHGLSSSQYQALAAICEALIPPIPLPQDS----DD-----EAMCSFYSSSASQPPFP  2182
             N  +  ++ ++ +AL + CEA++PP+P P +     DD     EA+ SFYS+S SQ P  
Sbjct  10    NFGHRDVTVAEMEALVSFCEAVLPPVPPPPEEFSGEDDHHRNKEALRSFYSTSGSQTPVV  69

Query  2181  DEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRRE  2002
              +  E++ +R   +A  I RLVL +L+TRLG+LL+CG  C   +WPF+  FSEL L++RE
Sbjct  70    RQTIELITKRGTIEAYLITRLVLFLLATRLGTLLICGRECLVTKWPFVEKFSELSLEKRE  129

Query  2001  AILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQ-  1825
              +  K  +     P+R  F+ IK+A  F +FS    N  NP+WEAIG+  + ++  P + 
Sbjct  130   RVFQKQFKNWFFTPIRAAFVYIKVAFLFCFFSRVSPNGENPSWEAIGYRANLDQKKPSET  189

Query  1824  QTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaa  1645
             Q  RPLEKGI+ET+ E   TL ESL +KGL      +A  +TI+CD V+VGSG GGGVAA
Sbjct  190   QKERPLEKGIVETMKETEQTLLESLAQKGLEADADHDA--ITIKCDAVVVGSGSGGGVAA  247

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
             +VLA SG KVVV+EKG YF   DY   EGP + +LYE+GG+L + DG VM+ AG+ VGGG
Sbjct  248   SVLAKSGLKVVVMEKGSYFTESDYPPFEGPGMDKLYENGGILPSVDGNVMILAGSTVGGG  307

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWSA IKTP +VL+EWS +QKIPLF + EY SAM+ V KRIGVTE C KEG QNQ+L
Sbjct  308   SAVNWSACIKTPKSVLHEWSEDQKIPLFATKEYVSAMELVWKRIGVTERCEKEGFQNQIL  367

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQA  1105
             RKGCENLG+ VE+V RN SEKHYCGSCGYGCR G+KKG D T+LVDAV++GAVILTGC+A
Sbjct  368   RKGCENLGINVENVARNSSEKHYCGSCGYGCRQGEKKGSDRTWLVDAVSHGAVILTGCKA  427

Query  1104  EKFILEEDETARK-----KCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSG  946
             E+FILE++    +     KCLGV+AKS   N  K ++IEA+ TVSA G+L TPPL+ISSG
Sbjct  428   ERFILEKNNCKNRGGKKMKCLGVMAKSLNGNILKKIKIEAKVTVSAAGALLTPPLMISSG  487

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMA---EMEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             L+N++IG NLHLHPVL AWGYFPE  +     +G  ++GGIITS+ KV+SE ++  AIIE
Sbjct  488   LRNRHIGKNLHLHPVLMAWGYFPEKASPNSNFKGNCYEGGIITSMSKVLSEDSEVRAIIE  547

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +LGPA FA + PW SGLDMK+RM +YSRTVN+ ++VRD GSG+VK  GR+ Y +D+ D
Sbjct  548   TPALGPASFAVLCPWISGLDMKKRMSRYSRTVNLITIVRDRGSGEVKTEGRVSYVVDKTD  607

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+N+  GLRQ+LRIL+ AGA EVGT RSDGQK+ CKG+  + +E FLD V A  GP +  
Sbjct  608   KENLNAGLRQSLRILIQAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVNAEEGPKAMT  667

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             E W++Y SAHQMGSC++G  EE+GAID NGE WEA+ L+VCDGS LPSA+GVNPMITI++
Sbjct  668   EKWSVYSSAHQMGSCKIGEDEEEGAIDLNGESWEAEKLFVCDGSALPSAVGVNPMITIMA  727

Query  234   TAYCISNGLAKSLNS  190
             TAYCIS  +AKS+ +
Sbjct  728   TAYCISTRIAKSMTT  742



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/726 (56%), Positives = 527/726 (73%), Gaps = 16/726 (2%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIPLPQD--------SDDEAMCSFYSSSASQPPFPDEVAEVV  2161
             ++ ++ ++LA+ CEA++PP+  P++         + EA+ SFYS+S SQ P   +  E++
Sbjct  15    ITEAEMESLASFCEAVLPPVLPPEEVSSEGDNHRNKEALRSFYSTSGSQTPVLRQSIELI  74

Query  2160  MRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWS  1981
              +R   +A    RL+L +L+TRLG+LL+CG  C   RWPF+  FSEL L++RE +L K  
Sbjct  75    TKRGTIEAYLATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQF  134

Query  1980  RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQQTGRPLE  1804
             R   + P+R  F+ IK+A  F +FS    +  NPAWEAIG+HV+ +E  P + +  RPLE
Sbjct  135   RNWFLTPIRAAFVYIKVAFLFCFFSRVTPDGENPAWEAIGYHVNLDENKPSETRKERPLE  194

Query  1803  KGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSG  1624
             KGI+ET+ E   TL E L +KGL        + + I+CD V+VGSG GGGVAA+VLA SG
Sbjct  195   KGIVETMEETEQTLLELLAQKGLEADLDTVHDAIRIKCDAVVVGSGSGGGVAASVLAKSG  254

Query  1623  HKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSA  1444
              KVVVLEKG YF   DY   EGP L +LYE+GG+L + DG +MV AG  VGGGSA+NWSA
Sbjct  255   LKVVVLEKGSYFTPSDYRPFEGPGLDKLYENGGILPSVDGNLMVLAGATVGGGSAVNWSA  314

Query  1443  SIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENL  1264
              IKTP +VL EWS +Q IPLF + EY SAM+ V +R+GVT+ C  E  QNQVLRKGC+NL
Sbjct  315   CIKTPKSVLQEWSEDQNIPLFATKEYVSAMEVVWERMGVTDKCEMESFQNQVLRKGCQNL  374

Query  1263  GLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEE  1084
             G+ VE+VPRN SE HYCGSCGYGC  GDKKG D T+LVDAV+ GAVILTGC+AE+FILE+
Sbjct  375   GVNVENVPRNSSESHYCGSCGYGCIQGDKKGSDRTWLVDAVSQGAVILTGCKAERFILEK  434

Query  1083  D---ETARK-KCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIGS  922
             +   E  +K KCLGV+AKS   N  K L+IEA+ TVSA G+L TPPL+ISSGL+N++IG 
Sbjct  435   NSGNEGGKKMKCLGVMAKSLNGNIAKTLKIEAKVTVSAGGALLTPPLMISSGLRNRHIGK  494

Query  921   NLHLHPVLFAWGYFP-ESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFA  745
             NLHLHPVL AWGYFP +  +  +GK+++GGIITS+ KV+SE ++  AIIE  +LGP  F+
Sbjct  495   NLHLHPVLMAWGYFPMKESSNFKGKSYEGGIITSVSKVLSEDSEVRAIIETPALGPGSFS  554

Query  744   AVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQ  565
              + PWTSGLDMK+RM +YSRT ++ ++VRD GSG+VK  GRI Y +D+ D+DN++ GLRQ
Sbjct  555   VLCPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRISYAVDKTDRDNLKAGLRQ  614

Query  564   ALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAH  385
             +L+IL+AAGA EVGT RSDGQ++ CKG     +E FLD V    GP    E W +Y SAH
Sbjct  615   SLKILIAAGAEEVGTHRSDGQRLICKGSDENSIEEFLDSVSTEEGPKGMTEKWNVYSSAH  674

Query  384   QMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLA  205
             QMGSCR+G  E++GAID NGE WEA+ L+VCD S LPSA+GVNPMIT++STAYCIS  +A
Sbjct  675   QMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCISTRIA  734

Query  204   KSLNSG  187
             KS+ +G
Sbjct  735   KSMTAG  740



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/695 (58%), Positives = 510/695 (73%), Gaps = 11/695 (2%)
 Frame = -3

Query  2238  DDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCF  2059
             + EA+ SFYS+S SQ P   +  E++ +R   +A  + RL+L +L+TRLG+LL+CG  C 
Sbjct  53    NTEALWSFYSTSGSQTPVLRQSIELLTKRATMEACLVTRLILFLLATRLGTLLICGTECL  112

Query  2058  DGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNP  1879
               RWPF+  FSEL L++RE ++ K  R  ++ P+R  F+ IK+   F +FS       NP
Sbjct  113   VTRWPFVEKFSELSLEKRERVIQKQFRNWILTPIRAGFVYIKVIFLFCFFSRVSPKGENP  172

Query  1878  AWEAIGFHVDTNEVPPDQQ-TGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTL  1702
             AWEAIG+HV+ +E  P      RPLEKGI+ET+NE   TL ESL +KGL      + +T+
Sbjct  173   AWEAIGYHVNLDENKPSATYKARPLEKGIVETMNETEQTLLESLARKGLEADHDMDQDTI  232

Query  1701  TIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGM  1522
              I+CD V++GSG GGGVAA+VLA SG KVVVLEKG Y+   DY   EGP + +LYE+GG+
Sbjct  233   RIKCDAVVIGSGSGGGVAASVLAKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGI  292

Query  1521  LTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVC  1342
             L T DG +MV AG  VGGGSA+NWSA IKTP +VL EWS +QKIP +G+ EY SAMD V 
Sbjct  293   LPTVDGNLMVLAGATVGGGSAVNWSACIKTPKSVLQEWSDDQKIPFYGTKEYVSAMDVVW  352

Query  1341  KRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDT  1162
             KR+GVTE C  E  QNQ+LRKGCEN+G+ VE+V RN SE HYCGSCGYGC+ GDKKG D 
Sbjct  353   KRMGVTEKCEMESFQNQILRKGCENIGVHVENVARNSSEGHYCGSCGYGCKQGDKKGSDQ  412

Query  1161  TYLVDAVNNGAVILTGCQAEKFILEED-----ETARKKCLGVIAKSKGNN--KILRIEAR  1003
             T+LVDAV++GAV+LTGC+AE+F+LE+      E  + KCLGV+AKS   N  K L+IEA+
Sbjct  413   TWLVDAVSHGAVVLTGCKAERFVLEKKGGSNVEGKQMKCLGVMAKSLNGNIAKKLKIEAK  472

Query  1002  ATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGI  832
              TVSA GSL TPPL+ISSGL+N+NIG NLHLHP L +WGYFPE   S    +GK+++GGI
Sbjct  473   VTVSAGGSLLTPPLMISSGLRNRNIGKNLHLHPTLMSWGYFPEKESSSLSFKGKSYEGGI  532

Query  831   ITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDH  652
             ITS+ KV+SE ++  AIIE  SLGP  F+ + PWTSGLDMK RM +YSRT ++ ++VRD 
Sbjct  533   ITSVSKVLSEDSEVRAIIETASLGPGSFSVLFPWTSGLDMKTRMARYSRTASLITIVRDR  592

Query  651   GSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTE  472
             GSG+VK  GRI Y +D+ DK+NI+ GLRQ+LRIL+AAGA EVGT RSDGQ + CKG+  +
Sbjct  593   GSGEVKTEGRISYVVDKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEK  652

Query  471   ELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVC  292
              +E FLD V +  GP    E W +YCSAHQMGSCR+G  E++GAID NGE WEA+ L+VC
Sbjct  653   SIEEFLDSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVC  712

Query  291   DGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSG  187
             D S LPSA+GVNPMIT++STAYCIS  +AKS+ +G
Sbjct  713   DASALPSAVGVNPMITVMSTAYCISTRIAKSMTTG  747



>gb|ACN27562.1| unknown [Zea mays]
 gb|AFW63032.1| oxidoreductase [Zea mays]
Length=768

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/758 (54%), Positives = 525/758 (69%), Gaps = 28/758 (4%)
 Frame = -3

Query  2376  NERKCHPLLRGG--RRNSYNHGLSSSQYQALAAICEALIPPIPL----------PQDSDD  2233
             N ++ HPLLRGG  +R  Y HG S+SQ  AL A+C AL+P +P           PQ  +D
Sbjct  5     NNKRGHPLLRGGSAKRERYTHGFSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEED  64

Query  2232  ----EAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFV  2065
                 + +  F  +SA+ PP P EVAE++ R+ LP+A+ + R VL +L TRLGSL LCG  
Sbjct  65    GGSSKVVEEFLLASAADPPVPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGAR  124

Query  2064  CFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYN  1885
             C   R+PF+  F ELPL+ REA L +WSR TL+ PLR+ F+  K+ C ++++SWTDEN  
Sbjct  125   CLSWRFPFVRRFDELPLEHREAALRRWSRLTLLPPLRMFFLITKVFCLYVFYSWTDENSK  184

Query  1884  NPAWEAIGFHVDTNEVP-----PDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTES  1720
             NP W AIG+     +        ++   RPL+ GI+ET  EN  +L   L +KGL V + 
Sbjct  185   NPHWRAIGYSPPPADDEPAPAESERPEKRPLDDGIVETNKENDASLPALLAEKGLRVADD  244

Query  1719  QNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGEL  1540
                N   + CDVVIVGSGCGGGVAAAVLA +GHKVVV+EKG+YF + DY+ +E PS+  L
Sbjct  245   AARNVCRVECDVVIVGSGCGGGVAAAVLAAAGHKVVVIEKGNYFTARDYTAIEAPSMEHL  304

Query  1539  YESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQS  1360
             YE GG ++T     ++ AG+ VGGG+A+NWSA IKTP++V  EW+ ++ +PLF + EY +
Sbjct  305   YEGGGFVSTLSASALLLAGSTVGGGTAVNWSACIKTPDDVRGEWARDRGLPLFATGEYAA  364

Query  1359  AMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGD  1180
             AMD V +R+GVT  C++EGLQN+VLRKGCE LG KVESV RN SE HYCGSCGYGCRTGD
Sbjct  365   AMDKVFERLGVTAGCAEEGLQNKVLRKGCERLGYKVESVSRNSSEGHYCGSCGYGCRTGD  424

Query  1179  KKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR---KKCLGVIAKSKGN--NKILR  1015
             K+G D+T+LVDAV+ GAVILTGC+AEK +LE    A    K+C+GV+A+S      + L 
Sbjct  425   KRGTDSTWLVDAVSRGAVILTGCKAEKLLLEPGSAADGRAKRCVGVVARSTNPAITRTLE  484

Query  1014  IEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGG  835
             + AR TVSACGSL TP LL  SGL+N++IG NLHLHP    WGYFP+++ ++ G+ ++GG
Sbjct  485   VTARVTVSACGSLLTPVLLRGSGLRNRHIGKNLHLHPTALVWGYFPDTVPDLRGRMYEGG  544

Query  834   IITSIHKVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMV  661
             IITS+HKV     G    AI+EA ++G AG     PW SG DMKERM +Y RTV++FSMV
Sbjct  545   IITSLHKVEGGGPGAPARAILEAPAMGLAGAGTQFPWVSGRDMKERMLRYGRTVHLFSMV  604

Query  660   RDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGI  481
             RD GSG V    R+ Y +D  D++N+R G+R+ALR+L AAGAAE+GT RSDGQ+  C G 
Sbjct  605   RDRGSGTVHGERRVAYHLDATDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGA  664

Query  480   KTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
                 LE FLDGV    GP S  E WTL C+AHQMGSCRMGAT  DGA+D  GE WEA  L
Sbjct  665   TEAALEEFLDGVDVVRGPQSKAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSL  724

Query  300   YVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSG  187
             YVCDGSVLP A+GVNPM+TI S AYC++ G+A+SL  G
Sbjct  725   YVCDGSVLPGAVGVNPMVTIQSVAYCLATGIAESLRRG  762



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/739 (55%), Positives = 535/739 (72%), Gaps = 20/739 (3%)
 Frame = -3

Query  2346  GGRRNSYNHGL---SSSQYQALAAICEALIPPI-----PLPQDSD---DEAMCSFYSSSA  2200
             G  R +  +GL   ++++ + LA+ CEA++PP+      +  DS+    EA+ SFYS+S 
Sbjct  2     GKHRIAGKYGLRDITAAEMETLASFCEAVLPPVPPPPEEISGDSNHRNKEALRSFYSTSG  61

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             SQ P   +  E++ +R   +A  + RL+L +L+TR+G+LL+CG  C   RWPF+  FSEL
Sbjct  62    SQTPVLRQSIELITKRGTIEAYLVTRLILFLLATRIGTLLICGTECLVSRWPFVEKFSEL  121

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
              L++RE +L K  R   + P+R  F+ IK+A  F +FS    N  N AWEAIG+ V+ +E
Sbjct  122   SLEKRERVLQKQFRNWFLTPVRAGFVYIKVAILFCFFSRVSPNGENSAWEAIGYKVNLDE  181

Query  1839  VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcg  1660
               P+    RPLEKGI+ET+NE   TL ESL +K L      + + + I+CD V+VGSG G
Sbjct  182   NKPETHKARPLEKGIVETMNETEETLLESLARKCLQTDHDVDNDAIRIKCDAVVVGSGSG  241

Query  1659  ggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGT  1480
             GGVAA+VLA SG KVVVLEKG Y+   +Y   EGP + +LYE+GG+L + DG +MV AG 
Sbjct  242   GGVAASVLAKSGLKVVVLEKGSYYTPSEYLPFEGPGMDKLYENGGILPSVDGNIMVLAGA  301

Query  1479  MVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGL  1300
              VGGGSA+NWSA IKTP  VL EWS +QKIP FG+ EY  AM+AV +R+GVTE C  E L
Sbjct  302   TVGGGSAVNWSACIKTPKTVLQEWSEDQKIPFFGTKEYVLAMEAVWERMGVTEKCEMESL  361

Query  1299  QNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVIL  1120
             QNQVLRKGCENLG  VE+VPRN SEKHYCGSCGYGCR GDKKG D T+LVDAV++GAVIL
Sbjct  362   QNQVLRKGCENLGFNVENVPRNSSEKHYCGSCGYGCRQGDKKGSDRTWLVDAVSHGAVIL  421

Query  1119  TGCQAEKFILEEDET----ARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLL  958
             TG +AE+FILE++ +     + KCLGV+AKS   N  K ++IEA+ TVSA G+L TPPL+
Sbjct  422   TGSKAERFILEKNCSNKGGKKMKCLGVVAKSLNGNIEKKIKIEAKVTVSAGGALLTPPLM  481

Query  957   ISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE---MEGKNHQGGIITSIHKVVSEGTKQA  787
             ISSGL+N++IG NLHLHPVL AWGYFP+  +    ++GK+++GGIITS+ KV+SE ++  
Sbjct  482   ISSGLRNRHIGRNLHLHPVLMAWGYFPDKASSNFNIKGKSYEGGIITSVSKVLSEDSEVR  541

Query  786   AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRM  607
             AIIE  +LGP  F+ + PWTSGLDMK+RM +YSRT N+ ++VRD GSG+VK  GRI Y +
Sbjct  542   AIIETPALGPGSFSVLCPWTSGLDMKKRMARYSRTANLITIVRDRGSGEVKTEGRISYVV  601

Query  606   DQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGP  427
             D+ D+DNI+ GLRQ+LRIL+AAGA EVGT RSDGQ++ CKG+  + ++ FLD V    GP
Sbjct  602   DKTDRDNIKAGLRQSLRILIAAGAEEVGTHRSDGQRLICKGVDEDSIQEFLDAVSTEEGP  661

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
                 E W +Y SAHQMGSCR+G  E++GAID NGE WEA+ L+VCD S LPSA+GVNPMI
Sbjct  662   KGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMI  721

Query  246   TILSTAYCISNGLAKSLNS  190
             T++STAYCIS  +AKS+ +
Sbjct  722   TVMSTAYCISTRIAKSMTT  740



>ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
Length=773

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/762 (54%), Positives = 526/762 (69%), Gaps = 33/762 (4%)
 Frame = -3

Query  2373  ERKCHPLLRGG--RRNSYNHGLSSSQYQALAAICEALIPPIP------LPQDSD------  2236
             +++ HPLLRGG   R  Y HG S+SQ  AL A+C AL+P +P        Q  D      
Sbjct  5     DKRGHPLLRGGAANRERYTHGFSASQMTALTALCGALVPSLPPDRRNGHQQQEDGGRGGG  64

Query  2235  -----DEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCG  2071
                  D+ +  F  +SA+ PP P EVAE + R+ LP+A+ + R VL +L TRLGSL LCG
Sbjct  65    SGGNKDKVVEEFLLASAADPPVPGEVAEQMSRKCLPEALALVRTVLWLLGTRLGSLALCG  124

Query  2070  F-VCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDE  1894
                C   R+PF+  F ELPL++REA L +WSR+TL+LPLR+ F+ IK  C  +++SWTDE
Sbjct  125   ARSCLSWRFPFVRRFDELPLEQREAALRRWSRQTLLLPLRMFFVIIKAICLHVFYSWTDE  184

Query  1893  NYNNPAWEAIGFH---VDTNEVPPDQQ--TGRPLEKGIIETINENGTTLKESLIKKGLNV  1729
             N  NP W AIG+     D    P + +    RPL+ G++ET  E   +L   L  KGL V
Sbjct  185   NSKNPHWRAIGYSPPLADDEPAPAESERPEKRPLDDGVVETTKETDASLPALLAAKGLTV  244

Query  1728  TESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSL  1549
              +    N   + CDVVIVGSGCGGGVAAAVLA +GHKVVV+EKG+YF + DY+ +E PS+
Sbjct  245   ADDSAQNVCRVECDVVIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTARDYTAIEAPSM  304

Query  1548  GELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSE  1369
              +LYE GG ++T  G  +V AG+ VGGG+A+NWSA IKTP++V  EW+ +Q +PLF + E
Sbjct  305   EQLYEGGGAVSTLSGSALVLAGSTVGGGTAVNWSACIKTPDDVREEWASDQGLPLFATDE  364

Query  1368  YQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCR  1189
             Y +AMD V +R+GVT  C++EGLQN+VLRKGCE LG KVESV RN SE HYCGSCGYGCR
Sbjct  365   YAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCEKLGYKVESVSRNSSEGHYCGSCGYGCR  424

Query  1188  TGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEED-----ETARKKCLGVIAKSKGN--  1030
             +GDK+G D T+LVDAV+ GAVILTGC+AEK +LE       E+  K+C+GV+A+S     
Sbjct  425   SGDKRGTDRTWLVDAVSRGAVILTGCKAEKLLLERTGTGGAESRAKRCVGVVARSTNPTI  484

Query  1029  NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGK  850
              + L + AR TVSACGSL TP LL  SGL N++IG NLHLHP    WGYFP++M +++GK
Sbjct  485   TRTLEVRARVTVSACGSLLTPVLLRGSGLSNRHIGKNLHLHPTALVWGYFPDTMPDLKGK  544

Query  849   NHQGGIITSIHKVV-SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNI  673
              ++GGIITS+HKV  + G    AI+E  ++G AG   + PW SG D+KERM +Y RTV++
Sbjct  545   TYEGGIITSLHKVEGAPGAPARAILETPAMGLAGAGTLFPWVSGSDLKERMLRYGRTVHL  604

Query  672   FSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKIC  493
             FS+VRD GSG V    R+ Y +D  D +N+R GLR+ALRIL AAGAAE+GT RSDGQ+  
Sbjct  605   FSLVRDRGSGSVLGERRVAYHLDATDAENMREGLRRALRILAAAGAAEIGTHRSDGQRFA  664

Query  492   CKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWE  313
             C+G     LE FLDGV    GP S  E W+L C+AHQMGSCRMG T  DGA+D  GE WE
Sbjct  665   CRGATEAALEEFLDGVDVVRGPQSKAEAWSLCCTAHQMGSCRMGVTARDGAVDARGESWE  724

Query  312   AKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSG  187
              + LYVCDGSVLPSA+GVNPM+TI S AYC++ G+A+SL  G
Sbjct  725   VESLYVCDGSVLPSAVGVNPMVTIQSVAYCLATGIAESLRRG  766



>ref|XP_004953134.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Setaria italica]
Length=773

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/775 (53%), Positives = 528/775 (68%), Gaps = 49/775 (6%)
 Frame = -3

Query  2376  NERKCHPLLRGG--RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD-----------  2236
              E++ HPLLRGG  RR  Y HG SSSQ  AL A+C AL+P +P P   +           
Sbjct  4     GEKRGHPLLRGGGARRERYTHGFSSSQMAALTALCGALVPSLPPPVSRNGHHPEEDGGPG  63

Query  2235  ------DEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLC  2074
                   ++ +  F  +SA+ PP PDEVAE++ RR LP+A+ + R VL +L TRLG+L LC
Sbjct  64    GGERGGNKVVEEFLLASAADPPVPDEVAELMSRRCLPEALALVRAVLWLLGTRLGALALC  123

Query  2073  GFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDE  1894
             G  C   R+PF+  F+ELP + RE  + +WSR+TL+ PLRI F+  K+ C ++++SWTDE
Sbjct  124   GARCLSWRFPFVRRFAELPPEEREGAMQRWSRQTLLPPLRIFFLITKVFCLYVFYSWTDE  183

Query  1893  NYNNPAWEAIGFHVDTNEVPP------------DQQTGRPLEKGIIETINENGTTLKESL  1750
             N  NP W A G+       PP             +   RPL+ G++ET NE   +L  SL
Sbjct  184   NSENPHWRATGYS------PPLADEEHAAAAEEGRPEKRPLDDGVVETTNETDASLAASL  237

Query  1749  IKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYS  1570
               KGL VTE    N  T+ CDVVIVGSGCGGGV+AAVLA +G+KVVV+EKG YF + DY+
Sbjct  238   AAKGLAVTEDAARNVCTVECDVVIVGSGCGGGVSAAVLAGAGYKVVVIEKGSYFTARDYT  297

Query  1569  GLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKI  1390
              +E PS+ +LYE GG ++T  G  ++ AG+ VGGG+A+NWSA IKTP+ V  EW+ +Q I
Sbjct  298   AVEAPSMEQLYEGGGFVSTLSGGALILAGSAVGGGTAVNWSACIKTPDEVRAEWARDQGI  357

Query  1389  PLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCG  1210
             PLF + EY +AMD V +R+GVT  C++EGLQN+VLRKGCE LG KVESV RN SE HYCG
Sbjct  358   PLFATDEYAAAMDRVFERLGVTHGCNEEGLQNKVLRKGCEKLGYKVESVSRNSSEGHYCG  417

Query  1209  SCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEED------ETARKKCLGVI  1048
             SCG+GCRTGDK+G DTT+LVDAV++GAVILTGC+AEK +L E       +   K+C GV+
Sbjct  418   SCGFGCRTGDKRGTDTTWLVDAVSHGAVILTGCKAEKLLLMERAGTGGADGRAKRCAGVV  477

Query  1047  AKSKGN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE  874
             A+S      + L + ARATVSACGSL TP LL  SGL N++IG NLHLHP    WGYFPE
Sbjct  478   ARSTNPAVTRTLEVRARATVSACGSLLTPVLLRGSGLSNRHIGKNLHLHPTALVWGYFPE  537

Query  873   SMA---EMEGKNHQGGIITSIHKVVS-EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKE  706
             S     +++GK ++GGIITS+HKV    G    AI+E  ++G A      PW SG DMKE
Sbjct  538   STTAEPDLKGKMYEGGIITSLHKVEGPPGAPARAILETPAMGLAAAGTQFPWVSGRDMKE  597

Query  705   RMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEV  526
             RM +Y RTV++FS+VRD GSG V    R+ Y +D  D++++R GLR+ALR+L AAGAAE+
Sbjct  598   RMLRYGRTVHLFSLVRDRGSGTVHGERRVAYHLDAADREDMREGLRRALRVLAAAGAAEI  657

Query  525   GTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEED  346
             GT RSDGQ+  C+G     LE FLDGV    GP S  E W+L+C+AHQMGSCRMGAT  D
Sbjct  658   GTHRSDGQRFVCRGATEAALEEFLDGVDVVRGPKSKAEAWSLFCTAHQMGSCRMGATAAD  717

Query  345   GAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
             GA+D  GE WEA+ LYVCDGSVLPSA+GVNPM+TI S AYC++ G+A+SL    A
Sbjct  718   GAVDARGESWEAQRLYVCDGSVLPSAVGVNPMVTIQSVAYCLATGIAESLRRDPA  772



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/729 (55%), Positives = 527/729 (72%), Gaps = 19/729 (3%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPI-PLPQD--------SDDEAMCSFYSSSASQPPFPDEVAEV  2164
             ++ ++ ++LA+ CEA++P + P P++         + EA+ SFYS+S S+ P   +  E+
Sbjct  15    ITVAEMESLASFCEAVLPSVQPPPEELSGEGDNHRNKEALRSFYSTSGSKTPVLRQSIEL  74

Query  2163  VMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKW  1984
             V +R   +A    RL+L +L+TRLG+LL+CG  C   RWPF+  FSEL L++RE +L K 
Sbjct  75    VTKRGTIEAYIATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQ  134

Query  1983  SRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQQTGRPL  1807
              +  ++ P+R  F+ IK+A  F +FS  + N  NPAWEAIG+ V+ +E  P +    RPL
Sbjct  135   FKNWILTPIRAAFVYIKVAFLFCFFSRVNPNGENPAWEAIGYRVNPDENKPSETHNERPL  194

Query  1806  EKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANS  1627
             EKGI+ET+ E   TL ESL  KGL        + + I+CDVV+VGSG GGGVAA+VLA S
Sbjct  195   EKGIVETMEETEQTLLESLAHKGLEAVLDTEHDAIRIKCDVVVVGSGSGGGVAASVLAKS  254

Query  1626  GHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWS  1447
             G KVVVLEKG YF   ++   EGP L +LYE+GG+L + DG  MV AG  VGGGSA+NWS
Sbjct  255   GLKVVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAVNWS  314

Query  1446  ASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCEN  1267
             A IKTP +VL EWS +Q IPLFG+ EY +AM+ V KR+GVTE C  E  QNQ+LRKGCEN
Sbjct  315   ACIKTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKGCEN  374

Query  1266  LGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILE  1087
             LG  VE+VPRN SE HYCGSCGYGCR GDKKG D T+LVDAV +GAVILTGC+AE+FILE
Sbjct  375   LGFNVENVPRNSSESHYCGSCGYGCRQGDKKGSDRTWLVDAVGHGAVILTGCKAERFILE  434

Query  1086  EDETAR----KKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIG  925
             ++ + +     KCLGV+AKS   N  K+L+IEA+ TVSA G+L TPPL+ISSGL+N+NIG
Sbjct  435   KNGSNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGALLTPPLMISSGLRNRNIG  494

Query  924   SNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPA  754
              NLHLHPVL AWGYFP+   S    +G +++GGIITS+ KV+SE ++  AIIE   LGP 
Sbjct  495   KNLHLHPVLMAWGYFPDKESSNISFKGNSYEGGIITSVSKVLSEDSEVRAIIETPQLGPG  554

Query  753   GFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTG  574
              F+ ++PWTSGLDMK+RM +YSRT ++ ++VRD GSG+VK  GRI Y +D+ D+DN++ G
Sbjct  555   SFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRINYTVDKTDRDNLKAG  614

Query  573   LRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYC  394
             LR++LRIL+AAGA EVGT RSDGQ++ CKG+    ++ FLD V    G     E W +Y 
Sbjct  615   LRESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQEFLDSVSTEEGAKGMTEKWNVYS  674

Query  393   SAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             SAHQMGSCR+G  E++GAID NGE WEA+ L+VCD S LPSA+GVNPMIT++STAYCIS 
Sbjct  675   SAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCIST  734

Query  213   GLAKSLNSG  187
              +AKS+ +G
Sbjct  735   RIAKSMTTG  743



>ref|NP_001148058.1| oxidoreductase [Zea mays]
 gb|ACG29606.1| oxidoreductase [Zea mays]
Length=768

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/758 (54%), Positives = 524/758 (69%), Gaps = 28/758 (4%)
 Frame = -3

Query  2376  NERKCHPLLRGG--RRNSYNHGLSSSQYQALAAICEALIPPIPL----------PQDSDD  2233
             N ++ HPLLRGG  +R  Y HG S+SQ  AL A+C AL+P +P           PQ  +D
Sbjct  5     NNKRGHPLLRGGSAKRERYTHGFSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEED  64

Query  2232  ----EAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFV  2065
                 + +  F  +SA+ PP P EVAE++ R+ LP+A+ + R VL +L TRLGSL LCG  
Sbjct  65    GGSSKVVEEFLLASAADPPVPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGAR  124

Query  2064  CFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYN  1885
             C   R+PF+  F ELPL+ REA L +WSR+TL+ PLR+ F+  K+ C ++++SWTDEN  
Sbjct  125   CLSWRFPFVRRFDELPLEHREAALRRWSRQTLLPPLRMFFLITKVFCLYVFYSWTDENSK  184

Query  1884  NPAWEAIGFHVDTNEVP-----PDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTES  1720
             NP W AIG+     +        ++   RPL+ GI+ET  EN  +L   L +KGL V + 
Sbjct  185   NPHWRAIGYSPPPADDEPAPAESERPEKRPLDDGIVETNKENDASLPALLAEKGLTVADD  244

Query  1719  QNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGEL  1540
                N   + CDVVIVGSGCGGGVAAAVLA +GHKVVV+EKG YF + DY+ +E PS+  L
Sbjct  245   AARNVCRVECDVVIVGSGCGGGVAAAVLAAAGHKVVVIEKGDYFTARDYTAIEAPSMEHL  304

Query  1539  YESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQS  1360
             YE GG ++T     ++ AG+ VGGG+A+NWSA IKTP++V  EW+ ++ +PLF + EY +
Sbjct  305   YEGGGFVSTLSASALLLAGSTVGGGTAVNWSACIKTPDDVRGEWARDRGLPLFATGEYAA  364

Query  1359  AMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGD  1180
             AMD V +R+GVT  C++EGLQN+VLRKGCE LG KVESV RN SE HYCGSCGYGCRTGD
Sbjct  365   AMDKVFERLGVTAGCAEEGLQNKVLRKGCERLGYKVESVSRNSSEGHYCGSCGYGCRTGD  424

Query  1179  KKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR---KKCLGVIAKSKGN--NKILR  1015
             K+G D+T+LVDAV+ GAVILTGC+AEK +LE    A    K+C+GV+A+S      + L 
Sbjct  425   KRGTDSTWLVDAVSRGAVILTGCKAEKLLLEPGRAADGRAKRCVGVVARSTNPAITRTLE  484

Query  1014  IEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGG  835
             + AR TVS+CGSL TP LL  SGL+N++IG NLHLHP    WGYFP+++ ++ G+ ++GG
Sbjct  485   VTARVTVSSCGSLLTPVLLRGSGLRNRHIGKNLHLHPTALVWGYFPDTVPDLRGRMYEGG  544

Query  834   IITSIHKVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMV  661
             IITS+HKV     G    AI+EA ++G AG     PW SG DMKERM +Y RTV++FSMV
Sbjct  545   IITSLHKVEGGGPGAPARAILEAPAMGLAGAGTQFPWVSGRDMKERMLRYGRTVHLFSMV  604

Query  660   RDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGI  481
             RD GSG V+   R+ Y +D  D++N+R G+R+ALR+L AAGAAE+GT RSDGQ+  C G 
Sbjct  605   RDRGSGTVQGERRVAYHLDATDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGA  664

Query  480   KTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
                 LE FLDGV    GP S  E WTL C+AHQMGSCRMGAT  DGA+D  GE WEA  L
Sbjct  665   TEAALEEFLDGVDVVRGPQSKAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSL  724

Query  300   YVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSG  187
             YVCDGSVLP A+GVNPM+TI S AYC +  +A+SL  G
Sbjct  725   YVCDGSVLPGAVGVNPMVTIQSVAYCFATDIAESLRRG  762



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/742 (55%), Positives = 532/742 (72%), Gaps = 23/742 (3%)
 Frame = -3

Query  2355  LLRGGR-----RNSYNHGLSSSQYQALAAICEALIPPIP--------LPQDSDDEAMCSF  2215
              ++GG+        Y+HG SS++   LAAI EAL P +P            +  +A+ SF
Sbjct  9     FMKGGKIEEIEGKKYDHGFSSAEVNTLAAIAEALFPSLPPSSCCFERRENQTISKAVRSF  68

Query  2214  YSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIH  2035
               +SASQ PFPDE AE++ +R   + V + R+VL++LST++G+LLLCG  C+   WP+I+
Sbjct  69    METSASQSPFPDEAAEMLWKRLFIECVVVVRVVLLLLSTKVGTLLLCGSHCWGKEWPYIN  128

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
              F+ +PL +RE +L  W +     P R+ F+  K+A  FI FS  DEN  NPAWEAIG++
Sbjct  129   GFTSMPLAKREQVLQAWFKHRFFTPFRVAFLYFKVAILFIIFSRVDENGENPAWEAIGYN  188

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINE-NGTTLKESLIKKGLNVTESQNANTLTIRCDvvi  1678
             +D  E  P++   RPL++GI+ET++  +   L + L +KGL VT+  + N + I+CD VI
Sbjct  189   IDKVENVPNE---RPLQQGIVETMHVIDSIDLHKLLTEKGLQVTQDPHKNAIKIKCDAVI  245

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSGCGGGVAAA LA+SG KVVVLEKG YF   DYS  EGPS+ +LYE GG L + DG+ 
Sbjct  246   VGSGCGGGVAAATLASSGLKVVVLEKGSYFGPADYSPFEGPSMEKLYELGGSLPSIDGQF  305

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
              + AG+ VGGGSA+NWSA IKTP +VL EW+ E KIP+FGS+EY SAMD VC+RIGVTE 
Sbjct  306   AILAGSTVGGGSAVNWSACIKTPESVLKEWTDECKIPVFGSNEYVSAMDIVCERIGVTED  365

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
             C +EG QN VL KGC+NLG  +E VPRN S +HYCGSCG+GCR GDKKG D T+LVDAVN
Sbjct  366   CEEEGFQNLVLCKGCKNLGFDIEKVPRNSSSRHYCGSCGFGCRRGDKKGTDKTWLVDAVN  425

Query  1137  NGAVILTGCQAEKFILEEDETA----RKKCLGVIAKSKGNN--KILRIEARATVSACGSL  976
             NG VILT C+AEKF+LE++ T     + KC GVIA +   N  K L+IEA+ T+SACG+L
Sbjct  426   NGTVILTACKAEKFMLEQNTTMISTRKMKCTGVIATTFNKNITKKLQIEAKVTISACGAL  485

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT  796
              TP L+ SSGLKN NIG NL LHPVL +WGYFP+S +++EGK   GGIITS+HKV+    
Sbjct  486   HTPLLMYSSGLKNPNIGRNLRLHPVLMSWGYFPDSDSDIEGKAVDGGIITSVHKVLGPNN  545

Query  795   KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQ  616
                AIIE  SLGP  + A+ PW SGLD K+RM K+SRT ++ ++V+D GSG+V   GR+ 
Sbjct  546   NVQAIIETPSLGPGQYTALCPWVSGLDFKQRMLKFSRTAHLITIVKDRGSGEVHMGGRVT  605

Query  615   YRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVAT  436
             Y+ D  D++N+R GLR++LR+LVAAGA EVGT RSDGQK+ CKG+  EELE FLD V + 
Sbjct  606   YKFDATDRENLRAGLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGVSKEELEEFLDTVFSV  665

Query  435   GGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVN  256
             GGP+ G + W ++ +AHQMGSC+MG  E+DG +D NGE WEA+GLYVCD SVLP+AIGVN
Sbjct  666   GGPLFGGDKWMVHTTAHQMGSCKMGRNEKDGGVDENGESWEAEGLYVCDASVLPTAIGVN  725

Query  255   PMITILSTAYCISNGLAKSLNS  190
             PMIT++STAYC+S  +A  + +
Sbjct  726   PMITVMSTAYCLSKRIAAKIQN  747



>ref|XP_006418179.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
 gb|ESQ36532.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
Length=763

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/749 (55%), Positives = 534/749 (71%), Gaps = 22/749 (3%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGG-RRNSYNHGLSSSQYQALAAICEALIPPIPL-PQDSD-------  2236
             ++K  E++ +PLLR   ++ S+ HG S S  QAL+AICEA++PP+PL   D D       
Sbjct  5     KRKRGEKRGNPLLRWSVKQESFTHGFSRSDLQALSAICEAIMPPVPLLSLDLDMKLKVLR  64

Query  2235  DEAMCSFYSSSASQPPF-PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCF  2059
             ++A+ SF+ SS+ Q    PDEVAEV+  + +P  V + R+VL +L+ RLG+LLLCGFVC 
Sbjct  65    NDALLSFFKSSSDQSHVRPDEVAEVMATKAMPVTVKVVRIVLRLLTFRLGTLLLCGFVCL  124

Query  2058  DGR-WPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNN  1882
             D + WPF+  FS++ L +RE +L KWS +     +RI FM IK    F YF+WT+EN   
Sbjct  125   DKKNWPFLLKFSDISLDKREKVLQKWSTQWYNPLVRIAFMMIKAIFLFYYFTWTNENSET  184

Query  1881  PAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTL  1702
             PAW+AIG+ V+  E    +   RPLEKGIIET  E+  ++K+ LI KGL VTE + +++ 
Sbjct  185   PAWDAIGYSVNLGENEDMEHRERPLEKGIIETAKEDEMSIKQRLINKGLIVTEDKESDSY  244

Query  1701  TIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGM  1522
              I CD V+VGSGCGGGVAAA LA SG +VV+LEKG+YFV  DYS LEGPS  EL+E+  +
Sbjct  245   KIECDAVVVGSGCGGGVAAANLAKSGLRVVILEKGNYFVPRDYSALEGPSTFELFEAHSL  304

Query  1521  LTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVC  1342
             L T DG+    AG+ VGGGS +NW+AS+KTP+ ++NEWS+++ I +F   EY +AM+ VC
Sbjct  305   LMTHDGRFRFMAGSTVGGGSVVNWAASLKTPDAIINEWSVDRGIAIFAREEYTAAMERVC  364

Query  1341  KRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDT  1162
             KRIGVTE   KEG QNQ+LRKGCE LGL V  VPRN SEKHYCGSC +GCRTGDK+G D+
Sbjct  365   KRIGVTEKIIKEGFQNQILRKGCEKLGLDVTVVPRNSSEKHYCGSCSFGCRTGDKRGTDS  424

Query  1161  TYLVDAVNNGAVILTGCQAEKFILEED------ETARKK-CLGVIA-KSKGNNKILRIEA  1006
             T+LVDAVNN AVILT C+AEK IL ++      ++ RKK CLGV A  S    K L+I A
Sbjct  425   TWLVDAVNNNAVILTQCRAEKLILADNDAQTRKQSGRKKICLGVTACPSNRTRKKLQINA  484

Query  1005  RATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIIT  826
             + TV ACGSL TP LL SSGL+N NIG  LH+HP+L  WGYFPE  ++  G  H+G I+T
Sbjct  485   KVTVVACGSLMTPGLLASSGLRNPNIGRGLHIHPILMVWGYFPEKNSDFNGAAHEGEIVT  544

Query  825   SIHKV--VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDH  652
             S+H V  +   T     +E  ++GP  FAA+ PW SG DMK R+ KY+RT +IF+M+RD 
Sbjct  545   SLHYVFEIDSTTTPNITLETPAIGPGTFAALIPWVSGSDMKNRLAKYARTSHIFAMIRDE  604

Query  651   GSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTE  472
             G G+V K G ++YR+ + D++N+  GL+QALRILVAAGA EVGT+RSDGQ+I CKGIK E
Sbjct  605   GVGEV-KGGLVKYRLTKADEENLAIGLKQALRILVAAGAEEVGTYRSDGQRIKCKGIKEE  663

Query  471   ELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVC  292
             +LE+FL  V    G +S  ++WT   +AHQMG CRMGATE++GAID  GE WEA+ LYVC
Sbjct  664   DLEAFLRTVNVPAGAVSMSKHWTHSFTAHQMGCCRMGATEKEGAIDGYGESWEAQDLYVC  723

Query  291   DGSVLPSAIGVNPMITILSTAYCISNGLA  205
             D SVLP+A+GVNPMITI STAYCISN +A
Sbjct  724   DASVLPTALGVNPMITIQSTAYCISNRIA  752



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/732 (55%), Positives = 526/732 (72%), Gaps = 22/732 (3%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIPLP------------QDSDDEAMCSFYSSSASQPPFPDEV  2173
             + +++ + LA+ CEA+ PP+  P            +  + EA+ SFYS+S SQ P   + 
Sbjct  15    IKAAEMETLASFCEAIFPPVAPPPPEELSGAGDTNKHRNTEALRSFYSTSGSQTPVLRQS  74

Query  2172  AEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAIL  1993
              E++ +R   +A  + RL+L +L+TRLG+LL+CG  C   RWPF+  FSEL L++RE ++
Sbjct  75    IELLTKRGTMEAYLVTRLILFLLATRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVI  134

Query  1992  LKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQ-TG  1816
              K  R  ++ P+R  F+ IK+   F +FS       NPAWEAIG+HV+ +E  P +    
Sbjct  135   QKQFRNWILTPIRAGFVYIKVVFLFCFFSRVSPKGENPAWEAIGYHVNLDENKPSETYKA  194

Query  1815  RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavl  1636
             RPLEKGI+ET+NE   TL ESL +KGL      + +T+ I+CD V++GSG GGGVAA+VL
Sbjct  195   RPLEKGIVETMNETEQTLLESLARKGLKADHDMDQDTIRIKCDAVVIGSGSGGGVAASVL  254

Query  1635  ANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAI  1456
             A SG KVVVLEKG Y+   DY   EGP + +LYE+GG+L T DG +MV AG  VGGGSA+
Sbjct  255   AKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNLMVLAGATVGGGSAV  314

Query  1455  NWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKG  1276
             NWSA IKTP +VL EWS +QKI  +G+ +Y SAM+ V KR+GVTE C  E  QNQ+LRKG
Sbjct  315   NWSACIKTPKSVLQEWSEDQKIHFYGTKDYVSAMNVVWKRMGVTEKCEMESFQNQILRKG  374

Query  1275  CENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKF  1096
             CEN+G+ VE+V RN SE HYCGSCGYGCR GDKKG D T+LVDAV++GAV+LTGC+AE+ 
Sbjct  375   CENIGVHVENVARNSSEGHYCGSCGYGCRQGDKKGSDQTWLVDAVSHGAVVLTGCKAERL  434

Query  1095  ILEEDET----ARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNK  934
             ILE+  +     + KCLGV+AKS   N  K L+IEA+ TVSA GSL TPPL+ISSGL+N+
Sbjct  435   ILEKKGSNVGGKQMKCLGVMAKSLNGNIAKKLKIEAKVTVSAGGSLLTPPLMISSGLRNR  494

Query  933   NIGSNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSL  763
             NIG NLHLHP L +WGYFPE   S    +GK+++GGIITS+ KV+SE ++  AIIE  SL
Sbjct  495   NIGKNLHLHPTLMSWGYFPEKESSSLSFKGKSYEGGIITSVSKVLSEDSEVRAIIETASL  554

Query  762   GPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNI  583
             GP  F+ + PWTSGLD+K RM +YSRT ++ ++VRD GSG+VK  GRI Y +D+ DK+NI
Sbjct  555   GPGSFSVLFPWTSGLDLKTRMSRYSRTASLITIVRDRGSGEVKTEGRISYVVDKTDKENI  614

Query  582   RTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWT  403
             + GLRQ+LRIL+AAGA EVGT RSDGQ + CKG+  + +E FLD V +  GP    E W 
Sbjct  615   KAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFLDSVSSEEGPKGMTEKWN  674

Query  402   LYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYC  223
             +YCSAHQMGSCR+G  E++GAID NGE WEA+ L+VCD S LPSA+GVNPMIT++STAYC
Sbjct  675   IYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYC  734

Query  222   ISNGLAKSLNSG  187
             IS  +AKS+ +G
Sbjct  735   ISTRIAKSMTTG  746



>ref|XP_006354464.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Solanum 
tuberosum]
Length=667

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/664 (59%), Positives = 503/664 (76%), Gaps = 5/664 (1%)
 Frame = -3

Query  2160  MRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWS  1981
             M+R   +A  + R +L ILSTR+GSLLLCG  CF   WP+I+ FS++ L +RE ++ KW 
Sbjct  1     MKRAFFEARMLVRGLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWF  60

Query  1980  RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEK  1801
                   P+R+ F+ +K  C +I+F+   E+  NPAW+ IG+ VD  E   +    RPL+K
Sbjct  61    NNRFFTPVRLAFVFVKFLCLYIFFTQVGEDSKNPAWDDIGYQVDNEENSSETPDERPLQK  120

Query  1800  GIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGH  1621
             GIIETI E  +T+ +SL++KGL VTE    N   ++CDVVIVGSGCGGGVAA+VLA+SG 
Sbjct  121   GIIETIYETESTIVKSLVEKGLKVTEDTKNNMYKVQCDVVIVGSGCGGGVAASVLASSGQ  180

Query  1620  KVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSAS  1441
             KVVVLEKG+YF   DYS LEGPS  ++YESGG+ +T DGKVM+ AG+ VGGGSA+NWSA 
Sbjct  181   KVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGIFSTLDGKVMILAGSTVGGGSAVNWSAC  240

Query  1440  IKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLG  1261
             IKTP++++ EW  +++I +F + EY SAMD VC+RI VTE C++EGLQNQ+L+KGCE LG
Sbjct  241   IKTPDSIIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGLQNQILQKGCERLG  300

Query  1260  LKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEED  1081
             L+VE V RN SE HYCGSC YGCR G+KKG DTT+LVDAV+ GAVI+TGC+AE+FILE  
Sbjct  301   LEVEGVARNSSEDHYCGSCCYGCRRGEKKGTDTTWLVDAVDCGAVIITGCKAERFILENK  360

Query  1080  E---TARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNL  916
             +   T  KKCLGVI+ S  K   K + IEA+ T+SACGSL TPPL+ISSGLKN+NIG NL
Sbjct  361   KYGKTRSKKCLGVISTSMNKDITKSICIEAKVTISACGSLLTPPLMISSGLKNRNIGRNL  420

Query  915   HLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVS  736
             HLHPV+ AWGYFPES ++++GK ++GGIITS+HKV S  +   AIIEA +LGP  FAA+ 
Sbjct  421   HLHPVIMAWGYFPESNSDLKGKIYEGGIITSVHKVGSHDSNVRAIIEAPALGPGSFAALC  480

Query  735   PWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALR  556
             PWTSG D+K R+ KY RT ++F+MV+D GSG+V+  GRI Y  +  DK++++ GLRQALR
Sbjct  481   PWTSGEDIKNRLLKYDRTAHLFAMVKDVGSGEVRSEGRINYTFNGTDKESLKLGLRQALR  540

Query  555   ILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMG  376
             IL+AAGAAEVGT RSDGQ+I CKG   + LESFLD V A  GP S  +++T YCSAHQMG
Sbjct  541   ILIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGPKSLVKDFTTYCSAHQMG  600

Query  375   SCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             SCRMG  E+D A+D NGE WEA+GL+VCD SVLP A+GVNPMITI STAYC+S  +A+ +
Sbjct  601   SCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMI  660

Query  195   NSGK  184
               G+
Sbjct  661   KDGR  664



>ref|XP_002454190.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
 gb|EES07166.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
Length=776

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/769 (53%), Positives = 524/769 (68%), Gaps = 40/769 (5%)
 Frame = -3

Query  2370  RKCHPLLRG--GRRNSYNHGLSSSQYQALAAICEALIPPIP-----------LPQD----  2242
             ++ HPLLRG   R   Y HG S+SQ  AL A+C AL+P +P            PQ+    
Sbjct  6     KRGHPLLRGVGARSEKYTHGFSASQMAALTALCGALVPSLPPDRRNGHHHHHHPQEDDGG  65

Query  2241  --------SDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGS  2086
                     +  + +  F  +SA+ PP P EVAE++ R+ LP+A+ + R VL +L TR GS
Sbjct  66    RGGGDGDGNSSKVVEEFLLASAADPPVPGEVAELMSRKCLPEALALVRTVLWLLGTRPGS  125

Query  2085  LLLCGF-VCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYF  1909
             L LCG   C   R PF+  F ELPL++REA L +WSR+TL+ PLR+ F+ +K+ C ++++
Sbjct  126   LALCGARPCLSWRLPFVRRFDELPLEQREAALRRWSRQTLLPPLRMFFVIVKVFCLYVFY  185

Query  1908  SWTDENYNNPAWEAIGFH---VDTNEVPPDQQT--GRPLEKGIIETINENGTTLKESLIK  1744
             SWTDEN  NP W AIG+     D    P + +    RPL+ GI+ET  E   +L   L +
Sbjct  186   SWTDENLKNPHWRAIGYSPPLADDEPTPAESERPEKRPLDDGIVETTKETDASLPALLAE  245

Query  1743  KGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGL  1564
             KGL V +    N   + CDVVI+GSGCGGGVAAAVLA +GHK VV+EKG+YF S DY+ +
Sbjct  246   KGLAVADDAARNVWRVECDVVIIGSGCGGGVAAAVLAGAGHKAVVIEKGNYFTSSDYTAV  305

Query  1563  EGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPL  1384
             E PS+  LYE GG ++T  G  ++ AG+ VGGG+A+NWSA IKTP++V  EW+  Q +PL
Sbjct  306   EAPSMEHLYEGGGFVSTLSGSALLLAGSTVGGGTAVNWSACIKTPDDVREEWARNQGLPL  365

Query  1383  FGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSC  1204
             F + EY +AMD V +R+GVT  C++EGLQN+VLRKGCE LG KVESV RN SE HYCGSC
Sbjct  366   FATDEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCEKLGYKVESVSRNSSEGHYCGSC  425

Query  1203  GYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA------RKKCLGVIAK  1042
             GYGCRTGDK+G D T+LVDAV  GAVILTGC+AEK +LE   T        K+C+GV+A+
Sbjct  426   GYGCRTGDKRGTDRTWLVDAVTRGAVILTGCKAEKLLLERMVTGGRADGRAKRCVGVVAR  485

Query  1041  SKGN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM  868
             S      + L + ARATVSACGSL TP LL  SGL N++IG NLHLHP    WGYFP++M
Sbjct  486   STNPAITRTLEVRARATVSACGSLLTPVLLRGSGLSNRHIGKNLHLHPTALVWGYFPDTM  545

Query  867   AEMEGKNHQGGIITSIHKVV-SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKY  691
              +++GK ++GGIITS+HKV  + G    AI+E  ++G AG     PW SG DMKER+ +Y
Sbjct  546   PDLKGKTYEGGIITSLHKVEGAPGAPARAILETPAMGLAGAGTQFPWVSGSDMKERILRY  605

Query  690   SRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRS  511
              RTV++FSMVRD GSG V    R+ Y +D  D++N+R GLR+ALR+L AAGAAE+GT RS
Sbjct  606   GRTVHLFSMVRDRGSGTVHGERRVAYHLDATDRENMREGLRRALRVLAAAGAAEIGTHRS  665

Query  510   DGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDN  331
             DGQ+  C+G     LE FLDGV    GP S  E W+L C+AHQMGSCRMGAT  DGA+D 
Sbjct  666   DGQRFVCRGATEAALEEFLDGVDVVRGPQSKAEAWSLCCTAHQMGSCRMGATARDGAVDA  725

Query  330   NGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
              GE WE + LYVCDGSVLPSA+GVNPM+TI S AYC++ G+A+SL  GK
Sbjct  726   RGESWEVESLYVCDGSVLPSAVGVNPMVTIQSVAYCLATGIAESLRRGK  774



>gb|EEC73620.1| hypothetical protein OsI_08118 [Oryza sativa Indica Group]
Length=770

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/767 (54%), Positives = 533/767 (69%), Gaps = 34/767 (4%)
 Frame = -3

Query  2394  KREKKMNERKCHPLLRGG-------RRNSYNHGLSSSQYQALAAICEALIPPIP------  2254
             + + +   R+ HPLLRGG       RR  Y HG S+SQ  ALAA+C AL P +P      
Sbjct  3     EEKSQQRRRQGHPLLRGGGAGKQAGRR--YTHGFSASQMVALAALCGALAPSLPPDTRDD  60

Query  2253  -----------LPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLII  2107
                            SD +A+  F  +SA+ PP PDEVAE++ R  L +A+ + R VL +
Sbjct  61    DDDDAGGGRYGGAGASDAKAVRDFLLASAADPPVPDEVAELMTRMCLREALALVRAVLWL  120

Query  2106  LSTRLGSLLLCGFVCFD-GRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKI  1930
             L TRLG+L LCG  C   GRWPF+  F+E+P++RRE  L +WSR T++ PLR  F+ +K+
Sbjct  121   LGTRLGTLALCGGRCVSWGRWPFVLTFAEMPVERREEALRRWSRVTVLPPLRAFFLVVKV  180

Query  1929  ACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQT---GRPLEKGIIETINENGTTLK  1759
              C ++++SW DE+  NP W AIG+   T+E P ++ T    RPL+ G++ETIN    +L 
Sbjct  181   FCLYVFYSWIDESSENPHWRAIGYSPPTDEPPAEEHTEATKRPLDDGVVETINLTDASLP  240

Query  1758  ESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSE  1579
              SL +KGL VT+    N   + CDV IVGSGCGGGVAAAVLA +GHKVVV+EKG+YF S 
Sbjct  241   SSLAEKGLAVTDDAARNVCRVECDVAIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTSR  300

Query  1578  DYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLE  1399
             DY+  EGPS+ +LYESGG +TT +G  ++ AG+ VGGGSA+NWSA +KTP  V  EW+  
Sbjct  301   DYTSFEGPSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAVNWSACLKTPEFVRREWAAA  360

Query  1398  QKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKH  1219
               +PLF S +Y +AMD V +R+GVT  C++EGLQN+VLRKGCE LG KV++V RN SE H
Sbjct  361   HGLPLFASPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKGCEKLGYKVDAVARNSSEGH  420

Query  1218  YCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETARKKCLGVIAKS  1039
             YCGSCG+GCRTGDK+G DTT+LVDAV  GAVILTGC+AEK +LE      ++C+GV+A+S
Sbjct  421   YCGSCGFGCRTGDKRGTDTTWLVDAVGRGAVILTGCKAEKLVLERGGARGRRCVGVVARS  480

Query  1038  KGN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA  865
                   K L + A+ TVSA GSL TP LL  SGL N +IG NLHLHP   AWGYFP++M 
Sbjct  481   TNPAITKTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIGKNLHLHPTALAWGYFPDTMP  540

Query  864   EMEGKNHQGGIITSIHKVVSE--GTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKY  691
             +++GK ++GGIITS+HKV +   G    AI+E   +  A      PW SG D KERM ++
Sbjct  541   DLKGKAYEGGIITSMHKVETSGAGAPHRAILETPMMAVAATGTQMPWLSGRDSKERMLRF  600

Query  690   SRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRS  511
             +RTV+IFS+VRD GSG V    R+ YR+D  D+++IR GLR+ALR+LVAAGAAEVGT RS
Sbjct  601   ARTVHIFSLVRDRGSGTVHGERRVAYRLDAADREDIRDGLRRALRVLVAAGAAEVGTHRS  660

Query  510   DGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDN  331
             DGQ++ C+G+  E LE FLDGV    GP S  E W L+CSAH MGSCRMGAT  DGA+D 
Sbjct  661   DGQRLRCEGLTEESLEEFLDGVTVVRGPQSRSETWGLFCSAHHMGSCRMGATAGDGAVDA  720

Query  330   NGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNS  190
              GE WEA+ LYVCDGSVLP+A+GVNPMITI S AYC++NG+A SL++
Sbjct  721   RGESWEAERLYVCDGSVLPTAVGVNPMITIQSVAYCLANGIADSLSA  767



>ref|XP_010457422.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Camelina sativa]
Length=752

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/752 (55%), Positives = 532/752 (71%), Gaps = 22/752 (3%)
 Frame = -3

Query  2379  MNERKCHPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD---------DE  2230
             M  R+ +PLLR   +  + +HG S S  QAL+AICEA++PP+PL Q  D         ++
Sbjct  1     MVGRRGNPLLRWNTKHENVSHGFSPSDLQALSAICEAILPPVPL-QSLDLEMKLKVLRND  59

Query  2229  AMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFD-G  2053
             A+ SF+ SS+     PDEVAE++  + +P  V + R+VL IL+ RLG+LLLCG VC D  
Sbjct  60    ALLSFFKSSSGPHVRPDEVAELLATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVCLDQA  119

Query  2052  RWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAW  1873
              WPF+  FSE+ L++RE +L +W+ +      RI FM IK    F YF+WTDEN  NPAW
Sbjct  120   NWPFLLKFSEISLEKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAW  179

Query  1872  EAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             +AIG+ VD NE    +   RPLEKGIIET  E+  T+K+ +I KGL VTE + ++T  I 
Sbjct  180   DAIGYSVDMNESEGMEHKERPLEKGIIETDKEDEMTIKQRMINKGLKVTEDRESDTYKIE  239

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CD V+VGSGCGGGVAAA LA SG +VVVLEKG+YFV  DYS LEGPS  E++ES  +L T
Sbjct  240   CDAVVVGSGCGGGVAAANLAKSGLRVVVLEKGNYFVPRDYSSLEGPSTFEMFESNSLLMT  299

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DG+    AG+ VGGGS +NW+AS+KTP+ ++ EWS+++ I +F S +Y++AMD VCKRI
Sbjct  300   HDGRFRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVQRGISVFSSEKYKTAMDRVCKRI  359

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE   +EG QNQ+LRKGCE LGL V +VPRN ++ HYCGSC +GC TG+K+G D T+L
Sbjct  360   GVTERVIREGFQNQILRKGCEKLGLDVTTVPRNSTDGHYCGSCSFGCPTGEKRGTDLTWL  419

Query  1152  VDAVNNGAVILTGCQAEKFILEED------ETARKK-CLGVIAK-SKGNNKILRIEARAT  997
             VDAVNN AVILT C+AEK IL E+      E+ RKK CLGV A  S    K L+I A+ T
Sbjct  420   VDAVNNNAVILTQCKAEKVILAENDAHKRKESGRKKRCLGVAASLSNRTRKKLQINAKVT  479

Query  996   VSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIH  817
             + ACGSL TP LL SSGLKN NIG  LH+HP+L AWGYFPE  ++ EG  H+G I+T++H
Sbjct  480   IVACGSLKTPQLLASSGLKNPNIGRGLHIHPILMAWGYFPEKKSDFEGAAHEGEIVTALH  539

Query  816   KVVS-EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQ  640
              V   + T     +E  ++GP  FAA+ PW SG D+KER+ KYSRT +IF MVRD G G+
Sbjct  540   YVHPMDSTTSNITLETPAIGPGTFAALVPWVSGSDIKERLAKYSRTSHIFVMVRDEGVGE  599

Query  639   VKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELES  460
             V K G ++YR+ + D++N+  GL+QAL+IL AAGAAEVGT+RSDGQ+I C G+K  +LE+
Sbjct  600   V-KGGIVKYRLTKADEENLTIGLKQALQILAAAGAAEVGTYRSDGQRIKCDGMKHNDLEA  658

Query  459   FLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSV  280
             FL  V A  G MS  ++WT   +AHQMG CRMGATE++GAID  GE WEA+ LYVCD SV
Sbjct  659   FLQTVEAPAGVMSMSKHWTHSFTAHQMGCCRMGATEKEGAIDGKGESWEAEDLYVCDASV  718

Query  279   LPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             LP+A+GVNPMITI STAYCISN +A+ +   K
Sbjct  719   LPTALGVNPMITIQSTAYCISNRIAELMKKKK  750



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/736 (57%), Positives = 538/736 (73%), Gaps = 16/736 (2%)
 Frame = -3

Query  2361  HPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPL--PQDS---DDEAMCSFYSSSA  2200
             HPLL+GGRR + Y+HG SSSQ Q L +ICE L+PP PL  P ++    ++ + +FY +SA
Sbjct  8     HPLLKGGRRETKYSHGFSSSQIQTLTSICEVLLPPTPLNNPHENINPQNDVVQAFYKASA  67

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             SQ P PDEVAE+VM+R   +A  +   ++ ILSTR+G+LL+CG      +WPF+  FSE+
Sbjct  68    SQYPVPDEVAELVMKRAFFEAKILVIAIVRILSTRVGTLLICGSSGVSKKWPFLKKFSEI  127

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT--  1846
             PL+ RE ++ KW    L+ P+R+ F+ +K     ++F+   E+ +NPAW+A+ + VD   
Sbjct  128   PLENREKVVQKWFTNWLLTPVRLAFVFLKFLVLLVFFTQVGEDSSNPAWKAMDYKVDVIG  187

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVT-ESQNANTLTIRCDvvivgs  1669
                P +    RPL+KGIIET  E  ++L  +L  KGL  T    + +T T++CD VIVGS
Sbjct  188   ENSPEEMSKERPLDKGIIETRLETDSSLAAALAGKGLKPTLNPASRDTYTVKCDAVIVGS  247

Query  1668  gcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVF  1489
             GCGGGVAAAVLA +G KVVVLEKG YF + DYS LEGPSL  LYESGG+L+T DGK M+ 
Sbjct  248   GCGGGVAAAVLAAAGLKVVVLEKGDYFTAGDYSSLEGPSLDRLYESGGILSTLDGKTMLL  307

Query  1488  AGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSK  1309
             AG+ VGGGSA+NWSA  KTP++++N+W+  Q +PLF   EY  AMD VC RIGVT  C+K
Sbjct  308   AGSTVGGGSAVNWSACFKTPDHIINDWAHGQNLPLFSGPEYLDAMDKVCDRIGVTVGCTK  367

Query  1308  EGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGA  1129
             EG QNQ+LR+GCENLGLK + VPRN SE HYCGSC YGC  GDKKG DTT+LVDAVN+ A
Sbjct  368   EGFQNQILRQGCENLGLKADPVPRNSSESHYCGSCCYGCIRGDKKGTDTTWLVDAVNSDA  427

Query  1128  VILTGCQAEKFIL---EEDETARKKCLGVIAKSKGNN-KI-LRIEARATVSACGSLFTPP  964
             VI++G +A +F++    +++  +KKC GVIAK    + KI LRIEAR T+SACG+L TPP
Sbjct  428   VIISGAKAVRFVINQNNKNQRKKKKCHGVIAKFTNQDIKITLRIEARVTISACGALLTPP  487

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAA  784
             LLI+SGLKN+NIG NLHLHPVL AWGYFPE    +EGK ++GGIITS+HKVV E  K  A
Sbjct  488   LLINSGLKNRNIGRNLHLHPVLMAWGYFPEPDI-VEGKAYEGGIITSVHKVV-EQDKVRA  545

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             IIE+  LGP  FAA+ P+ SG+++K R+ KYSRT ++FSM++D+GSG V   GRI Y++D
Sbjct  546   IIESPILGPGSFAALLPFESGIELKNRIIKYSRTCHLFSMIKDNGSGSVLSEGRIDYKLD  605

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM  424
               DK+N++ GL +ALRIL+AAGA EVGT +SDGQ++ C+G   E +E FL GVVA  GP 
Sbjct  606   SSDKENMKIGLVRALRILIAAGAVEVGTHQSDGQRVKCEGGDDEGVEEFLKGVVAPEGPK  665

Query  423   SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMIT  244
             S  E W+ YCSAHQMGSCRMG  E  GA+D  GE WEA+GL+VCD SVLP A+GVNPMIT
Sbjct  666   SMVEKWSTYCSAHQMGSCRMGVDERCGAVDTWGESWEAEGLFVCDASVLPGAVGVNPMIT  725

Query  243   ILSTAYCISNGLAKSL  196
             I +TAYCIS  +A+ L
Sbjct  726   IQATAYCISKKIAEKL  741



>ref|NP_001047464.1| Os02g0621800 [Oryza sativa Japonica Group]
 dbj|BAD21547.1| putative alcohol oxidase [Oryza sativa Japonica Group]
 dbj|BAF09378.1| Os02g0621800 [Oryza sativa Japonica Group]
Length=770

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/767 (54%), Positives = 533/767 (69%), Gaps = 34/767 (4%)
 Frame = -3

Query  2394  KREKKMNERKCHPLLRGG-------RRNSYNHGLSSSQYQALAAICEALIPPIP------  2254
             + + +   R+ HPLLRGG       RR  Y HG S+SQ  ALAA+C AL P +P      
Sbjct  3     EEKSQQRRRQGHPLLRGGGAGKQAGRR--YTHGFSASQMVALAALCGALAPSLPPDTRDD  60

Query  2253  -----------LPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLII  2107
                            SD +A+  F  +SA+ PP PDEVAE++ R  L +A+ + R VL +
Sbjct  61    DDDDAGGGRYGGAGASDAKAVRDFLLASAADPPVPDEVAELMTRMCLREALALVRAVLWL  120

Query  2106  LSTRLGSLLLCGFVCFD-GRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKI  1930
             L TRLG+L LCG  C   GRWPF+  F+E+P++RRE  L +WSR T++ PLR  F+ +K+
Sbjct  121   LGTRLGTLALCGGRCVSWGRWPFVLTFAEMPVERREEALGRWSRVTVLPPLRAFFLVVKV  180

Query  1929  ACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQT---GRPLEKGIIETINENGTTLK  1759
              C ++++SW DE+  NP W AIG+   T+E P ++ T    RPL+ G++ETIN    +L 
Sbjct  181   FCLYVFYSWIDESSENPHWRAIGYSPPTDEPPAEEHTEATKRPLDDGVVETINLTDASLP  240

Query  1758  ESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSE  1579
              SL +KGL VT+    N   + CDV IVGSGCGGGVAAAVLA +GHKVVV+EKG+YF S 
Sbjct  241   SSLAEKGLAVTDDAARNVCRVECDVAIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTSR  300

Query  1578  DYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLE  1399
             DY+  EGPS+ +LYESGG +TT +G  ++ AG+ VGGGSA+NWSA +KTP  V  EW+  
Sbjct  301   DYTSFEGPSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAVNWSACLKTPEFVRREWAAA  360

Query  1398  QKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKH  1219
               +PLF + +Y +AMD V +R+GVT  C++EGLQN+VLRKGCE LG KV++V RN SE H
Sbjct  361   HGLPLFATPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKGCEKLGYKVDAVARNSSEGH  420

Query  1218  YCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETARKKCLGVIAKS  1039
             YCGSCG+GCRTGDK+G DTT+LVDAV  GAVILTGC+AEK +LE      ++C+GV+A+S
Sbjct  421   YCGSCGFGCRTGDKRGTDTTWLVDAVGRGAVILTGCKAEKLVLERGGARGRRCVGVVARS  480

Query  1038  KGN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA  865
                   K L + A+ TVSA GSL TP LL  SGL N +IG NLHLHP   AWGYFP++M 
Sbjct  481   TNPAITKTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIGKNLHLHPTALAWGYFPDTMP  540

Query  864   EMEGKNHQGGIITSIHKVVSE--GTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKY  691
             +++GK ++GGIITS+HKV +   G    AI+E   +  A      PW SG D KERM ++
Sbjct  541   DLKGKAYEGGIITSMHKVETSGAGAPHRAILETPMMAVAATGTQMPWLSGRDSKERMLRF  600

Query  690   SRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRS  511
             +RTV+IFS+VRD GSG V    R+ YR+D  D+++IR GLR+ALR+LVAAGAAEVGT RS
Sbjct  601   ARTVHIFSLVRDRGSGTVHGERRVAYRLDAADREDIRDGLRRALRVLVAAGAAEVGTHRS  660

Query  510   DGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDN  331
             DGQ++ C+G+  E LE FLDGV    GP S  E W L+CSAH MGSCRMGAT  DGA+D 
Sbjct  661   DGQRLRCEGLTEEALEEFLDGVTVVRGPQSRSETWGLFCSAHHMGSCRMGATAGDGAVDA  720

Query  330   NGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNS  190
              GE WEA+ LYVCDGSVLP+A+GVNPMITI S AYC++NG+A SL++
Sbjct  721   RGESWEAERLYVCDGSVLPTAVGVNPMITIQSVAYCLANGIADSLSA  767



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/641 (62%), Positives = 495/641 (77%), Gaps = 5/641 (1%)
 Frame = -3

Query  2103  STRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIAC  1924
             STRLG+LLLCG +C   +WP+I+ FS +PL+ RE +L  W +  L   +RI F+ +K+AC
Sbjct  15    STRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKSWLFTLVRIAFIYLKVAC  74

Query  1923  YFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIK  1744
              +++FS   EN +NPAWEAIG+ VD  E        RPL+KG+IET++E  +TL +SL +
Sbjct  75    LYVFFSRVGENNDNPAWEAIGYQVDNVENSKQVSKERPLQKGMIETMHEKDSTLLQSLTQ  134

Query  1743  KGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGL  1564
             KGL VTE    N   I+CD VIVGSGCGGGVAAA+LA+SG KVVVLEKG YF   DYS  
Sbjct  135   KGLQVTEDTERNVYKIKCDAVIVGSGCGGGVAAAILASSGLKVVVLEKGSYFAPSDYSPF  194

Query  1563  EGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPL  1384
             EGPS+ +LYESGG+L + DG++++ AG+ VGGGSAINWSASIKTP ++L EW+ + ++PL
Sbjct  195   EGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAINWSASIKTPKSILQEWAEDCQLPL  254

Query  1383  FGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSC  1204
             FGS EY SAMD VC+RIGVTE C +EG QNQ+LRKGC+NLGL+VE+VPRN SE HYCGSC
Sbjct  255   FGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKGCKNLGLEVENVPRNSSESHYCGSC  314

Query  1203  GYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETARK---KCLGVIAKSKG  1033
             G+GCR GDKKG D T+LVDAV+NGAVILTGC+AEKFILE+++   K   KCLGVIAK+  
Sbjct  315   GFGCRRGDKKGTDRTWLVDAVSNGAVILTGCKAEKFILEKNKICSKRKLKCLGVIAKTSN  374

Query  1032  NN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEM  859
              N  K L IEA+ T+SACG+LFTP L+ SSGLKN+NIG NLHLHPVL AWGYFP+S +E 
Sbjct  375   KNITKKLHIEAKVTISACGALFTPLLMHSSGLKNRNIGRNLHLHPVLMAWGYFPDSDSEF  434

Query  858   EGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTV  679
             +GK ++GGIITS+HKVV+   K  AIIE  SLGPA +AA+ PW SGLDMK RM  +SRT 
Sbjct  435   KGKVYEGGIITSVHKVVAADNKVRAIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTA  494

Query  678   NIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQK  499
             ++ +++RD GSG+V   GR+ Y+ D +D+ N+++GLRQALRILVAAGA EVGT RSDGQ 
Sbjct  495   HMITIIRDQGSGKVHAGGRVTYKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQS  554

Query  498   ICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGEC  319
             I CKGI  +ELE FL+ V    GPM   E W  + SAHQMGSCRMG  E++GA+D NGE 
Sbjct  555   IRCKGISNKELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGES  614

Query  318   WEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             WEA+GL+VCD SVLP AIGVNPMIT+ STAYC+S  +A+SL
Sbjct  615   WEAEGLFVCDASVLPGAIGVNPMITVQSTAYCLSKRIAESL  655



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/756 (55%), Positives = 536/756 (71%), Gaps = 31/756 (4%)
 Frame = -3

Query  2370  RKCHPLLRG------GRRNSYNHGLSSSQYQALAAICEALIPPIPLPQ------------  2245
             R+CHP L+G       ++  +    SS + +ALAAICE + PP+                
Sbjct  3     RECHPALKGIIRGDREKKKLFRGSFSSREMEALAAICETVFPPLSGAAAAGAAGGEFEGR  62

Query  2244  -DSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGF  2068
              D +DEA+  FY SS SQ P P EVAE++ RR L  AV + R+VL++LSTRLG+LLLCG 
Sbjct  63    IDREDEAVRFFYESSGSQAPVPQEVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGS  122

Query  2067  VCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENY  1888
             +C  GRWP+++ FS +   +RE +L  W +   + P+R  F+ +K+ C ++ FS  DE  
Sbjct  123   LCVGGRWPYVNTFSSMGSDQREKVLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKG  182

Query  1887  NNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNAN  1708
              NP W+AIG+ VD  +       GRPLEKGIIET       L +SL +KGL VT+     
Sbjct  183   ENPLWKAIGYQVDEEQEMSKPDQGRPLEKGIIETNYSTDLGLLQSLKQKGLEVTQDSKNK  242

Query  1707  TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESG  1528
                I+CD VIVGSGCGGGVAAAVLA  G+KVVVLEKG+Y+  +DYS LEGPS+ +LYESG
Sbjct  243   IYRIKCDAVIVGSGCGGGVAAAVLAGCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESG  302

Query  1527  GMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDA  1348
             G+L +    V++ AG+ VGGGSA+NWSASI+TP+ VL +W+ +  + LFGS EY SAMD 
Sbjct  303   GILPSCTANVLILAGSTVGGGSAVNWSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDI  362

Query  1347  VCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGV  1168
             VCKRIGVT+ C ++  QN+VL++GCE LGL++ +VPRN SE HYCGSCGYGCR GDK+G 
Sbjct  363   VCKRIGVTDRCVEQSFQNKVLQEGCEKLGLEINAVPRNSSEDHYCGSCGYGCRRGDKQGT  422

Query  1167  DTTYLVDAVNNGAVILTGCQAEKFILEED---ETARKKCLGVIAKSKGNN--KILRIEAR  1003
             D T+LVDAVN GAVIL+GC+AE+ + E++      RKKC GV AKS  ++   +L+ EA+
Sbjct  423   DYTWLVDAVNCGAVILSGCKAEQLVFEKNAPGRARRKKCTGVRAKSMNSDIENVLQFEAK  482

Query  1002  ATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE-SMAEMEGKNHQGGIIT  826
              TVSACG+L TPPLLISSGLKNK+IG NLHLHPV  AWG+FP+ S +++ G ++QGGIIT
Sbjct  483   VTVSACGALLTPPLLISSGLKNKHIGRNLHLHPVAMAWGHFPQDSSSQLSGTSYQGGIIT  542

Query  825   SIHKVVSEGTKQ---AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRD  655
              IHKVV EG       AIIE   LGPA F  + PW SGLD+K+R+ KY+RT ++ ++VRD
Sbjct  543   LIHKVV-EGNSNPNVQAIIETPLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRD  601

Query  654   HGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKT  475
              G G+V + G I Y+MD +DK+NIR GLRQ+LRIL+AAGA EVGT RSDG ++ C+G   
Sbjct  602   RGHGEVTREGIINYKMDSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTA  661

Query  474   EE--LESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
              E  +E FLD V A  GP++ +E WT Y SAHQMGSCRMG  E++GA+D NGE WEA+GL
Sbjct  662   SEYQVEEFLDRVSAEDGPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGL  721

Query  300   YVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             +VCD SVLP+A+GVNPMITI STAYCI+N +A+ L+
Sbjct  722   FVCDASVLPTAVGVNPMITIESTAYCIANRIAEYLS  757



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/756 (55%), Positives = 536/756 (71%), Gaps = 31/756 (4%)
 Frame = -3

Query  2370  RKCHPLLRG------GRRNSYNHGLSSSQYQALAAICEALIPPIPLPQ------------  2245
             R+CHP L+G       ++  +    SS + +ALAAICE + PP+                
Sbjct  3     RECHPALKGIIRGDREKKKLFRGSFSSREMEALAAICETVFPPLSGAAAAGAAGGEFEGR  62

Query  2244  -DSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGF  2068
              D +DEA+  FY SS SQ P P EVAE++ RR L  AV + R+VL++LSTRLG+LLLCG 
Sbjct  63    IDREDEAVRFFYESSGSQAPVPQEVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGS  122

Query  2067  VCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENY  1888
             +C  GRWP+++ FS +   +RE +L  W +   + P+R  F+ +K+ C ++ FS  DE  
Sbjct  123   LCVGGRWPYVNTFSSMGSDQREKVLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKG  182

Query  1887  NNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNAN  1708
              NP W+AIG+ VD  +       GRPLEKGIIET       L +SL +KGL VT+     
Sbjct  183   ENPLWKAIGYQVDEEQEMSKPDQGRPLEKGIIETNYSTDLGLLQSLKQKGLEVTQDSKNK  242

Query  1707  TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESG  1528
                I+CD VIVGSGCGGGVAAAVLA  G+KVVVLEKG+Y+  +DYS LEGPS+ +LYESG
Sbjct  243   IYRIKCDAVIVGSGCGGGVAAAVLAGCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESG  302

Query  1527  GMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDA  1348
             G+L +    V++ AG+ VGGGSA+NWSASI+TP+ VL +W+ +  + LFGS EY SAMD 
Sbjct  303   GILPSCTANVLILAGSTVGGGSAVNWSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDI  362

Query  1347  VCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGV  1168
             VCKRIGVT+ C ++  QN+VL++GCE LGL++ +VPRN SE HYCGSCGYGCR GDK+G 
Sbjct  363   VCKRIGVTDRCVEQSFQNKVLQEGCEKLGLEINAVPRNSSEDHYCGSCGYGCRRGDKQGT  422

Query  1167  DTTYLVDAVNNGAVILTGCQAEKFILEED---ETARKKCLGVIAKSKGNN--KILRIEAR  1003
             D T+LVDAVN GAVIL+GC+AE+ + E++      RKKC GV AKS  ++   +L+ EA+
Sbjct  423   DYTWLVDAVNCGAVILSGCKAEQLVFEKNAPGRARRKKCTGVRAKSMNSDIENVLQFEAK  482

Query  1002  ATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE-SMAEMEGKNHQGGIIT  826
              TVSACG+L TPPLLISSGLKNK+IG NLHLHPV  AWG+FP+ S +++ G ++QGGIIT
Sbjct  483   VTVSACGALLTPPLLISSGLKNKHIGRNLHLHPVAMAWGHFPQDSSSQLSGTSYQGGIIT  542

Query  825   SIHKVVSEGTKQ---AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRD  655
              IHKVV EG       AIIE   LGPA F  + PW SGLD+K+R+ KY+RT ++ ++VRD
Sbjct  543   LIHKVV-EGNSNPNVQAIIETPLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRD  601

Query  654   HGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKT  475
              G G+V + G I Y+MD +DK+NIR GLRQ+LRIL+AAGA EVGT RSDG ++ C+G   
Sbjct  602   RGHGEVTREGIINYKMDSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTA  661

Query  474   EE--LESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
              E  +E FLD V A  GP++ +E WT Y SAHQMGSCRMG  E++GA+D NGE WEA+GL
Sbjct  662   SEYQVEEFLDRVSAEDGPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGL  721

Query  300   YVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             +VCD SVLP+A+GVNPMITI STAYCI+N +A+ L+
Sbjct  722   FVCDASVLPTAVGVNPMITIESTAYCIANRIAEYLS  757



>ref|XP_003575383.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=766

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/759 (54%), Positives = 524/759 (69%), Gaps = 25/759 (3%)
 Frame = -3

Query  2397  FKREKKMNERKCHPLLRGG---RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEA  2227
              +  KK   R+ HPLLRGG    R+SY HG S++Q  AL A C AL+P +P P D+  +A
Sbjct  1     MEEAKKQRMRQGHPLLRGGGGVSRSSYTHGFSATQMLALTAACGALVPSLP-PDDAGSKA  59

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRW  2047
             +  F+ +SA+ PP PDEVA+++    L +A+ + R +L +L TRLG+L LCG  C   + 
Sbjct  60    VREFFLASAADPPVPDEVAQLMSAMCLREALALIRTLLWLLGTRLGTLALCGSRCLSWQA  119

Query  2046  PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             PF+  F+E+P++RRE  L +WSRET++ PLR+ F+ +K+ C ++++S  DEN  NP W A
Sbjct  120   PFVRRFAEMPVERREDALRRWSRETVLPPLRLFFLLLKVFCLYVFYSRIDENSENPHWGA  179

Query  1866  IGFHVDTNEVPP-------DQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNAN  1708
             IG+   T+E             T RPL+ G++ETI+    +L   L  KGL VTE    N
Sbjct  180   IGYTPATDEASAEEEEEKEQPTTKRPLDDGVVETIHHTDASLPACLADKGLTVTEDAARN  239

Query  1707  TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESG  1528
                + CDV IVGSGCGGGV AAVLA +GHKVVV+EKG YF S+DY+ +EGPS+ +LYESG
Sbjct  240   LFRVECDVAIVGSGCGGGVTAAVLAAAGHKVVVIEKGSYFTSKDYTSIEGPSMRQLYESG  299

Query  1527  GMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWS-LEQKIPLFGSSEYQSAMD  1351
             G ++T  G  ++ AG+ VGGGSA+NWSA IKTP +V  EW+     +PLF S EY +AMD
Sbjct  300   GFVSTLSGSGLILAGSTVGGGSAVNWSACIKTPESVRGEWAGAHGGLPLFASPEYTAAMD  359

Query  1350  AVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKG  1171
             AV +R+GVT  C +EGLQN+VLRKGCE LG KVE V RN SE H+CGSCGYGCRTGDK+G
Sbjct  360   AVFRRLGVTSGCQEEGLQNKVLRKGCEKLGYKVEPVSRNSSEGHFCGSCGYGCRTGDKRG  419

Query  1170  VDTTYLVDAVNNGAVILTGCQAEKFILEEDETA--------RKKCLGVIAKSKGNNKILR  1015
              DTT+LVDAV  GAVILTGC+AEK +  +  TA        +K+C+GV+  +  N  I R
Sbjct  420   TDTTWLVDAVRRGAVILTGCKAEKLLFSDYATAMTSAEKKKKKRCVGVVVATSSNPAITR  479

Query  1014  ---IEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE-SMAEMEGKN  847
                + A+ TVSACGSL TP LL  SGL N +IG NLHLHP   AWGYFPE +  +++GK 
Sbjct  480   KVEVRAKVTVSACGSLLTPVLLRDSGLANPHIGKNLHLHPTAMAWGYFPEDTRPDLKGKM  539

Query  846   HQGGIITSIHKVVS-EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIF  670
             ++GGIITSIHKV   +G    AI+E   +G A      PW SG DMKERM KY R+V+IF
Sbjct  540   YEGGIITSIHKVEGVDGVPPRAILETPLMGVAAAGTQFPWVSGRDMKERMLKYGRSVHIF  599

Query  669   SMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICC  490
             S+VRD GSG V    RI Y MD  D++N R GLR+ALR+LVAAGA E+GT RSDGQ++ C
Sbjct  600   SLVRDRGSGTVHGERRIAYHMDPADRENQREGLRRALRVLVAAGATEIGTHRSDGQRMKC  659

Query  489   KGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEA  310
             KG   EE+E FLDGV    GP S  ENW+L C+AHQMGSCRM AT  DGA+D  GE WEA
Sbjct  660   KGATEEEVEEFLDGVTVLRGPQSKSENWSLCCTAHQMGSCRMAATALDGAVDARGESWEA  719

Query  309   KGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             + LYVCD SVLPSA+GVNPMITI + AYC++NG+A+ L 
Sbjct  720   ERLYVCDASVLPSAVGVNPMITIQAVAYCLANGIAEQLK  758



>ref|XP_010475034.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Camelina sativa]
Length=752

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/752 (55%), Positives = 531/752 (71%), Gaps = 22/752 (3%)
 Frame = -3

Query  2379  MNERKCHPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD---------DE  2230
             M  R+  PLLR   +  + +HG S+S  QAL+AICEA++PP+PL Q  D         ++
Sbjct  1     MVGRRGSPLLRWNTKHENVSHGFSASDLQALSAICEAILPPVPL-QSLDLEMKLKVLRND  59

Query  2229  AMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFD-G  2053
             A+ SF+ SS      PDEVAEV+  + +P  V + R+VL IL+ RLG+LLLCG V  D  
Sbjct  60    ALLSFFKSSPGPHVRPDEVAEVLATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVNLDKA  119

Query  2052  RWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAW  1873
              WPF+  FSE+ L++RE +L +W+ +      RI FM IK    F YF+WTDEN  NPAW
Sbjct  120   SWPFLLKFSEISLEKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAW  179

Query  1872  EAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             +AIG+ V  +E    +   RPLEKGIIET   N  T+K+ +I KGL VTE + ++T  I 
Sbjct  180   DAIGYSVGIDENEGMEHKERPLEKGIIETDKVNEMTIKQRMINKGLKVTEDRESDTYKIE  239

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CD V+VGSGCGGGVAAA LA SG +VVVLEKG+YFVS DYS LEGPS  EL+ES  +L T
Sbjct  240   CDAVVVGSGCGGGVAAANLAKSGLRVVVLEKGNYFVSRDYSALEGPSTFELFESNSLLMT  299

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DG+    AG+ VGGGS +NW+AS+KTP+ ++ EWS+++ I +F S +Y++AMD VCKRI
Sbjct  300   HDGRFRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVQRGISIFSSEKYKAAMDRVCKRI  359

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE   +EG QNQ+LRKGCE LGL V +VPRN ++ HYCGSC +GC TG+K+G D T+L
Sbjct  360   GVTERVIREGFQNQILRKGCEKLGLDVTTVPRNSTDGHYCGSCSFGCPTGEKRGTDLTWL  419

Query  1152  VDAVNNGAVILTGCQAEKFILEED------ETARKK-CLGVIAK-SKGNNKILRIEARAT  997
             VDAVNN AVILT C+AEK IL E+      E+ RKK CLGV A  S    K L+I A+ T
Sbjct  420   VDAVNNNAVILTQCKAEKVILAENDAHKRKESGRKKRCLGVAASLSNRTRKKLQINAKVT  479

Query  996   VSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIH  817
             + ACGSL TP LL SSGLKN NIG  LH+HP+L  WGYFPE  ++ +G  H+G I+T++H
Sbjct  480   IVACGSLKTPELLASSGLKNPNIGRGLHIHPILMTWGYFPEKKSDFKGAAHEGEILTTLH  539

Query  816   KVVSEGTKQAAI-IEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQ  640
              V    +  A I +E  ++GP  FAA+ PW SG D+KER+ KYSRT +IF  VRD G G+
Sbjct  540   YVHPMDSTTANITLETPAIGPGTFAALVPWVSGSDIKERLAKYSRTSHIFVTVRDEGVGE  599

Query  639   VKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELES  460
             V K G ++YR+ + D++N+  GL+QAL+ILVAAGAAEVGT+RSDGQ+I C GIK ++LE+
Sbjct  600   V-KGGIVKYRLTKADEENLTIGLKQALQILVAAGAAEVGTYRSDGQRIKCDGIKHKDLEA  658

Query  459   FLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSV  280
             FL+ V A  G +S  ++WT   +AHQMG CRMGATE++GAID  GE WEA+ LYVCD SV
Sbjct  659   FLETVDAPAGVVSMSKHWTHSITAHQMGCCRMGATEKEGAIDGKGESWEAEDLYVCDASV  718

Query  279   LPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             LP+A+GVNPMITI STAYCISN +A+ +   K
Sbjct  719   LPTALGVNPMITIQSTAYCISNRIAELMKKKK  750



>ref|XP_009119340.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Brassica rapa]
Length=761

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/747 (54%), Positives = 530/747 (71%), Gaps = 19/747 (3%)
 Frame = -3

Query  2376  NERKCHPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQ-DSD-------DEAM  2224
             ++++ HPLLR   ++ +++HG S S  QAL+AICEA++PP+PL   D D       ++A+
Sbjct  14    DKKRGHPLLRWSTKQETFSHGFSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDAL  73

Query  2223  CSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR-W  2047
              SF+ SS S    PDEVAEV+  + +P  V + R+VL +L+ RLG+LLLCGFVC D + W
Sbjct  74    LSFFKSSGSHVR-PDEVAEVMATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNW  132

Query  2046  PFIH-NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWE  1870
              F+   FS++ L++RE +L KW+++      RI FM IK    F YF+WT+EN  NPAW+
Sbjct  133   SFLLLKFSDISLEKREKVLQKWNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWD  192

Query  1869  AIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRC  1690
             AIG+ VD  E    ++  RPLEKGIIET  E+  T+K+ +I KGL + E + +NT  I C
Sbjct  193   AIGYKVDIGENEDIERKQRPLEKGIIETAKEDEATIKQLMINKGLKLKEDKESNTFKIEC  252

Query  1689  DvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTT  1510
             D V++GSGCGGGVAAA LA SG KV+V+EKG+YFV +DYS LEGPS+ E++E+ G+L T 
Sbjct  253   DAVVIGSGCGGGVAAANLAKSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMFEANGLLMTH  312

Query  1509  DGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIG  1330
             DG+    AG+ +GGGS +NW+AS+KTP+ ++ EWS+++ I  F    Y +AM++VCKRI 
Sbjct  313   DGRFRFMAGSTLGGGSVVNWAASLKTPDAIIEEWSVDRGIATFDREGYTAAMESVCKRIC  372

Query  1329  VTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLV  1150
             VTE   +EG QNQ+LRKGCE LGL V  VPRN SE+HYCGSC +GC+TGDK+G D T+LV
Sbjct  373   VTERVIREGFQNQILRKGCEKLGLDVTVVPRNSSEEHYCGSCSFGCKTGDKRGTDITWLV  432

Query  1149  DAVNNGAVILTGCQAEKFILEEDETAR--KKCLGVIAKSKGNNKILRIE--ARATVSACG  982
             DAV+N AVILT C+AEK I  E E+ R  K+CLGV   S  N  I +IE  A+ TV ACG
Sbjct  433   DAVDNNAVILTQCRAEKLIFAETESGRRKKRCLGVTT-SISNTAINKIEINAKVTVVACG  491

Query  981   SLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS-  805
             SL TP LL SSGLKN NIG  LH+HP+L AWGYFPE  +   G  H+G I+TS+H V   
Sbjct  492   SLMTPGLLSSSGLKNHNIGRGLHIHPILMAWGYFPEKNSNFNGAAHEGEIMTSLHYVFEI  551

Query  804   EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
             + T     +E  +LGP  FAA+ PW SG D KER+ KYSRT +IF MVRD G G+V K G
Sbjct  552   DSTTPNITLETPALGPGTFAALIPWVSGKDTKERLAKYSRTSHIFVMVRDEGVGEV-KGG  610

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
              ++Y++ + D++N+ TGLR+ALRILVAAGA EVGT+RSDGQ++ C G+K E+LE FL+ V
Sbjct  611   IVKYKLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLKCGGVKEEDLEKFLETV  670

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
              A  G +S    WT   +AHQMG CRMGATEE+GA+D  GE WEA+GLYVCD SVLP+A+
Sbjct  671   DAPAGVVSMSRRWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVLPTAL  730

Query  264   GVNPMITILSTAYCISNGLAKSLNSGK  184
             GVNPM+TI STAYCIS  LA  +   K
Sbjct  731   GVNPMVTIQSTAYCISKRLAALMMKNK  757



>ref|XP_010532672.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=746

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/733 (57%), Positives = 532/733 (73%), Gaps = 22/733 (3%)
 Frame = -3

Query  2343  GRRNSYNHGLSSSQYQALAAICEALIPPIP---LPQDSDD----EAMCSFYSSSASQPPF  2185
             GRR     G ++++ ++LAA+CE L+PP+     P   DD    EA+ SFYS S S+   
Sbjct  13    GRR-----GFTAAEMESLAAVCETLLPPLSPEYSPDGEDDHPNKEALRSFYSDSGSKSHV  67

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
               +  E++ RR L +AV + RLVL++LS+RLG+LLLCG  C    WPF+  F  L L++R
Sbjct  68    LHQGVELITRRGLIEAVLVVRLVLLLLSSRLGTLLLCGTHCLVPNWPFVERFGSLSLEKR  127

Query  2004  EAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQ  1825
             E +L KW R  L+ P+R+ F+ IK+   + +FSW   N  NPAWEAIG+ V+  E  P  
Sbjct  128   ERVLQKWFRNRLLAPIRLAFVYIKVVFLYCFFSWVGPNGENPAWEAIGYRVNLEESKPSN  187

Query  1824  -QTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggva  1648
                 RPLEKG++ET+ E  +TL +SL +KGL V    N + + I+CD VIVGSG GGGVA
Sbjct  188   IMKERPLEKGMVETVKETDSTLPKSLSEKGLEVMSGSNHDPIKIKCDAVIVGSGSGGGVA  247

Query  1647  aavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGG  1468
             AAVLA++G KVVVLEKG YF   +YS  EG    +LYESGG+L T DG VM+ AG  VGG
Sbjct  248   AAVLASAGLKVVVLEKGTYFAPSEYSPFEGHGFDQLYESGGVLPTVDGNVMILAGATVGG  307

Query  1467  GSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQV  1288
             GSA+NWSA IKTP  VL EWS + KIPLFG+ EY SAM+ V KRIGVTE C +E  QNQV
Sbjct  308   GSAVNWSACIKTPEPVLQEWSEDHKIPLFGTQEYGSAMEVVWKRIGVTEKCRQESFQNQV  367

Query  1287  LRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQ  1108
             LRKGC NLGLKVE+VPRN SE HYCGSC YGCR GDK+G D T+L+DAVN+GAVILTGC+
Sbjct  368   LRKGCLNLGLKVENVPRNSSENHYCGSCCYGCRQGDKQGSDRTWLLDAVNHGAVILTGCE  427

Query  1107  AEKFILEED-----ETARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISS  949
             AE+ ILE++        + KC GV+AKS   N  K L+IEA+ TV ACG++ TPPL+I S
Sbjct  428   AERLILEKNINKGVGAKKMKCSGVMAKSLNGNISKKLQIEAKVTVVACGAISTPPLIIKS  487

Query  948   GLKNKNIGSNLHLHPVLFAWGYFPES-MAEMEGKNHQGGIITSIHKVV-SEGTKQAAIIE  775
             GLKN+NIG NLHLHPVL AWGYFPE   + ++GK ++GGI+TS++KV+ ++ ++  AIIE
Sbjct  488   GLKNRNIGRNLHLHPVLMAWGYFPEKETSHLKGKIYEGGIMTSVNKVLLAKDSEVRAIIE  547

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               ++GPA F A+ PW SGLDMK+RM KYSRT ++ ++VRD  SG+V   GRI+Y +D+ D
Sbjct  548   TPAMGPASFTAICPWISGLDMKKRMTKYSRTAHLITIVRDRRSGEVMAEGRIRYTLDKTD  607

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             K+NI  GLRQ+LRIL++AGA EVGT RSDGQ++ CKGI  E +E+FLD V A  GP S  
Sbjct  608   KENIVAGLRQSLRILISAGAVEVGTHRSDGQRLKCKGIDEETIEAFLDTVTAEDGPGSYA  667

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             E W +Y SAHQMGSCR+G  EE GA+D NGE WEAKGL+VCDGS LPSA+GVNPMITI++
Sbjct  668   EKWAVYASAHQMGSCRIGENEEKGALDLNGESWEAKGLFVCDGSALPSALGVNPMITIMA  727

Query  234   TAYCISNGLAKSL  196
             T+YCIS G+ KSL
Sbjct  728   TSYCISTGIVKSL  740



>ref|XP_002889487.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65746.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
Length=760

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/746 (53%), Positives = 531/746 (71%), Gaps = 22/746 (3%)
 Frame = -3

Query  2358  PLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS--------DDEAMCSFYSS  2206
             P LR   ++ S++HG S S  QAL+AIC+A++PP+PL   +         ++A+ SF+ S
Sbjct  14    PWLRWSAKQESFSHGFSQSDLQALSAICDAIMPPVPLESLNLEMKLKVLRNDALLSFFKS  73

Query  2205  SASQPPF-PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR-WPFIHN  2032
             S S+    PDEVAE++  + +P  V + R+VL IL+ RLG+LLLCG VC D + WPF+  
Sbjct  74    STSESHVRPDEVAELLATKAIPLTVLVVRIVLRILTFRLGTLLLCGLVCLDMKNWPFLLK  133

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             FSE+ L++RE +L +W+ +      RI FM IK    F YF+WT+EN  NPAW+AI + V
Sbjct  134   FSEMSLEKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTNENTENPAWDAINYRV  193

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             +  E    +Q  RPL++GIIET  E+  T+K+ +I KGL VTE ++++T  I CD V+VG
Sbjct  194   EIGENEGMEQKERPLDQGIIETAKEDEMTIKQRMINKGLKVTEDRDSDTYKIECDAVVVG  253

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAA+LA SG +VVV+EKG+YFV  DYS LEGPS+ EL+ES  +L T DG+   
Sbjct  254   SGCGGGVAAAILAKSGLRVVVIEKGNYFVPRDYSALEGPSMFELFESNSLLMTHDGRFRF  313

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGS +NW+AS+KTP+ ++ EWS+ + I ++ S +Y++AMD V KR+GVTE  +
Sbjct  314   MAGSTVGGGSVVNWAASLKTPDAIIEEWSVHRGISVYSSEKYKAAMDRVLKRLGVTEKIN  373

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
              EG QN++LRKGCE LGL V  VPRN +EKH CGSC +GC TG+K+G D+T+LVDAVNN 
Sbjct  374   SEGFQNRILRKGCEKLGLDVTIVPRNSTEKHNCGSCSFGCPTGEKRGTDSTWLVDAVNNN  433

Query  1131  AVILTGCQAEKFIL-------EEDETARKKCLGVIAK-SKGNNKILRIEARATVSACGSL  976
             AVILT C+AEK IL        E+   RK+CLGV A  S    K L+I A+ T+ ACGSL
Sbjct  434   AVILTQCKAEKLILADNNAHQREESGRRKRCLGVTASLSNRTRKKLQINAKVTIVACGSL  493

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV--VSE  802
              TP LL SSGLKN NIG  LH+HP+L AWGYFPE  ++ +G  H+G I+TS+H V  + +
Sbjct  494   KTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNSDFQGAAHEGEIVTSLHYVHPMED  553

Query  801   GTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGR  622
              T     +E  ++GP  FAA++PW SG DMKER+ KY+RT +IF MVRD G G+V K   
Sbjct  554   STTPNITLETPAIGPGTFAALAPWVSGPDMKERLAKYARTSHIFVMVRDEGVGEV-KGDI  612

Query  621   IQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVV  442
             ++YR+ + D++N+ TGL+QALRILVAAGAAEVGT+RSDGQ++ C GIK E++E+FL  V 
Sbjct  613   VKYRLTKADEENLTTGLKQALRILVAAGAAEVGTYRSDGQRMKCSGIKQEDVEAFLQAVN  672

Query  441   ATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIG  262
             A  G +S  ++WT   +AHQMG CRMGATE+ GAID  GE WEA+ LYVCD SVLP+A+G
Sbjct  673   APAGVVSMSKHWTQSFTAHQMGCCRMGATEKAGAIDGKGESWEAEDLYVCDASVLPTALG  732

Query  261   VNPMITILSTAYCISNGLAKSLNSGK  184
             VNPMIT+ STAYCISN +A+ +   K
Sbjct  733   VNPMITVQSTAYCISNRIAELMKKKK  758



>emb|CDX89850.1| BnaA10g02320D [Brassica napus]
Length=752

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/746 (54%), Positives = 529/746 (71%), Gaps = 19/746 (3%)
 Frame = -3

Query  2373  ERKCHPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQ-DSD-------DEAMC  2221
             +++ HPLLR   ++ +++HG S S  QAL+AICEA++PP+PL   D D       ++A+ 
Sbjct  8     KKRGHPLLRWSTKQETFSHGFSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALL  67

Query  2220  SFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR-WP  2044
             SF+ SS S    PDEVAEV+  + +P  V + R+VL +L+ RLG+LLLCGFVC D + W 
Sbjct  68    SFFKSSGSHVR-PDEVAEVMATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWS  126

Query  2043  FIH-NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEA  1867
             F+   FS++ L++RE +L KW+++      RI FM IK    F YF+WT+EN  NPAW+A
Sbjct  127   FLLLKFSDISLEKREKVLQKWNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDA  186

Query  1866  IGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
             IG+ VD  E    ++  RPLEKGIIET  E+  T+K+ +I KGL + E + +NT  I CD
Sbjct  187   IGYKVDIGENEDIKRKQRPLEKGIIETAKEDEATIKQLMINKGLKLKEDKESNTFKIECD  246

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
              V++GSGCGGGVAAA LA SG KV+V+EKG+YFV +DYS LEGPS+ E++E+ G+L T D
Sbjct  247   AVVIGSGCGGGVAAANLAKSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMFEANGLLMTHD  306

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
             G+    AG+ +GGGS +NW+AS+KTP+ ++ EWS+++ I  F    Y +AM++VCKRI V
Sbjct  307   GRFRFMAGSTLGGGSVVNWAASLKTPDAIIEEWSVDRGIATFAREGYTAAMESVCKRICV  366

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             TE   +EG QNQ+LRKGCE LGL V  VPRN SE+HYCGSC +GC+TGDK+G D T+LVD
Sbjct  367   TERVIREGFQNQILRKGCEKLGLDVTVVPRNSSEEHYCGSCSFGCKTGDKRGTDITWLVD  426

Query  1146  AVNNGAVILTGCQAEKFILEEDETAR--KKCLGVIAKSKGNNKILRIE--ARATVSACGS  979
             AV+N AVILT C+AEK I  + E+ R  K+CLGV   S  N  I +IE  A+ TV ACGS
Sbjct  427   AVDNNAVILTQCRAEKLIFADTESGRRKKRCLGVTV-SISNTTINKIEINAKVTVVACGS  485

Query  978   LFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS-E  802
             L TP LL SSGLKN NIG  LH+HP+L AWGYFPE  +   G  H+G I+TS+H V   +
Sbjct  486   LMTPGLLSSSGLKNHNIGRGLHIHPILMAWGYFPEKNSNFNGAAHEGEIMTSLHYVFEID  545

Query  801   GTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGR  622
              T     +E  +LGP  FAA+ PW SG D K R+ KY+RT +IF MVRD G G+V K G 
Sbjct  546   STTPNITLETPALGPGTFAALIPWVSGKDTKVRLAKYARTSHIFVMVRDEGVGEV-KGGI  604

Query  621   IQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVV  442
             ++Y++ + D++N+ TGLR+ALRILVAAGA EVGT+RSDGQ++ C G+K E+LE FL+ V 
Sbjct  605   VKYKLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLKCGGVKEEDLEKFLETVD  664

Query  441   ATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIG  262
             A  G +S    WT   +AHQMG CRMGATEE+GA+D  GE WEA+GLYVCD SVLP+A+G
Sbjct  665   APAGVVSMSRRWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVLPTALG  724

Query  261   VNPMITILSTAYCISNGLAKSLNSGK  184
             VNPM+TI STAYCIS  LA+ +   K
Sbjct  725   VNPMVTIQSTAYCISKRLAELMMKKK  750



>ref|XP_010532671.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=741

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/730 (56%), Positives = 526/730 (72%), Gaps = 18/730 (2%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPLPQ----DSDD----EAMCSFYSSSASQPPFPDEV  2173
             +  G +  + ++LAA+CE ++PP+  P+    D DD    EA+ SFYS S SQ     + 
Sbjct  12    FRRGFTVMEMESLAAVCETILPPLS-PEYSNTDEDDHPNKEALRSFYSGSGSQSHVLHQA  70

Query  2172  AEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAIL  1993
             AE++ +R L + V + RLVL++LS+RLG+L+LCG  C    WPF+  F  L L++RE +L
Sbjct  71    AELITKRGLIEVVLVMRLVLVLLSSRLGTLVLCGTHCLVPNWPFVERFGSLSLEKRERVL  130

Query  1992  LKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQ-QTG  1816
              KW R  ++  +R+ F+ IKI   F +FSW + N  NPAWEAI + V+  E         
Sbjct  131   QKWFRSKILAAIRVAFVHIKIVFLFCFFSWVNTNGENPAWEAIQYQVNLEESESSNILKE  190

Query  1815  RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavl  1636
             RPLEKG++ET+ E  +TL ESL +KGL VT   N + + I+CDVVI+GSG GGGVAAAVL
Sbjct  191   RPLEKGMVETVKETDSTLPESLSEKGLEVTSGSNHDPIKIKCDVVIIGSGSGGGVAAAVL  250

Query  1635  ANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAI  1456
             A+S  KVV+LEKG YF   +YS  EG    +LYESGG+L T DG  M+ AG  VGGGSA+
Sbjct  251   ASSDLKVVILEKGRYFAPSEYSPFEGHGFDQLYESGGVLPTLDGNAMIIAGATVGGGSAV  310

Query  1455  NWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKG  1276
             +WSA IKTP +VL EW  + +IP FG+ EY SAMDAVCKRIGVT  C++E  QNQVLRKG
Sbjct  311   SWSACIKTPESVLQEWVKDHRIPFFGTQEYVSAMDAVCKRIGVTYRCNEESFQNQVLRKG  370

Query  1275  CENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKF  1096
             C NLGLKVE+VPRN SE HYCGSC YGCR GDKKG D T+L+DAVN+GAV+LTGC+AE+ 
Sbjct  371   CHNLGLKVENVPRNSSENHYCGSCCYGCRQGDKKGSDRTWLLDAVNHGAVVLTGCKAERL  430

Query  1095  ILEEDE-----TARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKN  937
             ILE++        + KCLGV+AK    N  + L+IEA+ TV ACG+L TPPL+I S LKN
Sbjct  431   ILEKNMNRGVGAKKMKCLGVMAKCLNGNISRNLQIEAKVTVMACGALLTPPLMIRSSLKN  490

Query  936   KNIGSNLHLHPVLFAWGYFPES-MAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLG  760
             +NIG NLHLH    AWGYFPE   + ++GK ++GGIITS +KV+S+ ++  A+IE  +LG
Sbjct  491   RNIGRNLHLHLAQVAWGYFPEKETSHLKGKIYEGGIITSANKVLSKDSEVRALIETPALG  550

Query  759   PAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIR  580
             P+ F A+SPW+SGLDMK RM KYSRT N+ ++VRD GSG++K  GRI+Y +D+ DK+NI 
Sbjct  551   PSLFTALSPWSSGLDMKNRMTKYSRTANLVTIVRDRGSGEIKAEGRIKYALDKTDKENIV  610

Query  579   TGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTL  400
              GLRQ+LRIL++AGA EVGT RSDGQ + CKGI  + +E FLD V A  GP S  E W +
Sbjct  611   AGLRQSLRILISAGAVEVGTHRSDGQSLKCKGIDEKAIEEFLDTVTAEDGPGSFTEKWMV  670

Query  399   YCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCI  220
             Y +  QMGSCR+G  EE+GA+D NGE WEA+ L+VCDGSVLPSAIGVNPMIT+++TAYCI
Sbjct  671   YGTTQQMGSCRIGVNEEEGALDPNGESWEAEKLFVCDGSVLPSAIGVNPMITVMATAYCI  730

Query  219   SNGLAKSLNS  190
             S G+AKS+ +
Sbjct  731   STGIAKSIRT  740



>ref|XP_006857358.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
 gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/777 (52%), Positives = 525/777 (68%), Gaps = 47/777 (6%)
 Frame = -3

Query  2376  NERKCHPLLRGGRR-NSYNHGLSSSQYQALAAICEALIPPIPLP--------QDSDDEAM  2224
             ++   HPLLRGGR+  S++HG + +Q Q+L AICEALIP +P+               ++
Sbjct  4     DQNTAHPLLRGGRKEKSFSHGFTKAQIQSLTAICEALIPSMPITALHVSSQRDPPPSPSL  63

Query  2223  CSFYSSSASQPPFPDE-----------VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLL  2077
              SFY +S S    PD+           VAE++++R LPDAV +   VL  LSTRLG+LLL
Sbjct  64    VSFYKASGSDYQVPDQALFRSRNSETFVAELMVKRGLPDAVTLVSWVLWALSTRLGTLLL  123

Query  2076  CGFVCFDGRWPFIHNFSELPLKRREAILLKWSRE-TLILPLRIVFMTIKIACYFIYFSWT  1900
             CG  C    +PFI +FSE+P+++RE +L+ WSRE +    LR+ F   KI C ++++SWT
Sbjct  124   CGSTCLSLNFPFIRSFSEMPVEKREKVLMAWSRERSFFSALRLSFALFKIFCVYVFYSWT  183

Query  1899  DENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTES  1720
             D N  NP+WEAI +     + P      +  +  II T      +L  ++  KG+ VTE 
Sbjct  184   DVNSKNPSWEAIDYSPGPLKPP-KNPPPKSFKDSIISTTTLTKESLVSTIKTKGITVTED  242

Query  1719  QNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGEL  1540
              +A+ LT+ CD V+VGSG GG VAAA LA SG++V+VLEKG YF  +DYS LEGPS+ ++
Sbjct  243   PSADLLTLECDAVVVGSGPGGSVAAAKLAKSGYQVLVLEKGLYFTPQDYSLLEGPSMDQM  302

Query  1539  YESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQS  1360
             YESGG+L+TTD KV++ AG+ VGGGSAINWSA IKTP+ VL +WS +  + LFGS  Y++
Sbjct  303   YESGGILSTTDAKVLITAGSTVGGGSAINWSACIKTPDKVLKQWSEDFSLSLFGSHNYRA  362

Query  1359  AMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGD  1180
             AM+AVCKR+GVTE C KE  QN+V R GCE LGLKVE VPRN  E HYCG CGYGCRTG+
Sbjct  363   AMEAVCKRLGVTEKCEKENFQNEVFRSGCERLGLKVEFVPRNSPEGHYCGQCGYGCRTGE  422

Query  1179  KKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETARKK-------------CLGVIA--  1045
             K+G   T+LVDA   GA+I TG +A+KF++ E++   +K             C+GV+A  
Sbjct  423   KQGTQCTWLVDAAEAGALIFTGVKAKKFVMRENDGLERKESGKPWSRERDQRCVGVMAVT  482

Query  1044  ----KSKGNNKILR--IEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGY  883
                   KG    LR  I+A+ +VSACGSL TPPLLISSGL+N NIG NL LHPV  AWGY
Sbjct  483   GCKVNQKGKKSSLRLMIKAKLSVSACGSLLTPPLLISSGLRNPNIGRNLRLHPVSMAWGY  542

Query  882   FPESMA--EMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLD  715
             FPE      + GK +QGGIITSIHK+V E        IIE   LGPA F+A+ PW SG +
Sbjct  543   FPEQDCGESLRGKCYQGGIITSIHKLVLENQDHDSGVIIETPFLGPASFSAIFPWLSGSE  602

Query  714   MKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGA  535
             MKE MR+Y+RTV+IF +VRD GSG+V K  +I Y + + D++  + GLR ALRILVAAGA
Sbjct  603   MKEAMRRYARTVHIFVLVRDTGSGEVMKERKITYNLHRTDREKFKKGLRTALRILVAAGA  662

Query  534   AEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGAT  355
              EVGT RSDGQ+I  KG++ E+ E FLDG+   GG  SGEE W LY SAHQMGSCRMGA 
Sbjct  663   VEVGTHRSDGQRIKTKGMRDEDFEEFLDGIEVFGGAYSGEEKWNLYTSAHQMGSCRMGAD  722

Query  354   EEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             EE  A+D  GE WEA+GL+VCDGS++P+A+GVNPMIT+ S A+CIS+ + + L  G+
Sbjct  723   EEKSAVDERGESWEAEGLFVCDGSLMPTALGVNPMITVQSIAHCISDNMVEFLRDGE  779



>emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
Length=678

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/671 (58%), Positives = 493/671 (73%), Gaps = 10/671 (1%)
 Frame = -3

Query  2169  EVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILL  1990
             E+V +R   +A    RL+L +L+TRLG+LL+CG  C   RWPF+  FSEL L++RE +L 
Sbjct  5     ELVTKRGTIEAYIATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQ  64

Query  1989  KWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE-VPPDQQTGR  1813
             K  +  ++ P+R  F+ IK+A  F +FS  + N  NPAWEAIG+ V+ +E  P +    R
Sbjct  65    KQFKNWILTPIRAAFVYIKVAFLFCFFSRVNPNGENPAWEAIGYRVNPDENKPSETHNER  124

Query  1812  PLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlA  1633
             PLEKGI+ET+ E   TL ESL  KGL        + + I+CDVV+VGSG GGGVAA+VLA
Sbjct  125   PLEKGIVETMEETEQTLLESLAHKGLEAVLDTEHDAIRIKCDVVVVGSGSGGGVAASVLA  184

Query  1632  NSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAIN  1453
              SG KVVVLEKG YF   ++   EGP L +LYE+GG+L + DG  MV AG  VGGGSA+N
Sbjct  185   KSGLKVVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAVN  244

Query  1452  WSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGC  1273
             WSA IKTP +VL EWS +Q IPLFG+ EY +AM+ V KR+GVTE C  E  QNQ+LRKGC
Sbjct  245   WSACIKTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKGC  304

Query  1272  ENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFI  1093
             ENLG  VE+VPRN SE HYCGSCGYGCR GDKKG D T+LVDAV +GAVILTGC+AE+FI
Sbjct  305   ENLGFNVENVPRNSSESHYCGSCGYGCRQGDKKGSDRTWLVDAVGHGAVILTGCKAERFI  364

Query  1092  LEEDETAR----KKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKN  931
             LE++ + +     KCLGV+AKS   N  K+L+IEA+ TVSA G+L TPPL+ISSGL+N+N
Sbjct  365   LEKNGSNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGALLTPPLMISSGLRNRN  424

Query  930   IGSNLHLHPVLFAWGYFPE---SMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLG  760
             IG NLHLHPVL AWGYFP+   S    +G +++GGIITS+ KV+SE ++  AIIE   LG
Sbjct  425   IGKNLHLHPVLMAWGYFPDKESSNISFKGNSYEGGIITSVSKVLSEDSEVRAIIETPQLG  484

Query  759   PAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIR  580
             P  F+ ++PWTSGLDMK+RM +YSRT ++ ++VRD GSG+VK  GRI Y +D+ D+DN++
Sbjct  485   PGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRINYTVDKTDRDNLK  544

Query  579   TGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTL  400
              GLR++LRIL+AAGA EVGT RSDGQ++ CKG+    ++ FLD V    G     E W +
Sbjct  545   AGLRESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQEFLDSVSTEEGAKGMTEKWNV  604

Query  399   YCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCI  220
             Y SAHQMGSCR+G  E++GAID NGE WEA+ L+VCD S LPSA+GVNPMIT++STAYCI
Sbjct  605   YSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCI  664

Query  219   SNGLAKSLNSG  187
             S  +AKS+ +G
Sbjct  665   STRIAKSMTTG  675



>ref|XP_010532673.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=770

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/737 (56%), Positives = 538/737 (73%), Gaps = 33/737 (4%)
 Frame = -3

Query  2343  GRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS-----DD----EAMCSFYSSSASQP  2191
             GRR     G ++++ ++LAA+C+ ++PP+  P+DS     DD    EA+ SF S+SASQP
Sbjct  41    GRR-----GFTAAEMESLAAVCDTILPPLS-PEDSAGGGEDDHPNKEALRSFCSASASQP  94

Query  2190  PFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLK  2011
              F  +  E++++R   +AV + RLVL++LS+R G+LLLCG  C    WPF+  F  L L+
Sbjct  95    LFLHQTVELMLKRGFIEAVLVVRLVLLLLSSRFGTLLLCGTHCLVPNWPFVERFGSLSLE  154

Query  2010  RREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV-----DT  1846
             +RE +L KW R  L+ P+R+ F+ IK+   F +FSW   N +NPAWEAI + V     ++
Sbjct  155   KRERVLQKWFRNRLLFPIRVAFIFIKVIFLFCFFSWIGPNGDNPAWEAIQYQVKAEDNES  214

Query  1845  NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsg  1666
             + VP +    RPLEKG+++T+ E  +TL E++ +K L VT     +T+ I+CD VI+GSG
Sbjct  215   SYVPKE----RPLEKGMVDTMKETDSTLPETIRQKELGVTFGSKHDTIEIKCDAVIIGSG  270

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
              GGGVAAAVLAN+G KVVVLEKG YFVS +YS  EGP L ELYESGG+L T DG +M+ A
Sbjct  271   SGGGVAAAVLANAGLKVVVLEKGSYFVSSEYSPFEGPGLSELYESGGILPTVDGNLMILA  330

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             G  VGGGS +N+SASIKTP +VL EW+ + KIPLFG+ EY SAMD V KRI VTE C +E
Sbjct  331   GATVGGGSVVNYSASIKTPESVLREWAEDHKIPLFGTQEYVSAMDVVWKRISVTEKCRQE  390

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAV  1126
               QNQVLRKGC NLGLKVE+VPRN SE H CGSC YGCR GDK+G D T+L+DAVN+GA+
Sbjct  391   SFQNQVLRKGCLNLGLKVENVPRNSSENHCCGSCCYGCRQGDKQGSDRTWLLDAVNHGAI  450

Query  1125  ILTGCQAEKFILEEDE-----TARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTP  967
             ILTGC+AE+ ILE++        + KC GV+A S   N  K L IEA+ TV ACG++ TP
Sbjct  451   ILTGCKAERLILEKNMNRGVGAKKMKCSGVMANSLNGNISKKLHIEAKVTVVACGAISTP  510

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPES-MAEMEGKNHQGGIITSIHKVVS-EGTK  793
             PL+I SGLKN+NIG NLHLHPVL AWGYFPE   ++++G  ++G I+TSI+KVVS + ++
Sbjct  511   PLMIKSGLKNRNIGRNLHLHPVLMAWGYFPEKETSDLKGSIYEGEILTSINKVVSYQDSE  570

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
               AIIE  +LGP+ FAAV PW SGLDMK RM KYSRT ++ ++VRD GSG++K  GR++Y
Sbjct  571   VRAIIETPALGPSSFAAVCPWISGLDMKNRMIKYSRTAHLLTIVRDRGSGEIKTEGRVKY  630

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
              +D+ DK+NI  GLRQ+LRIL++A A EVGT RSDGQ+  CKG+  + +E FLD V A  
Sbjct  631   VVDKTDKENIVAGLRQSLRILISARAVEVGTHRSDGQRFKCKGMDEKAIEEFLDTVTAED  690

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             G  S  E W +Y SAHQMGSCR+G  EE+GA+D NGE WEA+GL+VCDGSVLPSAIGVNP
Sbjct  691   GASSLTEKWAVYGSAHQMGSCRIGENEEEGALDPNGESWEAEGLFVCDGSVLPSAIGVNP  750

Query  252   MITILSTAYCISNGLAK  202
             MITI++T+Y IS G+A+
Sbjct  751   MITIMATSYGISTGIAR  767



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/750 (52%), Positives = 532/750 (71%), Gaps = 34/750 (5%)
 Frame = -3

Query  2361  HPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPL---------PQDSDDEAMCSFYS  2209
             HPLLRG RR+ Y HG+  +Q +AL A+C ALIP +P          P   D E    FY 
Sbjct  20    HPLLRGWRRDRYTHGMHPAQMEALRAMCGALIPSLPADGAHGRGDPPGGKDLE---RFYR  76

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNF  2029
             +SA+    PDEVAE+++ R + +AV +  +VL +LSTR+G+LLLCG +C  G +P++  F
Sbjct  77    ASAADSTIPDEVAELMVTRCIREAVALAWVVLWVLSTRVGTLLLCGRLCLAGGFPYVRKF  136

Query  2028  SELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV-  1852
             +++  +RREA L +W+R   + PLRI F  +KI C++++++  +EN  NP W+AIG+ V 
Sbjct  137   ADMTPERREAALQRWNRVRWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVH  196

Query  1851  ----DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE-SQNANTLTIRCD  1687
                 D  E  P     RPL+ G++ET   +   L  SL+ +GL V   + +AN   ++CD
Sbjct  197   EPREDQTEAAPSPS--RPLDVGVVETRLLDDNALLRSLVGRGLTVKPVASDANHHVVQCD  254

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
              VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF + DYS +EGPS+  L+E GG+  T++
Sbjct  255   AVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTASDYSSIEGPSMERLFERGGIFCTSN  314

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
                M+F G  VGGGSA+NWSASI+TP  V  EW+ E  +P+F S  Y  AMDAVC R+ V
Sbjct  315   VTTMIFTGATVGGGSAVNWSASIRTPKEVTQEWAREHGLPVFASPGYAQAMDAVCARLSV  374

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             T+ C +EG QN+V+R+GCE LGL  ++VPRN SE H+CGSC +GC TGDK+G DTT+LVD
Sbjct  375   TDGCREEGFQNKVVRRGCEALGLCADAVPRNSSEGHFCGSCNFGCPTGDKRGTDTTWLVD  434

Query  1146  AVNNGAVILTGCQAEKFILEEDE----TARKKCLGVIA--KSKGNNKILRIEARATVSAC  985
             AV +GAVILTGC+AE+F+ E++        KKC+G+++   S G  K LRIEA+ +++AC
Sbjct  435   AVASGAVILTGCKAERFVFEKNSGGGRGRGKKCVGLVSTCASDGITKKLRIEAKVSIAAC  494

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM--AEMEGKNHQGGIITSIHKV  811
             G+L TPPLL +SGLKN++IG NLHLHPV  AWGYFPE+    ++ GK+++GGIITS+H+V
Sbjct  495   GALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENRQDPQLTGKSYEGGIITSMHRV  554

Query  810   VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
                   +  IIE  +LGP  FAA+ PW SG DMKERMR+YSRT + F++VRD G+G V  
Sbjct  555   T-----ERTIIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGAGFVDG  609

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
              GR+++   + D + +R GLR+ LRILVAAGAAEVGT RSDG ++ CKG++ E+LE+FLD
Sbjct  610   EGRVRFTPSREDVEELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEAFLD  669

Query  450   GVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLP  274
              V    GPM S  + W L+CSAHQMGSCRMG++  DGA+D  GE WEA+GLYVCDGS+LP
Sbjct  670   EVTIEKGPMHSTADKWALHCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLP  729

Query  273   SAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             +A+GVNPMITI S AYC+S G+A++L  G+
Sbjct  730   TAVGVNPMITIQSIAYCLSKGIAETLTQGE  759



>ref|NP_171895.2| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
 sp|Q9ZWB9.2|FAO1_ARATH RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Arabidopsis thaliana]
 gb|AEE27643.1| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
Length=758

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/749 (53%), Positives = 529/749 (71%), Gaps = 21/749 (3%)
 Frame = -3

Query  2370  RKCHPLLRGG-RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS---------DDEAMC  2221
             ++  PLLR   ++ S++HG S S  QAL++IC+A++PP+PL   +         +D  + 
Sbjct  9     KRGSPLLRWSVKQESFSHGFSKSDLQALSSICDAIMPPVPLESLNLEMKLKVLRNDALLS  68

Query  2220  SFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR-WP  2044
              F SSS+     PDEVAE++  + +P  V + R+VL IL+ RLG+LLLCG VC D + WP
Sbjct  69    FFKSSSSESHVRPDEVAELLATKAIPLTVLVVRIVLRILTFRLGTLLLCGLVCLDKKHWP  128

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
             F+  FSE+ L++RE +L +W+ +      RI FM IK    F YF+WT+EN  NP W+AI
Sbjct  129   FLLKFSEMSLEKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTNENSENPVWDAI  188

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
              + V+  E    +Q  RPL++GIIET  E+  T+K+ +I KGL VTE +  +T  I CD 
Sbjct  189   NYSVEIGENEDMEQKERPLDEGIIETAKEDEMTIKQRMINKGLKVTEDRERDTYKIECDA  248

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             V+VGSGCGGGVAAA+LA SG +VVV+EKG+YF   DYS LEGPS+ EL+ES  ++ T DG
Sbjct  249   VVVGSGCGGGVAAAILAKSGLRVVVIEKGNYFAPRDYSALEGPSMFELFESNSLMMTHDG  308

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             +    AG+ VGGGS +NW+AS+KTP+ ++ EWS+ + I ++ S +Y++AM  VCKR+GVT
Sbjct  309   RFRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVHRGISIYSSEKYKAAMGIVCKRLGVT  368

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             E   +EG QNQ+LRKGCE LGL V  VPRN +EKHYCGSC YGC TG+K+G D+T+LVDA
Sbjct  369   EKIIREGFQNQILRKGCEKLGLDVTIVPRNSTEKHYCGSCSYGCPTGEKRGTDSTWLVDA  428

Query  1143  VNNGAVILTGCQAEKFIL-------EEDETARKKCLGVIAK-SKGNNKILRIEARATVSA  988
             VNN AVILT C+AEK IL        E+   RK+CLGV A  S    K L+I A+ T+ A
Sbjct  429   VNNNAVILTQCKAEKLILADNDANKREESGRRKRCLGVAASLSHQTRKKLQINAKVTIVA  488

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
             CGSL TP LL SSGLKN NI   LH+HP++ AWGYFPE  +E+EG  H+G I+TS+H V 
Sbjct  489   CGSLKTPGLLASSGLKNSNISRGLHIHPIMMAWGYFPEKNSELEGAAHEGEIVTSLHYVH  548

Query  807   S-EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
               + T     +E  ++GP  FAA++PW SG DMKERM KY+RT +IF+MVRD G G+V K
Sbjct  549   PMDSTTPNITLETPAIGPGTFAALTPWVSGSDMKERMAKYARTAHIFAMVRDEGVGEV-K  607

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                ++YR+ + D++N+  GL+QALRILVAAGAAEVGT+RSDGQ++ C GIK ++LE+FLD
Sbjct  608   GDIVKYRLTKADEENLTIGLKQALRILVAAGAAEVGTYRSDGQRMKCDGIKQKDLEAFLD  667

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
              V A  G +S  ++WT   +AHQ+G CRMGATE++GAID  GE WEA+ LYVCD SVLP+
Sbjct  668   TVNAPPGVVSMSKHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPT  727

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             A+GVNPMIT+ STAYCISN +A+ +   K
Sbjct  728   ALGVNPMITVQSTAYCISNRIAELMKKRK  756



>ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
Length=760

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/754 (53%), Positives = 522/754 (69%), Gaps = 37/754 (5%)
 Frame = -3

Query  2361  HPLLRGG-RRNSYNHGLSSSQYQALAAICEALIPPIPLP-----------QDSDDEAMCS  2218
             HPLLRGG RR  Y HGL ++Q +AL AIC A IP +P             +   D+ +  
Sbjct  12    HPLLRGGERRERYTHGLGAAQMEALRAICGAFIPSLPEAAAALAEADDEGRGGGDKDLER  71

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFD-----G  2053
             FY +SA+    PDEVAE+++ R   +AV +  +VL +L+TR G+L LCG          G
Sbjct  72    FYLASAADAAVPDEVAELMVNRCAWEAVALVTVVLWLLATRAGTLALCGAAACVASSAAG  131

Query  2052  RW-PFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPA  1876
              W P +  F++LP +RREA L +WS    + PL+I F  IKI C+F++++  DE   NP+
Sbjct  132   GWLPSVRRFADLPPERREAALRRWSSARWLFPLKITFTVIKIICHFVFYTKLDEKSRNPS  191

Query  1875  WEAIGFHVD------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQN  1714
             W+AIG+           +  P   + RPLE G++ET   +   L  SL++KGL V     
Sbjct  192   WKAIGYAAPAAAAAAVEQRRPASPSRRPLEDGVVETRRMDDNALLRSLVEKGLAVKTGTA  251

Query  1713  ANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYE  1534
             A+  T++CD V+VGSGCGGGVAAAVLA+ G+KVVV+EKG YF +EDY+ LEGPS+  LYE
Sbjct  252   AHH-TVQCDAVVVGSGCGGGVAAAVLASKGYKVVVVEKGDYFATEDYTSLEGPSMERLYE  310

Query  1533  SGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAM  1354
              GG+  T++   ++F G  VGGGSA+NWSA I+TP  +  EWS E  +P+F S+ Y  AM
Sbjct  311   KGGVFGTSNVTTILFTGATVGGGSAVNWSACIRTPAEIREEWSREHGLPVFASTAYAQAM  370

Query  1353  DAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKK  1174
             DAVC RI VT  C +EG QN+VLR+GC+ LG++ ++VPRN SE H+CGSC  GC TGDKK
Sbjct  371   DAVCDRIRVTGGCEEEGFQNRVLRRGCDALGMRADAVPRNSSEGHFCGSCNLGCPTGDKK  430

Query  1173  GVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR----KKCLGVIA--KSKGNNKILRI  1012
             G DTT+LVDAV  GAVILTGC+AE FILE +   R    K+C+G++A   S G  K LRI
Sbjct  431   GTDTTWLVDAVERGAVILTGCKAEHFILERNAGGRGGRSKRCVGLMATCTSSGITKKLRI  490

Query  1011  EARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGI  832
             EA+ ++SACG+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP+S AE+ GK ++GGI
Sbjct  491   EAKVSISACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELPGKCYEGGI  550

Query  831   ITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDH  652
             ITS+H+V         IIE  +LGP  F+AV PW SG DMKERMR+Y+RT + F++VRD 
Sbjct  551   ITSMHRVTDR-----TIIETPALGPGAFSAVVPWESGRDMKERMRRYARTAHAFALVRDR  605

Query  651   GSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTE  472
             G+G V   GR+++   + D + +R GLR+ALRILVAAGAAEVGT RSDG ++ CKG++  
Sbjct  606   GAGAVDGEGRVRFSPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGLRLRCKGVRDA  665

Query  471   ELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYV  295
             ++E+FLD V    GPM  G + W ++CSAHQMGSCRMGA+  DGA+D  GE WEA+GLYV
Sbjct  666   DVEAFLDEVTIEKGPMYPGSDKWAIFCSAHQMGSCRMGASPRDGAVDGAGESWEAEGLYV  725

Query  294   CDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             CDGS+LP+A+GVNPMITI S AYC+SNG+A +L+
Sbjct  726   CDGSLLPTAVGVNPMITIQSIAYCLSNGIADTLS  759



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/751 (53%), Positives = 530/751 (71%), Gaps = 32/751 (4%)
 Frame = -3

Query  2361  HPLLRGG-RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD------DEAMCSFYSSS  2203
             HPLLRGG RR+ Y HG+  +Q +AL A+C ALIP +P   D+        + +  FY +S
Sbjct  36    HPLLRGGWRRDRYTHGMRPAQMEALRAMCGALIPSLPADADAGRGDPPGGKDLERFYLAS  95

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
             A+    PDEVAE+++ R + +AV +  +VL  LSTR G+LLLCG +     +P++  F++
Sbjct  96    AADSTIPDEVAELMVTRCIREAVALAWVVLWALSTRAGTLLLCGRLSLGAGFPYVRRFAD  155

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTN  1843
             +  +RREA L +W+R   + PLRI F  +KI C++++++  +EN  NP W+AIG+ VD  
Sbjct  156   MAPERREAALRRWNRVRWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVD--  213

Query  1842  EVPPDQ------QTGRPLEKGIIETINENGTTLKESLIKKGLNVT-ESQNANTLTIRCDv  1684
             E   D+         RPL+ G++ET   +   L  SL+ +GL V   S +AN  T++CD 
Sbjct  214   EPREDRARTATPSPSRPLDVGVVETRLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDA  273

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF +EDYS +EGPS+  L+E GG+  T++ 
Sbjct  274   VIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNV  333

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
               M+F G  VGGGSA+NWSASI+TP  V  EW+ E  +P+F S  Y  AMDAVC R+GVT
Sbjct  334   TTMIFTGATVGGGSAVNWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVT  393

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             + C +EG QN+V+R+GCE LGL  ++VPRN S+ H+CGSC +GC TGDK+G DTT+LVDA
Sbjct  394   DGCQEEGFQNKVVRRGCEALGLCADAVPRNSSDAHFCGSCNFGCPTGDKRGTDTTWLVDA  453

Query  1143  VNNGAVILTGCQAEKFILEEDE------TARKKCLGVIA--KSKGNNKILRIEARATVSA  988
             V  GAVILTGC+AE F+LE++          KKC+G++A   S G  K LRIEA+ +++A
Sbjct  454   VARGAVILTGCKAEYFVLEKNHSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAA  513

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE--MEGKNHQGGIITSIHK  814
             CG+L TPPLL  SGLKN++IGSNLHLHPV  AWGYFPE+  +  + GK ++GGIITS+H+
Sbjct  514   CGALMTPPLLRRSGLKNRHIGSNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHR  573

Query  813   VVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK  634
             V         IIE  +LGP  FAA+ PW SG DMKERMR+YSRT + F++VRD G G V 
Sbjct  574   VTDR-----TIIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVD  628

Query  633   KAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL  454
               GR+++   + D D +R GLR+ LRILVAAGAAEVGT RSDG ++ CKG++ E+LE FL
Sbjct  629   GEGRVRFTPSREDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFL  688

Query  453   DGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVL  277
             D V    GPM S  + W L+CSAHQMGSCRMG++ +DGA+D  GE WEA+GLYVCDGS+L
Sbjct  689   DEVTIEKGPMHSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLL  748

Query  276   PSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             P+A+GVNPMITI S A+C+S G+A+++  G+
Sbjct  749   PTAVGVNPMITIQSIAFCLSKGIAETMAQGQ  779



>emb|CDY18199.1| BnaC05g02220D [Brassica napus]
Length=752

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/736 (54%), Positives = 520/736 (71%), Gaps = 20/736 (3%)
 Frame = -3

Query  2361  HPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPL-PQDSD-------DEAMCSFYS  2209
             HPLLR   ++ +++HG S S  QAL+AICEA++PP+PL   D D       ++A+ SF+ 
Sbjct  12    HPLLRWSTKQENFSHGFSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFK  71

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR-WP-FIH  2035
             SS S    PDEVAEV+  + +P  V + R+VL +L+ RLG+LLLCGFVC D + W   + 
Sbjct  72    SSGSHVR-PDEVAEVMATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWSSLLL  130

Query  2034  NFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH  1855
              FS++ L++RE +L KW+++      RI FM IK    F YF+WT+EN  NPAW+AIG+ 
Sbjct  131   KFSDISLEKREKVLQKWNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDAIGYK  190

Query  1854  VDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvviv  1675
             VD  E    +   RPLEKGIIET  E+  T+K+ +I KGL + E + +NT  I CD V++
Sbjct  191   VDIGENEDTEHKQRPLEKGIIETAKEDEATIKQLMISKGLKLKEDKESNTFKIECDAVVI  250

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSGCGGGVAAA LA SG KV+V+EKG+YFV +DYS LEGPS+ E++E+ G+L T DG+  
Sbjct  251   GSGCGGGVAAANLAKSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMFEANGLLVTHDGRFR  310

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
               AG  +GGGS +NW+AS+KTP+ ++ EWS+++ I  F    Y +AM++VCKRIGVTE  
Sbjct  311   FMAGATLGGGSVVNWAASLKTPDAIIEEWSVDKGIATFAREGYTAAMESVCKRIGVTERV  370

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              +EG QNQ+LRKGCE LGL V  VPRN SE+HYCGSC +GC+TGDK+G + T+LVDAV+N
Sbjct  371   IREGFQNQILRKGCEKLGLDVTVVPRNSSEEHYCGSCSFGCKTGDKRGTNITWLVDAVDN  430

Query  1134  GAVILTGCQAEKFILEEDETAR---KKCLGVIA--KSKGNNKILRIEARATVSACGSLFT  970
              AVILT C+AEK IL + ET R   K+CLGV A   +K  NKI  I A+ TV ACGSL T
Sbjct  431   SAVILTQCRAEKLILADTETGRRKKKRCLGVTASISNKTINKI-EINAKVTVVACGSLMT  489

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS-EGTK  793
             P LL SSGLKN NIG  LH+HP+L AWGYFPE  +   G  H+G I+TS+H V   + T 
Sbjct  490   PRLLSSSGLKNHNIGRGLHIHPILMAWGYFPEKNSSFNGAAHEGEIMTSLHYVFEIDSTT  549

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
                 +E  +LGP  FAA+ PW SG DMKER+ KY+RT +IF MVRD       K G ++Y
Sbjct  550   PNITLETPALGPGTFAALVPWVSGKDMKERLAKYARTSHIFVMVRDE-GVGEVKGGVVKY  608

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             ++ + D++N+ TGLR+ALRILVAAGA EVGT+RSDGQ++ C G++ E+LE FL+ V A  
Sbjct  609   KLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLRCDGVEEEDLEKFLETVDAPP  668

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
             G +S    WT   +AHQMG CRMGATEE+GA+D  GE WEA+GLYVCD SV+P+A+GVNP
Sbjct  669   GVVSMSRWWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVMPTALGVNP  728

Query  252   MITILSTAYCISNGLA  205
             MIT  STAYCIS  LA
Sbjct  729   MITTQSTAYCISKRLA  744



>ref|XP_004982882.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=762

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/750 (52%), Positives = 533/750 (71%), Gaps = 31/750 (4%)
 Frame = -3

Query  2361  HPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQ-----DSD-----DEAMCSFY  2212
             HPLL G +R  Y HGL   Q +AL A+C ALIP +P+ +     D+D      + +  FY
Sbjct  18    HPLLGGCKRERYTHGLRPPQMEALRAMCGALIPSLPVVEGHHGGDADHGRGSKDVVERFY  77

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +SA+    PDEVAE+V R  + +AV +  +VL ILSTR+G+L LCG +C  G++P++  
Sbjct  78    LASAADGTIPDEVAELVTR-CVWEAVVLVNVVLWILSTRVGTLALCGRLCMSGKFPYVRK  136

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             F+++P++RRE  L +W++   + PL+I F+ IK+  ++ +++  +EN +NP W+AIG+ V
Sbjct  137   FADMPVERREEALGRWNKARWLFPLKITFVVIKVLSHYAFYTMVNENSDNPCWKAIGYSV  196

Query  1851  DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
                E P +  + R L+ G++ET   N TTL  SL+ KGL V  +  +   T++CDVVIVG
Sbjct  197   PDMEEPREAPSPRSLDNGVVETKALNDTTLLRSLVDKGL-VVRTDASTYHTVQCDVVIVG  255

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAA LA++GHKVVV+EKG YF +EDYS +EGPS+  LYE GG+  T++   ++
Sbjct  256   SGCGGGVAAAALASAGHKVVVVEKGEYFTAEDYSSVEGPSMERLYEKGGIFCTSNVTTVL  315

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
             F G+MVGGGSA+NWSASI+TP  V  EW+ E  +P+F S  Y  AMDAVC R+ VT+ C 
Sbjct  316   FTGSMVGGGSAVNWSASIRTPEEVRQEWAREHGLPVFASPGYVEAMDAVCARLAVTDGCR  375

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QN+ +R+GCE LGL+ ++VPRN SE H+CGSC  GC TGDK+G DTT+LVD+V  G
Sbjct  376   EEGFQNKAVRRGCEALGLRADAVPRNSSEGHFCGSCHLGCPTGDKRGTDTTWLVDSVARG  435

Query  1131  AVILTGCQAEKFILEED--ETAR--KKCLGVIAKS--KGNNKILRIEARATVSACGSLFT  970
             AVILTGC+AE FILE +  E AR  +KC+G++A     G  K LRIEA+ +++ACG+L T
Sbjct  436   AVILTGCKAECFILESNSGENARRSRKCVGLVATCMVAGVTKKLRIEAKVSIAACGALMT  495

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE------MEGKNHQGGIITSIHKVV  808
             PPLL +SGLKN++IG NLHLHPV  AWGYFPE+  +      + GK ++GGIIT++H+V 
Sbjct  496   PPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENKQQEPQPPPLTGKCYEGGIITTMHRVT  555

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
                  +  I+E  +LGP  FA++ PW SG DMK+RMR+Y+RT + F++VRD G+G V   
Sbjct  556   -----ERTIVETPALGPGCFASMVPWESGRDMKDRMRRYARTAHAFALVRDRGAGTVDGE  610

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCK-GIKTEELESFLD  451
             GR+ Y   + D D +R GLR+ALRILVAAGAAEVGT RSDG ++ C  G++ +EL++FLD
Sbjct  611   GRVCYSPARDDVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDELDAFLD  670

Query  450   GVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLP  274
              V    GPM  G + W L CSAHQMGSCRMG++  DGA+D  GE WEA+GLYVCDGS+LP
Sbjct  671   EVTVATGPMLPGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLP  730

Query  273   SAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             +A+GVNPMITI STAYC+S G+A+SL   K
Sbjct  731   TAVGVNPMITIQSTAYCLSEGIAESLAQRK  760



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/670 (57%), Positives = 496/670 (74%), Gaps = 8/670 (1%)
 Frame = -3

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             VAE+V R F+ +A  I R VL++LSTRLGSLL+CG +C  G+WP++  FSE+ ++ RE I
Sbjct  1     VAELVGRTFV-EARLIVRFVLVLLSTRLGSLLICGRLCLVGKWPYVRRFSEIGVEDREEI  59

Query  1995  LLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTG  1816
             + +W     + P+R+ F+ +K+    ++FS  DEN  NPAW+AIG+ VD       +  G
Sbjct  60    VRRWFGNWFLTPIRVAFVFLKLLILLVFFSRVDENSQNPAWKAIGYEVDDPGRRCKKSDG  119

Query  1815  R-PLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaav  1639
             R PLE+GI+E   E  ++  +SL +KGL  T S+  N   + CD V+VGSGCGGGVAAAV
Sbjct  120   RRPLERGIVEGRLETESSFVDSLAEKGLTATPSERENAYRVECDAVVVGSGCGGGVAAAV  179

Query  1638  lANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSA  1459
             LA +GHKVVVLEKG YF ++DYSGLEGPSL +LYESGG+ ++ +GK+M+ AG  VGGGSA
Sbjct  180   LARAGHKVVVLEKGDYFAADDYSGLEGPSLRQLYESGGVFSSLEGKLMILAGATVGGGSA  239

Query  1458  INWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRK  1279
             +NWSA IKTP  VLN+W+ + K+PLF S  Y SAMD +  RIGVT+ C+ E  QN+VLRK
Sbjct  240   VNWSACIKTPPEVLNQWANDYKLPLFTSPGYASAMDEIWSRIGVTQNCAAESFQNKVLRK  299

Query  1278  GCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEK  1099
             GCE LGLK ESV  N SE H+CGSC YGC  GDKKG DTT+LVDAV +GAVI++GC+A+K
Sbjct  300   GCEALGLKSESVATNSSENHFCGSCCYGCMRGDKKGTDTTWLVDAVESGAVIISGCKAQK  359

Query  1098  FILEEDETARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIG  925
              IL+     + KC+G+ A    ++  K ++I ARATVSACG+L TPP LISSGL+N+NIG
Sbjct  360   LILQNGGRRKNKCVGIEASFTNSHIKKRIKIIARATVSACGALSTPPFLISSGLRNRNIG  419

Query  924   SNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSE---GTKQAAIIEAVSLGPA  754
              NLHLHPVL AWGYFPE+ +   GK++QGGIITS+HKV+SE     K  AI+E+  LGP 
Sbjct  420   RNLHLHPVLMAWGYFPETESP-NGKSYQGGIITSLHKVISENGSSPKVKAIVESPILGPG  478

Query  753   GFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTG  574
              FAA+ PW SG DMK RM +YSRT ++FS+++D   G+V + GRI Y ++QIDK+NI +G
Sbjct  479   SFAALCPWESGEDMKNRMMRYSRTAHLFSIIKDEAGGEVIREGRISYHLNQIDKENITSG  538

Query  573   LRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYC  394
             LR ALRIL++AGA EVGT RSDGQ++ C+GI  +E+E FLDGV A  GP S   +W++YC
Sbjct  539   LRTALRILISAGAVEVGTHRSDGQRLKCRGISEKEIEEFLDGVTAPEGPKSMVRDWSVYC  598

Query  393   SAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             SAHQMGSCRMG  EE+G +D NGE WEA+GL+VCD S+LP AIGVNPMITI +T+YCIS 
Sbjct  599   SAHQMGSCRMGRNEEEGGVDENGESWEAEGLFVCDSSLLPGAIGVNPMITIQATSYCISL  658

Query  213   GLAKSLNSGK  184
              +A +L   K
Sbjct  659   NIADNLKKTK  668



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/791 (51%), Positives = 538/791 (68%), Gaps = 58/791 (7%)
 Frame = -3

Query  2412  EGEKIFKREKKMNERKC--HPLLRGGRRN-SYNHGLSSSQYQALAAICEALIPPIPL---  2251
             +GE+  K EK    R+   HPLLRG RR   Y HG+  +Q +AL AIC A IP +P    
Sbjct  4     QGEEGRKEEKAAAGRRAGPHPLLRGWRREGKYTHGMHPAQMEALRAICGAFIPSMPAEEA  63

Query  2250  ----------PQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILS  2101
                       P   D E    FY +SA+    PDEVAE+++ R + +AV +  +VL +LS
Sbjct  64    AGAGGRADPPPGGKDLE---RFYLASAADSTIPDEVAELMVTRCIREAVLLAWVVLWVLS  120

Query  2100  TRLGSLLLCGFVCF-------DGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFM  1942
             TR+G+LLLCG +         D  +P +  F+++P+ RREA L +W+    +LPLRIVF 
Sbjct  121   TRVGTLLLCGRLSLSFSGGARDFSFPCVSRFADMPVARREAALQRWNSTRWLLPLRIVFT  180

Query  1941  TIKIACYFIYFSWTDENYNNPAWEAIGFHVDT-------NEVPPDQQTGRPLEKGIIETI  1783
              +KI  ++++++  +E   NP W+AIG+ VD        +         RPL+ G++ET 
Sbjct  181   LVKILSHYVFYAMVNEKSENPHWKAIGYRVDKRRTEQADDAAAKSPSPSRPLDSGVVETR  240

Query  1782  NENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLE  1603
               N TTL  SL  +GL V  S +A   T++CD VIVGSGCGGGVAAA+LA++G KVVVLE
Sbjct  241   ALNDTTLLRSLADRGLAV--SSDARHHTVQCDAVIVGSGCGGGVAAAMLASAGLKVVVLE  298

Query  1602  KGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNN  1423
             KG YF +EDYS +EGPS+  L+E GG+  T++   MVF G+ VGGGSA+NWSASI+TP  
Sbjct  299   KGDYFTAEDYSSVEGPSMERLFEKGGIFCTSNVTTMVFTGSTVGGGSAVNWSASIRTPGT  358

Query  1422  VLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESV  1243
             VL EWS E  +P+FGS  Y  AMDAVC R+ VT+ C +EG QN+V+R+GCE LGL V++V
Sbjct  359   VLQEWSQEHGLPVFGSDGYVQAMDAVCSRLAVTDACLEEGFQNKVVRRGCEALGLPVDAV  418

Query  1242  PRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEED------  1081
             PRN S  HYCGSC +GC TGDK+G DTT+LVDAV +GAVILTGC+A++FILE +      
Sbjct  419   PRNSSAGHYCGSCNFGCPTGDKRGTDTTWLVDAVEHGAVILTGCKADRFILESNTADTGG  478

Query  1080  -ETAR--KKCLGVIAK--SKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNL  916
              + AR  KKC+G++A   S G  K LRIEAR ++SACG+L TPPLL +SGL+N++IG NL
Sbjct  479   KDNARRSKKCVGLVATCMSNGITKKLRIEARVSISACGALMTPPLLRNSGLRNRHIGRNL  538

Query  915   HLHPVLFAWGYFPES------MAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPA  754
             HLHPV  AWGYF ++         + GK+++GGIITS+H++         I+E  +L P 
Sbjct  539   HLHPVSMAWGYFSDNKLPTSGQTIITGKSYEGGIITSMHRITDR-----TIVETPALSPG  593

Query  753   GFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTG  574
              FAA+ PW SG DMKERMR+Y+RT + F++VRD G+G V   GR+++   + D D +R G
Sbjct  594   AFAAMVPWESGRDMKERMRRYARTAHAFALVRDRGAGFVDCEGRLRFTPSRDDTDELRNG  653

Query  573   LRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM-SGEENWTLY  397
             LR+ LRILVAAGAAEVGT RSDG ++ CKG++ E+LE+FLD V    GPM S  + W L+
Sbjct  654   LRRVLRILVAAGAAEVGTHRSDGLRLRCKGVRDEDLEAFLDEVTIEKGPMHSTTDKWALF  713

Query  396   CSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCIS  217
              SAHQMGSCRMG++  +GA+D +GE WEA+GLYVCDGS+LP+A+GVNPMITI S AYC+S
Sbjct  714   SSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMITIQSVAYCLS  773

Query  216   NGLAKSLNSGK  184
               +A++L  GK
Sbjct  774   KDIAQALAHGK  784



>ref|XP_006306477.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
 gb|EOA39375.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
Length=752

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/751 (54%), Positives = 524/751 (70%), Gaps = 20/751 (3%)
 Frame = -3

Query  2379  MNERKCHPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDD--------EA  2227
             M  R+  PLLR   +  + +HG S S  QAL+AICEA++PP+PL     D        +A
Sbjct  1     MVGRRGSPLLRWSTKHGNVSHGFSQSDLQALSAICEAILPPVPLQSLDLDMKLKVLRSDA  60

Query  2226  MCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGR-  2050
             + SF+ SS      PDEVAE++  + +P  V + R+VL IL+ RLG+LLLCG V  D   
Sbjct  61    LLSFFKSSPGSHIRPDEVAELLATKAIPVTVKVVRVVLRILTFRLGTLLLCGLVSLDKEN  120

Query  2049  WPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWE  1870
             WPF+  FS++ L++RE +L +W+ +      R+ FM IK    F YF+WT+EN  NPAW+
Sbjct  121   WPFLLKFSDISLEKREKVLQRWNTQWYNPLARLGFMMIKAIFLFYYFTWTNENTENPAWD  180

Query  1869  AIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRC  1690
             AIG+ VD  E    +   RPLEKGIIET   +  T+K+ +I KGL VTE + ++T  I C
Sbjct  181   AIGYRVDMGENEGMEHKERPLEKGIIETAEVDEMTIKQRMINKGLKVTEDRESDTYKIEC  240

Query  1689  DvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTT  1510
             D VIVGSGCGGGVAAA LA SG KVVVLEKG+YFV  DYS LEGPS  EL+ES  +L T 
Sbjct  241   DAVIVGSGCGGGVAAANLAKSGLKVVVLEKGNYFVPRDYSALEGPSTFELFESNSLLMTH  300

Query  1509  DGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIG  1330
             DG+    AG+ VGGGS +NW+AS+ TP+ ++ EWS+++ I +F S +Y++AMD VCKRIG
Sbjct  301   DGRFRFMAGSTVGGGSVVNWAASLNTPDAIIEEWSVQRGIAIFSSEKYKAAMDRVCKRIG  360

Query  1329  VTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLV  1150
             VTE   +EG QN +LRKGCE LGL V +VPRN ++KHYCGSC +GC TG+K+G D+T+LV
Sbjct  361   VTEKIIREGFQNTILRKGCEKLGLDVTTVPRNSTDKHYCGSCSFGCPTGEKRGTDSTWLV  420

Query  1149  DAVNNGAVILTGCQAEKFILEED------ETARKK-CLGVIAK-SKGNNKILRIEARATV  994
             DAVNN AVILT C+AEK IL ++      E+ RKK CLGV A  S    K L I A+ T+
Sbjct  421   DAVNNNAVILTRCKAEKVILADNDAHKRKESGRKKRCLGVTASLSNRTRKKLEINAKVTI  480

Query  993   SACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHK  814
              ACGSL TP LL SSGLKN NIG  LH+HP+L AWGYFPE  ++ +G  H+G I+TS+H 
Sbjct  481   IACGSLKTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNSDFKGAAHEGEIMTSLHY  540

Query  813   VVS-EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQV  637
             V   + T     +E  ++GP  FA++ PW SG D+KER+ KY+RT +IF MVRD G G+V
Sbjct  541   VHPMDSTTPNITLETPAIGPGTFASLIPWVSGSDIKERLAKYTRTSHIFVMVRDEGVGEV  600

Query  636   KKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESF  457
              K   ++YR+ + D++N+  GL+QAL+ILVAAGA EVGT+RSDGQ+I C GIK EELE+F
Sbjct  601   -KGDIVKYRLTKADEENLTIGLKQALQILVAAGATEVGTYRSDGQRIKCDGIKREELEAF  659

Query  456   LDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVL  277
             L  V A  G +S  ++WT   +AHQMG CRMGA+E++GAID  GE WEA+ LYVCD SVL
Sbjct  660   LHTVNAPAGVVSMSKHWTHSFTAHQMGCCRMGASEKEGAIDGKGESWEAEDLYVCDASVL  719

Query  276   PSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             P+A+GVNPMIT+ STAYCISN +A+ +   K
Sbjct  720   PTALGVNPMITVQSTAYCISNRIAELMKKKK  750



>ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
Length=774

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/759 (53%), Positives = 538/759 (71%), Gaps = 39/759 (5%)
 Frame = -3

Query  2361  HPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQ--------DSDD----EAMCS  2218
             HPLLRG RR  Y HGL  +Q +AL A+C ALIP +PLP         DS D    + +  
Sbjct  18    HPLLRGCRRERYTHGLHLAQMEALRAMCGALIPSLPLPPVTERSLHGDSSDGGERKDLER  77

Query  2217  FYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDG-RWPF  2041
             FY +SA+    P+EVAE+V R  + +AV +  +VL ILST++G+L LCG +C  G ++P+
Sbjct  78    FYLASAADGTIPEEVAELVTR-CVWEAVVLVNVVLWILSTKVGTLALCGRLCISGGKFPY  136

Query  2040  IHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYN-NPAWEAI  1864
             +  F+++P++RRE  L +W+R   + PL+I F+ +KI  ++ +++  +EN + NP+W+AI
Sbjct  137   VRKFADMPVERREQALTQWNRTRWLFPLKITFVVVKILSHYAFYTTINENSDDNPSWKAI  196

Query  1863  GFHVDTNEVPPDQQ------TGRPLEKGIIETINENGTTLKESLIKKGLNVTESQN-ANT  1705
             G+ V   E    +       + RPL+ GI+ET   + T L  SL+ +GL V  +   AN 
Sbjct  197   GYSVPHGEEETREDETEAAPSPRPLDNGIVETKALDDTALLTSLMARGLEVKPAAPPANA  256

Query  1704  L-TIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESG  1528
               T+RCDVVIVGSGCGGGVAAAVLA++GHKVVV+EKG YF +EDYS +EGPS+  LYE G
Sbjct  257   YHTVRCDVVIVGSGCGGGVAAAVLASAGHKVVVIEKGDYFTAEDYSSVEGPSMERLYEKG  316

Query  1527  GMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDA  1348
             G+  TT+   ++F GT VGGGSAINWSASI+TP  V  EW+ E  +P+F S  Y  AMDA
Sbjct  317   GIFCTTNVTTILFTGTTVGGGSAINWSASIRTPEEVRQEWAREHGLPVFASPGYVQAMDA  376

Query  1347  VCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGV  1168
             VC R+ VT+ C  EG QN+V+R+GCE L L+ ++VPRN SE H+CGSC  GC TG+K+G 
Sbjct  377   VCARLAVTDGCRDEGFQNKVVRRGCEALALRADAVPRNSSEDHFCGSCYIGCPTGEKRGT  436

Query  1167  DTTYLVDAVNNGAVILTGCQAEKFILEEDETAR-----KKCLGVIAK--SKGNNKILRIE  1009
             DTT+LVDAV  GAVILTGC+AE+FILE +  +      +KC+GV+A+  S G  K LRIE
Sbjct  437   DTTWLVDAVARGAVILTGCKAERFILESNSNSSSGRKGRKCVGVVARCMSNGITKELRIE  496

Query  1008  ARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPES--MAEMEGKNHQGG  835
             A+ ++S CG+L TPPLL +SGLKN++IG NLHLHPV  AWGYFPE+   A++ GK  +GG
Sbjct  497   AKVSISGCGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENKQQAQITGKCFEGG  556

Query  834   IITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRD  655
             IITS+H+V      +  IIE  +LGP  FA++ PW SG DMKERMR+Y+RT + F++VRD
Sbjct  557   IITSMHRVT-----ERTIIETPALGPGCFASLMPWESGRDMKERMRRYARTAHAFALVRD  611

Query  654   HGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCK-GIK  478
              G+G V   GR++Y  ++ D + +R GLR+ALRILVAAGAAEVGT RSDG  + C  G++
Sbjct  612   RGAGTVDGEGRVRYTPNRADAEELRNGLRRALRILVAAGAAEVGTHRSDGFGLRCNGGVR  671

Query  477   TEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
              +ELE+FLD V    GPM  G + W L+CSAHQMGSCRMG++ +DGA+D  GE WEA+GL
Sbjct  672   DDELEAFLDEVTVAEGPMRPGPDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGL  731

Query  300   YVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             YVCDGS+LP+A+GVNPMITI S A+C+S G+A++L  GK
Sbjct  732   YVCDGSLLPTAVGVNPMITIQSIAFCLSKGIAETLAHGK  770



>dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/746 (51%), Positives = 523/746 (70%), Gaps = 32/746 (4%)
 Frame = -3

Query  2361  HPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIP----------LPQDSDDEAMCSFY  2212
             HPLLR  RR+ Y HGL  +Q +AL A+C+ALIP +P           P+D D E    FY
Sbjct  14    HPLLRVLRRDKYTHGLYPAQMEALRAMCDALIPSLPPEEALDGRRDTPRDKDLE---RFY  70

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +S +    PDEVAE+   R + +A  +  + L +L TRLG+L LCG +C  G +P++  
Sbjct  71    LASGADSTIPDEVAELAFTRCVWEAGLLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRR  130

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             F+++P+ RRE  L +W+R   ++P++I F  +K  C+ ++++  +EN  NP W+AIGF V
Sbjct  131   FADMPVGRREEALGRWTRARWLIPVKIAFAIVKSLCFNVFYTKVNENSENPCWKAIGFSV  190

Query  1851  -----DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
                     + P +    RPL+KG++ET   +  TL  SL  KGL V  + +     + CD
Sbjct  191   PNVKEQRKKHPTEAAALRPLDKGVVETRELDDATLLRSLADKGLAVKPATSGYYHAVECD  250

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
             VVIVGSGCGGGVAAAVLA+ GHKV+V+EKG YF  +DYS +EGPS+  LYE GG+  T++
Sbjct  251   VVIVGSGCGGGVAAAVLASVGHKVLVVEKGDYFTPDDYSSVEGPSMERLYEQGGIFCTSN  310

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
                ++FAGT VGGGSA+NWSASI+TP  VL EWS +  +P+FGS+ Y  +MDAVC R+ V
Sbjct  311   VTTVLFAGTTVGGGSAVNWSASIRTPREVLLEWSRDHGLPVFGSAGYVQSMDAVCARLAV  370

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             T+ C +EG QN+V+R+GCE LGL V+ VPRN SE HYCG+C  GC TGDK+G DTT+LVD
Sbjct  371   TDGCREEGFQNKVVRRGCEALGLPVDCVPRNSSEGHYCGNCYLGCPTGDKRGTDTTWLVD  430

Query  1146  AVNNGAVILTGCQAEKFILEEDETAR----KKCLGVIAKSKGN--NKILRIEARATVSAC  985
             AV +GAVIL GC+AE+FIL+ +   +    KKC+G++A   G+   K LRIEA+ ++SAC
Sbjct  431   AVQDGAVILAGCKAERFILQNNINGKNGRSKKCVGLVATCVGSGITKKLRIEAKVSISAC  490

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPES--MAEMEGKNHQGGIITSIHKV  811
             G+L TPPLL +SGL+N+++G NLHLHPV  AWGYFP++  + ++ GK ++GGIITS+H+V
Sbjct  491   GALMTPPLLRNSGLRNRHVGRNLHLHPVSMAWGYFPDTNQVPQLTGKCYEGGIITSMHRV  550

Query  810   VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
                   +  IIE  +LGP  FA++ PW SG DMKERMR+Y+RT + F++VRD  +G V  
Sbjct  551   T-----ERTIIETPALGPGAFASLVPWESGRDMKERMRRYARTAHAFALVRDRAAGSVYG  605

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
              GR+ Y   + D + +R GLR+ALRI+VAAGAAEVGT RSDG ++ CKG++ ++LE+FLD
Sbjct  606   EGRVHYSPSRDDIEELRDGLRRALRIMVAAGAAEVGTHRSDGLRLRCKGVQDKDLEAFLD  665

Query  450   GVVATGGPMS-GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLP  274
              V    GPM  G + W L CSAHQMGSCRMG++ ++GA+D  GE WEA+ LYVCDGS+LP
Sbjct  666   EVTVPRGPMQPGTDTWALLCSAHQMGSCRMGSSPKEGAVDGRGESWEAEDLYVCDGSLLP  725

Query  273   SAIGVNPMITILSTAYCISNGLAKSL  196
             +A+GVNPMITI S AYC++  +A+SL
Sbjct  726   TAVGVNPMITIQSLAYCLAMDIAQSL  751



>ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium 
distachyon]
Length=757

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/745 (52%), Positives = 522/745 (70%), Gaps = 30/745 (4%)
 Frame = -3

Query  2361  HPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLP-QDSDDEAMCSFYSSSASQPPF  2185
             HPLLR  RR+ Y HGL  +Q +AL A+C ALIP +PLP ++  ++ +  FY +S +    
Sbjct  14    HPLLRVLRRDEYTHGLRPAQMEALRAMCGALIPSLPLPPEEGGNKDLERFYLASGADSAV  73

Query  2184  PDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRR  2005
             PDEVAE+   R + +A  +  + L +L+TRLG+L LCG++C       +  F+++P++RR
Sbjct  74    PDEVAELAFTRCVWEAGVLVSVALWLLTTRLGTLALCGWLCVVD--SSVRRFADMPVERR  131

Query  2004  EAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV-DTNEVPPD  1828
             EA L +W+R   ++P++I F  +K   + ++++  +EN  NP W+AIG+ V D  E    
Sbjct  132   EAALQRWTRARWLIPVKIAFAIVKSLLFNVFYTKVNENSENPCWKAIGYSVPDVEEQRRR  191

Query  1827  QQTG-------RPLEKGIIETINENGTTLKESLIKKGLNVT-ESQNANTLTIRCDvvivg  1672
             ++ G       RPL+KG++ET   +   L  SL  KGL V   + N    T++CD VIVG
Sbjct  192   RKNGTEATARRRPLDKGVVETRELDDAALLRSLAAKGLTVKPAASNGPHHTVQCDAVIVG  251

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAAAVLA +GHKVVVLEKG YF ++DYS +EGPS+  LYE GG+  T++   ++
Sbjct  252   SGCGGGVAAAVLAAAGHKVVVLEKGDYFAAQDYSSVEGPSMERLYEQGGIFCTSNVTTVL  311

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
             ++GT VGGGSA+NWSASI+TP  +L EWS    +P+F S+ Y  AMDAV  R+ V++ C 
Sbjct  312   YSGTTVGGGSAVNWSASIRTPREILQEWSRGHGLPVFASAGYAQAMDAVSARLAVSDACL  371

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QN+V+R+GCE LGL V++VPRN S  HYCGSC  GC TGDK+G DTT+LVDAV +G
Sbjct  372   EEGFQNKVVRRGCEALGLPVDAVPRNSSADHYCGSCNLGCPTGDKRGTDTTWLVDAVEHG  431

Query  1131  AVILTGCQAEKFILEEDETAR----KKCLGVIAKSKGNNKILRIEARATVSACGSLFTPP  964
             AVI+TGC+A++FILE   T +    KKC+G++A      K LRIEA+ ++SACG+L TPP
Sbjct  432   AVIITGCKADRFILESSYTGKGRRGKKCVGLVATCGITQKKLRIEAKVSISACGALMTPP  491

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEME--------GKNHQGGIITSIHKVV  808
             LL SSGLKN++IG NLHLHPV  AWGYFPE     E        GK ++GGIITS+H+V 
Sbjct  492   LLRSSGLKNRHIGRNLHLHPVSMAWGYFPEEPEPQEQDAEEIISGKCYEGGIITSMHRVT  551

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
                  +  IIE  +LGP  FA++ PW SG DMKERMR+Y+RT + F++VRD G+G V   
Sbjct  552   -----ERTIIETPALGPGAFASLVPWESGRDMKERMRRYARTAHAFALVRDRGAGSVDGE  606

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GR+ +   + D + +R GLR+ALRI+VAAGAAEVGT RSDG ++ CKG++ E+LE+FLD 
Sbjct  607   GRVHFVPSRDDNEELRNGLRRALRIMVAAGAAEVGTHRSDGLRLRCKGVRDEDLEAFLDD  666

Query  447   VVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
             V    GPM +G + W L CSAHQMGSCRMG++  +GA+D +GE WEA+GLYVCDGS+LP+
Sbjct  667   VAVARGPMQAGTDTWALLCSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPT  726

Query  270   AIGVNPMITILSTAYCISNGLAKSL  196
             A+GVNPMITI S AYC+S  +A+SL
Sbjct  727   AVGVNPMITIQSLAYCLSKNIAESL  751



>gb|KEH23951.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=567

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/565 (65%), Positives = 459/565 (81%), Gaps = 7/565 (1%)
 Frame = -3

Query  1875  WEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTI  1696
             W+AIG+ VDT E    ++  RPL++G++ET  E  +TL +SL +KGL VTE +  N   I
Sbjct  2     WKAIGYKVDTREKLKLKK--RPLQEGLVETTYETNSTLIQSLSEKGLEVTEDEEQNVYKI  59

Query  1695  RCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLT  1516
             +CDVVIVGSG GGGVAAA+LANSGHKV++LEKG YFVS+DYS LE  ++ ELYESGG++ 
Sbjct  60    KCDVVIVGSGSGGGVAAAILANSGHKVIILEKGEYFVSQDYSSLESSAMNELYESGGIMP  119

Query  1515  TTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKR  1336
             T DGK+M+ AG+ VGGGSAINW+A ++TP++V  EWS + K+PLF SS+YQSAMD+VC+R
Sbjct  120   TLDGKMMILAGSTVGGGSAINWAACVRTPDSVKKEWSEKYKLPLFTSSDYQSAMDSVCRR  179

Query  1335  IGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTY  1156
             IGVT+ C+K+  QNQVLRKGCE +GLKVESV  N SE HYCGSC YGCRTGDKKG D+T+
Sbjct  180   IGVTDKCNKQSFQNQVLRKGCERIGLKVESVAVNASEDHYCGSCCYGCRTGDKKGTDSTW  239

Query  1155  LVDAVNNGAVILTGCQAEKFILE--EDETARKKCLGVIAKSKGNNKI---LRIEARATVS  991
             LVDAV NGAVILTGC+AEKFI+E  ++ET RK C GVIA +   +KI   L+IE++ T+S
Sbjct  240   LVDAVENGAVILTGCRAEKFIIENGKNETKRKNCSGVIAATSWRSKITKKLQIESKVTIS  299

Query  990   ACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV  811
             +CGSL TPPL+ISSGL+N NIG NLHLHPV FAWGYFPE+M  + G NH+GGIITSIHKV
Sbjct  300   SCGSLLTPPLMISSGLQNPNIGRNLHLHPVQFAWGYFPENMTNLSGNNHEGGIITSIHKV  359

Query  810   VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
             ++E +    IIEA +LGP  F+ + PW SGLDMK+RM KY+RT N+F++VRD GSG+V+ 
Sbjct  360   LAENSTPKIIIEAPALGPGSFSVLVPWISGLDMKDRMAKYARTANLFALVRDIGSGEVRS  419

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
              G+I YR+DQ+D++N+R GLR++LRILVAAGA EVGT+RSDGQKI C+GIK EELE FLD
Sbjct  420   EGKISYRLDQMDRENLRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLD  479

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
              V   GGP S  E WT++ SAHQMGSCRMG  EE+GA+D NGE WEAKGLYVCDGSVLPS
Sbjct  480   TVSVVGGPRSRSELWTMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPS  539

Query  270   AIGVNPMITILSTAYCISNGLAKSL  196
             A+GVNPM+TI STAYCI++ +A+SL
Sbjct  540   AVGVNPMVTIQSTAYCIASKIAESL  564



>ref|XP_004982884.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=764

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/747 (51%), Positives = 521/747 (70%), Gaps = 33/747 (4%)
 Frame = -3

Query  2358  PLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPL--PQDSDDEA------MCSFYSSS  2203
             PLLR  +R  Y HGL   Q +AL A+C ALIP +P+  P   D         +  FY +S
Sbjct  18    PLLRRCKRERYTHGLRPPQMEALRAMCGALIPSLPVEGPFHGDKHGGGNKDDVERFYRAS  77

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
             A+    PDEVAE+       +A+ + R++L +LST++G+ +LCG++C   R+P++  F++
Sbjct  78    AADGAIPDEVAEMATG-CAREAMLLVRVILWMLSTKVGTFVLCGWLCVSSRFPYVFKFAD  136

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV---  1852
             +PL+RRE +L  WS+   + PL++ F+ +KI  ++ +++  +E+ +NP+W+AIG+ V   
Sbjct  137   MPLERREEVLKWWSKTRWLFPLKVTFVLVKILSHYSFYTTINEHSDNPSWKAIGYSVPDV  196

Query  1851  -----DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
                  D +E  P   + RPL+ G++ET + +   L  SL+ KGL V    +    T++CD
Sbjct  197   DRPQEDLSEAAP-SPSPRPLDSGVVETRSLDDAALLRSLMDKGLAVKADVSGPHHTVQCD  255

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
             VVIVGSGCGGGVAAAVLA +GHKVVV+EKG YF +EDYS +EGPS+  LYE GG+  T++
Sbjct  256   VVIVGSGCGGGVAAAVLAAAGHKVVVVEKGDYFTAEDYSSIEGPSMERLYEKGGIFCTSN  315

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
                ++F G  VGGGSAINWSASI+TP  V  EW+ E  +P+FGS EY  AMDAVC R+ V
Sbjct  316   ASTIMFTGATVGGGSAINWSASIRTPEWVTQEWAREHGLPVFGSPEYAHAMDAVCTRLAV  375

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             T  C +EG QN+ LR GCE LGL+ ++VPRN SE H+CGSC  GC TG+K+G DTT+LVD
Sbjct  376   TSGCREEGFQNKALRNGCEALGLRADAVPRNTSEGHFCGSCHLGCPTGEKRGTDTTWLVD  435

Query  1146  AVNNGAVILTGCQAEKFILEEDETAR----KKCLGVIAKSKGN--NKILRIEARATVSAC  985
             AV  GAV+LTGC+AE+F+LE +        K+C+G++AK  G+   + LRIEA+ ++SAC
Sbjct  436   AVAQGAVVLTGCKAERFVLESNPGKNGCRSKRCVGLVAKCMGDGITRKLRIEAKVSISAC  495

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE---MEGKNHQGGIITSIHK  814
             G+L TPPLL  SGLKN++IG NLHLHPV  AWGYFP+   E   + GK ++GGIIT++H+
Sbjct  496   GALMTPPLLRRSGLKNRHIGRNLHLHPVSMAWGYFPDGTPEPRPLTGKCYEGGIITTLHR  555

Query  813   VVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK  634
             V +       I++  +LGP   A++ PW SG DMKERM +Y+RT + F++VRD G+G V 
Sbjct  556   VTAR-----TIVQTPALGPGSMASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGTVG  610

Query  633   KAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL  454
             + GR++Y     D + +R GLR+ALRILVAAGAAEVGT RSDG ++ C+G++ E+LE+FL
Sbjct  611   REGRVRYVPSSEDVEELRNGLRRALRILVAAGAAEVGTHRSDGLRLRCEGLRDEDLEAFL  670

Query  453   DGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVL  277
             + V    GPM  G + W L CSAHQMGSCRMG+   DGA+D  GE WEA+GLYVCDGS+L
Sbjct  671   NEVTVAKGPMIPGSDTWALLCSAHQMGSCRMGSRPRDGAVDGRGESWEAEGLYVCDGSLL  730

Query  276   PSAIGVNPMITILSTAYCISNGLAKSL  196
             P+A+GVNPMITI STAY +S G+A+SL
Sbjct  731   PTAVGVNPMITIQSTAYYVSKGIAESL  757



>ref|XP_008664883.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Zea mays]
 tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
Length=762

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/759 (51%), Positives = 528/759 (70%), Gaps = 40/759 (5%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPL------PQDS-DDEAMCSFY  2212
             R+  PLLR  +R  Y HGL   Q +AL A+C ALIP +P+      PQ     + +  F+
Sbjct  5     RRGSPLLRRCKREGYTHGLRPPQMEALRAMCGALIPSLPVEGLHVQPQPGRGKDDLDRFF  64

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDG---RWPF  2041
              +SA+    PDEVAE+V R  + + V + R+VL +LSTR+G+L LCG +CF      +P+
Sbjct  65    RASAADGAIPDEVAEMVTR-CVWEGVLLMRIVLWVLSTRIGTLALCGRLCFSAGKSSFPY  123

Query  2040  IHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIG  1861
                F+++P++RRE +L +WS    + PL+I F+  K+  ++ +++  +EN +NP+W+AIG
Sbjct  124   ACRFADMPVERRERVLQRWSGARWLFPLKITFVIAKLLSHYAFYTMVNENSDNPSWKAIG  183

Query  1860  FHV-------DTNEVPP--------DQQTGRPLEKGIIETINENGTTLKESLIKKGLNVT  1726
             + V       D + + P        +  + RPL+ G++ET + N  TL +SL ++G+ V 
Sbjct  184   YSVPVPAAAADVDRLRPRELGPAEAEAPSPRPLDSGVVETRSLNDATLLKSLTERGVAVK  243

Query  1725  ESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLG  1546
                +    T++CDVVIVGSGCGGGVAAAVLA +G KVVV+EKG YF +E Y+ +EGPS+ 
Sbjct  244   AGVSGAHHTVQCDVVIVGSGCGGGVAAAVLAAAGRKVVVVEKGDYFTAESYTSVEGPSME  303

Query  1545  ELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEY  1366
              LYE GG+  T++   ++FAGT VGGGSAINWSAS++TP  V  EW+ E  +P+FG  EY
Sbjct  304   RLYEKGGIFCTSNVTTIMFAGTTVGGGSAINWSASVRTPEWVTQEWAREHGLPMFGRPEY  363

Query  1365  QSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRT  1186
               AMDAVC R+ VT  C +EG QN+VLR+GCE LGL+ ++VPRN SE H+CGSC  GC T
Sbjct  364   AHAMDAVCARLAVTGGCREEGFQNKVLRRGCEALGLRGDAVPRNSSEGHFCGSCHLGCPT  423

Query  1185  GDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR----KKCLGVIAK--SKGNNK  1024
             GDK+G DTT+LVDAV  GAV+LTGC+AE+F+LE +   R     +C+G++A   S G  K
Sbjct  424   GDKRGTDTTWLVDAVARGAVVLTGCKAERFVLESNPGGRDGRSNRCVGLVATCMSDGITK  483

Query  1023  ILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM--AEMEGK  850
              LRIEA+ +VSACG+L TPPLL +SGL+N ++G NLHLHPV  AWGYFP+S   AE+ GK
Sbjct  484   KLRIEAKVSVSACGALMTPPLLRNSGLQNSHVGRNLHLHPVSMAWGYFPDSTPEAELSGK  543

Query  849   NHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIF  670
              ++GGIIT++ +V +       II+  +LGP  +A++ PW SG DMKERM +Y+RT + F
Sbjct  544   CYEGGIITTMRRVTAR-----TIIQTPALGPGCWASLVPWESGRDMKERMLRYARTAHAF  598

Query  669   SMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICC  490
             ++VRD G+G V   GR++Y   + D D +R GLRQ LRILVAAGAAEVGT RSDG ++ C
Sbjct  599   ALVRDRGAGHVDGEGRVRYTPSREDVDELRNGLRQTLRILVAAGAAEVGTHRSDGLRLRC  658

Query  489   KGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWE  313
              G++ E+LE+FL  V    GPM  G + W L+CSAHQMGSCRMG++ + GA+D  GE WE
Sbjct  659   DGLRDEDLEAFLKQVTVEKGPMVPGHDKWALHCSAHQMGSCRMGSSPKHGAVDGRGESWE  718

Query  312   AKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             A+GLYVCDGS+LP+A+GVNPMITI STAYC+S G+A+SL
Sbjct  719   AEGLYVCDGSLLPTAVGVNPMITIQSTAYCVSKGIAESL  757



>ref|XP_007035186.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 ref|XP_007035187.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06112.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06113.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
Length=657

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/572 (64%), Positives = 448/572 (78%), Gaps = 5/572 (1%)
 Frame = -3

Query  1896  ENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQ  1717
             EN +NPAWEAIG+ VD  E        RPL+KG+IET++E  +TL +SL +KGL VTE  
Sbjct  83    ENNDNPAWEAIGYQVDNVENSKQVSKERPLQKGMIETMHEKDSTLLQSLTQKGLQVTEDT  142

Query  1716  NANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELY  1537
               N   I+CD VIVGSGCGGGVAAA+LA+SG KVVVLEKG YF   DYS  EGPS+ +LY
Sbjct  143   ERNVYKIKCDAVIVGSGCGGGVAAAILASSGLKVVVLEKGSYFAPSDYSPFEGPSMDQLY  202

Query  1536  ESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSA  1357
             ESGG+L + DG++++ AG+ VGGGSAINWSASIKTP ++L EW+ + ++PLFGS EY SA
Sbjct  203   ESGGILPSIDGQMLILAGSTVGGGSAINWSASIKTPKSILQEWAEDCQLPLFGSPEYLSA  262

Query  1356  MDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDK  1177
             MD VC+RIGVTE C +EG QNQ+LRKGC+NLGL+VE+VPRN SE HYCGSCG+GCR GDK
Sbjct  263   MDNVCERIGVTENCKEEGFQNQILRKGCKNLGLEVENVPRNSSESHYCGSCGFGCRRGDK  322

Query  1176  KGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETARK---KCLGVIAKSKGNN--KILRI  1012
             KG D T+LVDAV+NGAVILTGC+AEKFILE+++   K   KCLGVIAK+   N  K L I
Sbjct  323   KGTDRTWLVDAVSNGAVILTGCKAEKFILEKNKICSKRKLKCLGVIAKTSNKNITKKLHI  382

Query  1011  EARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGI  832
             EA+ T+SACG+LFTP L+ SSGLKN+NIG NLHLHPVL AWGYFP+S +E +GK ++GGI
Sbjct  383   EAKVTISACGALFTPLLMHSSGLKNRNIGRNLHLHPVLMAWGYFPDSDSEFKGKVYEGGI  442

Query  831   ITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDH  652
             ITS+HKVV+   K  AIIE  SLGPA +AA+ PW SGLDMK RM  +SRT ++ +++RD 
Sbjct  443   ITSVHKVVAADNKVRAIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQ  502

Query  651   GSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTE  472
             GSG+V   GR+ Y+ D +D+ N+++GLRQALRILVAAGA EVGT RSDGQ I CKGI  +
Sbjct  503   GSGKVHAGGRVTYKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNK  562

Query  471   ELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVC  292
             ELE FL+ V    GPM   E W  + SAHQMGSCRMG  E++GA+D NGE WEA+GL+VC
Sbjct  563   ELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVC  622

Query  291   DGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             D SVLP AIGVNPMIT+ STAYC+S  +A+SL
Sbjct  623   DASVLPGAIGVNPMITVQSTAYCLSKRIAESL  654


 Score = 55.1 bits (131),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 11/80 (14%)
 Frame = -3

Query  2379  MNERKCH-PLLRGGRRNS----YNHGLSSSQYQALAAICEALIPPIPL------PQDSDD  2233
             M E +C  PLL G RR+     Y HGLSS++ Q LA+I EA+ P +         Q+   
Sbjct  1     MGEGQCQQPLLNGERRDRGKRRYAHGLSSAEVQTLASIGEAVFPSLKPNSDFEGKQNQPR  60

Query  2232  EAMCSFYSSSASQPPFPDEV  2173
             +A+ SF  +SAS+ P PDEV
Sbjct  61    KAVQSFLEASASESPIPDEV  80



>ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Length=732

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/735 (52%), Positives = 521/735 (71%), Gaps = 36/735 (5%)
 Frame = -3

Query  2298  QALAAICEALIPPIPLPQDSDDEA---------MCSFYSSSASQPPFPDEVAEVVMRRFL  2146
             +AL A+C ALIP +P+  + D +          +  FY +SA+    PDEVAE+V R  +
Sbjct  2     EALRAMCGALIPSLPVDPEGDQQQPARGKGHDDLERFYRASAADGVIPDEVAEMVTR-CV  60

Query  2145  PDAVFIFRLVLIILSTRLGSLLLCGFVCF----DGRW-PFIHNFSELPLKRREAILLKWS  1981
              +A+ + R++L +LSTR+G+L LCG +C     +G++ PF+  F+++P+KRRE +L +WS
Sbjct  61    WEAMLLMRVILWMLSTRVGTLALCGRLCLCFSDNGKFFPFVCKFADMPVKRREQVLKRWS  120

Query  1980  RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV---DTNEVPPDQQTGRP  1810
             +   + PL+I F+  K+  ++ +++  +EN +NP+W+AIG+ V   D +  P +  +  P
Sbjct  121   KARWLFPLKITFLIAKLLSHYSFYTMVNENSDNPSWKAIGYSVPEPDVDRPPEEAPSAWP  180

Query  1809  LEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlAN  1630
             L+ GI+ET + N  TL  SL ++GL V    +    T++CDVVIVGSGCGGGVAAAVLA 
Sbjct  181   LDAGIVETRSLNDATLLRSLTERGLAVKADVSGAHHTVQCDVVIVGSGCGGGVAAAVLAA  240

Query  1629  SGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINW  1450
             +GHKV+V+EKG YF +E Y+ +EGPS+  LYE GG+  T++   ++F G  VGGGSAINW
Sbjct  241   AGHKVIVVEKGDYFTAESYTSVEGPSMERLYEKGGIFCTSNVTTIMFTGATVGGGSAINW  300

Query  1449  SASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCE  1270
             SASI+TP  V  EW+ +  +P+FG+ EY  AMDAVC R+ VT  C +EG QN+ LR+GCE
Sbjct  301   SASIRTPEWVTKEWARDHGLPVFGTPEYARAMDAVCARLAVTGGCRQEGFQNKALRRGCE  360

Query  1269  NLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFIL  1090
              LGL+ ++VPRN SE H+CGSC  GC TG+K+G DTT+LVDAV+ GAVILTGC+AE+FIL
Sbjct  361   ALGLRGDAVPRNSSEGHFCGSCHLGCPTGEKRGTDTTWLVDAVDRGAVILTGCKAERFIL  420

Query  1089  EE------DETARKKCLGVIAK--SKGNNKILRIEARATVSACGSLFTPPLLISSGLKNK  934
             E       D    KKC+G++A   S G +K LRIEA+ ++SACG+L TPPLL +SGLKN+
Sbjct  421   ESNPGGGGDNGRSKKCVGLVAACMSDGISKKLRIEAKVSISACGALMTPPLLRNSGLKNR  480

Query  933   NIGSNLHLHPVLFAWGYFPESM---AEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSL  763
             +IG NLHLHPV  AWGYFP+     AE+ GK ++GGIIT++H+V +       II+  +L
Sbjct  481   HIGRNLHLHPVSMAWGYFPDGTPENAELSGKCYEGGIITTMHRVTAR-----TIIQTPAL  535

Query  762   GPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNI  583
             GP  +A++ PW SG DMKERM +Y+RT + F++VRD G+G V   GR++Y   + D + +
Sbjct  536   GPGCWASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGHVDGEGRVRYAPSREDVEEL  595

Query  582   RTGLRQALRILVAAGAAEVGTFRSDGQKICCK-GIKTEELESFLDGVVATGGPM-SGEEN  409
             R GLRQALRILVAAGAAEVGT RSDG ++ C  G++ E+LE+FL  V    GPM  G + 
Sbjct  596   RNGLRQALRILVAAGAAEVGTHRSDGLRLRCDGGLRDEDLEAFLKEVTVGEGPMLPGPDK  655

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
             W L+CSAHQMGSCRMG + +DGA+D  GE WEA+GLYVCDGSVLP+A+GVNPMITI STA
Sbjct  656   WALHCSAHQMGSCRMGCSPKDGAVDGRGESWEAEGLYVCDGSVLPTAVGVNPMITIQSTA  715

Query  228   YCISNGLAKSLNSGK  184
             YC+S G+A+SL   K
Sbjct  716   YCVSKGIAESLARDK  730



>gb|AAP54248.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=784

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/758 (52%), Positives = 515/758 (68%), Gaps = 37/758 (5%)
 Frame = -3

Query  2361  HPLLRG-GRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD-----DEAMCSFYSSSA  2200
             HP LRG  RR  Y HGL ++Q  AL A+C ALIP +P  ++       D  +  FY ++A
Sbjct  15    HPALRGPARRERYTHGLGAAQMGALRAMCGALIPALPAEEEDGARGGGDMDVERFYLATA  74

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             ++   PDEVAE+ M R + +A  + R++L IL+TR+G+L LCG  C  G +P++  F+++
Sbjct  75    AESTVPDEVAELTMTRCIWEAGVLVRIILWILATRVGTLALCGRRCVSGEFPYVRRFADM  134

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE  1840
             P++RREA L K SR +L         +       + +   DEN  NP+W+AIG+ V   E
Sbjct  135   PVERREAAL-KRSRSSLPSSRSSATSSSTPRFQVLIYHIVDENLENPSWKAIGYSVPAAE  193

Query  1839  VPPDQQTG---------------RPLEKGIIETINENGTTLKESLIKKGLNV---TESQN  1714
               P ++                 RPL+ G++ET   +   L  SL +KGL +     S +
Sbjct  194   EEPQKEEPTEATPTPAPATAPPCRPLDNGVVETKQLDDNALLMSLAEKGLALKTGASSPS  253

Query  1713  ANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYE  1534
             A+  T+ CD V+VGSGCGGGVAAAVLA++G+KVVV+EKG YF + DYS LEGP++  LYE
Sbjct  254   AHHHTVLCDAVVVGSGCGGGVAAAVLASAGYKVVVVEKGDYFAARDYSSLEGPTMERLYE  313

Query  1533  SGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAM  1354
             +GG+ +T +    +FAG  VGGGSA+NWSA I+TP NVL EWS +  +PLFG   Y  AM
Sbjct  314   NGGVFSTANVTTTMFAGATVGGGSAVNWSACIRTPANVLQEWSNDHGLPLFGGQGYVQAM  373

Query  1353  DAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKK  1174
             DAVC R+GVT  C +EG QN+ +R+GCE LGL+VE+V RN SE H+CGSC  GC TG+K+
Sbjct  374   DAVCARLGVTGRCREEGFQNKAVRRGCEALGLRVEAVSRNSSEGHFCGSCNLGCPTGEKR  433

Query  1173  GVDTTYLVDAVNNGAVILTGCQAEKFILEED----ETARKKCLGVIAK--SKGNNKILRI  1012
             G DTT+LVDAV  GAVILTGC+AE+FILE +       RKKC+GV+AK   KG  K LRI
Sbjct  434   GTDTTWLVDAVGRGAVILTGCKAERFILETNTGGGGGRRKKCVGVVAKCLGKGITKKLRI  493

Query  1011  EARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGI  832
             EA+ +VSACG+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP+S AE+ GK+++GGI
Sbjct  494   EAKVSVSACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELPGKSYEGGI  553

Query  831   ITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDH  652
             ITS+H+V         IIE  +LGP  FAAV PW SG DMKERMR+Y+RT +   +VRD 
Sbjct  554   ITSMHRVTDR-----TIIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDR  608

Query  651   GSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTE  472
              +G V   GR+++   + D   +R GLR+ALRILVAAGAAEVGT RSDG ++ CKG + E
Sbjct  609   AAGTVGGEGRVRFTPSRGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDE  668

Query  471   ELESFLDGVVATGGPMS-GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYV  295
             ++E+FLD V    GPM  G + W L  SAHQMGSCRMG + + G +D  GE WEA+GLYV
Sbjct  669   DVEAFLDEVSVEKGPMHPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYV  728

Query  294   CDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
             CDGS+LP+A+GVNPMITI S AYC++ G+A+SL S  A
Sbjct  729   CDGSLLPTAVGVNPMITIESVAYCVAKGIAESLASRAA  766



>gb|AAD10696.1| Unknown protein [Arabidopsis thaliana]
Length=736

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/749 (52%), Positives = 513/749 (68%), Gaps = 43/749 (6%)
 Frame = -3

Query  2370  RKCHPLLRGG-RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS---------DDEAMC  2221
             ++  PLLR   ++ S++HG S S  QAL++IC+A++PP+PL   +         +D  + 
Sbjct  9     KRGSPLLRWSVKQESFSHGFSKSDLQALSSICDAIMPPVPLESLNLEMKLKVLRNDALLS  68

Query  2220  SFYSSSASQPPFPDEV-AEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWP  2044
              F SSS+     PDEV AE++  + +P  V + R+VL IL+ RLG+LLLCG         
Sbjct  69    FFKSSSSESHVRPDEVVAELLATKAIPLTVLVVRIVLRILTFRLGTLLLCG---------  119

Query  2043  FIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAI  1864
                          E +L +W+ +      RI FM IK    F YF+WT+EN  NP W+AI
Sbjct  120   -------------EKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTNENSENPVWDAI  166

Query  1863  GFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDv  1684
              + V+  E    +Q  RPL++GIIET  E+  T+K+ +I KGL VTE +  +T  I CD 
Sbjct  167   NYSVEIGENEDMEQKERPLDEGIIETAKEDEMTIKQRMINKGLKVTEDRERDTYKIECDA  226

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             V+VGSGCGGGVAAA+LA SG +VVV+EKG+YF   DYS LEGPS+ EL+ES  ++ T DG
Sbjct  227   VVVGSGCGGGVAAAILAKSGLRVVVIEKGNYFAPRDYSALEGPSMFELFESNSLMMTHDG  286

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             +    AG+ VGGGS +NW+AS+KTP+ ++ EWS+ + I ++ S +Y++AM  VCKR+GVT
Sbjct  287   RFRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVHRGISIYSSEKYKAAMGIVCKRLGVT  346

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             E   +EG QNQ+LRKGCE LGL V  VPRN +EKHYCGSC YGC TG+K+G D+T+LVDA
Sbjct  347   EKIIREGFQNQILRKGCEKLGLDVTIVPRNSTEKHYCGSCSYGCPTGEKRGTDSTWLVDA  406

Query  1143  VNNGAVILTGCQAEKFIL-------EEDETARKKCLGVIAK-SKGNNKILRIEARATVSA  988
             VNN AVILT C+AEK IL        E+   RK+CLGV A  S    K L+I A+ T+ A
Sbjct  407   VNNNAVILTQCKAEKLILADNDANKREESGRRKRCLGVAASLSHQTRKKLQINAKVTIVA  466

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
             CGSL TP LL SSGLKN NI   LH+HP++ AWGYFPE  +E+EG  H+G I+TS+H V 
Sbjct  467   CGSLKTPGLLASSGLKNSNISRGLHIHPIMMAWGYFPEKNSELEGAAHEGEIVTSLHYVH  526

Query  807   S-EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
               + T     +E  ++GP  FAA++PW SG DMKERM KY+RT +IF+MVRD G G+V K
Sbjct  527   PMDSTTPNITLETPAIGPGTFAALTPWVSGSDMKERMAKYARTAHIFAMVRDEGVGEV-K  585

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                ++YR+ + D++N+  GL+QALRILVAAGAAEVGT+RSDGQ++ C GIK ++LE+FLD
Sbjct  586   GDIVKYRLTKADEENLTIGLKQALRILVAAGAAEVGTYRSDGQRMKCDGIKQKDLEAFLD  645

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
              V A  G +S  ++WT   +AHQ+G CRMGATE++GAID  GE WEA+ LYVCD SVLP+
Sbjct  646   TVNAPPGVVSMSKHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPT  705

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             A+GVNPMIT+ STAYCISN +A+ +   K
Sbjct  706   ALGVNPMITVQSTAYCISNRIAELMKKRK  734



>ref|XP_004982883.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=685

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/679 (54%), Positives = 494/679 (73%), Gaps = 21/679 (3%)
 Frame = -3

Query  2178  EVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREA  1999
             +VAE+V R  + +AV +  +VL ILSTR+G+L LCG +C  G++P++  F+++P++RRE 
Sbjct  12    KVAELVTR-CVWEAVVLVNVVLWILSTRVGTLALCGRLCMSGKFPYVRKFADMPVERREE  70

Query  1998  ILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQT  1819
              L +W++   + PL+I F+ IK+  ++ +++  +EN +NP W+AIG+ V   E P +  +
Sbjct  71    ALGRWNKARWLFPLKITFVVIKVLSHYAFYTMVNENSDNPCWKAIGYSVPDMEEPREAPS  130

Query  1818  GRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaav  1639
              R L+ G++ET   N TTL  SL+ KGL V  +  +   T++CDVVIVGSGCGGGVAAA 
Sbjct  131   PRSLDNGVVETKALNDTTLLRSLVDKGL-VVRTDASTYHTVQCDVVIVGSGCGGGVAAAA  189

Query  1638  lANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSA  1459
             LA++GHKVVV+EKG YF +EDYS +EGPS+  LYE GG+  T++   ++F G+MVGGGSA
Sbjct  190   LASAGHKVVVVEKGEYFTAEDYSSVEGPSMERLYEKGGIFCTSNVTTVLFTGSMVGGGSA  249

Query  1458  INWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRK  1279
             +NWSASI+TP  V  EW+ E  +P+F S  Y  AMDAVC R+ VT+ C +EG QN+ +R+
Sbjct  250   VNWSASIRTPEEVRQEWAREHGLPVFASPGYVEAMDAVCARLAVTDGCREEGFQNKAVRR  309

Query  1278  GCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEK  1099
             GCE LGL+ ++VPRN SE H+CGSC  GC TGDK+G DTT+LVD+V  GAVILTGC+AE 
Sbjct  310   GCEALGLRADAVPRNSSEGHFCGSCHLGCPTGDKRGTDTTWLVDSVARGAVILTGCKAEC  369

Query  1098  FILEED--ETAR--KKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPLLISSGLKN  937
             FILE +  E AR  +KC+G++A     G  K LRIEA+ +++ACG+L TPPLL +SGLKN
Sbjct  370   FILESNSGENARRSRKCVGLVATCMVAGVTKKLRIEAKVSIAACGALMTPPLLRNSGLKN  429

Query  936   KNIGSNLHLHPVLFAWGYFPESMAE------MEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             ++IG NLHLHPV  AWGYFPE+  +      + GK ++GGIIT++H+V      +  I+E
Sbjct  430   RHIGRNLHLHPVSMAWGYFPENKQQEPQPPPLTGKCYEGGIITTMHRVT-----ERTIVE  484

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +LGP  FA++ PW SG DMK+RMR+Y+RT + F++VRD G+G V   GR+ Y   + D
Sbjct  485   TPALGPGCFASMVPWESGRDMKDRMRRYARTAHAFALVRDRGAGTVDGEGRVCYSPARDD  544

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCK-GIKTEELESFLDGVVATGGPM-S  421
              D +R GLR+ALRILVAAGAAEVGT RSDG ++ C  G++ +EL++FLD V    GPM  
Sbjct  545   VDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDELDAFLDEVTVATGPMLP  604

Query  420   GEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITI  241
             G + W L CSAHQMGSCRMG++  DGA+D  GE WEA+GLYVCDGS+LP+A+GVNPMITI
Sbjct  605   GSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITI  664

Query  240   LSTAYCISNGLAKSLNSGK  184
              STAYC+S G+A+SL   K
Sbjct  665   QSTAYCLSEGIAESLAQRK  683



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/741 (50%), Positives = 496/741 (67%), Gaps = 24/741 (3%)
 Frame = -3

Query  2376  NERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSAS  2197
             N    HPLLRGGRR S++HGLS+SQ ++LAAIC+A IP IP   D  D  + SFY  S S
Sbjct  5     NAAHGHPLLRGGRRTSHSHGLSASQIKSLAAICDAFIPSIPPTNDLQDPEVESFYRLSGS  64

Query  2196  QPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
             Q   P++VAE++ RR  P A  + R +L +LSTRLG+ LLCG       +P++  FS++ 
Sbjct  65    QNGIPEQVAELIARRVKPIAFLMARWLLWLLSTRLGTWLLCGSASLKKEFPYLQPFSDVQ  124

Query  2016  LKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEV  1837
                RE ILL WSR   I  L+  F   KI C F +++  DEN  NPAW+ IG+       
Sbjct  125   QVSREQILLDWSRGRRITFLKFAFKLFKICCLFTFYTVADENAENPAWKGIGYS------  178

Query  1836  PPDQQT-----GRPLEKGIIETINENGTTLKESLIKKGLNVTESQNAN----TLTIRCDv  1684
             PP  +T     GRPLEKG+I+  + +   L +    +G  VTE +N +       + CD 
Sbjct  179   PPKPETDRVASGRPLEKGVIDLSSASEQDLPKLFQDRGFTVTEEENLSGKEKAWKVECDA  238

Query  1683  vivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDG  1504
             V+VGSG GGGVAA VLA +G++V+VLEKG Y+  +D + LEGPS  ++YESGG+L T DG
Sbjct  239   VVVGSGSGGGVAAGVLAKAGYRVIVLEKGKYYARDDLTLLEGPSFDQMYESGGILPTNDG  298

Query  1503  KVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVT  1324
             KV+V AG  VGGGSAINWSASI+TP +VL EWS +  +PLF S +YQ AM+AVC R+GV 
Sbjct  299   KVLVMAGATVGGGSAINWSASIRTPPHVLKEWSKQHGLPLFESHDYQDAMNAVCGRLGVQ  358

Query  1323  EVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDA  1144
             + CSKE  QN VL  GC  LG + E VPRN +E H+CGSC +GCR G+KKG D T+LVDA
Sbjct  359   DGCSKESFQNSVLSTGCAKLGFRFEKVPRNSTEDHFCGSCCFGCRKGNKKGADETWLVDA  418

Query  1143  VNNGAVILTGCQAEKFILEE-DETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTP  967
             +N+G++IL GC+AEK + +E   + +++  GV+A      + + ++A+ TV+ACGSL TP
Sbjct  419   MNSGSLILAGCKAEKVLCQEIPGSWKQRAAGVVAAFGPKRRSIFVQAKVTVAACGSLLTP  478

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS--EGTK  793
              LL SSGL+N NIG NLHLHPV  AWG+FPE+  E  GK H+GGIIT+I K  +  E + 
Sbjct  479   LLLRSSGLRNPNIGRNLHLHPVQMAWGFFPEN-KEPAGKPHEGGIITTICKEGAKWEQSG  537

Query  792   QAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQY  613
                II+  ++ P  FA++ PWTSGLDMKERM+KY RT ++F + RD GSG V     + Y
Sbjct  538   YGTIIQTPAIAPGSFASMIPWTSGLDMKERMQKYHRTAHVFCLARDRGSGSVGGEKDLDY  597

Query  612   RMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG  433
             R  + DKDN++ GLR+ ++IL+AAGA EVGT RSDG+++  KG   +E+E FL+     G
Sbjct  598   RFAESDKDNLKEGLRRCVQILIAAGATEVGTHRSDGERLAVKGATDDEIEEFLNN---KG  654

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
                 G   W  + SAHQMGSCRMG  EE G +D  GE WE +GL+VCDGS+LP+++GVNP
Sbjct  655   KGRRGV--WPTFFSAHQMGSCRMGKDEESGGVDWKGESWEVEGLFVCDGSLLPTSVGVNP  712

Query  252   MITILSTAYCISNGLAKSLNS  190
             MITI S A+C++N + + L +
Sbjct  713   MITIQSLAFCVANYILQFLRT  733



>gb|AAL31024.1|AC078948_8 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=756

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/776 (50%), Positives = 509/776 (66%), Gaps = 82/776 (11%)
 Frame = -3

Query  2391  REKKMNER--------KCHPLLRG-GRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS  2239
             RE+ M+++        + HP LRG  RR  Y HGL ++Q  AL A+C ALIP +P  ++ 
Sbjct  6     REEAMDQKAKEAAPAARGHPALRGPARRERYTHGLGAAQMGALRAMCGALIPALPAEEED  65

Query  2238  D-----DEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLC  2074
                   D  +  FY ++A++   PDEVAE+ M R + +A  + R++L IL+TR+G+L LC
Sbjct  66    GARGGGDMDVERFYLATAAESTVPDEVAELTMTRCIWEAGVLVRIILWILATRVGTLALC  125

Query  2073  GFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDE  1894
             G  C  G +P++  F+++P+                                      DE
Sbjct  126   GRRCVSGEFPYVRRFADMPV--------------------------------------DE  147

Query  1893  NYNNPAWEAIGFHVDTNEVPPDQQTG---------------RPLEKGIIETINENGTTLK  1759
             N  NP+W+AIG+ V   E  P ++                 RPL+ G++ET   +   L 
Sbjct  148   NLENPSWKAIGYSVPAAEEEPQKEEPTEATPTPAPATAPPCRPLDNGVVETKQLDDNALL  207

Query  1758  ESLIKKGLNV---TESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYF  1588
              SL +KGL +     S +A+  T+ CD V+VGSGCGGGVAAAVLA++G+KVVV+EKG YF
Sbjct  208   MSLAEKGLALKTGASSPSAHHHTVLCDAVVVGSGCGGGVAAAVLASAGYKVVVVEKGDYF  267

Query  1587  VSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEW  1408
              + DYS LEGP++  LYE+GG+ +T +    +FAG  VGGGSA+NWSA I+TP NVL EW
Sbjct  268   AARDYSSLEGPTMERLYENGGVFSTANVTTTMFAGATVGGGSAVNWSACIRTPANVLQEW  327

Query  1407  SLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCS  1228
             S +  +PLFG   Y  AMDAVC R+GVT  C +EG QN+ +R+GCE LGL+VE+V RN S
Sbjct  328   SNDHGLPLFGGQGYVQAMDAVCARLGVTGRCREEGFQNKAVRRGCEALGLRVEAVSRNSS  387

Query  1227  EKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEED----ETARKKC  1060
             E H+CGSC  GC TG+K+G DTT+LVDAV  GAVILTGC+AE+FILE +       RKKC
Sbjct  388   EGHFCGSCNLGCPTGEKRGTDTTWLVDAVGRGAVILTGCKAERFILETNTGGGGGRRKKC  447

Query  1059  LGVIAK--SKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWG  886
             +GV+AK   KG  K LRIEA+ +VSACG+L TPPLL +SGLKN++IG NLHLHPV  AWG
Sbjct  448   VGVVAKCLGKGITKKLRIEAKVSVSACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWG  507

Query  885   YFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKE  706
             YFP+S AE+ GK+++GGIITS+H+V         IIE  +LGP  FAAV PW SG DMKE
Sbjct  508   YFPDSTAELPGKSYEGGIITSMHRVTDR-----TIIETPALGPGAFAAVVPWESGRDMKE  562

Query  705   RMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEV  526
             RMR+Y+RT +   +VRD  +G V   GR+++   + D   +R GLR+ALRILVAAGAAEV
Sbjct  563   RMRRYARTAHAVVLVRDRAAGTVGGEGRVRFTPSRGDAGELRAGLRRALRILVAAGAAEV  622

Query  525   GTFRSDGQKICCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEE  349
             GT RSDG ++ CKG + E++E+FLD V    GPM  G + W L  SAHQMGSCRMG + +
Sbjct  623   GTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPMHPGSDKWALLASAHQMGSCRMGRSAK  682

Query  348   DGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
              G +D  GE WEA+GLYVCDGS+LP+A+GVNPMITI S AYC++ G+A+SL S  A
Sbjct  683   HGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCVAKGIAESLASRAA  738



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/678 (53%), Positives = 485/678 (72%), Gaps = 25/678 (4%)
 Frame = -3

Query  2163  VMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKW  1984
             ++ R + +AV +  +VL  LSTR G+LLLCG +     +P++  F+++  +RREA L +W
Sbjct  1     MVTRCIREAVALAWVVLWALSTRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRW  60

Query  1983  SRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQ------Q  1822
             +R   + PLRI F  +KI C++++++  +EN  NP W+AIG+ VD  E   D+       
Sbjct  61    NRVRWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVD--EPREDRARTATPS  118

Query  1821  TGRPLEKGIIETINENGTTLKESLIKKGLNVT-ESQNANTLTIRCDvvivgsgcgggvaa  1645
               RPL+ G++ET   +   L  SL+ +GL V   S +AN  T++CD VIVGSGCGGGVAA
Sbjct  119   PSRPLDVGVVETRLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDAVIVGSGCGGGVAA  178

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
             AVLA++G+KVVV+EKG YF +EDYS +EGPS+  L+E GG+  T++   M+F G  VGGG
Sbjct  179   AVLASAGYKVVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGG  238

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWSASI+TP  V  EW+ E  +P+F S  Y  AMDAVC R+GVT+ C +EG QN+V+
Sbjct  239   SAVNWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVV  298

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQA  1105
             R+GCE LGL  ++VPRN S+ H+CGSC +GC TGDK+G DTT+LVDAV  GAVILTGC+A
Sbjct  299   RRGCEALGLCADAVPRNSSDAHFCGSCNFGCPTGDKRGTDTTWLVDAVARGAVILTGCKA  358

Query  1104  EKFILEEDE------TARKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPLLISS  949
             E F+LE++          KKC+G++A   S G  K LRIEA+ +++ACG+L TPPLL  S
Sbjct  359   EYFVLEKNHSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACGALMTPPLLRRS  418

Query  948   GLKNKNIGSNLHLHPVLFAWGYFPESMAE--MEGKNHQGGIITSIHKVVSEGTKQAAIIE  775
             GLKN++IGSNLHLHPV  AWGYFPE+  +  + GK ++GGIITS+H+V         IIE
Sbjct  419   GLKNRHIGSNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHRVTDR-----TIIE  473

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +LGP  FAA+ PW SG DMKERMR+YSRT + F++VRD G G V   GR+++   + D
Sbjct  474   TPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPSRED  533

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM-SG  418
              D +R GLR+ LRILVAAGAAEVGT RSDG ++ CKG++ E+LE FLD V    GPM S 
Sbjct  534   VDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSR  593

Query  417   EENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITIL  238
              + W L+CSAHQMGSCRMG++ +DGA+D  GE WEA+GLYVCDGS+LP+A+GVNPMITI 
Sbjct  594   VDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQ  653

Query  237   STAYCISNGLAKSLNSGK  184
             S A+C+S G+A+++  G+
Sbjct  654   SIAFCLSKGIAETMAQGQ  671



>ref|XP_006412937.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54390.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=600

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/587 (61%), Positives = 439/587 (75%), Gaps = 13/587 (2%)
 Frame = -3

Query  1908  SWTDENYNNPAWEAIGFHVDT-----NEVPPDQQTGRPLEKGIIETINENGTTLKESLIK  1744
             S TDEN  NPA EAIG+ + T     N+   ++ T RPLE GIIET +E   T+ +SLI+
Sbjct  10    SQTDENLKNPALEAIGYSIATTETSSNKTRKEEGTRRPLEAGIIETKHETDITITQSLIE  69

Query  1743  KGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGL  1564
             KG++V    +     IRCD VIVGSG GGGVAAA LA +G KV+VLEKG+YF ++DYS L
Sbjct  70    KGVHVARDDDNGVHRIRCDAVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFAAQDYSAL  129

Query  1563  EGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPL  1384
             EGPS+ ELYE GG++TT DGK M+ AG+ VGGG+A+NWSASI+TP++VL EWS   KI  
Sbjct  130   EGPSMQELYEKGGLMTTVDGKFMILAGSTVGGGTAVNWSASIRTPDHVLQEWSERSKIEF  189

Query  1383  FGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSC  1204
             FGS EYQSAMD V +RIGVTE C KEG QNQVLR+GCE LGLKV SVPRN  E HYCGSC
Sbjct  190   FGSQEYQSAMDEVTRRIGVTERCVKEGFQNQVLREGCERLGLKVVSVPRNSPEDHYCGSC  249

Query  1203  GYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA----RKKCLGVIAKSK  1036
             GYGCR G K G D T+LVDAV NGAVILTG +AE+FIL E+  +    +K+C+GVIA S 
Sbjct  250   GYGCREGYKNGTDRTWLVDAVENGAVILTGVKAERFILVENTNSGNERKKRCVGVIASSV  309

Query  1035  GNN--KILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE  862
             G    K   IEAR TVS+ GSL TPPL++SSGL+N+NIG NL LHPVL  WGYFPE  +E
Sbjct  310   GGKMEKKFMIEARVTVSSAGSLLTPPLMLSSGLENRNIGRNLRLHPVLMTWGYFPEESSE  369

Query  861   MEGKNHQGGIITSIHKVVSEGTKQA-AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSR  685
               GK ++GGIITS+H + ++G K   AI+E   +GPA FA +SPW SG D++ERM KY R
Sbjct  370   FSGKMYEGGIITSVHHI-NDGEKGCRAILENPLIGPASFAGLSPWVSGADLEERMMKYGR  428

Query  684   TVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDG  505
             T ++F++VRD+GSG+V K   ++YR  + DK+N+R G+RQALR+LVAAGA E+GT+RSDG
Sbjct  429   TAHVFALVRDNGSGEVMKESEVRYRTSKKDKENLRVGIRQALRVLVAAGAVEIGTYRSDG  488

Query  504   QKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNG  325
             Q++ C+G+  E +E FLD V A GG  +  E WT Y SAHQMGSCRMG TEE+GA+D NG
Sbjct  489   QRMKCEGVTREAVEEFLDRVDADGGVSTNREYWTTYFSAHQMGSCRMGHTEEEGAVDENG  548

Query  324   ECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             E WEA+GL+VCDGSVLPSA+GVNPMITI S AYCIS  +  SL   K
Sbjct  549   ESWEAEGLFVCDGSVLPSAVGVNPMITIQSAAYCISKRIVDSLQRQK  595



>ref|XP_004982885.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=729

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/747 (50%), Positives = 500/747 (67%), Gaps = 68/747 (9%)
 Frame = -3

Query  2358  PLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPL--PQDSDD------EAMCSFYSSS  2203
             PLLR  +R  Y HGL   Q +AL A+C ALIP +P+  P   D       + +  FY +S
Sbjct  18    PLLRRCKRERYTHGLRPPQMEALRAMCGALIPSLPVEGPFHGDKHGGGNKDDVERFYRAS  77

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
             A+    PDEVAE+       +A+ + R++L +LST++G+ +LCG++C   R+P++  F++
Sbjct  78    AADGAIPDEVAEMATG-CAREAMLLVRVILWMLSTKVGTFVLCGWLCVSSRFPYVFKFAD  136

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV---  1852
             +PL+RRE                                   E+ +NP+W+AIG+ V   
Sbjct  137   MPLERRE-----------------------------------EHSDNPSWKAIGYSVPDV  161

Query  1851  -----DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCD  1687
                  D +E  P     RPL+ G++ET + +   L  SL+ KGL V    +    T++CD
Sbjct  162   DRPQEDLSEAAPSPSP-RPLDSGVVETRSLDDAALLRSLMDKGLAVKADVSGPHHTVQCD  220

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
             VVIVGSGCGGGVAAAVLA +GHKVVV+EKG YF +EDYS +EGPS+  LYE GG+  T++
Sbjct  221   VVIVGSGCGGGVAAAVLAAAGHKVVVVEKGDYFTAEDYSSIEGPSMERLYEKGGIFCTSN  280

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
                ++F G  VGGGSAINWSASI+TP  V  EW+ E  +P+FGS EY  AMDAVC R+ V
Sbjct  281   ASTIMFTGATVGGGSAINWSASIRTPEWVTQEWAREHGLPVFGSPEYAHAMDAVCTRLAV  340

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
             T  C +EG QN+ LR GCE LGL+ ++VPRN SE H+CGSC  GC TG+K+G DTT+LVD
Sbjct  341   TSGCREEGFQNKALRNGCEALGLRADAVPRNTSEGHFCGSCHLGCPTGEKRGTDTTWLVD  400

Query  1146  AVNNGAVILTGCQAEKFILEEDETAR----KKCLGVIAKSKGN--NKILRIEARATVSAC  985
             AV  GAV+LTGC+AE+F+LE +        K+C+G++AK  G+   + LRIEA+ ++SAC
Sbjct  401   AVAQGAVVLTGCKAERFVLESNPGKNGCRSKRCVGLVAKCMGDGITRKLRIEAKVSISAC  460

Query  984   GSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE---MEGKNHQGGIITSIHK  814
             G+L TPPLL  SGLKN++IG NLHLHPV  AWGYFP+   E   + GK ++GGIIT++H+
Sbjct  461   GALMTPPLLRRSGLKNRHIGRNLHLHPVSMAWGYFPDGTPEPRPLTGKCYEGGIITTLHR  520

Query  813   VVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK  634
             V +       I++  +LGP   A++ PW SG DMKERM +Y+RT + F++VRD G+G V 
Sbjct  521   VTAR-----TIVQTPALGPGSMASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGTVG  575

Query  633   KAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL  454
             + GR++Y     D + +R GLR+ALRILVAAGAAEVGT RSDG ++ C+G++ E+LE+FL
Sbjct  576   REGRVRYVPSSEDVEELRNGLRRALRILVAAGAAEVGTHRSDGLRLRCEGLRDEDLEAFL  635

Query  453   DGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVL  277
             + V    GPM  G + W L CSAHQMGSCRMG+   DGA+D  GE WEA+GLYVCDGS+L
Sbjct  636   NEVTVAKGPMIPGSDTWALLCSAHQMGSCRMGSRPRDGAVDGRGESWEAEGLYVCDGSLL  695

Query  276   PSAIGVNPMITILSTAYCISNGLAKSL  196
             P+A+GVNPMITI STAY +S G+A+SL
Sbjct  696   PTAVGVNPMITIQSTAYYVSKGIAESL  722



>ref|XP_006589282.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Glycine 
max]
Length=649

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/611 (59%), Positives = 456/611 (75%), Gaps = 17/611 (3%)
 Frame = -3

Query  1977  ETLILPLRIVFMTIKIACYFIYFSWT--------DENYNNPAWEAIGFHVDTNEVPPDQQ  1822
             E L+ PL++     K   +F   S +        D+N  NPAWEAIG+ VD++ +     
Sbjct  36    EALLPPLQLDSTKSKTVQHFWKASGSQFSIPHECDDNGENPAWEAIGYQVDSDGITTTSN  95

Query  1821  TGR--PLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggva  1648
               R  PLEKGI+E + E+  +L +SLI+KGL V      NTL I+CDVVIVGSGCGGGVA
Sbjct  96    VHRERPLEKGIVEAMKESNLSLPKSLIEKGLEVAIDSKNNTLNIKCDVVIVGSGCGGGVA  155

Query  1647  aavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGG  1468
             A++LA+SG KV+VLEKG+YF   DYS LEGPSL ELYE GG   + DGK+ +  GT VGG
Sbjct  156   ASILASSGLKVLVLEKGNYFTPNDYSSLEGPSLNELYELGGTFASRDGKMAILTGTTVGG  215

Query  1467  GSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQV  1288
             GSA+NW+ASI+TP+ VL EW  + K+ LF S EY SAMD VCKRIGVT+ C +EGLQNQV
Sbjct  216   GSAVNWAASIRTPDFVLEEWGKDHKLSLFSSHEYLSAMDMVCKRIGVTDKCIEEGLQNQV  275

Query  1287  LRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQ  1108
             LRKGC+NLGL V+ VPRN SE+HYCGSC YGC  G+K+G + T+LVDAV++GAVILTG +
Sbjct  276   LRKGCKNLGLPVDYVPRNSSERHYCGSCNYGCTRGEKQGTEVTWLVDAVDHGAVILTGTK  335

Query  1107  AEKFILEEDETA----RKKCLGVIAKSKGNNKI--LRIEARATVSACGSLFTPPLLISSG  946
             AE+FIL +        RKKCLGV+A    NN    L++EA+ TVSACG+LFTPPL+ISSG
Sbjct  336   AERFILGKKNKGGGVRRKKCLGVMANVVTNNITWRLKVEAKVTVSACGALFTPPLMISSG  395

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEG-TKQAAIIEAV  769
             LKNK+IG NLHLHPVL +WGYFP+S +E++GK ++GGIITS+HKVVSE  +K  AI+E  
Sbjct  396   LKNKHIGKNLHLHPVLMSWGYFPDSNSELKGKCYEGGIITSVHKVVSEDYSKVKAIVETP  455

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
             +LGP   + + PW SGLD K+RM KYSRTV++ +++RD G G+V+  GR+ Y +D+ DK+
Sbjct  456   ALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSEGRVHYELDESDKE  515

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEEN  409
             NIR G++QALRIL+AAGA EVGT RSDG +I C G   +ELE F++ V AT G MS EE 
Sbjct  516   NIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATEGLMSHEEK  575

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
             W++Y SAHQMGSCRMG +E++GA+D NG  WEA+GL+VCD S+LP+AIGVNPMITI STA
Sbjct  576   WSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTA  635

Query  228   YCISNGLAKSL  196
             YC++  +A  L
Sbjct  636   YCVAKRIAAFL  646


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -3

Query  2373  ERKCHPLLRGGRR-NSYN-HGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSA  2200
             +R CHPLLRGGRR N Y  H LSS++ ++L++ICEAL+PP+ L   +  + +  F+ +S 
Sbjct  2     KRDCHPLLRGGRRCNKYTPHILSSAEMESLSSICEALLPPLQL-DSTKSKTVQHFWKASG  60

Query  2199  SQPPFPDE  2176
             SQ   P E
Sbjct  61    SQFSIPHE  68



>gb|KHN30591.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=649

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/611 (59%), Positives = 456/611 (75%), Gaps = 17/611 (3%)
 Frame = -3

Query  1977  ETLILPLRIVFMTIKIACYFIYFSWT--------DENYNNPAWEAIGFHVDTNEVPPDQQ  1822
             E L+ PL++     K   +F   S +        D+N  NPAWEAIG+ VD++ +     
Sbjct  36    EALLPPLQLDSTKSKAVQHFWKASGSQFSIPHECDDNGENPAWEAIGYQVDSDGITTTSN  95

Query  1821  TGR--PLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggva  1648
               R  PLEKGI+E + E+  +L +SLI+KGL V      NTL I+CDVVIVGSGCGGGVA
Sbjct  96    VHRERPLEKGIVEAMKESNLSLPKSLIEKGLEVAIDSKNNTLNIKCDVVIVGSGCGGGVA  155

Query  1647  aavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGG  1468
             A++LA+SG KV+VLEKG+YF   DYS LEGPSL ELYE GG   + DGK+ +  GT VGG
Sbjct  156   ASILASSGLKVLVLEKGNYFTPNDYSSLEGPSLNELYELGGTFASRDGKMAILTGTTVGG  215

Query  1467  GSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQV  1288
             GSA+NW+ASI+TP+ VL EW  + K+ LF S EY SAMD VCKRIGVT+ C +EGLQNQV
Sbjct  216   GSAVNWAASIRTPDFVLEEWGKDHKLSLFSSHEYLSAMDMVCKRIGVTDKCIEEGLQNQV  275

Query  1287  LRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQ  1108
             LRKGC+NLGL V+ VPRN SE+HYCGSC YGC  G+K+G + T+LVDAV++GAVILTG +
Sbjct  276   LRKGCKNLGLPVDYVPRNSSERHYCGSCNYGCTRGEKQGTEVTWLVDAVDHGAVILTGTK  335

Query  1107  AEKFILEEDETA----RKKCLGVIAKSKGNNKI--LRIEARATVSACGSLFTPPLLISSG  946
             AE+FIL +        RKKCLGV+A    NN    L++EA+ TVSACG+LFTPPL+ISSG
Sbjct  336   AERFILGKKNKGGGVRRKKCLGVMANVVTNNITWRLKVEAKVTVSACGALFTPPLMISSG  395

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEG-TKQAAIIEAV  769
             LKNK+IG NLHLHPVL +WGYFP+S +E++GK ++GGIITS+HKVVSE  +K  AI+E  
Sbjct  396   LKNKHIGKNLHLHPVLMSWGYFPDSNSELKGKCYEGGIITSVHKVVSEDYSKVKAIVETP  455

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
             +LGP   + + PW SGLD K+RM KYSRTV++ +++RD G G+V+  GR+ Y +D+ DK+
Sbjct  456   ALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSEGRVHYELDESDKE  515

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEEN  409
             NIR G++QALRIL+AAGA EVGT RSDG +I C G   +ELE F++ V AT G MS EE 
Sbjct  516   NIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATEGLMSHEEK  575

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
             W++Y SAHQMGSCRMG +E++GA+D NG  WEA+GL+VCD S+LP+AIGVNPMITI STA
Sbjct  576   WSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTA  635

Query  228   YCISNGLAKSL  196
             YC++  +A  L
Sbjct  636   YCVAKRIAAFL  646


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = -3

Query  2373  ERKCHPLLRGGRR-NSYN-HGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSA  2200
             +R CHPLLRGGRR N Y  H LSS++ ++L++ICEAL+PP+ L   +  +A+  F+ +S 
Sbjct  2     KRDCHPLLRGGRRCNKYTPHILSSAEMESLSSICEALLPPLQL-DSTKSKAVQHFWKASG  60

Query  2199  SQPPFPDE  2176
             SQ   P E
Sbjct  61    SQFSIPHE  68



>gb|KEH15695.1| long-chain-alcohol oxidase FAO1, partial [Medicago truncatula]
Length=653

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/647 (54%), Positives = 468/647 (72%), Gaps = 20/647 (3%)
 Frame = -3

Query  2370  RKCHPLLRGGRRNS-YNHGLSSSQYQALAAICEALIPPIPLPQ--DSDDEA---MCSFYS  2209
             R+CHPLL G R NS Y HG S ++ ++L +ICE ++P +P+      DDE+   + SF++
Sbjct  3     RECHPLLSGVRENSKYKHGFSVAEMESLTSICEVVLPSLPMDDALTKDDESSKDVQSFFN  62

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNF  2029
              SAS  P PDEVAE++++  + +AV + R++L +L+TRLG+LL+CG +C   +WPFI+NF
Sbjct  63    ISASMYPIPDEVAEMLVKSGVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNF  122

Query  2028  SELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVD  1849
             S L L +RE I+ +  +   + P R+ F  IK+ C F++FSW DEN +NPAW+AIG+ V 
Sbjct  123   SSLSLDKREKIVQRALKLRFLTPFRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIGYEVS  182

Query  1848  T-NEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivg  1672
             T +E   +    RPLEKGIIE ++E+ TTL++SL  KGLNVT     N L I+CD V+VG
Sbjct  183   TADEKMTNDTKKRPLEKGIIEIMHEHDTTLQQSLSNKGLNVTLDSKNNILKIKCDAVVVG  242

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SGCGGGVAA+VL+ +G+KVVVLEKG+YFV +DYS LEGPS+ + YE+GG+L + D ++++
Sbjct  243   SGCGGGVAASVLSKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYENGGILASIDSRILI  302

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGSA+NWSA IKTP  VL EWS + K+ LF S EY SAM+ VC+RIGV E C+
Sbjct  303   LAGSTVGGGSAVNWSACIKTPEKVLKEWSEKHKLSLFDSIEYLSAMETVCERIGVNENCT  362

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG QNQVLRKGC+NLGLKV+ VPRN    HYCGSCGYGC  G+K+G   T+LVDAV+ G
Sbjct  363   QEGFQNQVLRKGCQNLGLKVDYVPRNSPGNHYCGSCGYGCPKGEKQGTQATWLVDAVDKG  422

Query  1131  AVILTGCQAEKFILEE-----DETARKKCLGVIAKS--KGNNKILRIEARATVSACGSLF  973
             AVI+TGC+AE+F+ E      +    KKCLGV+AK+   G    L+ EA+ T+SA G+L 
Sbjct  423   AVIITGCKAERFLFENNYRNANTRKNKKCLGVLAKTLNSGVTMKLQFEAKVTISAGGALL  482

Query  972   TPPLLISSGL-KNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV-----  811
             TPPL+ISSGL KNKNIG NLHLHPVL  WGYFPES ++ +GK ++GGIITS+H+V     
Sbjct  483   TPPLMISSGLTKNKNIGRNLHLHPVLMTWGYFPESKSDFKGKANEGGIITSVHRVPSSSN  542

Query  810   VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
                 +   AIIE   LGP+ F+A+ PW SGLD K+RM  Y RT +  +++RD   GQV  
Sbjct  543   DDSISDTRAIIETPLLGPSSFSALYPWESGLDYKQRMLNYPRTAHFITIIRDKAGGQVTT  602

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICC  490
               RI Y+++ IDK+N+R G++QALRIL+AAGA EVGT RS GQ+I C
Sbjct  603   ERRISYKLNSIDKENMRAGIQQALRILIAAGAVEVGTHRSGGQRIKC  649



>ref|XP_003607676.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=606

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/603 (58%), Positives = 453/603 (75%), Gaps = 18/603 (3%)
 Frame = -3

Query  1959  LRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT-NEVPPDQQTGRPLEKGIIETI  1783
             + + F+ + I  Y+ +    DEN +NPAW+AIG+ V T +E   +    RPLEKGIIE +
Sbjct  1     MSLCFLLLGI--YYFFNLAVDENGDNPAWKAIGYEVSTADEKMINDTKKRPLEKGIIEIM  58

Query  1782  NENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLE  1603
             +E+ TTL++SL  KGLNVT     N L I+CD V+VGSGCGGGVAA+VL+ +G+KVVVLE
Sbjct  59    HEHDTTLQQSLSNKGLNVTLDSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKVVVLE  118

Query  1602  KGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNN  1423
             KG+YFV +DYS LEGPS+ + YE GGML + D ++++FAG+ VGGGSA+NWSA I+TP N
Sbjct  119   KGNYFVPKDYSSLEGPSMDQQYEKGGMLASVDSRIVLFAGSTVGGGSAVNWSACIRTPQN  178

Query  1422  VLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESV  1243
             VL EWS E K+PLF + EY SAM+ VC+RIGV E C++EG QNQVLRKGC+NLGLKV+ V
Sbjct  179   VLKEWSDEHKLPLFETLEYLSAMETVCERIGVNENCTQEGFQNQVLRKGCQNLGLKVDYV  238

Query  1242  PRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEE-----DE  1078
             PRN    HYCGSCGYGC  G+K+G   T+LVDAV+ GAVI+TGC+AE+F+ +      + 
Sbjct  239   PRNSPGNHYCGSCGYGCPKGEKQGTQATWLVDAVDKGAVIITGCKAERFLFDNNYKNANT  298

Query  1077  TARKKCLGVIAKSKGNNKI---LRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLH  907
               +KKCLGV+AK+  N+++   L+IEA+ T+SA G++ TPPLLISSGLKNKNIG NLHLH
Sbjct  299   RKKKKCLGVLAKTL-NSRVTMKLQIEAKVTISAGGAILTPPLLISSGLKNKNIGRNLHLH  357

Query  906   PVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQA-----AIIEAVSLGPAGFAA  742
             PVL  WGYFPES ++++GK ++GGIITS+HKV S     +     AIIE   LGP+ FA+
Sbjct  358   PVLMTWGYFPESKSDLKGKIYEGGIITSVHKVSSSLNDHSISDTRAIIETPLLGPSSFAS  417

Query  741   VSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQA  562
             + PW SGLD K+RM KY RT ++ +++RD  SGQVK  GRI Y+++ ID++N+R GL+Q 
Sbjct  418   IYPWESGLDFKQRMLKYPRTAHLITIIRDKASGQVKTEGRISYKLNSIDRENMRAGLQQG  477

Query  561   LRILVAAGAAEVGTFRSDGQKI-CCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAH  385
             LRIL+AAGA EVGT RSDGQ+I C +    +E+E F+D V    G +   ENW LY SAH
Sbjct  478   LRILIAAGAVEVGTHRSDGQRIKCNENTGEKEIEEFIDSVYPMEGALWPGENWNLYTSAH  537

Query  384   QMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLA  205
             QMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLP+A+GVNPMITI STA+CISN + 
Sbjct  538   QMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAFCISNRIV  597

Query  204   KSL  196
               L
Sbjct  598   DFL  600



>ref|XP_010529119.1| PREDICTED: long-chain-alcohol oxidase FAO3-like, partial [Tarenaya 
hassleriana]
Length=660

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/650 (55%), Positives = 461/650 (71%), Gaps = 18/650 (3%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPLPQ----DSDD----EAMCSFYSSSASQPPFPDEV  2173
             +  G +  + ++LAA+CE ++PP+  P+    D DD    EA+ SFYS S SQ     + 
Sbjct  12    FRRGFTVMEMESLAAVCETILPPLS-PEYSNTDEDDHPNKEALRSFYSGSGSQSHVLHQA  70

Query  2172  AEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAIL  1993
             AE++ +R L + V + RLVL++LS+RLG+L+LCG  C    WPF+  F  L L++RE +L
Sbjct  71    AELITKRGLIEVVLVMRLVLVLLSSRLGTLVLCGTHCLVPNWPFVERFGSLSLEKRERVL  130

Query  1992  LKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQ-QTG  1816
              KW R  ++  +R+ F+ IKI   F +FSW + N  NPAWEAI + V+  E         
Sbjct  131   QKWFRSKILAAIRVAFVHIKIVFLFCFFSWVNTNGENPAWEAIQYQVNLEESESSNILKE  190

Query  1815  RPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavl  1636
             RPLEKG++ET+ E  +TL ESL +KGL VT   N + + I+CDVVI+GSG GGGVAAAVL
Sbjct  191   RPLEKGMVETVKETDSTLPESLSEKGLEVTSGSNHDPIKIKCDVVIIGSGSGGGVAAAVL  250

Query  1635  ANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAI  1456
             A+S  KVV+LEKG YF   +YS  EG    +LYESGG+L T DG  M+ AG  VGGGSA+
Sbjct  251   ASSDLKVVILEKGRYFAPSEYSPFEGHGFDQLYESGGVLPTLDGNAMIIAGATVGGGSAV  310

Query  1455  NWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKG  1276
             +WSA IKTP +VL EW  + +IP FG+ EY SAMDAVCKRIGVT  C++E  QNQVLRKG
Sbjct  311   SWSACIKTPESVLQEWVKDHRIPFFGTQEYVSAMDAVCKRIGVTYRCNEESFQNQVLRKG  370

Query  1275  CENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKF  1096
             C NLGLKVE+VPRN SE HYCGSC YGCR GDKKG D T+L+DAVN+GAV+LTGC+AE+ 
Sbjct  371   CHNLGLKVENVPRNSSENHYCGSCCYGCRQGDKKGSDRTWLLDAVNHGAVVLTGCKAERL  430

Query  1095  ILEEDE-----TARKKCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSGLKN  937
             ILE++        + KCLGV+AK    N  + L+IEA+ TV ACG+L TPPL+I S LKN
Sbjct  431   ILEKNMNRGVGAKKMKCLGVMAKCLNGNISRNLQIEAKVTVMACGALLTPPLMIRSSLKN  490

Query  936   KNIGSNLHLHPVLFAWGYFPES-MAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLG  760
             +NIG NLHLH    AWGYFPE   + ++GK ++GGIITS +KV+S+ ++  A+IE  +LG
Sbjct  491   RNIGRNLHLHLAQVAWGYFPEKETSHLKGKIYEGGIITSANKVLSKDSEVRALIETPALG  550

Query  759   PAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIR  580
             P+ F A+SPW+SGLDMK RM KYSRT N+ ++VRD GSG++K  GRI+Y +D+ DK+NI 
Sbjct  551   PSLFTALSPWSSGLDMKNRMTKYSRTANLVTIVRDRGSGEIKAEGRIKYALDKTDKENIV  610

Query  579   TGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
              GLRQ+LRIL++AGA EVGT RSDGQ + CKGI  + +E FLD V A  G
Sbjct  611   AGLRQSLRILISAGAVEVGTHRSDGQSLKCKGIDEKAIEEFLDTVTAEDG  660



>gb|EEC67160.1| hypothetical protein OsI_34014 [Oryza sativa Indica Group]
Length=710

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/758 (49%), Positives = 490/758 (65%), Gaps = 86/758 (11%)
 Frame = -3

Query  2361  HPLLRGGRRNS--YNHGLSSSQYQALAAICEALIPPIPLPQDSD-------DEAMCSFYS  2209
             HPLLRGG R    Y HG+  +Q +AL A+C ALIP +P+  D         D+ +  FY 
Sbjct  4     HPLLRGGARRGRKYAHGMHPAQMEALRAMCGALIPSLPVDADGGEGGRRPGDKDLERFYL  63

Query  2208  SSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCG---FVCFDGR-WPF  2041
             +SA+    PDEVAE+++ R + +AV +  +VL  LSTR G+LLLCG       DG  +PF
Sbjct  64    ASAADSSIPDEVAELLVTRCIWEAVALTWVVLWALSTRAGTLLLCGRDSVAAVDGGGFPF  123

Query  2040  I--HNFSELPLKRREAILLKWS-RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWE  1870
             +    F+++P  RREA L +WS    L  PLRI F   KI C+++++S  +EN  NP W+
Sbjct  124   VSVRRFADMPAARREAALRRWSGARWLFFPLRIAFAIAKILCHYVFYSMVNENSENPYWK  183

Query  1869  AIGFHVD---------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQ  1717
             AIG+ V+              P   + RPL+ G++ET     TTL  SL  KGL+V    
Sbjct  184   AIGYRVEEPRRDRAESMPSPSPSPASRRPLDNGVVETRALTDTTLLRSLAAKGLSVRPGA  243

Query  1716  NANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELY  1537
             +    T+RCD VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF  EDYS +EGPS+  L+
Sbjct  244   SDEHHTVRCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTKEDYSSIEGPSMERLF  303

Query  1536  ESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSA  1357
             E GG+  T++   M+F G  VGGGSA+NWSASI+TP  V+ EWS E  + +F S  Y  A
Sbjct  304   ERGGVFCTSNVTTMIFTGATVGGGSAVNWSASIRTPAGVMQEWSREHGLAVFASPGYARA  363

Query  1356  MDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDK  1177
             MDAVC+R+GVT+ C +EG QN+V+R+GC+ LGL+ ++VPRN SE H+CGSC +GC TGDK
Sbjct  364   MDAVCERLGVTDACREEGFQNKVVRRGCDGLGLRADAVPRNSSEGHFCGSCNFGCPTGDK  423

Query  1176  KGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAK--SKGNNKILRI  1012
             KG DTT+LVDAV  GAVILTGC+AE FI+E +       K+C+G++A   S G  K LR+
Sbjct  424   KGTDTTWLVDAVERGAVILTGCKAEHFIVESNGGGGGRSKRCVGLVATCMSNGITKKLRV  483

Query  1011  EARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE--MEGKNHQG  838
             EA+ ++SA G+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP++  E  + GK ++G
Sbjct  484   EAKVSISASGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDNTPEPHIPGKCYEG  543

Query  837   GIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVR  658
             GIITS+H+V      +  IIE  +LGP  FAA+ PW SG DMKERMR+Y+RT + F++VR
Sbjct  544   GIITSMHRVT-----ERTIIETPALGPGAFAALVPWESGRDMKERMRRYARTAHAFALVR  598

Query  657   DHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIK  478
             D G+G V   GR++Y   + D + +R GLR+ALRILVAAGAAE+G               
Sbjct  599   DRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEMG---------------  643

Query  477   TEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLY  298
                                               SCRMGA+  DGA+D  GE WEA+GLY
Sbjct  644   ----------------------------------SCRMGASPRDGAVDVAGESWEAEGLY  669

Query  297   VCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             VCDGS+LP+A+GVNPMITI S AYC++ G+A S+  GK
Sbjct  670   VCDGSLLPTAVGVNPMITIQSIAYCVAKGIADSMAHGK  707



>dbj|BAK00483.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=594

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/583 (58%), Positives = 417/583 (72%), Gaps = 9/583 (2%)
 Frame = -3

Query  1917  IYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTG---RPLEKGIIETINENGTTLKESLI  1747
              +F  TD+N  NP W+AIG+   T+E    ++     RPLE G++ETI++   +L  SL 
Sbjct  3     FHFPHTDDNSENPHWQAIGYSPPTDEAAEQEEQASIKRPLEDGVVETIHQTDASLPTSLA  62

Query  1746  KKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSG  1567
             +KGL VTE    N   I CDVVIVGSGCGGGVAAAVLA +GHKVVV+EKG+YF + DY+ 
Sbjct  63    EKGLAVTEDAARNVCRIECDVVIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTARDYTS  122

Query  1566  LEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIP  1387
             +EGPS+ +LYE GG ++T  G  ++ AG+ VGGGSA+NWSA IKTP++V  EW+    +P
Sbjct  123   IEGPSMSQLYEYGGFMSTLSGSGLLLAGSTVGGGSAVNWSACIKTPDSVRKEWAAAHGLP  182

Query  1386  LFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGS  1207
             LF  SEY +AMD V KR+GVT  C +EGLQN+VLRKGCE LG  VE V RN SE H+CGS
Sbjct  183   LFDKSEYTAAMDVVFKRLGVTSGCKEEGLQNKVLRKGCEKLGYNVEPVSRNSSEGHFCGS  242

Query  1206  CGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR-KKCLGVIAKSKGN  1030
             CGYGCRTGDK+G DTT+LVDAV+ GAVILTG +AEK +  +    R K+C GV+A S   
Sbjct  243   CGYGCRTGDKRGTDTTWLVDAVSRGAVILTGSKAEKLLFTDAAGKRGKRCAGVVAASSNP  302

Query  1029  --NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFP-ESMAEM  859
                + L + A+ TV+A GSL TP LL  SGLKN +IG NLHLHP+  AWGYFP + M E+
Sbjct  303   AITRKLEVRAKVTVAAGGSLLTPVLLRGSGLKNPHIGKNLHLHPIAMAWGYFPPDKMPEL  362

Query  858   EGKNHQGGIITSIHKVVSEGT--KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSR  685
             +GK ++GGIITS+HKV ++G      AI+E   +GPA      PW SG DMKERM  Y R
Sbjct  363   KGKMYEGGIITSLHKVEADGDGLPHRAILETPLMGPAAAGTQFPWVSGRDMKERMLNYGR  422

Query  684   TVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDG  505
             TV+IFS+VRDHGSG V    RI Y +D +D++N R GLR+ALRILVAAGA EVG  RSDG
Sbjct  423   TVHIFSLVRDHGSGTVHGERRIAYHLDPVDRENQREGLRRALRILVAAGATEVGIHRSDG  482

Query  504   QKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNG  325
             QK+ CKG   EE+E FLDGV    GP S  E W+L C+AHQMGSCRM AT  DGA+D  G
Sbjct  483   QKLRCKGATDEEVEEFLDGVSGVRGPQSKSEKWSLCCTAHQMGSCRMAATAGDGAVDTRG  542

Query  324   ECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             E WE + LYVCDGSVLP A+GVNPMITI S AYC++ G+A+ L
Sbjct  543   ESWEVERLYVCDGSVLPGAVGVNPMITIQSVAYCLATGIAEQL  585



>ref|XP_010501308.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO1-like 
[Camelina sativa]
Length=744

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/708 (49%), Positives = 464/708 (66%), Gaps = 21/708 (3%)
 Frame = -3

Query  2379  MNERKCHPLLR-GGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD---------DE  2230
             M  R+  PLLR   ++ + +HG S S  QAL+AICEA++PP+PL Q  D         ++
Sbjct  1     MVGRRGSPLLRWNTKQENVSHGFSPSDLQALSAICEAILPPVPL-QSLDLEMKLKVLRND  59

Query  2229  AMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFD-G  2053
             A+ SF+ SS+     PDEVAE++  + +P  V + R+VL IL+ RLG+LLLCG VC D  
Sbjct  60    ALLSFFKSSSGPHVRPDEVAELLATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVCLDKA  119

Query  2052  RWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAW  1873
              WPF+  FSE+ L++RE +L +W+ +      RI FM IK    F YF+WTDEN  NPAW
Sbjct  120   NWPFLLKFSEISLEKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAW  179

Query  1872  EAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
             +AIG+ VD NE    +   RPLEKGIIET   N  T+K+ +I KGL VTE + ++T  I 
Sbjct  180   DAIGYSVDMNENEGMKHKERPLEKGIIETDKVNEMTIKQRMINKGLKVTEDRESDTYKIE  239

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CD V+VGSGCGGGVAAA LA SG +VVVLEKG+YFV  DYS LEGPS  E++ES  +L T
Sbjct  240   CDAVVVGSGCGGGVAAANLAKSGLRVVVLEKGNYFVPRDYSALEGPSTFEMFESNSLLMT  299

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
              DG+    AG+ VGGGS +NW+A++KTP+ ++ EWS+++ I  F S +Y++AMD VCKRI
Sbjct  300   HDGRFRFMAGSTVGGGSVVNWAAALKTPDAIIEEWSVQRGISTFSSEKYKAAMDRVCKRI  359

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVTE   +EG QNQ+LRKGC+ LGL V +VPRN ++ HYCGSC +GC TGDK+G D T+L
Sbjct  360   GVTERIVREGFQNQILRKGCKKLGLDVTTVPRNSTDGHYCGSCSFGCPTGDKRGTDLTWL  419

Query  1152  VDAVNNGAVILTGCQAEKFILEEDETARKKCLGVIAKSKGNN---KILRIEARATVSACG  982
             VDAVNN              L          L  + + K  +       I        CG
Sbjct  420   VDAVNNNXFYYFTWVTSSIFLCMFLXQAIXFLXRLKRCKHESYGIYTFMIVLEVISLMCG  479

Query  981   SLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVS-  805
             S+          LKN NIG  LH+HP+L  WGYFPE  ++ EG  H+G I+T+++ V   
Sbjct  480   SM----QCAQQXLKNPNIGRGLHIHPILMVWGYFPEKKSDFEGAAHEGEILTALYYVHPM  535

Query  804   EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
             + T     +E  ++GP  FAA+ PW SG D+KER+ KYSRT +IF MVRD G G+V K G
Sbjct  536   DSTTPNITLETPAIGPGTFAALVPWVSGSDIKERLAKYSRTSHIFVMVRDEGVGEV-KGG  594

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
              ++YR+ + D++N+  GL+QAL+IL AAGAAEVGT+RSDGQ+I C G+K ++LE+FL  V
Sbjct  595   IVKYRLTKADEENLTIGLKQALQILAAAGAAEVGTYRSDGQRIKCDGMKHKDLEAFLQTV  654

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
              A  G +S  ++WT   +AHQMG CRMGATE++GAID  GE WEA+ L
Sbjct  655   EAPAGVVSMSKHWTHSFTAHQMGCCRMGATEKEGAIDGKGESWEAEDL  702



>gb|AAL31027.1|AC078948_11 putative alcohol oxidase [Oryza sativa Japonica Group]
 gb|AAP54254.1| GMC oxidoreductase family protein [Oryza sativa Japonica Group]
Length=637

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/582 (56%), Positives = 424/582 (73%), Gaps = 19/582 (3%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHVD------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKG  1738
             DE   NP+W+AIG+           +  P   + RPLE G++ET   +   L  SL++KG
Sbjct  61    DEKSRNPSWKAIGYAAPAAAAAAVEQRRPASPSRRPLEDGVVETRRMDDNALLRSLVEKG  120

Query  1737  LNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
             L V ++  A   T++CD V+VGSGCGGGVAAAVLA+ G+KVVV+EKG YF +EDY+ LEG
Sbjct  121   LAV-KTGTAAHHTVQCDAVVVGSGCGGGVAAAVLASKGYKVVVVEKGDYFATEDYTSLEG  179

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
             PS+  LYE GG+  T++   ++F G  VGGGSA+NWSA I+TP  +  EWS E  +P+F 
Sbjct  180   PSMERLYEKGGVFGTSNVTTILFTGATVGGGSAVNWSACIRTPAEIREEWSREHGLPVFA  239

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S+ Y  AMDAVC RI VT  C +EG QN+VLR+GC+ LG++ ++VPRN SE H+CGSC  
Sbjct  240   STAYAQAMDAVCDRIRVTGGCEEEGFQNRVLRRGCDALGMRADAVPRNSSEGHFCGSCNL  299

Query  1197  GCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR----KKCLGVIA--KSK  1036
             GC TGDKKG DTT+LVDAV  GAVILTGC+AE FILE +   R    K+C+G++A   S 
Sbjct  300   GCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFILERNAGGRGGRSKRCVGLMATCTSS  359

Query  1035  GNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEME  856
             G  K LRIEA+ ++SACG+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP+S AE+ 
Sbjct  360   GITKKLRIEAKVSISACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELP  419

Query  855   GKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVN  676
             GK ++GGIITS+H+V         IIE  +LGP  F+AV PW SG DMKERMR+Y+RT +
Sbjct  420   GKCYEGGIITSMHRVTDR-----TIIETPALGPGAFSAVVPWESGRDMKERMRRYARTAH  474

Query  675   IFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKI  496
              F++VRD G+G V   GR+++   + D + +R GLR+ALRILVAAGAAEVGT RSDG ++
Sbjct  475   AFALVRDRGAGAVDGEGRVRFSPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGLRL  534

Query  495   CCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGEC  319
              CKG++  ++E+FLD V    GPM  G + W ++CSAHQMGSCRMGA+  DGA+D  GE 
Sbjct  535   RCKGVRDADVEAFLDEVTIEKGPMYPGSDKWAIFCSAHQMGSCRMGASPRDGAVDGAGES  594

Query  318   WEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             WEA+GLYVCDGS+LP+A+GVNPMITI S AYC+SNG+A +L+
Sbjct  595   WEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCLSNGIADTLS  636



>gb|KFK42743.1| hypothetical protein AALP_AA1G034000 [Arabis alpina]
Length=682

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/584 (57%), Positives = 422/584 (72%), Gaps = 10/584 (2%)
 Frame = -3

Query  1902  TDENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE  1723
             T+EN  NPAW+AIG+ VD       +Q  RPL+KGIIET  E+  T+K+ +I KGL VT 
Sbjct  101   TNENTENPAWDAIGYAVDIGTNDDAEQKERPLDKGIIETAKEDDKTIKQLMINKGLQVTG  160

Query  1722  SQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGE  1543
              + +NT  I CD V+VGSGCGGGVAAA LA SG +VVVLEKG+YFV +DYS LEGPS+ E
Sbjct  161   ERESNTYKIECDAVVVGSGCGGGVAAANLAKSGLRVVVLEKGNYFVPQDYSALEGPSMFE  220

Query  1542  LYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQ  1363
             L+E   +L T DG+    AG  VGGGS +NW+A++KTP+ +++EWS++  IP+F   EY+
Sbjct  221   LFELNTLLMTHDGRFRFMAGKTVGGGSVVNWAAALKTPDAIIDEWSVDLGIPIFSKEEYK  280

Query  1362  SAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTG  1183
             +AM+ V KR+GVTE   KEG QNQ+LRKGCE LGL V +VPRN SEKH+CGSC +GC TG
Sbjct  281   AAMNIVYKRLGVTEKIIKEGFQNQILRKGCEKLGLDVTAVPRNTSEKHHCGSCSFGCNTG  340

Query  1182  DKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA-------RKKCLGVIAKSKGNNK  1024
             DK G D+T+LVDAVNN AVILT CQA+K IL +++         RK+CLGV A S  N  
Sbjct  341   DKIGTDSTWLVDAVNNNAVILTQCQADKLILIDNDAENRWESGRRKRCLGVTA-SLSNGT  399

Query  1023  ILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNH  844
              L+I A+ TV ACGSL TP LL SSGLKN NIG  LH+HP+L  WGYFPE  +  EG  H
Sbjct  400   KLQINAKVTVVACGSLMTPGLLTSSGLKNPNIGCGLHIHPILMVWGYFPEKNSNFEGVAH  459

Query  843   QGGIITSIHKVVS-EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFS  667
             +G I+TS+H V   + T     +E  ++GP  FAA++PW SG DMK R+ KY+RT +IF 
Sbjct  460   EGEIVTSLHYVFPIDSTTPNITLEIPAIGPGMFAALTPWVSGSDMKTRLAKYARTSHIFV  519

Query  666   MVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCK  487
             MVRD G G+V +   + Y++ + D++N+  GL+QALRILVAAGA EVGT+RSDGQ++ C 
Sbjct  520   MVRDEGVGKV-RGEIVTYKLTKSDEENLTIGLKQALRILVAAGATEVGTYRSDGQRLKCD  578

Query  486   GIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAK  307
             GIK EELE+FLD V    G +S  ++WT   +AHQ+G CRMGATE++GA+D  GE WEA+
Sbjct  579   GIKEEELETFLDTVTVPPGVLSMSKHWTHSFTAHQIGCCRMGATEKEGALDGYGESWEAE  638

Query  306   GLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA*N  175
              LYVCD SVLP+AIGVNPMITI STAYCIS  +A+ + + K  N
Sbjct  639   DLYVCDASVLPTAIGVNPMITIQSTAYCISKRIAELMETKKKIN  682


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 11/89 (12%)
 Frame = -3

Query  2361  HPLLR--GGRRNSYNHGLSSSQYQALAAICEALIPPIP-LPQDSD-------DEAMCSFY  2212
             +PLLR    ++ S++HG S    Q L+AICEA++P +P L  D D       ++A+ SF+
Sbjct  12    NPLLRWRSVKQESFSHGFSEPDLQVLSAICEAIMPRVPLLTLDLDMKLKVLRNDALLSFF  71

Query  2211  SSSASQPPF-PDEVAEVVMRRFLPDAVFI  2128
              SS+      PDEVAE+++ + +P  V +
Sbjct  72    KSSSGWSHVRPDEVAELLVTKAMPVTVKV  100



>ref|XP_010523169.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO1 
[Tarenaya hassleriana]
Length=779

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/778 (47%), Positives = 476/778 (61%), Gaps = 69/778 (9%)
 Frame = -3

Query  2373  ERKCHPLLRGGR-RNSYNHGLSSSQYQALAAICEALIPPIPLPQDS--------DDEAMC  2221
             ER+ +PLL       S+ HG S SQ +AL+AIC A++ P+ L             ++A+ 
Sbjct  12    ERRGNPLLEWSNGEESFCHGFSPSQLEALSAICRAILRPVALESLKLNMKLKILRNDALL  71

Query  2220  SFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPF  2041
              F+ SS      P   A+ V      ++ F +RL         G+LLLCGF+  D +WPF
Sbjct  72    RFFESSC-----PQVRADEVCCSQSGESSFTYRL---------GTLLLCGFLSLDQKWPF  117

Query  2040  IHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFS---------------  1906
             +  F+E  L + E IL +WSR+      R+ F+ IK    F YF+               
Sbjct  118   LLTFAESSLDKTEKILQRWSRQRFNPLARLAFIMIKAFFLFYYFTRVCLKFPHVMYILXS  177

Query  1905  --------------WTDENYNNPAWEAIGFHVDTNEVPPDQ-QTGRP-LEKGIIETINEN  1774
                            TDEN  NP W+AIG++V       ++ Q  RP L +GIIET  EN
Sbjct  178   PDSKSHTYMTHLHGQTDENTGNPTWDAIGYYVTNKATSQEKRQEDRPLLNEGIIETEKEN  237

Query  1773  GTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGH  1594
               TLK+ LI KGL VTE + +NT  I CD V++G GCGG VAA  LA SG +VVVLEKG+
Sbjct  238   DRTLKQRLISKGLRVTEDRQSNTYKIECDAVVMGMGCGGAVAATNLARSGLRVVVLEKGN  297

Query  1593  YFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLN  1414
             Y V  DYS LEGPS+ EL ES G + T D +  + AG+ VG GSAINWSASIKT   ++ 
Sbjct  298   YSVPRDYSSLEGPSMFELIESNGFMMTQDRRFQLLAGSTVGDGSAINWSASIKTHEPIIK  357

Query  1413  EWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRN  1234
             EWS+++KI +F S EY+ AMD VCKRIGVTE  + E  QNQ+LRKG + LGL VE+V RN
Sbjct  358   EWSVDRKIAIFSSEEYEMAMDKVCKRIGVTERLTGEEFQNQILRKGGKKLGLDVETVARN  417

Query  1233  CSE-KHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR----  1069
              S  KH CGSC +GC TGDK   D T+L+DAVN  AVILT   AEK ILE +   +    
Sbjct  418   YSSWKHECGSCAFGCTTGDKNSTDRTWLIDAVNYNAVILTQRMAEKLILEGNSVEQRWER  477

Query  1068  ---KKCLGV----IAKSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHL  910
                K+CL V       SK   + L+I A+ TV ACGSL TP +L+ S LKN NIG NLHL
Sbjct  478   GRXKRCLEVRTFFFFLSKETERRLQINAKVTVLACGSLNTPYMLLLSWLKNPNIGRNLHL  537

Query  909   HPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV-SEGTKQAAIIEAVSLGPAG--FAAV  739
             HP+L AWGYFPE   +  G+ H+G IITS+H VV  E     A+++  +L PA   FAA+
Sbjct  538   HPILMAWGYFPEENXKFRGRAHEGEIITSMHIVVPDESAAPKAMLQTPALAPAPGMFAAL  597

Query  738   SPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQAL  559
              PW  G DMKERM KY+RT +IF++VRD  SG+VK    I Y++ + D++N+   ++ A 
Sbjct  598   LPWVXGSDMKERMAKYARTSHIFALVRDESSGEVKLKDIINYKLIKTDQENLALAVKWAQ  657

Query  558   RILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQM  379
             R LVAAGA EVGT+ S+G ++ CKGI  E+ E FL  V   GGP+S  +NW    SA QM
Sbjct  658   RTLVAAGAEEVGTYSSEGXRLRCKGIHEEDREKFLRTVSVAGGPVSTSKNWCRSISASQM  717

Query  378   GSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLA  205
             GSCRMG TE++G +D  GE WEA+ L VCD SVLP+A+G NPM+TI ST+YCIS+ +A
Sbjct  718   GSCRMGNTEKEGTVDGYGESWEAESLXVCDSSVLPTALGDNPMVTIQSTSYCISSRIA  775



>tpg|DAA49654.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=590

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/590 (56%), Positives = 428/590 (73%), Gaps = 25/590 (4%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHVDTNEVPPDQ------QTGRPLEKGIIETINENGTTLKESLIKKG  1738
             +EN  NP W+AIG+ VD  E   D+         RPL+ G++ET   +   L  SL+ +G
Sbjct  4     NENSENPYWKAIGYSVD--EPREDRARTATPSPSRPLDVGVVETRLLDDNKLLRSLVGRG  61

Query  1737  LNVT-ESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLE  1561
             L V   S +AN  T++CD VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF +EDYS +E
Sbjct  62    LTVKPASSDANHHTVQCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTAEDYSSIE  121

Query  1560  GPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLF  1381
             GPS+  L+E GG+  T++   M+F G  VGGGSA+NWSASI+TP  V  EW+ E  +P+F
Sbjct  122   GPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASIRTPEEVTQEWAREHGLPVF  181

Query  1380  GSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCG  1201
              S  Y  AMDAVC R+GVT+ C +EG QN+V+R+GCE LGL  ++VPRN S+ H+CGSC 
Sbjct  182   ASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRRGCEALGLCADAVPRNSSDAHFCGSCN  241

Query  1200  YGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDE------TARKKCLGVIA--  1045
             +GC TGDK+G DTT+LVDAV  GAVILTGC+AE F+LE++          KKC+G++A  
Sbjct  242   FGCPTGDKRGTDTTWLVDAVARGAVILTGCKAEYFVLEKNHSSGSGSGRGKKCVGLVATC  301

Query  1044  KSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA  865
              S G  K LRIEA+ +++ACG+L TPPLL  SGLKN++IGSNLHLHPV  AWGYFPE+  
Sbjct  302   ASNGVTKKLRIEAKVSIAACGALMTPPLLRRSGLKNRHIGSNLHLHPVSMAWGYFPENKQ  361

Query  864   E--MEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKY  691
             +  + GK ++GGIITS+H+V         IIE  +LGP  FAA+ PW SG DMKERMR+Y
Sbjct  362   DPPLSGKCYEGGIITSMHRVTDR-----TIIETPALGPGAFAAMVPWESGRDMKERMRRY  416

Query  690   SRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRS  511
             SRT + F++VRD G G V   GR+++   + D D +R GLR+ LRILVAAGAAEVGT RS
Sbjct  417   SRTAHAFALVRDRGVGFVDGEGRVRFTPSREDVDELRNGLRRVLRILVAAGAAEVGTHRS  476

Query  510   DGQKICCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAID  334
             DG ++ CKG++ E+LE FLD V    GPM S  + W L+CSAHQMGSCRMG++ +DGA+D
Sbjct  477   DGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWALHCSAHQMGSCRMGSSPKDGAVD  536

Query  333   NNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
               GE WEA+GLYVCDGS+LP+A+GVNPMITI S A+C+S G+A+++  G+
Sbjct  537   GRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCLSKGIAETMAQGQ  586



>ref|XP_003607656.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1, partial [Medicago truncatula]
Length=584

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/576 (55%), Positives = 422/576 (73%), Gaps = 14/576 (2%)
 Frame = -3

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             VAE++++  + +AV + R++L +L+TRLG+LL+CG +C   +WPFI+NFS L L +RE I
Sbjct  3     VAEMLVKSGVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKI  62

Query  1995  LLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDT-NEVPPDQQT  1819
             + +  +   + P R+ F  IK+ C F++FSW DEN +NPAW+AIG+ V T +E   +   
Sbjct  63    VQRALKLRFLTPFRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIGYEVSTADEKMTNDTK  122

Query  1818  GRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaav  1639
              RPLEKGIIE ++E+ TTL++SL  KGLNVT     N L I+CD V+VGSGCGGGVAA+V
Sbjct  123   KRPLEKGIIEIMHEHDTTLQQSLSNKGLNVTLDSKNNILKIKCDAVVVGSGCGGGVAASV  182

Query  1638  lANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSA  1459
             L+ +G+KVVVLEKG+YFV +DYS LEGPS+ + YE+GG+L + D ++++ AG+ VGGGSA
Sbjct  183   LSKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYENGGILASIDSRILILAGSTVGGGSA  242

Query  1458  INWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRK  1279
             +NWSA IKTP  VL EWS + K+ LF S EY SAM+ VC+RIGV E C++EG QNQVLRK
Sbjct  243   VNWSACIKTPEKVLKEWSEKHKLSLFDSIEYLSAMETVCERIGVNENCTQEGFQNQVLRK  302

Query  1278  GCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEK  1099
             GC+NLGLKV+ VPRN    HYCGSCGYGC  G+K+G   T+LVDAV+ GAVI+TGC+AE+
Sbjct  303   GCQNLGLKVDYVPRNSPGNHYCGSCGYGCPKGEKQGTQATWLVDAVDKGAVIITGCKAER  362

Query  1098  FILEE-----DETARKKCLGVIAKS--KGNNKILRIEARATVSACGSLFTPPLLISSGL-  943
             F+ E      +    KKCLGV+AK+   G    L+ EA+ T+SA G+L TPPL+ISSGL 
Sbjct  363   FLFENNYRNANTRKNKKCLGVLAKTLNSGVTMKLQFEAKVTISAGGALLTPPLMISSGLT  422

Query  942   KNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV-----VSEGTKQAAII  778
             KNKNIG NLHLHPVL  WGYFPES ++ +GK ++GGIITS+H+V         +   AII
Sbjct  423   KNKNIGRNLHLHPVLMTWGYFPESKSDFKGKANEGGIITSVHRVPSSSNDDSISDTRAII  482

Query  777   EAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQI  598
             E   LGP+ F+A+ PW SGLD K+RM  Y RT +  +++RD   GQV    RI Y+++ I
Sbjct  483   ETPLLGPSSFSALYPWESGLDYKQRMLNYPRTAHFITIIRDKAGGQVTTERRISYKLNSI  542

Query  597   DKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICC  490
             DK+N+R G++QALRIL+AAGA EVGT RS GQ+I C
Sbjct  543   DKENMRAGIQQALRILIAAGAVEVGTHRSGGQRIKC  578



>gb|EEE57396.1| hypothetical protein OsJ_07570 [Oryza sativa Japonica Group]
Length=1066

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/735 (49%), Positives = 467/735 (64%), Gaps = 72/735 (10%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGG-------RRNSYNHGLSSSQYQALAAICEALIPPIP--------  2254
             + +   R+ HPLLRGG       RR  Y HG S+SQ  ALAA+C AL P +P        
Sbjct  5     KSQQRRRQGHPLLRGGGAGKQAGRR--YTHGFSASQMVALAALCGALAPSLPPDTRDDDD  62

Query  2253  ---------LPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILS  2101
                          SD +A+  F  +SA+ PP PDEVAE+  R  L +A+ + R VL +L 
Sbjct  63    DDAGGGRYGGAGPSDAKAVRDFLLASAADPPVPDEVAELNPRMCLREALALVRAVLWLLG  122

Query  2100  TRLGSLLLCGFVCFD-GRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIAC  1924
             TRLG+L LCG  C   GRWPF+  F+E+P++RRE  L +WSR T++ PLR  F+ +K+ C
Sbjct  123   TRLGTLALCGGRCVSWGRWPFVLTFAEMPVERREEALGRWSRVTVLPPLRAFFLVVKVFC  182

Query  1923  YFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQT---GRPLEKGIIETINENGTTLKES  1753
              ++++SW DE+  NP W AIG+   T+E P ++ T    RPL+ G++ETIN    +L  S
Sbjct  183   LYVFYSWIDESSENPHWRAIGYSPPTDEPPAEEHTEATKRPLDDGVVETINLTDASLPSS  242

Query  1752  LIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDY  1573
             L +KGL VT+    N   + CDV IVGSGCGGGVAAAVLA +GHKVVV+EKG+YF S DY
Sbjct  243   LAEKGLAVTDDAARNVCRVECDVAIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTSRDY  302

Query  1572  SGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQK  1393
             +  EGPS+ +LYESGG +TT +G  ++ AG+ VGGGSA+NWSA +KTP  V  EW+    
Sbjct  303   TSFEGPSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAVNWSACLKTPEFVRREWAAAHG  362

Query  1392  IPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYC  1213
             +PLF + +Y +AMD V +R+GVT  C++EGLQN+VLRKGCE LG KV++V RN SE HYC
Sbjct  363   LPLFATPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKGCEKLGYKVDAVARNSSEGHYC  422

Query  1212  GSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETARKKCLGVIAKSKG  1033
             GSCG+GCRTGDK+G DTT+LVDAV  GAVILTGC+AEK +LE      ++C+GV+A+S  
Sbjct  423   GSCGFGCRTGDKRGTDTTWLVDAVGRGAVILTGCKAEKLVLERGGARGRRCVGVVARST-  481

Query  1032  NNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEG  853
             N  I +   R                 SGL N +IG NLHLHP   AWGYFP++M +++G
Sbjct  482   NPAITKTLER-----------------SGLTNPHIGKNLHLHPTALAWGYFPDTMPDLKG  524

Query  852   KNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNI  673
             K  Q G   ++ +    G          S  P G    SPW+                  
Sbjct  525   KALQ-GRNHNVDEPRCPGCPGETRRSGCSGSP-GRCTSSPWSG-----------------  565

Query  672   FSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKIC  493
                  D GSG V    R+ YR+D  D+++IR GLR+ALR+LVAAGAAEVGT RSDGQ++ 
Sbjct  566   -----DRGSGTVHGERRVAYRLDAADREDIRDGLRRALRVLVAAGAAEVGTHRSDGQRLR  620

Query  492   CKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWE  313
             C+G+  E LE FLDGV    GP S  E W L+CSAH MGSCRMGAT  DGA+D  GE WE
Sbjct  621   CEGLTEEALEEFLDGVTVVRGPQSRSETWGLFCSAHHMGSCRMGATAGDGAVDARGESWE  680

Query  312   AKGLYVCDGSVLPSA  268
             A+ LYVCDGSVLP+A
Sbjct  681   AERLYVCDGSVLPTA  695


 Score =   424 bits (1091),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 213/373 (57%), Positives = 262/373 (70%), Gaps = 15/373 (4%)
 Frame = -3

Query  1278  GCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEK  1099
             GCE LG KV++V RN SE HYCGSCG+GCRTGDK+G DTT+LVDAV  GAVILTGC+AEK
Sbjct  696   GCEKLGYKVDAVARNSSEGHYCGSCGFGCRTGDKRGTDTTWLVDAVGRGAVILTGCKAEK  755

Query  1098  FILEEDETARKKCLGVIAKSKGNNKILRIE------ARA--TVSACGSLFTPPLLISSGL  943
              +LE     R    G   + +G  +    +      AR      A GSL TP LL  SGL
Sbjct  756   LVLE-----RGGAKGQAVRRRGGQEHQPGDHEDAGGARQGDPFRAAGSLLTPVLLQRSGL  810

Query  942   KNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGT--KQAAIIEAV  769
              N +IG NLHLHP   AWGYFP++M +++GK ++GGIITS+HKV + G      AI+E  
Sbjct  811   TNPHIGKNLHLHPTALAWGYFPDTMPDLKGKAYEGGIITSMHKVETSGAGAPHRAILETP  870

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
              +  A      PW SG D KERM +++RTV+IFS+VRD GSG V    R+ YR+D  D++
Sbjct  871   MMAVAATGTQMPWLSGRDSKERMLRFARTVHIFSLVRDRGSGTVHGERRVAYRLDAADRE  930

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEEN  409
             +IR GLR+ALR+LVAAGAAEVGT RSDGQ++ C+G+  E LE FLDGV    GP S  E 
Sbjct  931   DIRDGLRRALRVLVAAGAAEVGTHRSDGQRLRCEGLTEEALEEFLDGVTVVRGPQSRSET  990

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
             W L+CSAH MGSCRMGAT  DGA+D  GE WEA+ LYVCDGSVLP+A+GVNPMITI S A
Sbjct  991   WGLFCSAHHMGSCRMGATAGDGAVDARGESWEAERLYVCDGSVLPTAVGVNPMITIQSVA  1050

Query  228   YCISNGLAKSLNS  190
             YC++NG+A SL++
Sbjct  1051  YCLANGIADSLSA  1063



>gb|EMT04470.1| Putative GMC-type oxidoreductase [Aegilops tauschii]
Length=865

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/671 (51%), Positives = 460/671 (69%), Gaps = 22/671 (3%)
 Frame = -3

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             VAE+ ++R   +A  + R VL  LST+ G+L+LCG +C       I  F+ +PL+R+E  
Sbjct  204   VAELAVKRCPWEATTLLRAVLWALSTKAGTLVLCGRLCISDE---IRRFAHMPLERKEEA  260

Query  1995  LLKWSRET-LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQT  1819
             L KWS+ +  +LP RI F+  K+ C +++++  DENY+NP+W+AIG+ V   E    ++ 
Sbjct  261   LKKWSKASWFLLPTRIAFVIFKMLCQYVFYTKVDENYDNPSWKAIGYGVKKVEEQWQKRP  320

Query  1818  --GRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaa  1645
                RPL+KG++ T   N  T   S+ +KGL V    N    T+ CDVVI GSGCGGGVAA
Sbjct  321   RRPRPLDKGVLNTKELNDQTFLRSVTEKGLAVKPGTN-QYHTVECDVVIAGSGCGGGVAA  379

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
             AVLA++G KVVV+EKG YF+++DYSG+EGPS+ +LYE+GG+L T+D    + +G  VGGG
Sbjct  380   AVLASAGLKVVVVEKGDYFIADDYSGIEGPSMEQLYENGGILFTSDATTALLSGATVGGG  439

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWSASI+TP +VL EWS    + LF SS Y+ AMDAVCKR+GVT  C +EG QN+VL
Sbjct  440   SAVNWSASIRTPEDVLQEWSQHHGLGLFRSSRYEQAMDAVCKRLGVTARCREEGFQNKVL  499

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQA  1105
             R+GC+ LG+ V++VPRN  E    G    G  TG+++G DTT+LVDAV +GAVILTGC A
Sbjct  500   RRGCKALGIPVQAVPRNSPEGQRGGGGACGPPTGERRGTDTTWLVDAVAHGAVILTGCNA  559

Query  1104  EKFILEEDETARK-----KCLGVIAK--SKGNNKILRIEARATVSACGSLFTPPLLISSG  946
              +FILE+     K     KC G++AK  + G  K LRI A+A++SACG+L TPPLL  SG
Sbjct  560   HQFILEKSTRPGKAGRSSKCTGLVAKCMNSGITKKLRIMAKASISACGALMTPPLLRKSG  619

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVS  766
             LKNK+IG NL+LHP   AWGYFPE    + GK +QGG+ITS+H+V      +  +IE  +
Sbjct  620   LKNKHIGRNLYLHPASMAWGYFPEDT--VTGKCYQGGVITSMHRVT-----ERTVIETPA  672

Query  765   LGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDN  586
             L P  FA V PW SG DMK RM +Y+RT ++ ++VRD G G V   GR+++     D   
Sbjct  673   LAPGMFATVMPWVSGRDMKHRMLRYARTAHLVALVRDRGQGFVDGVGRVRFTPSPDDTRE  732

Query  585   IRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS-GEEN  409
             + + LR+ALRILVAAGAAEVG  RSDG ++ CKG+  E+LE+FL GV    GP+    + 
Sbjct  733   LCSALRRALRILVAAGAAEVGIHRSDGLRLGCKGVGDEDLEAFLAGVTIEKGPLHFATDK  792

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
             W +  SAHQMGSCRM +   DGA+D++GE WEA+GLYV D SVLP+AIG+NPMITI S A
Sbjct  793   WGILGSAHQMGSCRMASNNRDGAVDSSGESWEAEGLYVSDASVLPTAIGINPMITIQSVA  852

Query  228   YCISNGLAKSL  196
             YCIS+ +A S 
Sbjct  853   YCISHDIAMSF  863



>ref|XP_002464494.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
 gb|EER91492.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
Length=587

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/587 (55%), Positives = 424/587 (72%), Gaps = 20/587 (3%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHV-----DTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGL  1735
             +EN  NP W+AIG+ V     D           RPL+ G++ET   N   L  SL+ +GL
Sbjct  4     NENSENPYWKAIGYSVYEPREDVTRTEATPSPSRPLDVGVVETRLLNDNALLRSLVGRGL  63

Query  1734  NVT-ESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
              V   + +AN  T++CD VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF ++DYS +EG
Sbjct  64    TVKPAASDANHHTVQCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTADDYSSIEG  123

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
             PS+  L+E GG+  T++   M+F G  VGGGSA+NWSA I+TP  V  EW+ E  +P+F 
Sbjct  124   PSMERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSACIRTPEEVTQEWAREHGLPVFA  183

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S  Y  AMDAVC R+ VT+ C +EG QN+V+R+GCE LGL  ++VPRN S+ H+CGSC +
Sbjct  184   SPGYVQAMDAVCARLAVTDGCREEGFQNKVVRRGCEALGLCADAVPRNSSDGHFCGSCNF  243

Query  1197  GCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA----RKKCLGVIA--KSK  1036
             GC TGDK+G DTT+LVDAV  GAVILTGC+AE F+ E++ +      KKC+G++A   S 
Sbjct  244   GCPTGDKRGTDTTWLVDAVARGAVILTGCKAEHFVFEKNRSGVSGRGKKCVGLVATCASN  303

Query  1035  GNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE--  862
             G  K LRIEA+ +++ACG+L TPPLL +SGLKN++IGSNLHLHPV  AWGYFPE+  +  
Sbjct  304   GVTKKLRIEAKVSIAACGALMTPPLLRNSGLKNRHIGSNLHLHPVSMAWGYFPENKQDPP  363

Query  861   MEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRT  682
             + GK  +GGIITS+H+V      +  IIE  +LGP  FAA+ PW SG DMKERMR+YSRT
Sbjct  364   LPGKCFEGGIITSMHRVT-----ERTIIETPALGPGAFAAMVPWESGRDMKERMRRYSRT  418

Query  681   VNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQ  502
              + F++VRD G G V   GR+++   + D + +R GLR+ LRILVAAGA EVGT RSDG 
Sbjct  419   AHAFALVRDRGVGYVDGEGRVRFTPSREDIEELRNGLRRTLRILVAAGAVEVGTHRSDGL  478

Query  501   KICCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNG  325
             ++ CKG++ E+LE+FLD V    GPM S  + W L+CSAHQMGSCRMG++ +DGA+D  G
Sbjct  479   RLRCKGLRDEDLEAFLDEVTIEKGPMHSRTDKWALHCSAHQMGSCRMGSSPKDGAVDGRG  538

Query  324   ECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             E WEA+GLYVCDGS+LP+A+GVNPMITI S A+C+S G+A+++  GK
Sbjct  539   ESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCLSKGIAETMAQGK  585



>ref|NP_001064839.2| Os10g0474800 [Oryza sativa Japonica Group]
 dbj|BAF26753.2| Os10g0474800 [Oryza sativa Japonica Group]
Length=614

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/598 (56%), Positives = 424/598 (71%), Gaps = 30/598 (5%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHVDTNEVPPDQQTG---------------RPLEKGIIETINENGTT  1765
             DEN  NP+W+AIG+ V   E  P ++                 RPL+ G++ET   +   
Sbjct  4     DENLENPSWKAIGYSVPAAEEEPQKEEPTEATPTPAPATAPPCRPLDNGVVETKQLDDNA  63

Query  1764  LKESLIKKGLNV---TESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGH  1594
             L  SL +KGL +     S +A+  T+ CD V+VGSGCGGGVAAAVLA++G+KVVV+EKG 
Sbjct  64    LLMSLAEKGLALKTGASSPSAHHHTVLCDAVVVGSGCGGGVAAAVLASAGYKVVVVEKGD  123

Query  1593  YFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLN  1414
             YF + DYS LEGP++  LYE+GG+ +T +    +FAG  VGGGSA+NWSA I+TP NVL 
Sbjct  124   YFAARDYSSLEGPTMERLYENGGVFSTANVTTTMFAGATVGGGSAVNWSACIRTPANVLQ  183

Query  1413  EWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRN  1234
             EWS +  +PLFG   Y  AMDAVC R+GVT  C +EG QN+ +R+GCE LGL+VE+V RN
Sbjct  184   EWSNDHGLPLFGGQGYVQAMDAVCARLGVTGRCREEGFQNKAVRRGCEALGLRVEAVSRN  243

Query  1233  CSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEED----ETARK  1066
              SE H+CGSC  GC TG+K+G DTT+LVDAV  GAVILTGC+AE+FILE +       RK
Sbjct  244   SSEGHFCGSCNLGCPTGEKRGTDTTWLVDAVGRGAVILTGCKAERFILETNTGGGGGRRK  303

Query  1065  KCLGVIAK--SKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFA  892
             KC+GV+AK   KG  K LRIEA+ +VSACG+L TPPLL +SGLKN++IG NLHLHPV  A
Sbjct  304   KCVGVVAKCLGKGITKKLRIEAKVSVSACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMA  363

Query  891   WGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDM  712
             WGYFP+S AE+ GK+++GGIITS+H+V         IIE  +LGP  FAAV PW SG DM
Sbjct  364   WGYFPDSTAELPGKSYEGGIITSMHRVTDR-----TIIETPALGPGAFAAVVPWESGRDM  418

Query  711   KERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAA  532
             KERMR+Y+RT +   +VRD  +G V   GR+++   + D   +R GLR+ALRILVAAGAA
Sbjct  419   KERMRRYARTAHAVVLVRDRAAGTVGGEGRVRFTPSRGDAGELRAGLRRALRILVAAGAA  478

Query  531   EVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS-GEENWTLYCSAHQMGSCRMGAT  355
             EVGT RSDG ++ CKG + E++E+FLD V    GPM  G + W L  SAHQMGSCRMG +
Sbjct  479   EVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPMHPGSDKWALLASAHQMGSCRMGRS  538

Query  354   EEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
              + G +D  GE WEA+GLYVCDGS+LP+A+GVNPMITI S AYC++ G+A+SL S  A
Sbjct  539   AKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCVAKGIAESLASRAA  596



>gb|AAL31021.1|AC078948_5 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=590

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/589 (56%), Positives = 423/589 (72%), Gaps = 22/589 (4%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHVD---------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLI  1747
             +EN  NP W+AIG+ V+              P   + RPL+ G++ET     TTL  SL 
Sbjct  4     NENSENPYWKAIGYRVEEPRRDRAESMPSPSPSPVSRRPLDNGVVETRALTDTTLLRSLA  63

Query  1746  KKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSG  1567
              KGL V    +    T+RCD VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF  EDYS 
Sbjct  64    AKGLAVRPGASDEHHTVRCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTKEDYSS  123

Query  1566  LEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIP  1387
             +EGPS+  L+E GG+  T++   M+F G  VGGGSA+NWSASI+TP  V+ EWS E  + 
Sbjct  124   IEGPSMERLFERGGVFCTSNVTTMIFTGATVGGGSAVNWSASIRTPAGVMQEWSREHGLA  183

Query  1386  LFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGS  1207
             +F S  Y  AMDAVC+R+GVT+ C +EG QN+V+R+GC+ LGL+ ++VPRN SE H+CGS
Sbjct  184   VFASPGYARAMDAVCERLGVTDACREEGFQNKVVRRGCDALGLRADAVPRNSSEGHFCGS  243

Query  1206  CGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAK--  1042
             C +GC TGDKKG DTT+LVDAV  GAVILTGC+AE FI+E +       K+C+G++A   
Sbjct  244   CNFGCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFIVESNGGGGGRSKRCVGLVATCM  303

Query  1041  SKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE  862
             S G  K LR+EA+ ++SA G+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP++  E
Sbjct  304   SNGITKKLRVEAKVSISASGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDNTPE  363

Query  861   --MEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYS  688
               + GK ++GGIITS+H+V      +  IIE  +LGP  FAA+ PW SG DMKERMR+Y+
Sbjct  364   PHIPGKCYEGGIITSMHRVT-----ERTIIETPALGPGAFAALVPWESGRDMKERMRRYA  418

Query  687   RTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSD  508
             RT + F++VRD G+G V   GR++Y   + D + +R GLR+ALRILVAAGAAEVGT RSD
Sbjct  419   RTAHAFALVRDRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSD  478

Query  507   GQKICCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDN  331
             G ++ CKG +  ++E+FLD V    GPM S  + W++ CSAHQMGSCRMGA+  DGA+D 
Sbjct  479   GARLRCKGARDADVEAFLDEVTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGAVDV  538

Query  330   NGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
              GE WEA+GLYVCDGS+LP+A+GVNPMITI S AYC++ G+A S+  GK
Sbjct  539   AGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCVAKGIADSMAHGK  587



>gb|AAL31049.1|AC078893_12 putative oxidase [Oryza sativa Japonica Group]
 gb|ABB47786.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=595

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/592 (55%), Positives = 424/592 (72%), Gaps = 22/592 (4%)
 Frame = -3

Query  1908  SWTDENYNNPAWEAIGFHVD---------TNEVPPDQQTGRPLEKGIIETINENGTTLKE  1756
             S  +EN  NP W+AIG+ V+              P   + RPL+ G++ET     TTL  
Sbjct  6     SMVNENSENPYWKAIGYRVEEPRRDRAESMPSPSPSPVSRRPLDNGVVETRALTDTTLLR  65

Query  1755  SLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSED  1576
             SL  KGL V    +    T+RCD VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF  ED
Sbjct  66    SLAAKGLAVRPGASDEHHTVRCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTKED  125

Query  1575  YSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQ  1396
             YS +EGPS+  L+E GG+  T++   M+F G  VGGGSA+NWSASI+TP  V+ EWS E 
Sbjct  126   YSSIEGPSMERLFERGGVFCTSNVTTMIFTGATVGGGSAVNWSASIRTPAGVMQEWSREH  185

Query  1395  KIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHY  1216
              + +F S  Y  AMDAVC+R+GVT+ C +EG QN+V+R+GC+ LGL+ ++VPRN SE H+
Sbjct  186   GLAVFASPGYARAMDAVCERLGVTDACREEGFQNKVVRRGCDALGLRADAVPRNSSEGHF  245

Query  1215  CGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIA  1045
             CGSC +GC TGDKKG DTT+LVDAV  GAVILTGC+AE FI+E +       K+C+G++A
Sbjct  246   CGSCNFGCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFIVESNGGGGGRSKRCVGLVA  305

Query  1044  K--SKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPES  871
                S G  K LR+EA+ ++SA G+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP++
Sbjct  306   TCMSNGITKKLRVEAKVSISASGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDN  365

Query  870   MAE--MEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMR  697
               E  + GK ++GGIITS+H+V      +  IIE  +LGP  FAA+ PW SG DMKERMR
Sbjct  366   TPEPHIPGKCYEGGIITSMHRVT-----ERTIIETPALGPGAFAALVPWESGRDMKERMR  420

Query  696   KYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTF  517
             +Y+RT + F++VRD G+G V   GR++Y   + D + +R GLR+ALRILVAAGAAEVGT 
Sbjct  421   RYARTAHAFALVRDRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTH  480

Query  516   RSDGQKICCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGA  340
             RSDG ++ CKG +  ++E+FLD V    GPM S  + W++ CSAHQMGSCRMGA+  DGA
Sbjct  481   RSDGARLRCKGARDADVEAFLDEVTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGA  540

Query  339   IDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             +D  GE WEA+GLYVCDGS+LP+A+GVNPMITI S AYC++ G+A S+  GK
Sbjct  541   VDVAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCVAKGIADSMAHGK  592



>ref|XP_003590828.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=576

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/576 (56%), Positives = 414/576 (72%), Gaps = 45/576 (8%)
 Frame = -3

Query  1917  IYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKG  1738
             + F + DEN  N AWEAIG+HVD +E   + Q  RPLEKGI+E +NE+  +L +SL  KG
Sbjct  35    LMFLFYDENGENQAWEAIGYHVDNDESTSNIQKERPLEKGIVEAMNEDDLSLAQSLSNKG  94

Query  1737  LNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
             L +    N+N L ++CDVVIVGSGCGGGVAAAVLA+SG K+ +LE              G
Sbjct  95    LEIDIDANSNILKVKCDVVIVGSGCGGGVAAAVLASSGLKIFLLE--------------G  140

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
              SL ELYE GG   T+DGK+++ AG+ +GGGSA+NWSASIKTP+ VL +WS    +PLF 
Sbjct  141   SSLNELYEQGGTFATSDGKIVLLAGSTIGGGSAVNWSASIKTPDYVLTDWSENHNLPLFS  200

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S EY  AMD VC+RI VT+ C  EGLQNQVLRKGC  LGL+V+ VPRN SE HYCG+   
Sbjct  201   SQEYLYAMDTVCERISVTDTCVVEGLQNQVLRKGCNELGLQVDYVPRNSSEHHYCGT---  257

Query  1197  GCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNN  1027
                       D T+LVDAV +GAVILT C+AEKFILE ++     RKKCLGV+AK     
Sbjct  258   ----------DVTWLVDAVEHGAVILTRCKAEKFILENNKEGCVRRKKCLGVMAK-----  302

Query  1026  KILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKN  847
                     AT+S+CG+L TPPL+ISSGLKNKNIG +LHLHPVL  WG+FP++M++++GK+
Sbjct  303   --------ATISSCGALSTPPLMISSGLKNKNIGRHLHLHPVLMTWGHFPDTMSDLKGKS  354

Query  846   HQGGIITSIHKVVSEG-TKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIF  670
             ++GGIITS+HKV+S+  +K  AIIE  SLGP  F+ + PW SG D KERM +YSRTV+  
Sbjct  355   YEGGIITSVHKVLSDDDSKVRAIIETPSLGPGAFSTMIPWESGFDFKERMLRYSRTVHFI  414

Query  669   SMVRDHGSGQVKKAGRIQYRMDQ-IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKIC  493
             ++++D G G+VK  GRI Y +D+  DK+N++ GL++ALRIL+AAGA EVGT RSDGQ+I 
Sbjct  415   TIIQDKGCGEVKSEGRINYELDEEFDKENMKHGLQRALRILIAAGAVEVGTHRSDGQRIV  474

Query  492   CKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWE  313
             C G    EL  F++ V A  GPMS +E W +Y SAHQMGSCR+G T+++G +D NG+ WE
Sbjct  475   CSGTNEMELNKFVESVYAAEGPMSHQETWNMYASAHQMGSCRIGITDKEGTVDENGQNWE  534

Query  312   AKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLA  205
             A+GL+VCD S+ P+AIG+NPMITI S AYC++  +A
Sbjct  535   AEGLFVCDASLFPTAIGINPMITIQSIAYCVAKRIA  570



>gb|AES61079.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=538

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/570 (56%), Positives = 411/570 (72%), Gaps = 45/570 (8%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTES  1720
             DEN  N AWEAIG+HVD +E   + Q  RPLEKGI+E +NE+  +L +SL  KGL +   
Sbjct  3     DENGENQAWEAIGYHVDNDESTSNIQKERPLEKGIVEAMNEDDLSLAQSLSNKGLEIDID  62

Query  1719  QNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGEL  1540
              N+N L ++CDVVIVGSGCGGGVAAAVLA+SG K+ +LE              G SL EL
Sbjct  63    ANSNILKVKCDVVIVGSGCGGGVAAAVLASSGLKIFLLE--------------GSSLNEL  108

Query  1539  YESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQS  1360
             YE GG   T+DGK+++ AG+ +GGGSA+NWSASIKTP+ VL +WS    +PLF S EY  
Sbjct  109   YEQGGTFATSDGKIVLLAGSTIGGGSAVNWSASIKTPDYVLTDWSENHNLPLFSSQEYLY  168

Query  1359  AMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGD  1180
             AMD VC+RI VT+ C  EGLQNQVLRKGC  LGL+V+ VPRN SE HYCG+         
Sbjct  169   AMDTVCERISVTDTCVVEGLQNQVLRKGCNELGLQVDYVPRNSSEHHYCGT---------  219

Query  1179  KKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGNNKILRIE  1009
                 D T+LVDAV +GAVILT C+AEKFILE ++     RKKCLGV+AK           
Sbjct  220   ----DVTWLVDAVEHGAVILTRCKAEKFILENNKEGCVRRKKCLGVMAK-----------  264

Query  1008  ARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGII  829
               AT+S+CG+L TPPL+ISSGLKNKNIG +LHLHPVL  WG+FP++M++++GK+++GGII
Sbjct  265   --ATISSCGALSTPPLMISSGLKNKNIGRHLHLHPVLMTWGHFPDTMSDLKGKSYEGGII  322

Query  828   TSIHKVVSEG-TKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDH  652
             TS+HKV+S+  +K  AIIE  SLGP  F+ + PW SG D KERM +YSRTV+  ++++D 
Sbjct  323   TSVHKVLSDDDSKVRAIIETPSLGPGAFSTMIPWESGFDFKERMLRYSRTVHFITIIQDK  382

Query  651   GSGQVKKAGRIQYRMDQ-IDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKT  475
             G G+VK  GRI Y +D+  DK+N++ GL++ALRIL+AAGA EVGT RSDGQ+I C G   
Sbjct  383   GCGEVKSEGRINYELDEEFDKENMKHGLQRALRILIAAGAVEVGTHRSDGQRIVCSGTNE  442

Query  474   EELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYV  295
              EL  F++ V A  GPMS +E W +Y SAHQMGSCR+G T+++G +D NG+ WEA+GL+V
Sbjct  443   MELNKFVESVYAAEGPMSHQETWNMYASAHQMGSCRIGITDKEGTVDENGQNWEAEGLFV  502

Query  294   CDGSVLPSAIGVNPMITILSTAYCISNGLA  205
             CD S+ P+AIG+NPMITI S AYC++  +A
Sbjct  503   CDASLFPTAIGINPMITIQSIAYCVAKRIA  532



>gb|EAY78905.1| hypothetical protein OsI_34008 [Oryza sativa Indica Group]
Length=564

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/549 (58%), Positives = 402/549 (73%), Gaps = 15/549 (3%)
 Frame = -3

Query  1797  IIETINENGTTLKESLIKKGLNV---TESQNANTLTIRCDvvivgsgcgggvaaavlANS  1627
             ++ET   +   L  SL +KGL +     S +A+  T+ CD V+VGSGCGGGVAAAVLA++
Sbjct  3     VVETKQLDDNALLMSLAEKGLALKTGASSPSAHHHTVLCDAVVVGSGCGGGVAAAVLASA  62

Query  1626  GHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWS  1447
             G+KVVV+EKG YF + DYS LEGP++  LYE+GG+ +T +    +FAG  VGGGSA+NWS
Sbjct  63    GYKVVVVEKGDYFAARDYSSLEGPTMERLYENGGVFSTANVTTTMFAGATVGGGSAVNWS  122

Query  1446  ASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCEN  1267
             A I+TP NVL EWS +  +PLFG   Y  AMDAVC R+GVT  C +EG QN+ +R+GCE 
Sbjct  123   ACIRTPANVLQEWSNDHGLPLFGGQGYVQAMDAVCARLGVTGRCREEGFQNKAVRRGCEA  182

Query  1266  LGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILE  1087
             LGL+VE+V RN SE H+CGSC  GC TG+K+G DTT+LVDAV  GAVILTGC+AE+FILE
Sbjct  183   LGLRVEAVSRNSSEGHFCGSCNLGCPTGEKRGTDTTWLVDAVGRGAVILTGCKAERFILE  242

Query  1086  ED----ETARKKCLGVIAKSKGN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNIG  925
              +       RKKC+GV+AK  GN   K LRIEA+ +VSACG+L TPPLL +SGLKN++IG
Sbjct  243   TNTGGGGGRRKKCVGVVAKCLGNGITKKLRIEAKVSVSACGALMTPPLLRNSGLKNRHIG  302

Query  924   SNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFA  745
              NLHLHPV  AWGYFP+S AE+ GK+++GGIITS+H+V         IIE  +LGP  FA
Sbjct  303   RNLHLHPVSMAWGYFPDSTAELPGKSYEGGIITSMHRVTDR-----TIIETPALGPGAFA  357

Query  744   AVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQ  565
             AV PW SG DMKERMR+Y+RT +   +VRD  +G V   GR+++   + D   +R GLR+
Sbjct  358   AVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTVGGEGRVRFTPSRGDAGELRAGLRR  417

Query  564   ALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMS-GEENWTLYCSA  388
             ALRILVAAGAAEVGT RSDG ++ CKG + E++E+FLD V    GPM  G + W L  SA
Sbjct  418   ALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPMHPGSDKWALLASA  477

Query  387   HQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGL  208
             HQMGSCRMG + + G +D  GE WEA+GLYVCDGS+LP+A+GVNPMITI S AYC++ G+
Sbjct  478   HQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCVAKGI  537

Query  207   AKSLNSGKA  181
             A+SL S  A
Sbjct  538   AESLASRAA  546



>ref|XP_006489751.1| PREDICTED: long-chain-alcohol oxidase FAO3-like, partial [Citrus 
sinensis]
Length=580

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/463 (61%), Positives = 361/463 (78%), Gaps = 6/463 (1%)
 Frame = -3

Query  1566  LEGPSLGELYESGGMLTTTDGKV-MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKI  1390
             LE   +  +YE+   +  +  +  ++ AG+ VGGGSA+NWSA IKTP ++L EW+ + K+
Sbjct  113   LEKGIVETMYETDSTIVQSLTQTSLLLAGSTVGGGSAVNWSACIKTPKSLLQEWAGQYKL  172

Query  1389  PLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCG  1210
             PLFGS +Y SAMD V +RIGVTE C +EG QNQVLRKGC+NLGL VE +PRN SE HYCG
Sbjct  173   PLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLRKGCKNLGLDVERIPRNSSENHYCG  232

Query  1209  SCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDE---TARKKCLGVIAKS  1039
             SCG+GC++GDKKG D+T+LVDAVN+GAVILTGC+AE+FILE+ +   T   KC GVIAK+
Sbjct  233   SCGHGCKSGDKKGTDSTWLVDAVNHGAVILTGCKAERFILEKSDNGSTRTMKCSGVIAKA  292

Query  1038  KGNNKILR--IEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA  865
               N+  ++  IE +AT+SACG+L TPPL+ISSGLKN++IG NLHLHPVL AWGYFP+S  
Sbjct  293   LNNDIRMKFQIETKATISACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNL  352

Query  864   EMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSR  685
             E +GKN++GGIITS HKVVS  ++  A+IE     PA F+   PW SG+D K+ M KYSR
Sbjct  353   EFKGKNYEGGIITSAHKVVSGDSEVRALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSR  412

Query  684   TVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDG  505
             T ++ +++RD GSG+VK  GRI +++DQ+DK+N++ GLRQALRIL+AAGA EVGT RSDG
Sbjct  413   TAHLITIIRDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRILIAAGAVEVGTHRSDG  472

Query  504   QKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNG  325
             Q++ C+GI  +E+E FLD V A  GP S  ENW +Y +AHQMGSCRMG  E++GA+D NG
Sbjct  473   QRLKCEGITKKEVEQFLDTVYAAEGPKSPVENWMVYGTAHQMGSCRMGVNEKEGAVDENG  532

Query  324   ECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             + WEA+GLYVCD SVLPSA+GVNPMITI STAYC+S  +A+SL
Sbjct  533   QSWEAEGLYVCDASVLPSAVGVNPMITIQSTAYCLSKRIAESL  575


 Score =   150 bits (378),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = -3

Query  2142  DAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLIL  1963
             + V + R+VL++LST+LG+L+LCG +C   +WP+I+NFS + L++RE +L KW +  +  
Sbjct  2     EGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKREKVLQKWFKNWIFT  61

Query  1962  PLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGRPLEKGIIETI  1783
             P+RI F  +KI C F++FS  DEN  NPAWEAI +HV+ +E   + Q  RPLEKGI+ET+
Sbjct  62    PVRIAFFILKIFCLFVFFSQLDENGKNPAWEAIDYHVENDEDESEVQQERPLEKGIVETM  121

Query  1782  NENGTTLKESLIKKGL  1735
              E  +T+ +SL +  L
Sbjct  122   YETDSTIVQSLTQTSL  137



>gb|EEE51131.1| hypothetical protein OsJ_31875 [Oryza sativa Japonica Group]
Length=611

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/629 (51%), Positives = 418/629 (66%), Gaps = 37/629 (6%)
 Frame = -3

Query  2022  LPLKRREAILLKWS-RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVD-  1849
             +P  RREA L +WS    L  PLRI F   KI C+++++S  +EN  NP W+AIG+ V+ 
Sbjct  1     MPAARREAALWRWSGARWLFFPLRIAFAIAKILCHYVFYSMVNENSENPYWKAIGYRVEE  60

Query  1848  --------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIR  1693
                          P   + RPL+ G++ET     TTL  SL  KGL V    +    T+R
Sbjct  61    PRRDRAESMPSPSPSPVSRRPLDNGVVETRALTDTTLLRSLAAKGLAVRPGASDEHHTVR  120

Query  1692  CDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTT  1513
             CD VIVGSGCGGGVAAAVLA++G+KVVV+EKG YF  EDYS +EGPS+  L+E GG+  T
Sbjct  121   CDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTKEDYSSIEGPSMERLFERGGVFCT  180

Query  1512  TDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRI  1333
             ++   M+F G  VGGGSA+NWSASI+TP  V+ EWS E  + +F S  Y  AMDAVC+R+
Sbjct  181   SNVTTMIFTGATVGGGSAVNWSASIRTPAGVMQEWSREHGLAVFASPGYARAMDAVCERL  240

Query  1332  GVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYL  1153
             GVT+ C +EG QN+V+R+GC+ LGL+ ++VPRN SE H+CGSC +GC TGDKKG DTT+L
Sbjct  241   GVTDACREEGFQNKVVRRGCDALGLRADAVPRNSSEGHFCGSCNFGCPTGDKKGTDTTWL  300

Query  1152  VDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAK--SKGNNKILRIEARATVSA  988
             VDAV  GAVILTGC+AE FI+E +       K+C+G++A   S G  K LR+EA+    A
Sbjct  301   VDAVERGAVILTGCKAEHFIVESNGGGGGRSKRCVGLVATCMSNGITKKLRVEAK---RA  357

Query  987   CGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKVV  808
                   P      G+    +    H  P              + GK ++GGIITS+H+V 
Sbjct  358   QEPPHRPEPAPPPGVHGVGLLPGQHAEP-------------HIPGKCYEGGIITSMHRVT  404

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
                  +  IIE  +LGP  FAA+ PW SG DMKERMR+Y+RTV+ F++VRD G+G V   
Sbjct  405   -----ERTIIETPALGPGAFAALVPWESGRDMKERMRRYARTVHAFALVRDRGAGSVDGE  459

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GR++Y   + D + +R GLR+ALRILVAAGAAEVGT RSDG ++ CKG +  ++E+FLD 
Sbjct  460   GRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLRCKGARDADVEAFLDE  519

Query  447   VVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
             V    GPM S  + W++ CSAHQMGSCRMGA+  DGA+D  GE WEA+GLYVCDGS+LP+
Sbjct  520   VTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPT  579

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             A+GVNPMITI S AYC++ G+A S+  GK
Sbjct  580   AVGVNPMITIQSIAYCVAKGIADSMAHGK  608



>gb|ACF87929.1| unknown [Zea mays]
Length=468

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/460 (58%), Positives = 336/460 (73%), Gaps = 7/460 (2%)
 Frame = -3

Query  1545  ELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEY  1366
              LYE GG ++T     ++ AG+ VGGG+A+NWSA IKTP++V  EW+ ++ +PLF + EY
Sbjct  3     HLYEGGGFVSTLSASALLLAGSTVGGGTAVNWSACIKTPDDVRGEWARDRGLPLFATGEY  62

Query  1365  QSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRT  1186
              +AMD V +R+GVT  C++EGLQN+VLRKGCE LG KVESV RN SE HYCGSCGYGCRT
Sbjct  63    AAAMDKVFERLGVTAGCAEEGLQNKVLRKGCERLGYKVESVSRNSSEGHYCGSCGYGCRT  122

Query  1185  GDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETA---RKKCLGVIAKSKGN--NKI  1021
             GDK+G D+T+LVDAV+ GAVILTGC+AEK +LE    A    K+C+GV+A+S      + 
Sbjct  123   GDKRGTDSTWLVDAVSRGAVILTGCKAEKLLLEPGSAADGRAKRCVGVVARSTNPAITRT  182

Query  1020  LRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQ  841
             L + AR TVSACGSL TP LL  SGL+N++IG NLHLHP    WGYFP+++ ++ G+ ++
Sbjct  183   LEVTARVTVSACGSLLTPVLLRGSGLRNRHIGKNLHLHPTALVWGYFPDTVPDLRGRMYE  242

Query  840   GGIITSIHKVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFS  667
             GGIITS+HKV     G    AI+EA ++G AG     PW SG DMKERM +Y RTV++FS
Sbjct  243   GGIITSLHKVEGGGPGAPARAILEAPAMGLAGAGTQFPWVSGRDMKERMLRYGRTVHLFS  302

Query  666   MVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCK  487
             MVRD GSG V    R+ Y +D  D++N+R G+R+ALR+L AAGAAE+GT RSDGQ+  C 
Sbjct  303   MVRDRGSGTVHGERRVAYHLDATDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACG  362

Query  486   GIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAK  307
             G     LE FLDGV    GP S  E WTL C+AHQMGSCRMGAT  DGA+D  GE WEA 
Sbjct  363   GATEAALEEFLDGVDVVRGPQSKAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAG  422

Query  306   GLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSG  187
              LYVCDGSVLP A+GVNPM+TI S AYC++ G+A+SL  G
Sbjct  423   SLYVCDGSVLPGAVGVNPMVTIQSVAYCLATGIAESLRRG  462



>gb|ACF88407.1| unknown [Zea mays]
Length=466

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/465 (57%), Positives = 343/465 (74%), Gaps = 16/465 (3%)
 Frame = -3

Query  1545  ELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEY  1366
              L+E GG+  T++   M+F G  VGGGSA+NWSASI+TP  V  EW+ E  +P+F S  Y
Sbjct  3     RLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASIRTPEEVTQEWAREHGLPVFASPGY  62

Query  1365  QSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRT  1186
               AMDAVC R+GVT+ C +EG QN+V+R+GCE LGL  ++VPRN S+ H+CGSC +GC T
Sbjct  63    AQAMDAVCARLGVTDGCQEEGFQNKVVRRGCEALGLCADAVPRNSSDAHFCGSCNFGCPT  122

Query  1185  GDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDE------TARKKCLGVIA--KSKGN  1030
             GDK+G DTT+LVDAV  GAVILTGC+AE F+LE++          KKC+G++A   S G 
Sbjct  123   GDKRGTDTTWLVDAVARGAVILTGCKAEYFVLEKNHSSGSGSGRGKKCVGLVATCASNGV  182

Query  1029  NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE--ME  856
              K LRIEA+ +++ACG+L TPPLL  SGLKN++IGSNLHLHPV  AWGYFPE+  +  + 
Sbjct  183   TKKLRIEAKVSIAACGALMTPPLLRRSGLKNRHIGSNLHLHPVSMAWGYFPENKQDPPLS  242

Query  855   GKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVN  676
             GK ++GGIITS+H+V         IIE  +LGP  FAA+ PW SG DMKERMR+YSRT +
Sbjct  243   GKCYEGGIITSMHRVTDR-----TIIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAH  297

Query  675   IFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKI  496
              F++VRD G G V   GR+++   + D D +R GLR+ LRILVAAGAAEVGT RSDG ++
Sbjct  298   AFALVRDRGVGFVDGEGRVRFTPSREDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRL  357

Query  495   CCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGEC  319
              CKG++ E+LE FLD V    GPM S  + W L+CSAHQMGSCRMG++ +DGA+D  GE 
Sbjct  358   RCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGES  417

Query  318   WEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             WEA+GLYVCDGS+LP+A+GVNPMITI S A+C+S G+A+++  G+
Sbjct  418   WEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCLSKGIAETMAQGQ  462



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   557 bits (1435),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 321/778 (41%), Positives = 454/778 (58%), Gaps = 64/778 (8%)
 Frame = -3

Query  2340  RRNSYNHGLSSSQYQALAAICEALIPPIPLPQ---------DSD-DEAMCSFYSSSASQP  2191
             RR SY + LS  Q   L A+C+  +P I  P          D D DE +  FY +SAS  
Sbjct  41    RRVSYVNSLSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMA  100

Query  2190  PFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLK  2011
               P+++  ++  R     +++ RL L  LST +G+ +LCG  CF   +P++  F E+P +
Sbjct  101   GTPEKLGGLISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQR  160

Query  2010  RREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNE---  1840
             RRE I+ +WSR    L LRI   T+K+  + ++F+  DE  +N +W+AIG+     E   
Sbjct  161   RREEIVRRWSRSVFPL-LRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDPEFEN  219

Query  1839  ----------VPPDQQTGR----------------PLEKGIIETINENGTTLKESLIKKG  1738
                       +  D+Q G+                PL +G+I  ++      K SL + G
Sbjct  220   SKKLKRTSCQISADEQQGKEQATAKNGYEDEAFFGPLHQGLIHMVHPRDIVTK-SLRQFG  278

Query  1737  LNV---TESQNAN-----TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVS  1582
               V     + N       +L+I+CD V++GSG GGGV A VLA +G+KV+VLEKG Y   
Sbjct  279   FPVLICPSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVLVLEKGSYCAR  338

Query  1581  EDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSL  1402
              + S LEGP++ ++Y SGG++ T D   +V AG+ VGGGS INWSAS++TP +V+NEWS 
Sbjct  339   SNLSLLEGPTMDQMYLSGGVVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSN  398

Query  1401  EQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEK  1222
             +  + LF S  Y+ A+D VCKR+GV    S+EG  N VLRKGC+ LG  V ++PRN    
Sbjct  399   KYDLELFDSKLYREALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPAD  458

Query  1221  HYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQA-EKFILEEDETARKKCLGVI  1048
             HYCG C  GC+ G KKG   T+LVD V +G   IL GC+A E     +    R    GV 
Sbjct  459   HYCGWCCLGCKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHSRQSRRGRDTATGVT  518

Query  1047  AKSKGN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE  874
              + + N   ++  IE++ T+ ACG+L TP LL  SGLKN NIG NLHLHPV  AWGYFP+
Sbjct  519   FEFEHNGVKEVCIIESKVTIVACGALSTPALLKRSGLKNPNIGKNLHLHPVTMAWGYFPD  578

Query  873   S-MAEM----EGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLD  715
             + MA++    E K+++GGI+T++  VV    K    A+I+  +L P  F+A+ PWTSGLD
Sbjct  579   TEMADLWPEKEKKSYEGGIMTAMSTVVGNFNKSGYGAVIQTPALHPGMFSALMPWTSGLD  638

Query  714   MKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGA  535
             MKERM K+SRT ++F++ RD GSG +  +  I Y+MD  D+ N++ GL + LRIL AAGA
Sbjct  639   MKERMTKFSRTAHLFTLARDKGSGTITSSTSISYKMDDADEQNLQKGLEKVLRILAAAGA  698

Query  534   AEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGAT  355
              E+G+   +G+ +  K +   E E F    V      S +   T  CSAHQMGSCRMG  
Sbjct  699   EEIGSHHGEGKTLKVKQVSYHEFEQF----VKEESARSIKGLSTPICSAHQMGSCRMGPD  754

Query  354   EEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
                 A++  GE WE +GLYV D SV P+A+GVNPM+T+ + AYC +  + ++L   K+
Sbjct  755   PRSSAVNPMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALRRKKS  812



>tpg|DAA49655.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=448

 Score =   541 bits (1394),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 260/449 (58%), Positives = 334/449 (74%), Gaps = 16/449 (4%)
 Frame = -3

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
             M+F G  VGGGSA+NWSASI+TP  V  EW+ E  +P+F S  Y  AMDAVC R+GVT+ 
Sbjct  1     MIFTGATVGGGSAVNWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDG  60

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
             C +EG QN+V+R+GCE LGL  ++VPRN S+ H+CGSC +GC TGDK+G DTT+LVDAV 
Sbjct  61    CQEEGFQNKVVRRGCEALGLCADAVPRNSSDAHFCGSCNFGCPTGDKRGTDTTWLVDAVA  120

Query  1137  NGAVILTGCQAEKFILEEDE------TARKKCLGVIA--KSKGNNKILRIEARATVSACG  982
              GAVILTGC+AE F+LE++          KKC+G++A   S G  K LRIEA+ +++ACG
Sbjct  121   RGAVILTGCKAEYFVLEKNHSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACG  180

Query  981   SLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAE--MEGKNHQGGIITSIHKVV  808
             +L TPPLL  SGLKN++IGSNLHLHPV  AWGYFPE+  +  + GK ++GGIITS+H+V 
Sbjct  181   ALMTPPLLRRSGLKNRHIGSNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHRVT  240

Query  807   SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
                     IIE  +LGP  FAA+ PW SG DMKERMR+YSRT + F++VRD G G V   
Sbjct  241   DR-----TIIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGE  295

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
             GR+++   + D D +R GLR+ LRILVAAGAAEVGT RSDG ++ CKG++ E+LE FLD 
Sbjct  296   GRVRFTPSREDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDE  355

Query  447   VVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
             V    GPM S  + W L+CSAHQMGSCRMG++ +DGA+D  GE WEA+GLYVCDGS+LP+
Sbjct  356   VTIEKGPMHSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPT  415

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             A+GVNPMITI S A+C+S G+A+++  G+
Sbjct  416   AVGVNPMITIQSIAFCLSKGIAETMAQGQ  444



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   551 bits (1421),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 313/749 (42%), Positives = 445/749 (59%), Gaps = 44/749 (6%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIP----LPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRF  2149
             LSS+Q  +L AIC+ ++P I       Q++ D+   +F  +SAS    P  +A ++  R 
Sbjct  29    LSSNQMDSLTAICDTILPSIDANSFYHQEAIDDPFTNFLQTSASMTGTPQHIAWMISNRL  88

Query  2148  LPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETL  1969
                 + + ++ L +LSTR+G+L+LCG      ++P++ +FS +   +RE I+L WS    
Sbjct  89    QHPKLNLCKIALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNKREEIVLSWSTSCF  148

Query  1968  ILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF------HVDTNEVPPDQQTGR--  1813
              L LRI+F  IKI    ++F+  +E   NP+W+A+G+          N+ P DQ+     
Sbjct  149   KL-LRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKKQNQGPQDQEEEEEL  207

Query  1812  --PLEKGIIETINENGTTLKESLIKKGLNVTESQNANT---------LTIRCDvvivgsg  1666
               PL +GII        T  E L K G +V++  N N           TI CD V+VGSG
Sbjct  208   FGPLYQGIISLKQSQKKTF-ERLQKIGFSVSKPHNFNNTRRSTECPDFTIECDAVVVGSG  266

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
              GGGV A +LA +GHKV+VLEKG Y    + S LEGPS+ ++Y   G+LT+ D  VM+ A
Sbjct  267   SGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYLGNGLLTSKDMDVMLLA  326

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             G+ VGGGS INWSASI+TP +VL EWS   K+ LF S  Y+ A+  VC+++GV      E
Sbjct  327   GSTVGGGSTINWSASIQTPQHVLKEWSERYKLDLFQSEFYKGALKVVCEKMGVQSEIEDE  386

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-A  1129
             G QN +LRKGC+ LG +VE++PRN    HYCG C  GC+ G KKG   T+LVD V +G  
Sbjct  387   GFQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSMGCKDGKKKGTAETWLVDLVKSGNG  446

Query  1128  VILTGCQAEKFI--LEEDETARKKCLGV---IAKSKGNNKILRIEARATVSACGSLFTPP  964
              I   C+A + I   + D + + K +GV       KG  +I  ++++ T+ ACG+L TP 
Sbjct  447   AIFPECEALEVIHVKKNDNSGKSKAIGVAFAFQNGKGVREICMVKSKVTIVACGALSTPS  506

Query  963   LLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-------EMEGKNHQGGIITSIHKVVS  805
             LL  SGLKN NIG NLHLHPV+ AWGYFP++ +       E + K+++GGI+T++ KVV+
Sbjct  507   LLKRSGLKNPNIGRNLHLHPVVIAWGYFPDTPSDSNVLWPEADKKSYEGGIMTAMSKVVA  566

Query  804   --EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
               EG+   AII+   L P  F+A+ PW SGLD+K RM KYSRT  I ++ RD GSG+   
Sbjct  567   NFEGSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRMCKYSRTAYILALARDKGSGEAFS  626

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                + Y+MDQID++N++ GL + LRIL AAGA E+GT    G+ +  K    +E E F  
Sbjct  627   PYSVTYKMDQIDEENLKLGLEKMLRILAAAGAEEIGTQHGKGRSLKVKDASLKEFERF--  684

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
               V     +    +    CSAHQMGSCRMG       +++ GE WE +GL++ D SV P+
Sbjct  685   --VKEESSIEIGNHSVPICSAHQMGSCRMGVDPTTSVVNSKGELWEVEGLFLGDSSVFPT  742

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             AIGVNPM+TI + +YC +  + + L + K
Sbjct  743   AIGVNPMVTIQAISYCTAQSVVQLLKNQK  771



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   552 bits (1423),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 310/776 (40%), Positives = 459/776 (59%), Gaps = 62/776 (8%)
 Frame = -3

Query  2355  LLRGG------RRNSYNHGLSSSQYQALAAICEALIPPIP--LPQDSDDEAMCSFYSSSA  2200
             LL GG      ++ +  + LS  Q ++L A+C+ ++P I   +P   DDE+  +FY  SA
Sbjct  56    LLEGGGGEIREKQKTLKNSLSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISA  115

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             S    P+ +  ++  R +     + +LVL  LST LG+++LCG  C   ++PFIH F +L
Sbjct  116   SMAGTPERLGGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDL  175

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF------  1858
             PL +R+ I+  WS  +    LR+ F TIK+    I+F+  DE+ +N +W+AIG+      
Sbjct  176   PLHKRQQIMQSWSL-SFFRHLRMFFRTIKLLTLLIFFTQVDESEDNCSWKAIGYCGPDPE  234

Query  1857  ----------------HVDTNEVPPDQQTG-RPLEKGIIETINENGTTLKESLIKKGLNV  1729
                               D+ E   D +    PL KG++  +N     + ++L + G  V
Sbjct  235   FKAQLKNHFLHGACKEKQDSEEGDNDAELAIGPLYKGLVH-LNYPRDIIVDTLRRFGFPV  293

Query  1728  TESQ---------NANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSED  1576
             + S+         ++ +L ++CD V+VGSG GGGV A +LAN+G+KV+VLEKG Y    +
Sbjct  294   SVSRRKQKTAPSLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKVLVLEKGGYSARNN  353

Query  1575  YSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQ  1396
              S LEGP++ ++Y++GG++ T D  + + +G+ VGGGSAINWSA IKTP +V  EW  + 
Sbjct  354   LSLLEGPTMDQMYQAGGLVATDDMNIFILSGSTVGGGSAINWSACIKTPQHVCKEWCEKH  413

Query  1395  KIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHY  1216
              + LF S  YQ AM+AVC+++GV     +EG  N +LRKGC+ +G  V ++PRN S  HY
Sbjct  414   GLELFESELYQEAMEAVCEKMGVQSEIEEEGFNNAILRKGCQEMGYPVNNIPRNASPDHY  473

Query  1215  CGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA--  1045
             CG C  GC+ G KKG   T+LVD V +G   IL GC A K + ++ + + +K    +A  
Sbjct  474   CGWCCLGCKDGKKKGTSETWLVDLVKSGNGAILPGCTAMKVLHKKKKGSGEKTARGVAFE  533

Query  1044  -KSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM  868
              + +G+  I  +E++ T+ ACG+L TP LL  SGLKN NIG NLHLHPV+ AWGYFP++ 
Sbjct  534   FEYRGSKDICVVESKVTIVACGTLNTPSLLKRSGLKNNNIGRNLHLHPVVMAWGYFPDTP  593

Query  867   AEMEG----------KNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTS  724
              E  G          K+++GGI+T++  VV+E  K    A+I+  +L P  F+ V PW S
Sbjct  594   VEPTGASEVWPETWKKSYEGGIMTAMSPVVAEFEKSGYGAVIQTPALHPGTFSIVMPWVS  653

Query  723   GLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVA  544
             G D+K+RMRK+SRT +IF++ RD GSG V    RI Y M+ +D++N++ G+ + LRIL A
Sbjct  654   GSDIKDRMRKFSRTAHIFALARDQGSGNVHSPSRISYEMEDVDEENLQKGIDKVLRILAA  713

Query  543   AGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRM  364
             AGA E+GT  + G  +  K     E E F    V      S  +  T  CSAHQMGSCRM
Sbjct  714   AGAEEIGTHHNKGNTLNVKNASYHEFEQF----VKKESSRSLTDLSTPLCSAHQMGSCRM  769

Query  363   GATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             G+  ++  +   GE WE + L+V D SV P+A+G+NPMIT+ S AYC +  + + L
Sbjct  770   GSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMITVQSIAYCTAQSVLQVL  825



>gb|EEE51130.1| hypothetical protein OsJ_31873 [Oryza sativa Japonica Group]
Length=621

 Score =   542 bits (1396),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 294/576 (51%), Positives = 382/576 (66%), Gaps = 23/576 (4%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHVD------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKG  1738
             DE   NP+W+AIG+           +  P   + RPLE G++ET   +   L  SL++KG
Sbjct  61    DEKSRNPSWKAIGYAAPAAAAAAVEQRRPASPSRRPLEDGVVETRRMDDNALLRSLVEKG  120

Query  1737  LNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
             L V ++  A   T++CD V+VGSGCGGGVAAAVLA+ G+KVVV+EKG YF +EDY+ LEG
Sbjct  121   LAV-KTGTAAHHTVQCDAVVVGSGCGGGVAAAVLASKGYKVVVVEKGDYFATEDYTSLEG  179

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
             PS+  LYE GG+  T++   ++F G  VGGGSA+NWSA I+TP  +  EWS E  +P+F 
Sbjct  180   PSMERLYEKGGVFGTSNVTTILFTGATVGGGSAVNWSACIRTPAEIREEWSREHGLPVFA  239

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S+ Y  AMDAVC RI VT  C +EG QN+VLR+GC+ LG++ ++VPRN SE H+CGSC  
Sbjct  240   STAYAQAMDAVCDRIRVTGGCEEEGFQNRVLRRGCDALGMRADAVPRNSSEGHFCGSCNL  299

Query  1197  GCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKIL  1018
             GC TGDKKG  T + V      A      + +   L   E           +     + L
Sbjct  300   GCPTGDKKG--TGHDVARRRRRARRGHPDRVQGRALHPREER--------RREGRPEQEL  349

Query  1017  RIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQG  838
             RIEA+ ++SACG+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP+S AE+ GK ++G
Sbjct  350   RIEAKVSISACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELPGKCYEG  409

Query  837   GIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVR  658
             GIITS+H+V         IIE  +LGP  F+AV PW SG DMKERMR+Y+RT + F++  
Sbjct  410   GIITSMHRVTDR-----TIIETPALGPGAFSAVVPWESGRDMKERMRRYARTAHAFALCA  464

Query  657   DHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIK  478
                  Q                 +   GLR+ALRILVAAGAAEVGT RSDG ++ CKG++
Sbjct  465   TAAPAQSTARPPSASPRAATTPRSFGAGLRRALRILVAAGAAEVGTHRSDGLRLRCKGVR  524

Query  477   TEELESFLDGVVATGGPM-SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGL  301
               ++E+FLD V    GPM  G + W ++CSAHQMGSCRMGA+  DGA+D  GE WEA+GL
Sbjct  525   DADVEAFLDEVTIEKGPMYPGSDKWAIFCSAHQMGSCRMGASPRDGAVDGAGESWEAEGL  584

Query  300   YVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             YVCDGS+LP+A+GVNPMITI S AYC+SNG+A +L+
Sbjct  585   YVCDGSLLPTAVGVNPMITIQSIAYCLSNGIADTLS  620



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   546 bits (1406),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 320/774 (41%), Positives = 453/774 (59%), Gaps = 60/774 (8%)
 Frame = -3

Query  2340  RRNSYNHGLSSSQYQALAAICEALIPPIPLPQD-SD-----DEAMCSFYSSSASQPPFPD  2179
             RR SY + LS  Q + L ++C+  +P I  P   SD     DE +  FY +SAS    P+
Sbjct  35    RRVSYVNSLSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPE  94

Query  2178  EVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREA  1999
             ++  +V  R     +++  L L +LST +G+ +LCG  CF   +P++  FSE+P +RRE 
Sbjct  95    KIGGLVSERMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREE  154

Query  1998  ILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH-VDTN-------  1843
             I  +W R    + LR+   TIK+  + ++F+  DE   N +W+AIG+   D +       
Sbjct  155   IARRWFRSVFPV-LRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFENSKKL  213

Query  1842  -----EVPPDQQTGR----------------PLEKGIIETINENGTTLKESLIKKGLNV-  1729
                  +V  D+Q G+                PL +G+I+ ++      K SL + G  V 
Sbjct  214   KRMSCQVSADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVHPQDIVTK-SLRQFGFPVL  272

Query  1728  --TESQNAN-----TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYS  1570
                 + N       +L+I+CD V++GSG GGGV A VLA +GHKV+VLEKG Y    + S
Sbjct  273   ICPSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLS  332

Query  1569  GLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKI  1390
              LEGP++ ++Y SGG++ T D   +V AG+ VGGGS INWSAS++TP +V+NEWS +  +
Sbjct  333   LLEGPTMDQMYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDL  392

Query  1389  PLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCG  1210
              LF S  YQ A+D VCKR+GV    S+EG  N VLRKGC+ LG  V ++PRN    HYCG
Sbjct  393   ELFDSKLYQEALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCG  452

Query  1209  SCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQA-EKFILEEDETARKKCLGVIAKSK  1036
              C  GC+ G KKG   T+LVD V +G   IL GC+A E          R    GV  + +
Sbjct  453   WCCLGCKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHTRRSGRGRDTVTGVAFEFE  512

Query  1035  GN--NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-  865
              N   ++  +E+  T+ ACG+L TP LL  SGLKN NIG NLHLHPV  AWGYFP++   
Sbjct  513   HNGFKEVCIVESNVTIVACGALGTPALLKRSGLKNPNIGKNLHLHPVAMAWGYFPDTKTV  572

Query  864   ----EMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKER  703
                 E E K+++GGI+T++  VV    K    A+I+  +L P  F+ + PWTSGLDMKER
Sbjct  573   DLWPEKEKKSYEGGIMTAMSPVVGNFDKSGYGAVIQTPALHPGMFSVLMPWTSGLDMKER  632

Query  702   MRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVG  523
             M K+SRT ++F++ RD GSG +  +  I Y+MD  D+ N++ GL + LRIL AAGA E+G
Sbjct  633   MTKFSRTAHLFALARDKGSGTIASSTSISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIG  692

Query  522   TFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDG  343
             T  ++G+ +  K +   E E F+    A   P+ G+   T  CSAHQMGSCRMG      
Sbjct  693   THHNEGKTLKVKQVSYHEFERFVKEESAR--PIKGQS--TPICSAHQMGSCRMGPNPRSS  748

Query  342   AIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
              ++  GE WE +GLYV D SV P+A+GVNPM+T+ + AYC +  + ++L   K+
Sbjct  749   VVNPMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALRRKKS  802



>gb|EEC67159.1| hypothetical protein OsI_34012 [Oryza sativa Indica Group]
Length=714

 Score =   541 bits (1393),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 283/521 (54%), Positives = 369/521 (71%), Gaps = 19/521 (4%)
 Frame = -3

Query  1899  DENYNNPAWEAIGFHVD------TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKG  1738
             DE   NP+W+AIG+           +  P   + RPLE G++ET   +   L  SL++KG
Sbjct  106   DEKSRNPSWKAIGYAAPAAAAAAVEQRRPASPSRRPLEDGVVETRRMDDNALLRSLVEKG  165

Query  1737  LNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
             L V     A+  T++CD V+VGSGCGGGVAAAVLA+ G+KVVV+EKG YF +EDY+ LEG
Sbjct  166   LAVKTGTAAHH-TVQCDAVVVGSGCGGGVAAAVLASKGYKVVVVEKGDYFATEDYTSLEG  224

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
             PS+  LYE GG+  T++   ++F G  VGGGSA+NWSA I+TP  +  EWS E  +P+F 
Sbjct  225   PSMERLYEKGGVFGTSNVTTILFTGATVGGGSAVNWSACIRTPAEIREEWSREHGLPVFA  284

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S+ Y  AMDAVC RI VT  C +EG QN+VLR+GC+ LG++ ++VPRN SE H+CGSC  
Sbjct  285   STAYAQAMDAVCDRIRVTGGCEEEGFQNRVLRRGCDALGMRADAVPRNSSEGHFCGSCNL  344

Query  1197  GCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEKFILEEDETAR----KKCLGVIA--KSK  1036
             GC TGDKKG DTT+LVDAV  GAVILTGC+AE FILE +   R    K+C+G++A   S 
Sbjct  345   GCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFILERNAGGRGGRSKRCVGLMATCTSS  404

Query  1035  GNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEME  856
             G  K LRIEA+ ++SACG+L TPPLL +SGLKN++IG NLHLHPV  AWGYFP+S AE+ 
Sbjct  405   GITKKLRIEAKVSISACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELP  464

Query  855   GKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVN  676
             GK ++GGIITS+H+V         IIE  +LGP  F+AV PW SG DMKERMR+Y+RT +
Sbjct  465   GKCYEGGIITSMHRVTDR-----TIIETPALGPGAFSAVVPWESGRDMKERMRRYARTAH  519

Query  675   IFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKI  496
              F++VRD G+G V   GR+++   + D + +R GLR+ALRILVAAGAAEVGT RSDG ++
Sbjct  520   AFALVRDQGAGAVDGEGRVRFSPSRDDVEELRAGLRRALRILVAAGAAEVGTHRSDGLRL  579

Query  495   CCKGIKTEELESFLDGVVATGGPM-SGEENWTLYCSAHQMG  376
              CKG++  ++E+FLD V    GPM  G + W ++CSAH+ G
Sbjct  580   RCKGVRDADVEAFLDEVTIEKGPMYPGSDKWAIFCSAHRDG  620



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   543 bits (1398),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 314/776 (40%), Positives = 463/776 (60%), Gaps = 66/776 (9%)
 Frame = -3

Query  2376  NERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQD-----SDDEAMCSFY  2212
             +++K  P LR        + LS +Q ++L A+C+ ++P I   +D     S DE + +FY
Sbjct  48    SDQKLLPPLR--------NSLSPTQMKSLVALCDTMLPSI---KDNNVAASSDEFLNNFY  96

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
              +SAS    P+ VA +V  +    + ++ +L L +LST  G+L+LCG      ++PF H+
Sbjct  97    RTSASMAGTPELVANLVSEKLKHPSTWLLKLTLWLLSTWFGTLILCGIASISTKFPFFHS  156

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHV  1852
             + +L  ++R+ ++L WS  + + PLR++F TIK+    ++F+  DE  NNP+W+AIG+  
Sbjct  157   YPKLSPEKRQKVMLSWSV-SYLRPLRMLFRTIKLLTLLVFFTQVDEEKNNPSWKAIGYSG  215

Query  1851  DTNEVPP------------------------DQQTGRPLEKGIIETINENGTTLKESLIK  1744
                E                           D++   PL +G++  +N     + +SL +
Sbjct  216   PDQEFKAQRKNKILHKTSKEGRQEKEDCDHDDEEVIGPLYEGLV-NLNYPRDIISDSLRR  274

Query  1743  KGLNVTESQNAN--------TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYF  1588
              G  V+ +   N        +L I+CD V+VGSG GGGV A VLA SG+KV+VLEKG YF
Sbjct  275   FGFPVSVTPPTNKASTISSPSLVIQCDAVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYF  334

Query  1587  VSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEW  1408
                + S LEGP+L ++Y + G++ T D  V+V AG+ VGGGSAINWSASIKTP++V  EW
Sbjct  335   ARNNLSLLEGPTLDQMYLANGLIATDDMSVLVLAGSTVGGGSAINWSASIKTPSHVCKEW  394

Query  1407  SLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCS  1228
                 ++ LF S  Y+ AMDAVC+++GV     +EG  N +LRKGC+ +G  V ++PRN  
Sbjct  395   CDRHELELFESELYKEAMDAVCEKMGVQSEFEEEGFNNAILRKGCQEMGYPVSNIPRNAP  454

Query  1227  EKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDE-TARKKCLG  1054
               HYCG C  GC+ G KKG   T+LVD V +G   IL  C+A + +  E + T RK   G
Sbjct  455   PDHYCGWCCLGCKDGKKKGTSETWLVDLVKSGNGAILPNCEAIQVLYREKKGTDRKIAKG  514

Query  1053  VIAKSKGNNK--ILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYF  880
             V  +   N K  I  +E++ T+ ACG+L TP LL  SGLKN+NIG NLHLHPV  AWGYF
Sbjct  515   VAFEIDYNGKKDICVVESKVTIVACGALCTPSLLKRSGLKNENIGRNLHLHPVTMAWGYF  574

Query  879   PESMAEME------GKNHQGGIITSIHKVVSE--GTKQAAIIEAVSLGPAGFAAVSPWTS  724
             P++ +  E       K+++GGI+T++  VV++   T   A+I+  SL P  F+ + PW+S
Sbjct  575   PDAPSSPELWPEGHKKSYEGGIMTAMSTVVADFNATGYGAVIQTPSLHPGLFSVLMPWSS  634

Query  723   GLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVA  544
             G+D+K+RMRK+SRT ++F++ RD GSG V    RI Y+M  +DK+N+  G+ + LRIL A
Sbjct  635   GMDIKDRMRKFSRTAHVFALARDQGSGTVDSPTRISYQMKNVDKENLHKGIEKVLRILAA  694

Query  543   AGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRM  364
             AGA E+GT  + G+ +  K +   E E F    V     M   +  T  CSAHQMGSCRM
Sbjct  695   AGAEEIGTHNNKGRSLNVKEVSYHEFEKF----VKEESSMPLTDLSTPVCSAHQMGSCRM  750

Query  363   GATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             G   ++  ++  GE WE +GLY+ D SV P+A+GVNPM+T+ + AYC +  + + L
Sbjct  751   GTNPKESVVNQTGETWEVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQHVLEVL  806



>ref|XP_006379996.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
 gb|ERP57793.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
Length=388

 Score =   526 bits (1356),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 254/385 (66%), Positives = 310/385 (81%), Gaps = 5/385 (1%)
 Frame = -3

Query  1335  IGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTY  1156
             IGVTE C  EG QNQVLRKGCE LG+ V++VPRN SE+HYCGSCGYGCR G+KKG D T+
Sbjct  1     IGVTENCKVEGFQNQVLRKGCERLGVPVKTVPRNSSERHYCGSCGYGCRKGEKKGTDRTW  60

Query  1155  LVDAVNNGAVILTGCQAEKFILEEDE---TARKKCLGVIAKSKGNNKI--LRIEARATVS  991
             LVDAV+NGAVILTGC+AE+FILE+++     +KKCLGVIAK   NN I  L+IEA+ T+S
Sbjct  61    LVDAVDNGAVILTGCKAERFILEKNKGLGKRKKKCLGVIAKIINNNIITRLQIEAKVTIS  120

Query  990   ACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGIITSIHKV  811
             ACG+L TPPL+ISSGLKN+NIG NLHLHPVL AWGYFPES +E +GK + GGIIT++H+V
Sbjct  121   ACGALLTPPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYDGGIITAVHEV  180

Query  810   VSEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
             V+  +   AI+E   LGP+ F+ + PW SG DMK RM KYSRT ++ +++RD GSG+V  
Sbjct  181   VAGDSNVRAIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYSRTAHLITIIRDSGSGKVTT  240

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
              GRI Y ++  D+DN++ GLRQALRILVAAGA EVGT RSDGQ+I C+GIK E+LE FLD
Sbjct  241   EGRISYYLNASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFLD  300

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
              V ATGG +S EE+W  Y SAHQMGSCRMG  E++GA+D NGE WEA+GL+VCD SVLPS
Sbjct  301   TVYATGGALSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPS  360

Query  270   AIGVNPMITILSTAYCISNGLAKSL  196
             A+GVNPMITI STAYC+S  +A+SL
Sbjct  361   AVGVNPMITIQSTAYCLSKKIAESL  385



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   542 bits (1397),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 313/793 (39%), Positives = 463/793 (58%), Gaps = 50/793 (6%)
 Frame = -3

Query  2445  SITAKQREREREGEKIFKREKKMNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALI  2266
             +IT    E  RE ++ F   + +      PL+ G  +N Y+  LSS Q ++L A+C+  +
Sbjct  5     NITGIGTEGLREKQEDFMATEFVEMEAGRPLM-GRVKNPYSSSLSSRQMESLKALCDTYL  63

Query  2265  PPIPLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGS  2086
             P I       DE+   FY +SAS    P  +  ++  R     +F+ RL L  LST +G+
Sbjct  64    PSIDGFHTKHDESTARFYQTSASVAGTPQRLGGLISERLQHPKLFMARLALWFLSTSIGT  123

Query  2085  LLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFS  1906
               +CG     G +P++  FS++  ++RE I+L WSR ++I PLR++F  +K+    ++FS
Sbjct  124   FAMCGIASLSGNFPYLQKFSQVSPEKREQIVLSWSR-SIIFPLRLLFTALKVLILLVFFS  182

Query  1905  WTDENYNNPAWEAIG-------FHVDTN---------EVPPDQQTGR--------PLEKG  1798
               D+   N +W+AIG       F   T          E   DQ+           PL KG
Sbjct  183   QVDDKEENLSWKAIGYCGPDPDFKRQTQRIKTLKQMFESAEDQKQDEASAEELFGPLYKG  242

Query  1797  IIETINENGTTLKESLIKKGLNVTESQ---------NANTLTIRCDvvivgsgcgggvaa  1645
             I+  ++     + E L   G +V+ S          N  +  I+CD V+VGSG GGGV A
Sbjct  243   IV-NLDRPKQFVFEKLQNAGFSVSASSHLKNAKSKYNRPSFRIKCDAVVVGSGSGGGVVA  301

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
              +LA +G+K +VLEKG+YF   + S LEG ++ ++Y   G + T    V+  AG+ VGGG
Sbjct  302   GILAKAGYKTLVLEKGNYFARTNLSLLEGSTMDQMYLGSGFMATEKMDVIFLAGSTVGGG  361

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWS+SI+TP +V+ EWS   ++ LF S  Y+ A+DAVC+++GV      EG  N VL
Sbjct  362   SAVNWSSSIRTPPHVIKEWSESYELELFDSKLYEEALDAVCQKMGVQSEIENEGFNNMVL  421

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQ  1108
             RKGCE LG  V ++PRN +  HYCG C +GC+ G KKG   T+LVD +N+G  +IL  C+
Sbjct  422   RKGCEELGYPVNTIPRNATADHYCGWCCFGCKDGRKKGTLETWLVDLLNSGNGLILPECK  481

Query  1107  AEKFILEEDETAR-KKCLGVIAK--SKGNNKILRIEARATVSACGSLFTPPLLISSGLKN  937
             A + + +     + +  +GV  K  ++G  +I  +E++ T+ ACG+L TP LLI SGLKN
Sbjct  482   AIRVLHKRKNKKKGRHAVGVAFKFQNQGVEEIGIVESKVTIVACGALSTPELLIKSGLKN  541

Query  936   KNIGSNLHLHPVLFAWGYFPESM----AEMEGKNHQGGIITSIHKVVS--EGTKQAAIIE  775
              NIG +LH+HPV  AWGYFP++      E E K+++GGI+T++  VV+  EG+   A+I+
Sbjct  542   PNIGKHLHIHPVAMAWGYFPDTTPDPWPEAEKKSYEGGIMTAMSTVVANFEGSGYGAVIQ  601

Query  774   AVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQID  595
               +L P  F+A+ PWTSG D K+RM K+SRT ++F++ RD GSG++     I Y MD+ID
Sbjct  602   TPALHPGMFSALMPWTSGRDFKDRMCKFSRTAHVFALARDKGSGKLLYPNSITYNMDKID  661

Query  594   KDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGE  415
             ++NI+ GL + LRIL +AGA E+GT    G+ I  K +   E + F    V      S +
Sbjct  662   EENIKRGLEKVLRILASAGAEEIGTHHVKGRSINVKKVSYTEFDKF----VKEESSRSLK  717

Query  414   ENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILS  235
             +  T  CSAHQMGSCRMG   +    +  GE WE +GLY+ D SV P+A+GVNPM+T+ +
Sbjct  718   DLATPICSAHQMGSCRMGVDPKISVANPIGETWEIEGLYLADSSVFPTALGVNPMVTVQA  777

Query  234   TAYCISNGLAKSL  196
              AYC +  + +SL
Sbjct  778   IAYCTAQSVLESL  790



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   540 bits (1392),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 315/748 (42%), Positives = 458/748 (61%), Gaps = 38/748 (5%)
 Frame = -3

Query  2337  RNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD-DEAMCSFYSSSASQPPFPDEVAEVV  2161
             +  Y + +++ + ++L AIC+ LIP     +    D+ +  +YS+SAS    PD VA ++
Sbjct  32    KTVYANSMTAREMESLVAICDTLIPSRDASEVGHLDDGVAGYYSASASHTGTPDRVARLM  91

Query  2160  MRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWS  1981
               R      +I R+ L  LST +GSL++CG   F G +P+   F  LP  +RE ILL W+
Sbjct  92    SERLHHPKKWILRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRFCWLPETQREEILLNWA  151

Query  1980  RETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF------HVDTNEVPPDQQT  1819
                 IL LR+ F +IK+   F++F+  DE  NN AW+AIG+      H D  E   ++ T
Sbjct  152   SSYFIL-LRMFFRSIKLITAFVFFTQVDEKGNNVAWKAIGYNGPSSDHSDHEEEINEKTT  210

Query  1818  GR--------PLEKGIIETINENGTTLKESLIKKGLNVT---ESQNANT-----LTIRCD  1687
              +        PL  GII+  N      K+ L   G  V+    ++N ++     +TI+CD
Sbjct  211   KKNKHDEIFGPLYNGIIDLKNPREAVTKK-LTGHGFTVSTHKRTKNGSSISDPVMTIQCD  269

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
              V+VGSG GGGV A +LA +G+KV+V+EKG+Y+   + S  EG +L E+Y SGG+L TTD
Sbjct  270   AVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQALDEMYLSGGLLATTD  329

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
               V++ AG+ VGGGS INWSASIKTP +V+ EWS + ++ +FGS  Y+ AMD VC+R+GV
Sbjct  330   MDVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVVCERMGV  389

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
                  +EG  N++LRKGCENLGL V+++PRN    HYCG C  GC+ G K+G   T+LVD
Sbjct  390   QCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVD  449

Query  1146  AVNNG-AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFT  970
              V +G  +IL GC+A + + E     + K    IA + G + I  +E+RAT+ ACG+L T
Sbjct  450   LVESGNGLILPGCEAMEVLYECKGGKKTKTSTGIAFAFGKD-IYMVESRATIVACGALRT  508

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYF--PESMAEMEGKNHQGGIITSIHKVVSEGT  796
             P LL  SGLKN +IG NL LHPV+ AWG+F   E   E + +++QGGI+T++  VV+E T
Sbjct  509   PHLLKHSGLKNGSIGRNLCLHPVVMAWGWFPEEEEWPEKKKRSYQGGIMTAMSSVVNEET  568

Query  795   KQA---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
             K +    +I+  SL P  F+ V PWTS  + K RM K+SRT ++F+++RD G+G +    
Sbjct  569   KNSYGETVIQTPSLHPGLFSGVIPWTSSKEFKSRMLKFSRTAHVFTLLRDKGTGTINSKS  628

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL-DG  448
              I+Y ++  D+++++ GL + L IL AAGA E+GT  S+G+ +  K     E+E F+ + 
Sbjct  629   SIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTTSAVEIERFVREE  688

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
                +   +SG+      CSAHQMGSCRMG + E  A+   GE WE +GL+V D SV P+A
Sbjct  689   SSKSLKDLSGQ-----ICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVADTSVFPTA  743

Query  267   IGVNPMITILSTAYCISNGLAKSLNSGK  184
             +GVNPM+T+ S AYCI   +  +L   K
Sbjct  744   LGVNPMVTVQSIAYCIGLNVVDALKRKK  771



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   540 bits (1391),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 308/748 (41%), Positives = 449/748 (60%), Gaps = 43/748 (6%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIP----LPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRF  2149
             LSS+Q  +L A+C+ ++P I        ++ D+   +F  +SAS    P  +A ++  R 
Sbjct  29    LSSNQMDSLTALCDTILPSIDANSFYQNEAIDDPFTNFLQTSASMTGTPQHIAWMISNRL  88

Query  2148  LPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETL  1969
                 + + +L L +LSTR+G+L+LCG      ++P++ +FS +   +RE I+L WS    
Sbjct  89    HHPKLNLCKLALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNQREEIVLSWSTSCF  148

Query  1968  ILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF------HVDTNEVPPDQQTGR--  1813
              L LRI+F  IKI    ++F+  +E   NP+W+A+G+          N+   DQ+  +  
Sbjct  149   KL-LRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKKQNQGVQDQEEEQLF  207

Query  1812  -PLEKGIIETINENGTTLKESLIKKGLNVTESQNAN---------TLTIRCDvvivgsgc  1663
              PL +GII ++ ++     E L K G +V++  N N           TI CD V+VGSG 
Sbjct  208   GPLYQGII-SLKQSQKKAFERLQKLGFSVSKPHNFNDTRRSTECPNFTIECDAVVVGSGS  266

Query  1662  gggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAG  1483
             GGGV A +LA +GHKV+VLEKG Y    + S LEGPS+ ++Y   G+LT+ D  +M+ AG
Sbjct  267   GGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYLGNGLLTSKDMDIMLLAG  326

Query  1482  TMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEG  1303
             + VGGGS INWSASI+TP +VL EWS + K+ LF S  Y+ A+  VC+++GV      EG
Sbjct  327   STVGGGSTINWSASIQTPQHVLKEWSEKYKLELFQSEFYEGALKVVCEKMGVQSEIEDEG  386

Query  1302  LQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AV  1126
              QN +LRKGC+ LG +VE++PRN    HYCG C  GC+ G KKG   T+LVD V +G   
Sbjct  387   FQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSMGCKDGKKKGTAETWLVDLVKSGNGA  446

Query  1125  ILTGCQAEKFI--LEEDETARKKCLGV---IAKSKGNNKILRIEARATVSACGSLFTPPL  961
             IL  C+A + I   + D + + K +GV       KG  +I  ++++ T+ ACG+L TP L
Sbjct  447   ILPECEALEVIHVKKNDNSGKSKAIGVAFAFQNGKGVREICMVKSKVTIVACGALSTPSL  506

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-------EMEGKNHQGGIITSIHKVVS-  805
             L  SGLKN NIG NLHLHPV+ AWGYFP++ +       E   K+++GGI+T++ KVV+ 
Sbjct  507   LKKSGLKNPNIGRNLHLHPVVIAWGYFPDTPSDCNVLWPEANKKSYEGGIMTAMSKVVAN  566

Query  804   -EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKA  628
              EG+   AII+   L P  F+A+ PW SGLD+K RM KYSRT  + ++ RD GSG+    
Sbjct  567   FEGSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRMCKYSRTAYLLALARDMGSGEAFSP  626

Query  627   GRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDG  448
               + Y+MD+ID++N++ GL + LRIL AAGA  +GT    G+ +    +K E L+ F   
Sbjct  627   YSVTYKMDRIDEENLKLGLEKMLRILAAAGAEAIGTQHGKGRSL---NVKDESLKEFERF  683

Query  447   VVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSA  268
             V        G  +  + CSAHQMGSCRMG       +++ GE WE +GL++ D SV P+A
Sbjct  684   VKEESSIKIGNHSVPI-CSAHQMGSCRMGEDPTTSVVNSKGETWEVEGLFLGDSSVFPTA  742

Query  267   IGVNPMITILSTAYCISNGLAKSLNSGK  184
             IGVNPM+TI + +YC +  + + L + K
Sbjct  743   IGVNPMVTIQAISYCTAQSVLQLLKNQK  770



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   540 bits (1391),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 304/767 (40%), Positives = 456/767 (59%), Gaps = 55/767 (7%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQ  2194
             E+K  PL          + LS  Q ++L A+C+ ++P +    D+ DE++  FY  SAS 
Sbjct  51    EKKLQPL---------TNTLSPRQMKSLYALCDTILPSVDHFVDTSDESVTKFYQISASM  101

Query  2193  PPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPL  2014
                P+    ++  +       + + VL +LST  G+L+ CG  CF  ++PFIH + +LPL
Sbjct  102   TGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPL  161

Query  2013  KRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF--------  1858
             ++R+ I+  WS  + +   R++F TIK+    I+F+  DE+ +N AW+AIG+        
Sbjct  162   QKRQQIMRSWSL-SYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFK  220

Query  1857  -HVDTNEVPPDQQTGR-------------PLEKGIIETINENGTT---LKE-----SLIK  1744
               + ++ +    + G+             PL KG++        T   LK      S+I+
Sbjct  221   ARLKSHFLDGTSKGGQEDKEDEDAEEVIGPLYKGLVHLNYPRDITADALKRLGFPVSVIR  280

Query  1743  KGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGL  1564
             +      + ++ +L I+CD V+VGSG GGGV A VLA +G+KV+VLEKG Y    + S L
Sbjct  281   QKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSARNNLSLL  340

Query  1563  EGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPL  1384
             EGP++ ++Y +GG++ + D  V + +G+ VGGGSAINWSA IKTP +V  EWS +  + L
Sbjct  341   EGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQHVCKEWSDKHGLEL  400

Query  1383  FGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSC  1204
             F S  Y+ A++AVC+++ V      EG  N +LRKGC+ +G  V ++PRN +  HYCG C
Sbjct  401   FESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMGYPVSNIPRNSASDHYCGWC  460

Query  1203  GYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSK  1036
               GC+ G KKG   T+LVD V +G   IL GC+A K + ++ E   +K    +A   + K
Sbjct  461   CMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHKKKEGRDRKIARGVAFEFEYK  520

Query  1035  GNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFP-----ES  871
             G   I  +E++ T+ ACG+L TP LL  SGL+N+NIG NLHLHPV  AWGYFP     E 
Sbjct  521   GTKDICVVESKVTIVACGALSTPALLKKSGLRNQNIGRNLHLHPVAMAWGYFPDAPESEV  580

Query  870   MAEMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMR  697
               E   K+++GGI+T++  VV+E  +    A+I+  SL P  F+ V+PWTSG+D+++RMR
Sbjct  581   WPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMR  640

Query  696   KYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTF  517
             K+SRT +IF++ RD GSG VK   RI Y+   +D++N++ G+ + LRIL AAGA E+GT 
Sbjct  641   KFSRTAHIFALARDQGSGTVKAPDRISYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTH  700

Query  516   RSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAI  337
              + G+ +  K ++  E E F    V      S  +  T  CSAHQMGSCRMG+  +  A+
Sbjct  701   HNKGRTLNVKQVRYHEFEKF----VKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSAV  756

Query  336   DNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             +  GE WE +GLYV D SV P+A+GVNPM+T+ + AYC +  + + L
Sbjct  757   NQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVVEVL  803



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   540 bits (1390),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 304/767 (40%), Positives = 456/767 (59%), Gaps = 55/767 (7%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQ  2194
             E+K  PL          + LS  Q ++L A+C+ ++P +    D+ DE++  FY  SAS 
Sbjct  51    EKKLQPL---------TNTLSPRQMKSLYALCDTILPSVDHFVDTSDESVTKFYQISASM  101

Query  2193  PPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPL  2014
                P+    ++  +       + + VL +LST  G+L+ CG  CF  ++PFIH + +LPL
Sbjct  102   TGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPL  161

Query  2013  KRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF--------  1858
             ++R+ I+  WS  + +   R++F TIK+    I+F+  DE+ +N AW+AIG+        
Sbjct  162   QKRQQIMRSWSL-SYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFK  220

Query  1857  -HVDTNEVPPDQQTGR-------------PLEKGIIETINENGTT---LKE-----SLIK  1744
               + ++ +    + G+             PL KG++        T   LK      S+I+
Sbjct  221   ARLKSHFLDGTSKGGQEDKEDEDAEEVIGPLYKGLVHLNYPRDITADALKRLGFPVSVIR  280

Query  1743  KGLNVTESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGL  1564
             +      + ++ +L I+CD V+VGSG GGGV A VLA +G+KV+VLEKG Y    + S L
Sbjct  281   QKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSARNNLSLL  340

Query  1563  EGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPL  1384
             EGP++ ++Y +GG++ + D  V + +G+ VGGGSAINWSA IKTP +V  EWS +  + L
Sbjct  341   EGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQHVCKEWSDKHGLEL  400

Query  1383  FGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSC  1204
             F S  Y+ A++AVC+++ V      EG  N +LRKGC+ +G  V ++PRN +  HYCG C
Sbjct  401   FESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMGYPVSNIPRNSAADHYCGWC  460

Query  1203  GYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSK  1036
               GC+ G KKG   T+LVD V +G   IL GC+A K + ++ E   +K    +A   + K
Sbjct  461   CMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHKKKEGRDRKIARGVAFEFEYK  520

Query  1035  GNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFP-----ES  871
             G   I  +E++ T+ ACG+L TP LL  SGL+N+NIG NLHLHPV  AWGYFP     E 
Sbjct  521   GTKDICVVESKVTIVACGALSTPALLKKSGLRNQNIGRNLHLHPVAMAWGYFPDAPESEV  580

Query  870   MAEMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMR  697
               E   K+++GGI+T++  VV+E  +    A+I+  SL P  F+ V+PWTSG+D+++RMR
Sbjct  581   WPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMR  640

Query  696   KYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTF  517
             K+SRT +IF++ RD GSG VK   RI Y+   +D++N++ G+ + LRIL AAGA E+GT 
Sbjct  641   KFSRTAHIFALARDQGSGTVKAPDRISYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTH  700

Query  516   RSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAI  337
              + G+ +  K ++  E E F    V      S  +  T  CSAHQMGSCRMG+  +  A+
Sbjct  701   HNKGRTLNVKQVRYHEFEKF----VKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSAV  756

Query  336   DNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             +  GE WE +GLYV D SV P+A+GVNPM+T+ + AYC +  + + L
Sbjct  757   NQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVVEVL  803



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   539 bits (1388),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 317/796 (40%), Positives = 467/796 (59%), Gaps = 76/796 (10%)
 Frame = -3

Query  2412  EGEKIFKREKKMNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPI-PLPQDSD  2236
             +GE I K++K +    C       RR          Q ++L+ + + ++P I       D
Sbjct  44    DGEAIIKKQKYLTNSLC-------RR----------QMKSLSVLADTILPSINDFVAIKD  86

Query  2235  DEAMCSFYSSSASQPPFPDEVAEVVMRRF-LPDAVFIFRLVLIILSTRLGSLLLCGFVCF  2059
             DE+  +FY  SAS    P+ V  V+  R       ++ + VL +LST +G+++LCG  CF
Sbjct  87    DESAATFYHISASMAGTPELVGGVISERLNYHPMTWLLKFVLWLLSTLVGTIILCGMDCF  146

Query  2058  DGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNP  1879
               ++PFIH F  LPL +R+ I+  WS  +    LR+ F TIK+    ++F+  DE+ +N 
Sbjct  147   STKFPFIHTFPNLPLHKRQRIMQSWSL-SFFRHLRMFFKTIKLLTLLVFFTQIDESEDNC  205

Query  1878  AWEAIGF-------------HV------------DTNEVPPDQQTGRPLEKGIIETINEN  1774
             +W+AIG+             H             + +E   +Q  G PL KG++  +N  
Sbjct  206   SWKAIGYCGPDPEFKAQLRNHFLHRTCKGGQESEEGDEDDAEQVIG-PLYKGLVH-LNCP  263

Query  1773  GTTLKESLIKKGLNVTESQ---------NANTLTIRCDvvivgsgcgggvaaavlANSGH  1621
                  ++L + G  V+ ++         ++ +L I+CD V+VGSG GGG+ A +LA +G+
Sbjct  264   RDITADALRRFGFPVSVTRRKPKAAANLSSPSLVIQCDAVVVGSGSGGGLVAGILAKAGY  323

Query  1620  KVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSAS  1441
             KV+VLEKG Y    + S LEGP+L ++Y+SGGML T D  V V +G+ VGGGSAINWSAS
Sbjct  324   KVLVLEKGGYSARSNLSLLEGPTLDQMYQSGGMLATDDMSVFVLSGSTVGGGSAINWSAS  383

Query  1440  IKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLG  1261
             IKTP +V  EW  +  + LF S  Y+ AMD VC+++GV     +EG  N +LR+GC+ LG
Sbjct  384   IKTPQHVCKEWCEKHGLELFESELYREAMDVVCEKMGVQSEIEEEGFNNTILRRGCQELG  443

Query  1260  LKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEE  1084
               V ++PRN    HYCG C  GC+ G KKG   T+LVD V +G   IL GC+  K + ++
Sbjct  444   YPVSTIPRNSPSDHYCGWCFMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEVLKVLYKK  503

Query  1083  DETARKKCLGVIA---KSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLH  913
              + + +K    +A   + KG+  I  +E++ T+ ACG+L TP LL  SGLKN NIG NLH
Sbjct  504   KKGSDQKTARGVAFEFEYKGSKDICVVESKVTIVACGALNTPALLKRSGLKNNNIGRNLH  563

Query  912   LHPVLFAWGYFPESMAEMEG----------KNHQGGIITSIHKVVS--EGTKQAAIIEAV  769
             LHPV+ AWGYFP+S AE  G          K+++GGI+T++  VV+  E +   A+I+  
Sbjct  564   LHPVVMAWGYFPDSSAESTGETEVWPEAWKKSYEGGIMTAMSPVVAEFENSGYGAVIQTP  623

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
             +L P  F+ V PW SG D+K+RMRK+SRT +IF++ RD GSG+V    RI Y+M+ +D++
Sbjct  624   ALHPGTFSIVMPWISGKDIKDRMRKFSRTAHIFALARDKGSGKVDSPNRINYQMEDVDEE  683

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEEN  409
             N++ G+ + LRIL AAGA E+GT  + G+ +  K     ELE F+     +  P++    
Sbjct  684   NLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQASKLELEKFVKE--ESSRPLTKLS-  740

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
              T  CSAHQMGSCRMG+  ++ A+   GE WE + LYV D SV P+A+G+NPMITI S A
Sbjct  741   -TPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMITIQSIA  799

Query  228   YCISNGLAKSLNSGKA  181
             YC +  +  +L   ++
Sbjct  800   YCTAQSVLHALKRKRS  815



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   538 bits (1385),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 301/753 (40%), Positives = 455/753 (60%), Gaps = 46/753 (6%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDA  2137
             LSS Q ++L+A+C+ ++P +     S DE++  FY  SAS    P     ++  +     
Sbjct  60    LSSRQMKSLSALCDTILPSLDHFPHSSDESVNRFYRISASMAGTPQLFGGMICEKLKHPM  119

Query  2136  VFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPL  1957
               + +LVL  LST  G+L+LCG  C   ++PFIH++ +L +++R+ I+  WS  + I  L
Sbjct  120   TGLLKLVLWALSTWFGTLILCGMGCVSTKFPFIHSYPDLSVEKRQQIMRSWSL-SYIRHL  178

Query  1956  RIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF---------HVDTNEVPPDQQTGR---  1813
             R +F TIK+    I+F+  DE+ +N +W+AIG+          +  + +    + G    
Sbjct  179   RQLFRTIKLLTLLIFFTQLDESEDNLSWKAIGYCGPDPEFKAQLKNHFLEGKSKRGEEDK  238

Query  1812  ----------PLEKGIIETINENGTT--------LKESLIKKGLNVTESQNANTLTIRCD  1687
                       PL KG++   N    T           S+I++      + ++ +L I+CD
Sbjct  239   EDEDVEEVIGPLYKGLVHLNNPRDITADALRRIGFPVSVIRRKHKAAANLSSPSLVIQCD  298

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
              V+VGSG GGGV A VLA +G+KV+VLEKG YF   + S LEG ++ ++Y +GG++ + D
Sbjct  299   AVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYFARNNLSLLEGQTMDQMYLNGGLVASDD  358

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
               + + +G+ VGGGSAINWSASIKTP +V  EW  +  + LFGS  Y+ A+DAVC+++GV
Sbjct  359   MGMFILSGSTVGGGSAINWSASIKTPQHVRKEWCEKHGLELFGSELYREALDAVCEKMGV  418

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
                   EG  N VLRKGC+ +G  V ++PRN S  HYCG C  GC+ G KKG   T+LVD
Sbjct  419   QSEIGDEGFNNAVLRKGCQEMGYPVNTIPRNSSSDHYCGWCCLGCKDGKKKGTLETWLVD  478

Query  1146  AVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSKGNNKILRIEARATVSACGS  979
              V +G   IL GC+A K + ++ E   +K    +A   + KG   I  +E++ T+ ACG+
Sbjct  479   LVKSGNGAILPGCEAIKVLHKKKEGKDRKVARGVAFEFEYKGIKDICVVESKVTIVACGA  538

Query  978   LFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-----EMEGKNHQGGIITSIHK  814
             L TP LL  SGL+N+NIG +LHLHPV  AWGYFP+  A     E   K+++GGI+T++  
Sbjct  539   LCTPALLKRSGLRNQNIGRHLHLHPVTMAWGYFPDEPASEVWPEAYKKSYEGGIMTAMSS  598

Query  813   VVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQ  640
             VV+E  +    A+I+  SL P  F+ V+PWTSG+D+++RMRK+SRT +IF++ RD GSG 
Sbjct  599   VVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDKGSGT  658

Query  639   VKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELES  460
             V+    I YR+  +D++N++ G+ + LRIL AAGA E+GT  + G+ +  K +   E E 
Sbjct  659   VESPKHISYRLAGVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEK  718

Query  459   FLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSV  280
             F+     +  P++  +  T  CSAHQMGSCRMG+  +   ++  GE WE +GLY+ D SV
Sbjct  719   FVK--EESSRPLA--DLSTPLCSAHQMGSCRMGSNPKQSVVNQTGETWEMEGLYLADTSV  774

Query  279   LPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
              P+A+GVNPM+T+ +TAYCI+  + + L   ++
Sbjct  775   FPTALGVNPMVTVQATAYCIAQSVVEVLRRKRS  807



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   539 bits (1388),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 310/798 (39%), Positives = 459/798 (58%), Gaps = 84/798 (11%)
 Frame = -3

Query  2355  LLRGG------RRNSYNHGLSSSQYQALAAICEALIPPIP--LPQDSDDEAMCSFYSSSA  2200
             LL GG      ++ +  + LS  Q ++L A+C+ ++P I   +P   DDE+  +FY  SA
Sbjct  56    LLEGGGGEIREKQKTLKNSLSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISA  115

Query  2199  SQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSEL  2020
             S    P+ +  ++  R +     + +LVL  LST LG+++LCG  C   ++PFIH F +L
Sbjct  116   SMAGTPERLGGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDL  175

Query  2019  PLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSW---------------------  1903
             PL +R+ I+  WS  +    LR+ F TIK+    I+F+                      
Sbjct  176   PLHKRQQIMQSWSL-SFFRHLRMFFRTIKLLTLLIFFTQYKILFLLGNDLLYSSLHYTYF  234

Query  1902  -TDENYNNPAWEAIGF----------------------HVDTNEVPPDQQTG-RPLEKGI  1795
               DE+ +N +W+AIG+                        D+ E   D +    PL KG+
Sbjct  235   QVDESEDNCSWKAIGYCGPDPEFKAQLKNHFLHGACKEKQDSEEGDNDAELAIGPLYKGL  294

Query  1794  IETINENGTTLKESLIKKGLNVTESQ---------NANTLTIRCDvvivgsgcgggvaaa  1642
             +  +N     + ++L + G  V+ S+         ++ +L ++CD V+VGSG GGGV A 
Sbjct  295   VH-LNYPRDIIVDTLRRFGFPVSVSRRKQKTAPSLSSPSLVVQCDAVVVGSGSGGGVVAG  353

Query  1641  vlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGS  1462
             +LAN+G+KV+VLEKG Y    + S LEGP++ ++Y++GG++ T D  + + +G+ VGGGS
Sbjct  354   ILANAGYKVLVLEKGGYSARNNLSLLEGPTMDQMYQAGGLVATDDMNIFILSGSTVGGGS  413

Query  1461  AINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLR  1282
             AINWSA IKTP +V  EW  +  + LF S  YQ AM+AVC+++GV     +EG  N +LR
Sbjct  414   AINWSACIKTPQHVCKEWCEKHGLELFESELYQEAMEAVCEKMGVQSEIEEEGFNNAILR  473

Query  1281  KGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQA  1105
             KGC+ +G  V ++PRN S  HYCG C  GC+ G KKG   T+LVD V +G   IL GC A
Sbjct  474   KGCQEMGYPVNNIPRNASPDHYCGWCCLGCKDGKKKGTSETWLVDLVKSGNGAILPGCTA  533

Query  1104  EKFILEEDETARKKCLGVIA---KSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNK  934
              K + ++ + + +K    +A   + +G+  I  +E++ T+ ACG+L TP LL  SGLKN 
Sbjct  534   MKVLHKKKKGSGEKTARGVAFEFEYRGSKDICVVESKVTIVACGTLNTPSLLKRSGLKNN  593

Query  933   NIGSNLHLHPVLFAWGYFPESMAEMEG----------KNHQGGIITSIHKVVSEGTKQ--  790
             NIG NLHLHPV+ AWGYFP++  E  G          K+++GGI+T++  VV+E  K   
Sbjct  594   NIGRNLHLHPVVMAWGYFPDTPVEPTGASEVWPETWKKSYEGGIMTAMSPVVAEFEKSGY  653

Query  789   AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
              A+I+  +L P  F+ V PW SG D+K+RMRK+SRT +IF++ RD GSG V    RI Y 
Sbjct  654   GAVIQTPALHPGTFSIVMPWVSGSDIKDRMRKFSRTAHIFALARDQGSGNVHSPSRISYE  713

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGG  430
             M+ +D++N++ G+ + LRIL AAGA E+GT  + G  +  K     E E F    V    
Sbjct  714   MEDVDEENLQKGIDKVLRILAAAGAEEIGTHHNKGNTLNVKNASYHEFEQF----VKKES  769

Query  429   PMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPM  250
               S  +  T  CSAHQMGSCRMG+  ++  +   GE WE + L+V D SV P+A+G+NPM
Sbjct  770   SRSLTDLSTPLCSAHQMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPM  829

Query  249   ITILSTAYCISNGLAKSL  196
             IT+ S AYC +  + + L
Sbjct  830   ITVQSIAYCTAQSVLQVL  847



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   536 bits (1382),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 309/761 (41%), Positives = 448/761 (59%), Gaps = 51/761 (7%)
 Frame = -3

Query  2352  LRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLP-------------------------  2248
             L GG   S NH LS  Q ++L A+C+ LIP I +                          
Sbjct  46    LMGGLPPSPNH-LSPRQMESLTALCDTLIPSIDVDFHGQQPRNAGDDAIRSFATSAFMSD  104

Query  2247  ------QDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGS  2086
                   Q++ D+A+ SF+++SAS    PD VA +V  +       + RL L +LST  G+
Sbjct  105   FHGQQQQNAGDDAIRSFFATSASMSGTPDHVAGLVSGKVKHALSGVLRLCLWLLSTWYGT  164

Query  2085  LLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFS  1906
              ++CG +     +P+  +F ++   +RE I+L WS  ++ L LR +F  IK   + I++S
Sbjct  165   FIICGTLSLSSHFPYFQSFPQIIQPKREEIMLSWSTSSIYL-LRALFQCIKFFVHLIFYS  223

Query  1905  WTDENYNNPAWEAIGF----HVDTNEVPPDQQTGR-PLEKGIIETINENGTTLKESLIKK  1741
               DEN +N  W+AIG+        +  P  QQ  + PL+ G+I+  + +  T    L   
Sbjct  224   KVDENNHNSTWQAIGYCGPDPQKESGCPHGQQESKGPLQHGVIDLDSMDHHTFAHVLRAS  283

Query  1740  GLNVTESQNA-NTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGL  1564
             G  V++ +   +  TI+CD V+VGSG GGGVAA VLA +GHKVVVLEKGHYF     S L
Sbjct  284   GFTVSQPKEKFSNFTIKCDAVVVGSGSGGGVAAGVLAVAGHKVVVLEKGHYFARSQLSLL  343

Query  1563  EGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPL  1384
             EGP++ ++Y+  G++ T D   ++ AG+ VGGGSAINWSA+I+TP++VLNEW+    + L
Sbjct  344   EGPTMDQMYDRHGLIATDDLSAIILAGSTVGGGSAINWSAAIRTPDHVLNEWNQVHGLEL  403

Query  1383  FGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSC  1204
             F S  Y  AMD V + +GV    S EGL    LRKGC+ LG  V +VPRN  + HYCG C
Sbjct  404   FESKAYHQAMDVVARDMGVQTQVSDEGLACSALRKGCQELGFPVVNVPRNSPDDHYCGWC  463

Query  1203  GYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVI----AKS  1039
              +GC+ G KKG   T+L+D VN+G  V+++G +  + +  + +  R   +GV+     K 
Sbjct  464   CFGCKDGKKKGTGETWLLDMVNSGNGVVVSGARVVEVVQRKRKGMRNLAVGVVFERENKR  523

Query  1038  KGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-E  862
              G  +   I ++ TV ACG+L TP LL  SGL+++ IG NLH+HP   AWGYFPE+   E
Sbjct  524   LGCRERFMIVSKVTVVACGALGTPVLLKKSGLRSQEIGRNLHIHPTNMAWGYFPENRDFE  583

Query  861   MEGKNHQGGIITSIHKVV--SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYS  688
              E ++++GGI+T++  V   S+ +    +I+  +L P  F+ V PW S LDMKERM ++S
Sbjct  584   KEKRSYEGGILTAMLPVPGKSKDSGYGGLIQNPALHPGMFSVVMPWMSSLDMKERMTRFS  643

Query  687   RTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSD  508
             RTV++F++VRD GSG V     + Y+M   DK+ +   + + LRIL AAGA E+GT  S+
Sbjct  644   RTVHLFALVRDKGSGVVSSPPYLSYKMSHSDKETMSNCMEKMLRILAAAGAEEIGTHGSN  703

Query  507   GQKICCKGIKTEELESFLDGVVATGGPMSGEEN--WTLYCSAHQMGSCRMGATEEDGAID  334
             G++I  K   + E E F+  V  +  P+    N  W   CSAHQMG+CRMGA   D  +D
Sbjct  704   GERINVKVASSHEFERFVREV--SRKPLQRFSNGYWRPICSAHQMGTCRMGAHPNDSVVD  761

Query  333   NNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNG  211
               GECWE +GLY+ D SV P+A+GVNPM+T+ + AYC ++ 
Sbjct  762   QKGECWEVEGLYIADSSVFPTALGVNPMLTVQAIAYCTAHA  802



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   536 bits (1380),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 302/771 (39%), Positives = 453/771 (59%), Gaps = 53/771 (7%)
 Frame = -3

Query  2355  LLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDE  2176
             L  GG R  Y + LSS + ++L A+C+  +P I +   + + ++ +FY +SAS    P  
Sbjct  39    LFLGGERQLYPNSLSSREMESLTALCDTFLPSIDVSDTTTNASLVAFYRTSASMAGTPQR  98

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             V  ++  R     +++ RL L  LST +GS +LCG      ++P+  +F ++  ++RE I
Sbjct  99    VGGLISERMKHPKLWLMRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEI  158

Query  1995  LLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF--------------  1858
             LL WS     L LR++F ++K+    ++F+  +E   N +W+AI +              
Sbjct  159   LLSWSLSYFYL-LRMLFKSMKLLTLLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKF  217

Query  1857  ------------HVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQN  1714
                         + + N  P  ++   PL +GII  +++    + ++L   G+  +   +
Sbjct  218   KASTTIGSQRPNNEEQNACPHKEELFGPLNRGII-NLDKPKDLVVDALSTFGIPASVLHS  276

Query  1713  ANT--------LTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
               T        LTIRCD V++GSG GGGV A VLA +G+KVVV+EKG+Y   ++ + LEG
Sbjct  277   EKTVNCSSNPSLTIRCDAVVIGSGSGGGVVAGVLATAGYKVVVIEKGNYHARKNLTLLEG  336

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
             P++ ++Y SGG++ T D  V V AG+ VGGGSAINWSASI+TP +V+ EW  + ++ LF 
Sbjct  337   PAMDQMYLSGGLIATDDMGVFVLAGSTVGGGSAINWSASIRTPQHVIKEWCNDHELELFD  396

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S  YQ A+D VC+++GV     +EG  N +LRKGC+ LG  V ++PRN    HYCG C +
Sbjct  397   SKLYQEALDVVCEKMGVQSQIQEEGFNNAILRKGCQELGYPVNNIPRNSPPNHYCGWCCF  456

Query  1197  GCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKK--CLGVIAKSK--G  1033
             GC+ G K G   T+LVD VN+G   ILTGC+A K + +  +  R +    GV  + +  G
Sbjct  457   GCKDGRKGGTTETWLVDLVNSGNGAILTGCEAIKVLHKRKKGRRDRNTATGVAFEFEHGG  516

Query  1032  NNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA----  865
               +I  +E++ T+ ACG+L TP LL  SGLKN NIG NLHLHPV  AWGYFP+S      
Sbjct  517   GKEIGFVESKVTIVACGALCTPKLLKRSGLKNVNIGENLHLHPVAMAWGYFPDSQVFDGR  576

Query  864   -EMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRK  694
              E E K+++GGI+T++  VV+E  K    A+I+  +L P  F+ V PW SG D+K RM +
Sbjct  577   PEREKKSYEGGIMTAMSTVVAEFNKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSR  636

Query  693   YSRTVNIFSMVRDHGSGQVKKAG-RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTF  517
             +SRT ++F++ RD GSG V      I Y M+ +D++N++ GL ++LRIL AAGA ++GT 
Sbjct  637   FSRTAHVFALARDKGSGTVNAPPYSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTH  696

Query  516   RSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAI  337
                G+ +  K    +E E F+     +  P+   E  +  CSAHQMGSCRMG   +   +
Sbjct  697   HFKGKGLHVKKSNLDEFERFVKE--ESSRPL--RELSSAICSAHQMGSCRMGVDSKQSVL  752

Query  336   DNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             +  GE WE +GL+V D SV P+A+GVNPM+T+ + AYC S  + + L   K
Sbjct  753   NQMGETWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTSQSILQVLRRKK  803



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   534 bits (1375),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 307/733 (42%), Positives = 452/733 (62%), Gaps = 38/733 (5%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPLPQ--DSDDEAMCSFYSSSASQPPFPDEVAEVVMR  2155
             Y + L++ + ++L AIC+ LIP I   +    +D+ +  +YS+SASQ   PD VA ++  
Sbjct  16    YTNSLTAREMESLVAICDTLIPSIDGSKLGHVEDDGVARYYSASASQTGTPDRVARLMSE  75

Query  2154  RFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRE  1975
             R      +I R+ L  LST +GSL+LCG   F G +P+   F +LP K+RE ILL WS  
Sbjct  76    RLDHPKKWILRVGLWFLSTWIGSLILCGRKSFSGEFPYFRRFCKLPEKQREEILLNWSSS  135

Query  1974  TLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGR------  1813
              ++L +R++F ++K+    ++F+  DE   N AW+AIG++  T++    ++         
Sbjct  136   YIVL-IRMLFRSLKLITALVFFTQLDEQGQNLAWKAIGYNGPTSDDSDHEEELNEKKKKK  194

Query  1812  -------PLEKGIIETINENGTTLKESLIKKGLNV-TESQNAN-------TLTIRCDvvi  1678
                    PL  GII+  N      K+ L  +G  V T   N N        +TIRCD V+
Sbjct  195   KPEEIFGPLYNGIIDLTNPRDAVAKK-LTGRGFTVSTPKSNKNGSFISDPVMTIRCDAVV  253

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSG GGGV A VLA +G+KV+V+EKG+Y+   + S LEG +L E+Y S G+L T+D  V
Sbjct  254   VGSGSGGGVVAGVLAKAGYKVLVVEKGNYYARSNLSLLEGQALDEMYLSAGLLATSDMNV  313

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
             ++ AG+ VGGGS INWSASIKTP +V+ EW+ + K+ +FGS  Y+ AMD VC+R+GV   
Sbjct  314   VILAGSTVGGGSTINWSASIKTPEHVMKEWADKSKLEMFGSDLYREAMDVVCERMGVQCG  373

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
               +EG  N++LRKGCE LGL+V+++PRN    HYCG C  GC+ G K+G   T+LVD V 
Sbjct  374   FVEEGFNNEILRKGCEELGLQVKNIPRNSPSDHYCGFCCLGCKKGQKQGTSETWLVDLVE  433

Query  1137  NG-AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPL  961
             +G  +IL GC+A + + E +   +KK    +A + G  ++  +E++A + ACG+L TP L
Sbjct  434   SGNGLILPGCEAMEVLYEREPGKKKKIATGVAFAFG-EEVYVVESKAAIVACGALRTPDL  492

Query  960   LISSGLKNKNIGSNLHLHPVLFAWGYF--PESMAEMEGKNHQGGIITSIHKVVSEGTKQA  787
             L  SGLKN NIG NL LHPV+ AWG+F   E   E + K+++GGI+T++  VV+  T+ +
Sbjct  493   LKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKSYEGGIMTAMSSVVNAETRSS  552

Query  786   ---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQ  616
                 +I+  SL P  F+ + PWTS  D K RM K+SRT ++F+++RD G+G +     I 
Sbjct  553   YGETVIQTPSLHPGMFSGIIPWTSSKDFKTRMLKFSRTAHVFALLRDRGTGTISSKSCID  612

Query  615   YRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVAT  436
             Y +   D+++++ GL + L IL+AAGA E+GT  S+G+ +        ++  F+    + 
Sbjct  613   YNLQDEDEESLKKGLERVLEILIAAGAEEIGTHNSEGKSLNITTANALQIARFVREESSK  672

Query  435   G-GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGV  259
             G   +SG+      CSAHQMGSCRMG   E+ A+   GE WE +GL+V D SV P+A+GV
Sbjct  673   GLKDLSGQ-----ICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGV  727

Query  258   NPMITILSTAYCI  220
             NPM+T+ S AYCI
Sbjct  728   NPMVTVQSIAYCI  740



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   534 bits (1376),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 307/731 (42%), Positives = 448/731 (61%), Gaps = 37/731 (5%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPLPQDSD-DEAMCSFYSSSASQPPFPDEVAEVVMRR  2152
             Y + L+  + ++L AIC+ LIP I        D+++  ++S+SASQ   PD VA+++  R
Sbjct  36    YANSLTQREMESLVAICDTLIPSIDGSGVGHVDDSVAEYFSASASQTGTPDRVAKLISER  95

Query  2151  FLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRET  1972
                   +I R+ L  LST +GS +LCG   F G +P+   F  LP K+RE +LL WS   
Sbjct  96    LDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASY  155

Query  1971  LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH------------VDTNEVPPD  1828
               L LR+ F  IK+    ++F+  D    N AW+AIG++            ++  +  PD
Sbjct  156   FSL-LRMFFKCIKLITGLVFFTQVDGKGRNLAWKAIGYNGPSLDDSDLQEELNEKKKKPD  214

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVT--------ESQNANTLTIRCDvvivg  1672
             +  G PL  GI++  +      K+ L  +G  V+         S +   +TIRCD V+VG
Sbjct  215   EIFG-PLYNGIVDLKSPREVVTKK-LTDRGFTVSTPKKIQKGSSLSNRVMTIRCDAVVVG  272

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SG GGGV A VLA +G+KV+V+E G+Y+     S LEG ++ E+Y SGG+L T+D  V+V
Sbjct  273   SGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVVV  332

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGS INWSASIKTP +V+NEW+ + K+ +FGS  Y+ AMD VCKR+GV     
Sbjct  333   LAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLEMFGSDSYREAMDVVCKRMGVQCGFV  392

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG  N++LRKGCE LGL V+++PRN    HYCG C  GC+ G K+G   T+LVD V +G
Sbjct  393   EEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESG  452

Query  1131  -AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLI  955
               +IL GC+  + + E ++  +KK    ++ + G  +I  +E+RATV ACG+L TP LL 
Sbjct  453   NGLILPGCEVMEVLYECEQGKKKKKASGVSFAFG-EEIYVVESRATVVACGALKTPHLLK  511

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFP--ESMAEMEGKNHQGGIITSIHKVVSEGTKQA--  787
              SGLKN NIG NL LHPV+ AWG+FP  +   E +  +++GGI+T++  VV+  T+ +  
Sbjct  512   RSGLKNGNIGRNLCLHPVVMAWGWFPKEDKWPEKKKMSYEGGIMTAMSSVVNAKTQSSYG  571

Query  786   -AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
               +I+  +L P  F+ V+PWTS  D K RM K+SRT +IF+++RD G+G V     I Y 
Sbjct  572   ETVIQTPALHPGMFSGVTPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSCIDYN  631

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL-DGVVATG  433
             ++  D+++++ GL + L+IL A+GA E+GT   +G+ +  +     E+E F+ +      
Sbjct  632   LNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREESSKPL  691

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
               +SG+      CSAHQMGSCRMG   E+ A+   GE WE +GL+V D SV P+A+GVNP
Sbjct  692   KDLSGQ-----LCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNP  746

Query  252   MITILSTAYCI  220
             M+T+ S AYCI
Sbjct  747   MVTVQSIAYCI  757



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   533 bits (1374),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 310/737 (42%), Positives = 454/737 (62%), Gaps = 45/737 (6%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPLPQDSD--DEAMCSFYSSSASQPPFPDEVAEVVMR  2155
             Y + L+  + + L A C+ LIP I         D+++  ++++SASQ   PD VA ++  
Sbjct  24    YANSLTQREMETLVAFCDTLIPSIDGSGVGGHVDDSVAEYFAASASQTGTPDRVARLMSE  83

Query  2154  RFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRE  1975
             R      +I R+ L +LST +GSL+LCG   F G +P+   F  LP K+REAILL WS  
Sbjct  84    RLDHPKKWILRVALWLLSTWIGSLVLCGRRSFTGEFPYFRRFCRLPTKQREAILLNWSES  143

Query  1974  TLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH---VDTNEVPPDQQTGR---  1813
                L LR+ F  IK+   F++F+  DE   N AW+AIG++   +D ++   +++      
Sbjct  144   YFSL-LRMFFRCIKLITAFVFFTQVDEKGRNLAWKAIGYNGPSLDDSDHDLEEELNEKKK  202

Query  1812  -------PLEKGIIETINENGTTLKESLIKKGLNVTESQNAN--------TLTIRCDvvi  1678
                    PL  GI++ +N     + + L  +G  V+  +N +         +TIRCD V+
Sbjct  203   KPEEIFGPLYNGIVD-LNCPREAVTKKLTGRGFTVSSQKNKSKGSSLSNPVMTIRCDAVV  261

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSG GGGV A VLA +G+KV+V+E G+Y+   + S LEG ++ ++Y SGG+L T+D  V
Sbjct  262   VGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSNLSLLEGQAMEDMYLSGGLLATSDTNV  321

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
             ++ AG+ VGGGS INWSASIKTP +V+ EW+ + K+ +FGS  Y+ AMD VC+R+GV   
Sbjct  322   VILAGSTVGGGSTINWSASIKTPEHVMKEWTEKSKLEMFGSDLYREAMDVVCERMGVQCG  381

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
               +EG  N++LRKGCE LGL V+++PRN    HYCG C  GC+ G K+G   T+LVD V 
Sbjct  382   FVEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGHCCLGCKKGQKQGTSETWLVDLVQ  441

Query  1137  NG-AVILTGCQAEKFIL--EEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTP  967
             +G  +IL GC+A + +   E+ +  +KK  GV A + G  +I  +E+RATV ACG+L TP
Sbjct  442   SGNGLILPGCKAMEVLYECEQGKKNKKKATGV-AFAFG-EEIYVVESRATVVACGALRTP  499

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEGK--NHQGGIITSIHKVVSEGTK  793
              LL  SGLKN NIG NL LHPV+ AWG+FPE     E K  +++GGI+T++  VV+  T+
Sbjct  500   HLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEGEKWPEKKKMSYEGGIMTAMSSVVNAETQ  559

Query  792   QA---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGR  622
              +    +I+  +L P  F+ V+PW S  D K RM K+SRT +IF+++RD G+G +     
Sbjct  560   SSYGETVIQTPALHPGMFSGVTPWASSKDFKTRMLKFSRTAHIFALLRDKGTGTINSKSY  619

Query  621   IQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVV  442
             I Y ++  D+++++ GL + L+I+ AAGA E+GT  S+G+ +  +     E E F+    
Sbjct  620   IDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRASAVEFERFVRE--  677

Query  441   ATGGP---MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
              +  P   +SG+      CSAHQMGSCRMG   E+ A+   GE WE +GL+V D SV P+
Sbjct  678   ESSKPLKNLSGQ-----ICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPT  732

Query  270   AIGVNPMITILSTAYCI  220
             A+GVNPM+T+ S AYCI
Sbjct  733   ALGVNPMVTVQSIAYCI  749



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   534 bits (1375),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 314/753 (42%), Positives = 461/753 (61%), Gaps = 38/753 (5%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD-DEAMCSFY  2212
             E K++     P  +   +  Y + L++ + ++L AIC+ LIP +   +    D+ +  +Y
Sbjct  15    EAKLDVEFGSPRQQDETKTLYANSLTAREMESLVAICDTLIPSLDGAEVGHLDDGVAGYY  74

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
             S+SAS    PD VA ++ +R      +I R+ L  LST +GSL+LCG   F G +P+   
Sbjct  75    SASASHTGTPDRVARLMSQRLHHPKKWILRVGLWSLSTWIGSLVLCGQRSFIGGFPYFQR  134

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF--  1858
             F  LP K+RE  LL W+    +L LR+ F +IK+    ++F+  DE   N AW+AIG+  
Sbjct  135   FCRLPKKQREETLLNWASSYFLL-LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNG  193

Query  1857  ----HVDTNEVPPDQQTGRPLEKGIIETINENGTTLK---ESLIKK----GLNVTESQNA  1711
                 H D  E   + +T + + K I   +      LK   E++ KK    G  ++ +Q +
Sbjct  194   PSSDHSDHEEELNETKTNKNMPKEIFGPLYNGIINLKKPREAVTKKLTGHGFTIS-TQKS  252

Query  1710  N---------TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
             N          +TIRCD V+VGSG GGGV A +LA +G+KV+V+EKG+Y+   + S LEG
Sbjct  253   NKKRSSISNPVMTIRCDAVVVGSGSGGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEG  312

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
              ++ E+Y SGG+L T+D  V++ AG+ VGGGS INWSASIKTP +V+ EW+ + ++ LF 
Sbjct  313   QAMDEMYLSGGLLATSDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFE  372

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S+ Y+ AMD VC+R+GV     +EG  N+VLRKGCE LGL+V+++PRN S+ HYCG C  
Sbjct  373   SNLYREAMDVVCERMGVQCGFVEEGFNNEVLRKGCEELGLQVKNIPRNASKDHYCGFCSL  432

Query  1197  GCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKI  1021
             GC+ G K+G   T+LVD V +G  +IL GC+A + + E +   +KK    IA + G + I
Sbjct  433   GCKKGQKQGTSETWLVDLVESGNGLILPGCKAMEVLYESEGGNKKKTSTGIAFAFGED-I  491

Query  1020  LRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYF--PESMAEMEGKN  847
               +E+RATV ACG+L TP LL  SGLKN NIG NL LHPV+ AWG+F   E   E + K+
Sbjct  492   YVVESRATVVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKS  551

Query  846   HQGGIITSIHKVVSEGTKQA---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVN  676
             ++GGI+T++  VV+   K      +I+  SL P  F+ V PWTS  D K RM K+SRT +
Sbjct  552   YEGGIMTAMSSVVNAEAKTTYGETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTAH  611

Query  675   IFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKI  496
             +F+++RD G+G +     I Y ++  D+++++ GL   L IL+AAGA E+GT  S+G+ +
Sbjct  612   VFTLLRDKGTGTINSKSYIDYNLNDEDEESLKKGLGSVLNILIAAGAEEIGTHNSEGKSL  671

Query  495   CCKGIKTEELESFL-DGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGEC  319
               +     E++ F+ +    +   +SG+      CSAHQMGSCRMG   E+ A+   GE 
Sbjct  672   NVRTASAVEIKRFVREESSKSLKDLSGQ-----ICSAHQMGSCRMGIRPEESAVKPTGET  726

Query  318   WEAKGLYVCDGSVLPSAIGVNPMITILSTAYCI  220
             WE +GL+V D SV P+A+GVNPM+T+ S AYCI
Sbjct  727   WEVEGLFVADTSVFPTALGVNPMVTVQSIAYCI  759



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   533 bits (1373),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 315/763 (41%), Positives = 441/763 (58%), Gaps = 52/763 (7%)
 Frame = -3

Query  2337  RNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDD---EAMCSFYSSSASQPPFPDEVAE  2167
             + +Y +  S    +AL A+C+  +P I +  D D    +++ +FY +SAS    P  VAE
Sbjct  6     KTTYKNAFSKRDMEALTALCDTFLPAIDV-SDHDPHLPQSVANFYQTSASMSETPPLVAE  64

Query  2166  VVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLK  1987
              +  +     + + ++ + +LST +G+ +LCG       +P++  FS +   +RE ILL 
Sbjct  65    FIAEKVKHPKILLAKVAVKMLSTWIGTFILCGRKSLSDDFPYLQRFSRVESLKREEILLS  124

Query  1986  WSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF---HVDTNEVPPDQQTG  1816
             WS     L LRI+F  +KI   F +F+  DE  +N +W+AIG+     D     P  Q  
Sbjct  125   WSNSCFSL-LRILFSALKIFILFTFFTQVDEKEDNISWKAIGYCGPDPDFKTRKPQYQEC  183

Query  1815  R----------------PLEKGII----ETINENGTTLKESLIKKGLNVTESQNANT---  1705
                              PL KGII    + I ++   L++S     +        NT   
Sbjct  184   EQKEENDHKSIEEDLFGPLHKGIINFSHQPIEKSLRKLRDSGFTTAVVSKPYSEKNTSVG  243

Query  1704  ------LTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGE  1543
                     ++CD VIVGSG GGGV A VLA +GHKVVVLEKG Y    + S LEG +L +
Sbjct  244   SLLNPSFVLKCDAVIVGSGSGGGVVAGVLAKAGHKVVVLEKGSYLARSNLSLLEGEALDQ  303

Query  1542  LYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQ  1363
             +Y   G++ + +  V+  AG+ VGGGSA+NWSAS +TP++V  EWS +  + LFGS  Y+
Sbjct  304   MYLGNGIVASDNMDVLFLAGSTVGGGSAVNWSASFRTPSHVTKEWSEKHGLELFGSKNYE  363

Query  1362  SAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTG  1183
             +A+D VC+++GV      EG  N VLRKGCE LG +V ++PRN    HYCG C  GC+ G
Sbjct  364   NALDVVCEKMGVQSEFDDEGFNNMVLRKGCEGLGYQVGNIPRNAPSDHYCGWCCMGCKDG  423

Query  1182  DKKGVDTTYLVDAV--NNGAVILTGCQAEKFILEEDET--ARKKCLGV---IAKSKGNNK  1024
              KKG   T+LVD V   NGA IL+ C+A K I  E +T   RK   GV       +G  +
Sbjct  424   RKKGTLETWLVDLVESKNGA-ILSECEALKVITTEGKTVNGRKMATGVAFAFRNEEGGQE  482

Query  1023  ILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE-SMAEMEGKN  847
             I  +EA+ TV+ACG++ TP LL  SGLKNKNIG NLH+HPV+ AWGYFPE S  E E ++
Sbjct  483   IGIVEAKVTVTACGAMCTPQLLKKSGLKNKNIGKNLHVHPVVMAWGYFPEDSWPETEKRS  542

Query  846   HQGGIITSIHKVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNI  673
             H+GGI+T++ KVVS  E +   A+I+  SL P  F+AV PW SG D K+RM KYSRT ++
Sbjct  543   HKGGIMTAMSKVVSNFETSGYGAVIQTPSLHPGLFSAVMPWVSGKDFKDRMVKYSRTAHV  602

Query  672   FSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKIC  493
             F++ RD G G +     I Y++D +D++N+R G+ + LRIL AAGA E+GT   DG  + 
Sbjct  603   FALARDKGRGTIASPSDISYKLDDLDRENLREGIERVLRILAAAGAEEIGTHHRDGGVLK  662

Query  492   CKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWE  313
              KG   EE E F++    +  P+      T   SAHQMGSCRMG       +D  GE WE
Sbjct  663   VKGASREEFEGFVE--RESMRPLRNLS--TPIASAHQMGSCRMGVDSGGSGVDPRGETWE  718

Query  312   AKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
              +GL+V D SV P+A+GVNPM+T+ + AYC +  + + L   K
Sbjct  719   VEGLFVADSSVFPTALGVNPMVTVQAIAYCTAQSVLEILGGKK  761



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   534 bits (1376),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 312/766 (41%), Positives = 454/766 (59%), Gaps = 56/766 (7%)
 Frame = -3

Query  2349  RGGRRNSYNHGLSSSQYQALAAICEALIPPIP--LPQDSDDEAMCSFYSSSASQPPFPDE  2176
             R   +    + LS  Q ++L A+C+ +IP I   + + SDDE++ +FY +SAS    P  
Sbjct  52    RDKHQKPLTNSLSPRQMKSLVALCDTIIPSIDNNVVRSSDDESVANFYKTSASMAGTPQH  111

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             + +++  +    + ++  L L +LST  G+L+LCG      R+PF H++ E+ L +R+ +
Sbjct  112   LGKLISEKVKHPSTWLLLLTLWLLSTWFGTLILCGMASVSSRFPFFHSYPEMSLLKRQRV  171

Query  1995  LLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF--------------  1858
             +  WS  + + PLR+ F TIK+     +F+  DE   NP+W+AIG+              
Sbjct  172   MQSWSL-SYLRPLRMFFRTIKLLTLLTFFTQVDEAEENPSWKAIGYCGPDPEFKAQLKNN  230

Query  1857  --HVDTNEVPPDQQTGR---------PLEKGIIETINENGTTLKESLIKKGLNVT-----  1726
               H  + E    ++            PL KG++  +N     +K SL + G +V+     
Sbjct  231   FLHRTSKEEQHQKKDDDDDEEEEFRGPLHKGLVH-LNYPRDMIKNSLRRFGFSVSTISKK  289

Query  1725  -ESQNANT--LTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGP  1555
              E+ N ++  L I+CD V+VGSG GGGVAA VLAN+G+KV+VLEKG Y    + S LEGP
Sbjct  290   HEASNLSSPSLVIQCDAVVVGSGSGGGVAAGVLANAGYKVLVLEKGSYCARNNLSLLEGP  349

Query  1554  SLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGS  1375
             S+ ++Y S G++ T D  V++ AG+ VGGGSA+NWSASIKTP +V  EW    ++ LF S
Sbjct  350   SMDQMYLSNGLVATKDMSVLILAGSTVGGGSAVNWSASIKTPQHVCKEWCDLHELELFES  409

Query  1374  SEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYG  1195
               Y+ AMDAVC ++GV     +EG  N+VLR+GC  +G  V ++PRN S  HYCG C  G
Sbjct  410   KLYREAMDAVCGKMGVQSEVEEEGFNNEVLRRGCLEMGYHVCNIPRNASSDHYCGWCCMG  469

Query  1194  CRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFI-----LEEDETARKKCLGVIAKSKG  1033
             C+ G+KK    T+LVD V +G   I+  C+A + +       E +TAR     +  + KG
Sbjct  470   CKDGNKKSTSETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGSEKKTARGVAFAI--EYKG  527

Query  1032  NNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA----  865
                I  +E++ T+ ACG+L TP LL  SGLKN+NIG NLHLHPV  AWGYFP+S +    
Sbjct  528   KKDICVVESKVTIVACGALSTPALLKKSGLKNENIGKNLHLHPVAMAWGYFPDSSSPKMW  587

Query  864   -EMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRK  694
              E   K+++GGI+T++  VV++  K    A+I+  SL P  F+ + PWTSG DMK+RM K
Sbjct  588   PEKHKKSYEGGIMTAMSTVVAQFDKTGYGAVIQTPSLHPGMFSILMPWTSGKDMKDRMHK  647

Query  693   YSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFR  514
             +SRT ++F++ RD GSG V     I Y +  +DK+N+ TG+ + LRIL AAGA E+GT  
Sbjct  648   FSRTAHVFALARDQGSGTVNSPSLISYELKDVDKENLETGIEKVLRILAAAGAEEIGTHN  707

Query  513   SDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAID  334
             + G+ I  K +   E E F    V     MS  +  T  CSAHQMGSC+MG    D  ++
Sbjct  708   NKGRSINVKQVSYHEFEKF----VKEESSMSLTDLTTPLCSAHQMGSCKMGTNPSDSVVN  763

Query  333   NNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSL  196
               GE WE +GLY+ D SV P+A+GVNPM+T+ + AYC +  +A+ L
Sbjct  764   QMGETWEVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQYVAEVL  809



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   532 bits (1370),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 316/753 (42%), Positives = 455/753 (60%), Gaps = 38/753 (5%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSD-DEAMCSFY  2212
             E K++     P  +   +  Y + L++ + ++L AIC+ LIP I   +    D+ +  +Y
Sbjct  15    EAKLDVEFGSPRQQDETKTLYANSLTAREMESLVAICDTLIPSIDGAEVGHLDDGVAGYY  74

Query  2211  SSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHN  2032
             S+SAS    PD VA ++ +R      +I R+ L  LST +GSL+LCG   F G +PF   
Sbjct  75    SASASHTGTPDRVARLMSQRLHHPRKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQR  134

Query  2031  FSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF--  1858
             F  LP K+RE  LL W+    +L LR+ F +IK+    ++F+  DE   N AW+AIG+  
Sbjct  135   FCRLPKKQREETLLNWASSYFLL-LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNG  193

Query  1857  ----HVDTNEVPPDQQTGR--------PLEKGIIETINENGTTLKESLIKKGLNVTESQN  1714
                 H D  E   + +T +        PL  GII  + +    + + L   G  V+  ++
Sbjct  194   PSSDHSDHEEELNETKTNKEMPKEIFGPLYNGII-NLKKPREAVTKKLTDHGFTVSTQKS  252

Query  1713  AN--------TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
              N         +TIRCD V+VGSG GGGV A +LA +G KV+V+EKG+Y+   + S LEG
Sbjct  253   NNNRSSISNPVMTIRCDAVVVGSGSGGGVVAGLLAKAGFKVLVVEKGNYYARSNLSQLEG  312

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
              ++ E+Y SGG+L T+D  V++ AG+ VGGGS INWSASIKTP +V+ EW+ + ++ LF 
Sbjct  313   QAMDEMYLSGGLLATSDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFE  372

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S  Y+ AMD VC+R+GV     +EG  N+VLRKGCE LGLKV+++PRN S+ HYCG C  
Sbjct  373   SDLYREAMDVVCERMGVQCGFVEEGFNNEVLRKGCEELGLKVKNIPRNASKDHYCGFCSL  432

Query  1197  GCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKI  1021
             GC+ G K+G   T+LVD V +G   IL GC+A + + E +   +KK    IA + G + I
Sbjct  433   GCKKGQKQGTSETWLVDLVESGNGSILPGCKAMEVLYECEGGNKKKTSTGIAFAFGED-I  491

Query  1020  LRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYF--PESMAEMEGKN  847
               +E+RATV ACG+L TP LL  SGLKN NIG NL LHPV+ AWG+F   E   E + K+
Sbjct  492   YVVESRATVVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKS  551

Query  846   HQGGIITSIHKVVSEGTKQA---AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVN  676
             ++GGI+T++  V++   K      +I+  SL P  F+ V PWTS  D K RM K+SRT +
Sbjct  552   YEGGIMTAMSSVLNAEAKTTYGETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTAH  611

Query  675   IFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKI  496
             +F+++RD G+G +     I Y ++  D+++++ GL   L IL+AAGA E+GT  S G+ +
Sbjct  612   VFTLLRDKGTGTINSKSYIDYNLNDEDEESLKKGLESVLNILIAAGAEEIGTHNSKGKSL  671

Query  495   CCKGIKTEELESFL-DGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGEC  319
               +     E+E F+ +    +   +SG+      CSAHQMGSCRMG   E+ A+   GE 
Sbjct  672   NVRTASAVEIERFVREESSKSLKDLSGQ-----ICSAHQMGSCRMGIRPEESAVRPMGET  726

Query  318   WEAKGLYVCDGSVLPSAIGVNPMITILSTAYCI  220
             WE +GL+V D SV P+A+GVNPM+T+ S AYCI
Sbjct  727   WEVEGLFVADTSVFPTALGVNPMVTVQSIAYCI  759



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   543 bits (1399),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 350/890 (39%), Positives = 491/890 (55%), Gaps = 97/890 (11%)
 Frame = -3

Query  2580  MHVHPTD-----SEV---PKSHGLISTARGFTLLRPGSIQYLW------------HYLAV  2461
             +H  P+D      E+   P  H L ST  G  L RP S  Y++            H   V
Sbjct  256   LHFQPSDGIYDAEEIEFFPDEHMLPSTTTGLDLYRPSSESYVFGLQGPSTPHLSSHIGYV  315

Query  2460  RESVASITAKQ-------------REREREGEKIFKREKKMN--------ERKCHPLLRG  2344
               S A I A +             +E   E   + +RE++          + +  PL   
Sbjct  316   GLSEAPIYASKDALQIVRCWKKLRKEGSMEENGVGRREEQTTMIELSTGIDIEKLPLWEE  375

Query  2343  GR--RNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDEVA  2170
              R  RN Y + +SS + ++L AIC+A +P + +   +D +A+ +FY SSAS    P+ V 
Sbjct  376   ERQYRNCYVNSISSREMESLTAICDAFLPSLHV-SAADADAVATFYQSSASMAATPERVG  434

Query  2169  EVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILL  1990
              ++  R      ++ RL L +LST LG+ +LCG       +PF H FS+L  ++RE ILL
Sbjct  435   GLLSERMEHPKKWMIRLALWLLSTWLGTFVLCGPRSLSTNFPFFHTFSQLSQQKREEILL  494

Query  1989  KWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPD------  1828
              WS  +    LR++F + K+    ++FS  DE   N +W+AIG+     E  P       
Sbjct  495   SWSL-SFFYHLRMLFKSTKLLTLLVFFSQVDEKNQNLSWKAIGYCGPDPEFQPQASRLKT  553

Query  1827  -QQTGR---------------------PLEKGIIETINENGTTLKESLIKKGLNVT----  1726
              +Q G                      PL +G+I  +      + ++L++ GL V+    
Sbjct  554   SKQNGYGNFICKEQECKEDGEKEERYGPLCRGLI-NLKHPRDVVADNLLRFGLPVSVRPK  612

Query  1725  ----ESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
                  + +  +LTI+CD VIVGSG GGGV A VLA +G+KV+VLEKG+YF   + S LEG
Sbjct  613   KINPPNLSHPSLTIKCDAVIVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARSNLSLLEG  672

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
             PS+ ++Y SGGML T D  V++ AG+ VGGGS INWSASIKTP +V+NEW    K+ LF 
Sbjct  673   PSMDQMYMSGGMLATDDMGVVILAGSTVGGGSTINWSASIKTPQHVINEWCDRCKLELFD  732

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S  Y+ AMD VC+++GV     +EG  N VLRKGCE LG  V  +PRN    HYCG C  
Sbjct  733   SKLYKEAMDVVCEKMGVQSEIVEEGFNNAVLRKGCEELGYPVNDIPRNSPPDHYCGWCCM  792

Query  1197  GCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSKGN  1030
             GC+ G KKG   T+LVD VN+G  VIL GC+A K + +  +   +     IA   +  G 
Sbjct  793   GCKDGRKKGTSETWLVDLVNSGNGVILPGCEAIKVLHKRRKGRGRNRATGIAFQLEYVGA  852

Query  1029  NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPES-----MA  865
               I  +E++ T+ ACG+L TPPLL  SGLKN NIG NLHLHPV  AWGYFP++       
Sbjct  853   KDICIVESKVTIVACGALSTPPLLKRSGLKNANIGKNLHLHPVAMAWGYFPDAPLSSGWP  912

Query  864   EMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKY  691
             E E K+++GGI+T++  VV+   K    A+++  +L P  F+A+ PW SG DMK RM ++
Sbjct  913   EKEKKSYEGGIMTAMSTVVANMDKSGYGAVLQTPALHPGMFSALMPWLSGADMKRRMLRF  972

Query  690   SRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRS  511
             SRT +IF++ RD GSG V     I Y+M+  D++N++ GL + LRIL AAGA E+GT   
Sbjct  973   SRTAHIFALARDKGSGDVYSPDSIGYKMEATDEENLKKGLDKILRILAAAGAEEIGTHHC  1032

Query  510   DGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDN  331
              G+ I  K   + E E F+     +  P+      T  CSAHQMGSCRMG   +   ++ 
Sbjct  1033  KGKSINVKQASSHEFERFVKE--ESSRPLRDLN--TQICSAHQMGSCRMGIDPKQSVVNQ  1088

Query  330   NGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
              GE WE +GL+V D SV P+A+GVNPM+TI + AYC +  +   L   K+
Sbjct  1089  MGETWEVEGLFVADSSVFPTALGVNPMVTIQAIAYCTAQSVLDVLKRKKS  1138



>gb|ACR36076.1| unknown [Zea mays]
 tpg|DAA49651.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=544

 Score =   523 bits (1348),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/436 (58%), Positives = 324/436 (74%), Gaps = 16/436 (4%)
 Frame = -3

Query  1458  INWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRK  1279
             +NWSASI+TP  V  EW+ E  +P+F S  Y  AMDAVC R+GVT+ C +EG QN+V+R+
Sbjct  110   VNWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRR  169

Query  1278  GCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQAEK  1099
             GCE LGL  ++VPRN S+ H+CGSC +GC TGDK+G DTT+LVDAV  GAVILTGC+AE 
Sbjct  170   GCEALGLCADAVPRNSSDAHFCGSCNFGCPTGDKRGTDTTWLVDAVARGAVILTGCKAEY  229

Query  1098  FILEEDE------TARKKCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPLLISSGL  943
             F+LE++          KKC+G++A   S G  K LRIEA+ +++ACG+L TPPLL  SGL
Sbjct  230   FVLEKNHSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACGALMTPPLLRRSGL  289

Query  942   KNKNIGSNLHLHPVLFAWGYFPESMAE--MEGKNHQGGIITSIHKVVSEGTKQAAIIEAV  769
             KN++IGSNLHLHPV  AWGYFPE+  +  + GK ++GGIITS+H+V         IIE  
Sbjct  290   KNRHIGSNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHRVTDR-----TIIETP  344

Query  768   SLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKD  589
             +LGP  FAA+ PW SG DMKERMR+YSRT + F++VRD G G V   GR+++   + D D
Sbjct  345   ALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPSREDVD  404

Query  588   NIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM-SGEE  412
              +R GLR+ LRILVAAGAAEVGT RSDG ++ CKG++ E+LE FLD V    GPM S  +
Sbjct  405   ELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVD  464

Query  411   NWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILST  232
              W L+CSAHQMGSCRMG++ +DGA+D  GE WEA+GLYVCDGS+LP+A+GVNPMITI S 
Sbjct  465   KWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSI  524

Query  231   AYCISNGLAKSLNSGK  184
             A+C+S G+A+++  G+
Sbjct  525   AFCLSKGIAETMAQGQ  540


 Score = 63.2 bits (152),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 7/75 (9%)
 Frame = -3

Query  2361  HPLLRGG-RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS------DDEAMCSFYSSS  2203
             HPLLRGG RR+ Y HG+  +Q +AL A+C ALIP +P   D+        + +  FY +S
Sbjct  36    HPLLRGGWRRDRYTHGMRPAQMEALRAMCGALIPSLPADADAGRGDPPGGKDLERFYLAS  95

Query  2202  ASQPPFPDEVAEVVM  2158
             A+    PDEVAE+++
Sbjct  96    AADSTIPDEVAELMV  110



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   531 bits (1368),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 310/783 (40%), Positives = 446/783 (57%), Gaps = 58/783 (7%)
 Frame = -3

Query  2388  EKKMNERKCHPLLRGGRRN--SYNHGLSSSQYQALAAICEALIPPIPLP-----QD----  2242
             ++KM +  C   L    R+   Y   LSS+Q  +L  +C+  +P I        QD    
Sbjct  2     DQKMTQNCC--FLSKSSRSVIEYLGALSSNQLDSLTTLCDTFVPSIHDANSYGHQDQGNI  59

Query  2241  SDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVC  2062
              DD++   F  +SAS    P  +A ++  R     + + RL L +LSTR+G+ +LCG   
Sbjct  60    DDDDSYAKFLQTSASMNGTPQHIAWMINNRLQHPKMNLCRLALWLLSTRIGTFILCGKAS  119

Query  2061  FDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNN  1882
                ++P++  FS +  K+RE  +  W+     L LRI+F   KI    ++++  ++   N
Sbjct  120   LSTQFPYLQTFSNISPKKREESVKSWATSCFKL-LRILFFAAKILVLLVFYTQVNDENKN  178

Query  1881  PAWEAIGF-----------HVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGL  1735
              +W+A+G+             + N    D Q   PL +GII   N         L + G 
Sbjct  179   SSWKALGYSGPDPDFKKQKQENMNSKKKDDQPFGPLHEGIISLKNSQKIIFHR-LQELGF  237

Query  1734  NVTESQNANT---------LTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVS  1582
             +V++  N N            I CD V+VGSG GGGV A +LAN+GHKV+VLEKG Y   
Sbjct  238   SVSKPHNFNNARRSTECPAFIIECDAVVVGSGSGGGVIAGILANAGHKVIVLEKGSYLAR  297

Query  1581  EDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSL  1402
              + S LEGPS+ ++Y   G+L T D  VM+ AG+ VGGGS +NWSASI+TP +VL EWS 
Sbjct  298   SNLSLLEGPSMDQMYLGSGLLITQDMDVMLLAGSTVGGGSTVNWSASIQTPRHVLKEWSE  357

Query  1401  EQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEK  1222
                + LF S  Y+ AM+ VC+++GV      EG QN +LRKGC+ LG  VE++P N    
Sbjct  358   SYNLRLFESELYKEAMEIVCEKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSD  417

Query  1221  HYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEED--ETARKKCLGV  1051
             HYCG C  GC+ G KKG   T+LVD V +G   IL  C+A + I EE    + + K +GV
Sbjct  418   HYCGWCSMGCKDGKKKGTSETWLVDLVKSGNGAILPECEALEVIHEEKNGNSGKSKAIGV  477

Query  1050  ---IAKSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYF  880
                    +G  +I  +++  T+ ACG+L TP LLI SGLKN NIG NLHLHPV+ AWGYF
Sbjct  478   AFAFQNIEGMREICMVKSTVTIIACGALSTPSLLIKSGLKNPNIGRNLHLHPVVIAWGYF  537

Query  879   P-------ESMAEMEGKNHQGGIITSIHKVVS--EGTKQAAIIEAVSLGPAGFAAVSPWT  727
             P       E+  + E K+++GGI+T++ KVV+  EG+   A+I+   L P  F+A+ PW 
Sbjct  538   PDSPSNSNETWPKAEKKSYEGGIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWV  597

Query  726   SGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILV  547
             SGLD K RM KYSRT  IF++ RD GSG+      + Y++DQ D++N++ GL + LRIL 
Sbjct  598   SGLDFKMRMSKYSRTAYIFALARDKGSGEAFSPYSVSYKLDQTDEENLKAGLEKTLRILA  657

Query  546   AAGAAEVGTFRSDGQKICCKGIKTEELESFL--DGVVATGGPMSGEENWTLYCSAHQMGS  373
             AAGA E+GT +  G+ +      T+E E F+  +  +  G      ++    CSAHQMGS
Sbjct  658   AAGAEEIGTQQEKGRSLKVNEASTKEFERFVREESSIEIG------KHSVPICSAHQMGS  711

Query  372   CRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLN  193
             CRMG   +   +++ GE WE +GL++ D SV P+AIGVNPM+TI + +YC +  + + L 
Sbjct  712   CRMGTDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVLQLLK  771

Query  192   SGK  184
             + K
Sbjct  772   NQK  774



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   529 bits (1362),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 310/734 (42%), Positives = 448/734 (61%), Gaps = 39/734 (5%)
 Frame = -3

Query  2298  QALAAICEALIPPIPLPQDSD-DEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFR  2122
             ++L AIC+  I  I        D+ +  ++S+SASQ   PD  A ++  R      +I R
Sbjct  2     ESLVAICDTFISSIDGSGVGHVDDCVAGYFSASASQTGTPDRAARLMSERLHHPKKWILR  61

Query  2121  LVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFM  1942
               L +LST +G+L+LCG   F G++P+   F  LP K+RE ILL WS     L LR+ F 
Sbjct  62    AGLWLLSTWIGTLILCGRRSFTGQFPYFRRFCRLPEKQREEILLNWSSSYFSL-LRMFFR  120

Query  1941  TIKIACYFIYFSWTDENYNNPAWEAIGF----------HVDTNEV---PPDQQTGRPLEK  1801
             +IK+   F++F+  DEN  N AW+AIG+           V+ NE     P++  G PL  
Sbjct  121   SIKLITAFVFFTQVDENGRNLAWKAIGYDGPSSDHSDHEVELNEKMQKKPEEIFG-PLYN  179

Query  1800  GIIETINENGTTLKESLIKKGLNV-TESQNAN-------TLTIRCDvvivgsgcgggvaa  1645
             GII+ +      + + L   G  V T+ +N N        +TIRCD V+VGSG GGGV A
Sbjct  180   GIID-LQSPREAVAKKLTGHGFTVSTQKRNTNGSSISDLVMTIRCDAVVVGSGSGGGVVA  238

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
              VLA +G+KV+V+E G Y+     S LEG ++ ++Y SGG+L T+D  V++ AG+ VGGG
Sbjct  239   GVLAKAGYKVLVVESGTYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVILAGSTVGGG  298

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             S INWSASIKTP +V+ EW+ + K+ +FGS  Y+ AMD VC+R+GV     +EG  N++L
Sbjct  299   STINWSASIKTPEHVIKEWAEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEGFNNEIL  358

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQ  1108
             RKGCE LGL V+++PRN +  HYCG C  GC+ G K+G   T+LVD V +G  +IL GC+
Sbjct  359   RKGCEELGLPVKNIPRNAASDHYCGFCCLGCKKGQKQGTSETWLVDLVESGNGLILPGCE  418

Query  1107  AEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNI  928
             A + + +     +KK  GV A + G  +I  +E++ TV ACG+L TP LL  SGL+N NI
Sbjct  419   AMEVLYDCGRGKKKKATGV-AFAYG-EEIYVVESKTTVVACGALRTPHLLKRSGLRNGNI  476

Query  927   GSNLHLHPVLFAWGYFP--ESMAEMEGKNHQGGIITSIHKVVSEGTKQA---AIIEAVSL  763
             G NL LHPV+ AWG+FP  +   E + K+++GGI+T++  VV+  T  +    +I+  +L
Sbjct  477   GRNLCLHPVVMAWGWFPDEDKWPEKKKKSYEGGIMTAMSSVVNAETHSSYGEMVIQTPAL  536

Query  762   GPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNI  583
              P  F+ + PWTS  D K RM K+SRT +IF+++RD G+G +     I Y ++  D++++
Sbjct  537   HPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTINSKSYIDYNLNDEDEESL  596

Query  582   RTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL-DGVVATGGPMSGEENW  406
             ++GL + L+IL AAGA E+GT  S+G+ +  +   T E+E F+ +        +SG+   
Sbjct  597   KSGLDRVLKILAAAGAEEIGTHHSEGRSLNVRTASTLEIERFVREESSKPLKDLSGQ---  653

Query  405   TLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAY  226
                CSAHQMGSCRMG   E+ A+   GE WE +GL+V D SV P+A+GVNPM+T+ S AY
Sbjct  654   --ICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAY  711

Query  225   CISNGLAKSLNSGK  184
             CI   +   L   K
Sbjct  712   CIGLNVVDVLKRKK  725



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   531 bits (1368),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 317/762 (42%), Positives = 446/762 (59%), Gaps = 45/762 (6%)
 Frame = -3

Query  2358  PLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQ----DSDDEAMCSFYSSSASQP  2191
             P L  G R  Y + LS  Q + L A  + L+P +  P        ++++  FY +SAS  
Sbjct  46    PSLLPGERKPYVNSLSPRQMEVLTAFSDTLLPSV-FPDINCSGQLEDSLFKFYRTSASMA  104

Query  2190  PFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLK  2011
               P+ V   +  +     + +  L L +LST  G+ +LCG      ++P+   FS++  K
Sbjct  105   GTPELVGGFLSGKIEHPMLGVLLLALWLLSTWFGTFILCGIPSLSTQFPYFQRFSQVSQK  164

Query  2010  RREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF---------  1858
             +RE ILL WS  +  +  R++F T+K   +FI+F+  DEN  NP W  I +         
Sbjct  165   KREKILLSWSSSSFNI-YRMLFKTLKYLVFFIFFTQVDENNENPTWRGIDYCGPDPDFIN  223

Query  1857  ----HVDTNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNV--------TESQN  1714
                    T +    ++   PL +GI+  + +    L E+L + G +V          S +
Sbjct  224   NRTRETKTPQGHEHEELFEPLYRGIV-NMRQPREALAETLRQSGFHVRLHPHRRYNPSPS  282

Query  1713  ANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYE  1534
               +LTIRCD V+VGSG GGGVAA +LA +G+KV VLEKG+YF  ++ S LEGPS+ E+Y 
Sbjct  283   HPSLTIRCDAVVVGSGSGGGVAAGILAKAGYKVAVLEKGNYFGRKNLSLLEGPSMDEMYL  342

Query  1533  SGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAM  1354
             SGG++ T D  V++ AG+ VGGGS INWSASI+TP +V+ EW  E ++ LFGS  Y+ AM
Sbjct  343   SGGLMVTDDMGVIMLAGSTVGGGSTINWSASIRTPQHVIREWCNEYELELFGSKLYKEAM  402

Query  1353  DAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKK  1174
             D VCKR+GV     +E L N VLRKGC  LG  V + PRN    HYCG C +GC+ G KK
Sbjct  403   DVVCKRMGVQPDVEEESLSNTVLRKGCSELGYPVITAPRNSPPNHYCGWCCFGCKDGRKK  462

Query  1173  GVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNN----KILRIE  1009
             G   T+LVD V++G  VIL GC+A K IL E +  RK+        + NN        +E
Sbjct  463   GTSETWLVDLVDSGNGVILPGCEALK-ILHERKKGRKRNTATGVVFEFNNGWGKDFCVLE  521

Query  1008  ARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-----EMEGKNH  844
             ++ T+ A G+L TP LL  SGL+N NIG NLHLHPV+ AWG+FP   A     E + K++
Sbjct  522   SKVTIVAGGALCTPTLLKRSGLRNSNIGKNLHLHPVVMAWGHFPSRPADSGWPEKDKKSY  581

Query  843   QGGIITSIHKVV--SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIF  670
             +GGIIT++  VV  SEG+   A+I+   L P  F+ ++PW S +DM+ERM K+SRT  IF
Sbjct  582   KGGIITAMSTVVANSEGSGYGAVIQTPMLHPGMFSVITPWISSVDMRERMSKFSRTAYIF  641

Query  669   SMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICC  490
             ++ RD GSGQV     I YRMD +D+++++ GL + LRIL AAGA E+GT    G+K+  
Sbjct  642   ALARDKGSGQVNSPSSISYRMDAMDEEHLKQGLEKILRILAAAGAEEIGTSHCLGRKVNV  701

Query  489   KGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEA  310
             K + + E E F    V      +  +  T   SAHQMGSCRMG   +   +++ GE WE 
Sbjct  702   KKVSSNEFERF----VKKESRRALRDLRTPIPSAHQMGSCRMGVDPKSSVVNHRGETWEV  757

Query  309   KGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             +GL++ D SV P+A+GVNPM+TI S AYC +  + + L   K
Sbjct  758   EGLFLADSSVFPTALGVNPMVTIQSIAYCTAQSVLEVLRRKK  799



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   528 bits (1359),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 312/741 (42%), Positives = 447/741 (60%), Gaps = 52/741 (7%)
 Frame = -3

Query  2298  QALAAICEALIPPIPLPQDSD----DEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVF  2131
             ++L AIC+  I  I    DS     D+ +  ++S+SASQ   PD VA ++  R      +
Sbjct  2     ESLVAICDTFISSI---DDSGVGHVDDCVAGYFSASASQTGTPDRVARLMSERLHHPKKW  58

Query  2130  IFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRI  1951
             I R  L +LST +GSL+LCG+  F G +P+   F  LP KRRE ILL WS     L LR+
Sbjct  59    ILRAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREEILLNWSSSYFSL-LRM  117

Query  1950  VFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGR--------------  1813
             +F TIK+    ++F+  DE   N AW+AIG+    N   PD                   
Sbjct  118   LFRTIKLISALVFFTQVDEKGRNLAWKAIGY----NGPSPDHSDHEVELNEEKKKKKPEE  173

Query  1812  ---PLEKGIIETINENGTTLKESLIKKGLNVT-ESQNAN-------TLTIRCDvvivgsg  1666
                PL  GI++ +      +++ L  +G  V+ + +N N        + I+CD V+VGSG
Sbjct  174   IFGPLYNGIVD-LKSPREAVEKKLAGRGFAVSNQKRNTNGSSISDPVMKIQCDAVVVGSG  232

Query  1665  cgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFA  1486
              GGGVAA VLA +G+KV+V+E G+Y+     S LEG ++ ++Y SGG+L T+D  V++ A
Sbjct  233   SGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVILA  292

Query  1485  GTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKE  1306
             G+ VGGGS INWSASIKTP +V+ EW+ + K+ +FGS  Y+ AMD VCKR+GV     +E
Sbjct  293   GSTVGGGSTINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCGFVEE  352

Query  1305  GLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV-NNGA  1129
             G  N+VLRKGCE LGL V+++PRN    HYCG C  GC+ G K+G   T+LVD V ++  
Sbjct  353   GFNNEVLRKGCEKLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESDNG  412

Query  1128  VILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLISS  949
             +IL GCQA + + + ++  +KK  GV A + G  +I  +E+R T+ ACG+L TP LL  S
Sbjct  413   LILPGCQATEVMYDCEQGKKKKATGV-AFAFG-EEIYVVESRVTIVACGALRTPHLLKRS  470

Query  948   GLKNKNIGSNLHLHPVLFAWGYFPE--SMAEMEGKNHQGGIITSIHKVVSEGTKQA---A  784
             GLKN NIG NL LHPV+ AWG+FPE     E + K+++GGI+T++  VV E T  +    
Sbjct  471   GLKNSNIGRNLCLHPVVMAWGWFPEEDKWPEKKKKSYEGGIMTAMSSVVIEETHSSYGEM  530

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             +I+  +L P  F+ + PWTS  D K RM K+SRT +IF+++RD G+G +     I Y ++
Sbjct  531   VIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDSKTYIDYNLN  590

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL-DGVVATGGP  427
               D+++++ GL + L+IL AAGA E+GT  S+G+ +  +   + E+E F+ +        
Sbjct  591   DEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREESSKPLKD  650

Query  426   MSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMI  247
             +SG+      CSAHQMGSCRMG   E+ A+   GE WE + L+V D SV P+A+GVNPM+
Sbjct  651   LSGQ-----ICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPMV  705

Query  246   TILSTAYCISNGLAKSLNSGK  184
             T+ S AYCI   +   L   K
Sbjct  706   TVQSIAYCIGLNVVDVLKKKK  726



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   531 bits (1367),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 302/750 (40%), Positives = 444/750 (59%), Gaps = 49/750 (7%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDA  2137
             LS+++ ++LAA+C+  +P +  P  + D +   F+ +SAS    P+ V E++M R     
Sbjct  73    LSAAEMESLAALCDTFLPSVA-PATAADRSTAVFFETSASAVGTPERVGEMIMERVRHPK  131

Query  2136  VFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPL  1957
              ++ R+ L +LST  G+ +LCG       +P+   FS++  K+RE I L WS     L L
Sbjct  132   KWLVRVSLWMLSTWYGTYILCGNESLSNHFPYFKRFSKVSQKKREQIALSWSLSYFFL-L  190

Query  1956  RIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH-VDTNEVPPDQQTGR-----------  1813
             R+ F TIKI C   +F+  DE  NN +W+AI +   D    PP     +           
Sbjct  191   RMFFRTIKILCLLAFFTQVDEEMNNISWKAIDYPGSDPQFKPPSNLKEKDSKSREVDEEG  250

Query  1812  ------------PLEKGIIETINENGTTLKESLIKKG------LNVTESQNANTLTIRCD  1687
                         PL KGI+   ++    +    ++K       L+ T      ++ I+CD
Sbjct  251   DEEEEEAEELYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCD  310

Query  1686  vvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTD  1507
              V+VGSG GGGV A VLAN+G+KV+VLEKG Y    + S LEGP++ E+Y+S G++ T +
Sbjct  311   AVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDN  370

Query  1506  GKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGV  1327
               V++ AG+ VGGGS +NWSASIKTP++V  EWS E ++ LF S+ Y+ A+D VCK++GV
Sbjct  371   MNVLILAGSTVGGGSTVNWSASIKTPSHVTKEWSDEYELELFRSNLYKEAIDVVCKKMGV  430

Query  1326  TEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVD  1147
                   EG  N VLRKGCE LG    ++PRN +  HYCG C  GCR G KKG   T+LVD
Sbjct  431   QSKIDNEGFNNAVLRKGCEELGGHAINIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVD  490

Query  1146  AVNNG-AVILTGCQAEKFILEEDE-TARKKCLGVIAK---SKGNNKILRIEARATVSACG  982
              V +G  VIL GC+A K   E+ +   RK   GV  +        ++  +E++ T+ ACG
Sbjct  491   LVRSGNGVILPGCEAIKIRQEKKQGRERKMAKGVAFEFWCGSAAKQMCLVESKVTIVACG  550

Query  981   SLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFP----ESMAEMEGKNHQGGIITSIHK  814
             +L TPPLL  SGL+N NIG NLHLHPV  AWGYFP    +S  E + K+++GGI+T++  
Sbjct  551   ALNTPPLLKRSGLRNPNIGKNLHLHPVTMAWGYFPAETDKSWPEKDKKSYEGGIMTAMCN  610

Query  813   VVSEGTKQ----AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGS  646
             +  E  ++     A+I+  +L P  F+ + PW SG ++K+RM K+SRT ++F + RD GS
Sbjct  611   IGPEPNQEPGYGGAVIQTPALHPGLFSILMPWVSGTNIKQRMCKFSRTAHVFVLARDKGS  670

Query  645   GQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEEL  466
             G VK    + Y+MD +D+ N++ GL +AL+IL AAGA E+GT  + G+ I  K +   E 
Sbjct  671   GTVKSPSSLSYKMDNVDEQNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREY  730

Query  465   ESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDG  286
             E F+     +  P+  ++  T  CSAHQMGSCRMG+  +D  ++  GE WE +GL++ D 
Sbjct  731   EKFVKE--ESSRPL--KDLLTPICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIADS  786

Query  285   SVLPSAIGVNPMITILSTAYCISNGLAKSL  196
             SV P+A+GVNPM+T+ + AYC +  + ++L
Sbjct  787   SVFPTALGVNPMVTVQAIAYCTAQSVLETL  816



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   529 bits (1362),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 301/731 (41%), Positives = 448/731 (61%), Gaps = 38/731 (5%)
 Frame = -3

Query  2325  NHGLSSSQYQALAAICEALIPPIPLPQ--DSDDEAMCSFYSSSASQPPFPDEVAEVVMRR  2152
             N  L+  + ++L AIC+ LIP I        DD+++  ++S+SASQ   PD VA+++  R
Sbjct  39    NSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSER  98

Query  2151  FLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRET  1972
                   +I R+ L  LST +GS +LCG   F G +P+   F  LP K+RE +LL WS   
Sbjct  99    LDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASY  158

Query  1971  LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH------------VDTNEVPPD  1828
               L LR+ F +IK+    ++F+  D    N +W+AIG++            ++  +  P+
Sbjct  159   FSL-LRMFFKSIKLITALVFFTQVDGKGRNLSWKAIGYNGPSLDDSDLQEELNEKKKKPE  217

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVT--------ESQNANTLTIRCDvvivg  1672
             +  G PL  GI++  +      K+ L  +G  V+         S +   +TIRCD V+VG
Sbjct  218   EIFG-PLYNGIVDLKSPREVVTKK-LTDRGFTVSTPKKNPKGSSLSNRVMTIRCDAVVVG  275

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SG GGGV A VLA +G+KV+V+E G+Y+     S LEG ++ E+Y SGG+L T+D  V+V
Sbjct  276   SGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVVV  335

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGS INWSASIKTP +V+NEW+ + K+ +F S  Y+ AMD VCKR+GV     
Sbjct  336   LAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLKMFRSDSYREAMDVVCKRMGVQCGFV  395

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
             +EG  N++LRKGCE LGL V+++PRN    HYCG C  GC+ G K+G   T+LVD V +G
Sbjct  396   EEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESG  455

Query  1131  -AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLI  955
               +IL GC+  + + + ++  +KK    ++ + G  +I  +E+R+TV ACG+L TP LL 
Sbjct  456   NGLILPGCEVMEVLYDCEQGKKKKKASGVSFAFG-EEIYVVESRSTVVACGALRTPHLLK  514

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFPE--SMAEMEGKNHQGGIITSIHKVVSEGTKQA--  787
              SGL N NIG NL LHPV+ AWG+FPE     E +  +++GGI+T++  +V+  T+++  
Sbjct  515   RSGLTNANIGRNLSLHPVVMAWGWFPEEDKWPEKKKMSYEGGIMTAMSSLVNAQTQRSYG  574

Query  786   -AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
               +I+  +L P  F+ ++PWTS  D K RM K+SRT +IF+++RD G+G V     I Y 
Sbjct  575   ETVIQTPALHPGMFSGITPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSCIDYN  634

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL-DGVVATG  433
             ++  D+++++ GL + L+IL A+GA E+GT   +G+ +  +     E+E F+ +      
Sbjct  635   LNDEDEESLKKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREESSKPL  694

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
               +SG+      CSAHQMGSCRMG   E+ A+   GE WE +GL+V D SV P+A+GVNP
Sbjct  695   KDLSGQ-----LCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNP  749

Query  252   MITILSTAYCI  220
             M+T+ S AYCI
Sbjct  750   MVTVQSIAYCI  760



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   530 bits (1364),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 319/814 (39%), Positives = 468/814 (57%), Gaps = 94/814 (12%)
 Frame = -3

Query  2412  EGEKIFKREKKMNERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPI-PLPQDSD  2236
             +GE I K++K +    C       RR          Q ++L+ + + ++P I       D
Sbjct  44    DGEAIIKKQKYLTNSLC-------RR----------QMKSLSVLADTILPSINDFVAIKD  86

Query  2235  DEAMCSFYSSSASQPPFPDEVAEVVMRRF-LPDAVFIFRLVLIILSTRLGSLLLCGFVCF  2059
             DE+  +FY  SAS    P+ V  V+  R       ++ + VL +LST +G+++LCG  CF
Sbjct  87    DESAATFYHISASMAGTPELVGGVISERLNYHPMTWLLKFVLWLLSTLVGTIILCGMDCF  146

Query  2058  DGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYF----------  1909
               ++PFIH F  LPL +R+ I+  WS  +    LR+ F TIK+    ++F          
Sbjct  147   STKFPFIHTFPNLPLHKRQRIMQSWSL-SFFRHLRMFFKTIKLLTLLVFFTQIFLLFGTL  205

Query  1908  --SW------TDENYNNPAWEAIGF-------------HV------------DTNEVPPD  1828
               SW       DE+ +N +W+AIG+             H             + +E   +
Sbjct  206   YSSWHGTYFQIDESEDNCSWKAIGYCGPDPEFKAQLRNHFLHRTCKGGQESEEGDEDDAE  265

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQ---------NANTLTIRCDvviv  1675
             Q  G PL KG++  +N       ++L + G  V+ ++         ++ +L I+CD V+V
Sbjct  266   QVIG-PLYKGLVH-LNCPRDITADALRRFGFPVSVTRRKPKAAANLSSPSLVIQCDAVVV  323

Query  1674  gsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVM  1495
             GSG GGG+ A +LA +G+KV+VLEKG Y    + S LEGP+L ++Y+SGGML T D  V 
Sbjct  324   GSGSGGGLVAGILAKAGYKVLVLEKGGYSARSNLSLLEGPTLDQMYQSGGMLATDDMSVF  383

Query  1494  VFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVC  1315
             V +G+ VGGGSAINWSASIKTP +V  EW  +  + LF S  Y+ AMD VC+++GV    
Sbjct  384   VLSGSTVGGGSAINWSASIKTPQHVCKEWCEKHGLELFESELYREAMDVVCEKMGVQSEI  443

Query  1314  SKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNN  1135
              +EG  N +LR+GC+ LG  V ++PRN    HYCG C  GC+ G KKG   T+LVD V +
Sbjct  444   EEEGFNNTILRRGCQELGYPVSTIPRNSPSDHYCGWCFMGCKDGRKKGTSETWLVDLVKS  503

Query  1134  G-AVILTGCQAEKFILEEDETARKKCLGVIA---KSKGNNKILRIEARATVSACGSLFTP  967
             G   IL GC+  K + ++ + + +K    +A   + KG+  I  +E++ T+ ACG+L TP
Sbjct  504   GNGAILPGCEVLKVLYKKKKGSDQKTARGVAFEFEYKGSKDICVVESKVTIVACGALNTP  563

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEMEG----------KNHQGGIITSIH  817
              LL  SGLKN NIG NLHLHPV+ AWGYFP+S AE  G          K+++GGI+T++ 
Sbjct  564   ALLKRSGLKNNNIGRNLHLHPVVMAWGYFPDSSAESTGETEVWPEAWKKSYEGGIMTAMS  623

Query  816   KVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSG  643
              VV+  E +   A+I+  +L P  F+ V PW SG D+K+RMRK+SRT +IF++ RD GSG
Sbjct  624   PVVAEFENSGYGAVIQTPALHPGTFSIVMPWISGKDIKDRMRKFSRTAHIFALARDKGSG  683

Query  642   QVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELE  463
             +V    RI Y+M+ +D++N++ G+ + LRIL AAGA E+GT  + G+ +  K     ELE
Sbjct  684   KVDSPNRINYQMEDVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQASKLELE  743

Query  462   SFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGS  283
              F+     +  P++     T  CSAHQMGSCRMG+  ++ A+   GE WE + LYV D S
Sbjct  744   KFVKE--ESSRPLTKLS--TPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVADSS  799

Query  282   VLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
             V P+A+G+NPMITI S AYC +  +  +L   ++
Sbjct  800   VFPTALGLNPMITIQSIAYCTAQSVLHALKRKRS  833



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   528 bits (1360),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 306/777 (39%), Positives = 450/777 (58%), Gaps = 61/777 (8%)
 Frame = -3

Query  2373  ERKCHPLLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLP-QDSDDEAMCSFYSSSAS  2197
             E+K  PL          + LS  Q ++L A+C+ ++P +     DS DE++  FY  SAS
Sbjct  45    EKKLQPL---------TNSLSPRQMKSLTALCDTILPSVADHFVDSSDESVTKFYQISAS  95

Query  2196  QPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELP  2017
                 P+    ++  R       + + VL +LST  G+L+ CG  C   ++PFIH +  L 
Sbjct  96    MTGTPERFGGMISERLKHPLTGLLKFVLWLLSTWYGTLIFCGIGCLSTQFPFIHAYPHLS  155

Query  2016  LKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF-------  1858
             L++R+ I+  WS   L    R++F TIK+    I+F+  DE+ +N AW+AIG+       
Sbjct  156   LQKRQKIMRSWSLSYL-RHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEF  214

Query  1857  -------HVDTNEVPPDQQTGR----------PLEKGIIETINENGTTLKESLIKKGLNV  1729
                     +D       Q+             PL KG++  +N       ++L + G  V
Sbjct  215   KAQLKNHFLDGTSKGGGQEDKEEDEDAEEMIGPLYKGLVH-LNYPQDITADALRRFGFPV  273

Query  1728  T------ESQNAN----TLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSE  1579
             +      ++  AN    +L I+CD V+VGSG GGGV A VLA +G+KV+VLEKG Y    
Sbjct  274   SVIRRKHKAAAANLSCPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSAKN  333

Query  1578  DYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLE  1399
             + S LEGP++ ++Y +GG++ + D  V + +G+ VGGGSAINWSA IKTP +V  EW  +
Sbjct  334   NLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQHVCKEWCDK  393

Query  1398  QKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKH  1219
               + LF S  Y+ A+DAVC ++GV      EG  N +LRKGC+ +G  V ++PRN    H
Sbjct  394   HGLELFESELYREALDAVCGKMGVQSEIEDEGFNNAILRKGCQEMGYPVNNIPRNSPSNH  453

Query  1218  YCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA-  1045
             YCG C  GC+ G KKG   T+LVD V +G   IL GC+A K + ++ E   +K    +A 
Sbjct  454   YCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHKKKEGKDRKIARGVAF  513

Query  1044  --KSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFP--  877
               + KG   +  +E++ T+ ACG+L TP LL  SGL+N+NIG NLHLHPV+ AWGYFP  
Sbjct  514   EFEYKGTKDVCVVESKVTIVACGALSTPALLKRSGLRNQNIGKNLHLHPVVMAWGYFPDA  573

Query  876   ---ESMAEMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDM  712
                E   E   K+++GGI+T++  VV+E  +    A+I+  SL P  F+ V+PWTSG+D+
Sbjct  574   PESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDI  633

Query  711   KERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAA  532
             ++RMRK+SRT +IF++ RD GSG VK   RI Y+   +D++N++ G+ + LRIL AAGA 
Sbjct  634   RDRMRKFSRTAHIFALARDQGSGTVKAPDRISYKPADVDEENLKKGIEKVLRILAAAGAE  693

Query  531   EVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATE  352
             E+GT  + G+ +  K +   E E F    V      S  +  T  CSAHQMGSCRMG+  
Sbjct  694   EIGTHHNKGRTLNVKQVSYHEFEKF----VKEESSRSLTDLTTPLCSAHQMGSCRMGSNP  749

Query  351   EDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGKA  181
             +   ++  GE WE +GLYV D SV P+A+GVNPM+T+ + AYC +  + + L   ++
Sbjct  750   KQSVVNPTGETWEVEGLYVADASVFPTALGVNPMVTVQAIAYCTAQSVVEVLKRKRS  806



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   527 bits (1357),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 304/772 (39%), Positives = 445/772 (58%), Gaps = 54/772 (7%)
 Frame = -3

Query  2355  LLRGGRRNSYNHGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDE  2176
             LL GG R  Y + LSS + ++L AI +  +P +  P ++    +  FY +SAS    P  
Sbjct  22    LLNGGGRQLYLNKLSSREMESLIAISDTFLPSVEAPHNAAHAYVDKFYRTSASMAGTPHI  81

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             V  ++  R     +++ R+VL +LST  G+ ++CG       +P+  +F ++   +R  I
Sbjct  82    VGGLISERLEHPKLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEI  141

Query  1995  LLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF---------HVDTN  1843
             +L WS     L +R++F ++K+    ++F+  DE   N  W+AIG+             N
Sbjct  142   VLSWSLSYFSL-IRMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRAN  200

Query  1842  EVPPDQQTGR------------------PLEKGIIETINENGTTLKESLIKKGLNVT---  1726
             +       GR                  PL +G+I  +      + E+L   G +++   
Sbjct  201   KTAQPNGYGRSIYQREQEEEDDREDFNGPLYRGLI-NVKRPREVVAEALRLSGFSISIHS  259

Query  1725  ---ESQNANT-LTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEG  1558
                E+ N+++ L IRCD V++GSG GGGVAA VLA +G+KV+VLEKG+Y    + S LEG
Sbjct  260   RKHETPNSSSPLIIRCDAVVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEG  319

Query  1557  PSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFG  1378
             P+L ++Y  GGML T D  V++ AG+ VGGGS INWSASI+TP +V  EW  + ++ LF 
Sbjct  320   PTLDQMYLYGGMLATDDTGVIILAGSTVGGGSTINWSASIRTPQHVRKEWCDQHELELFD  379

Query  1377  SSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGY  1198
             S  Y+ AMD VC+++GV     +EGL N VLR+GC+ LG  V  +PRN   KHYCG C +
Sbjct  380   SQLYKEAMDVVCEKMGVQSEIYEEGLNNAVLRRGCQELGYPVTDIPRNSQPKHYCGWCCF  439

Query  1197  GCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDE-TARKKCLGVI--AKSKGN  1030
             GC+ G KKG   T+LVD +N+G  VIL GC+A K +    +  AR    GV    + KG 
Sbjct  440   GCKDGRKKGTAETWLVDMMNSGNGVILPGCEAIKVLHNRKKGRARSTATGVAFEFEYKGV  499

Query  1029  NKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESM------  868
              ++  +E++ T+ ACG++ TP LL  SGLKN NIG NLHLHPV  AWG+FPE        
Sbjct  500   KEVFMVESKVTIVACGAISTPGLLKRSGLKNPNIGKNLHLHPVAMAWGHFPEPTPLSPSP  559

Query  867   --AEMEGKNHQGGIITSIHKVVS--EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERM  700
                 +E ++++G I+T +  VV+  EG+   A+I+  SL P  F+ + PW SG DMK+RM
Sbjct  560   GCPGLEKRSYEGEIMTVMSTVVADFEGSGYGAVIQTPSLHPGMFSVLMPWISGPDMKDRM  619

Query  699   RKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGT  520
              +YSRT +IF++ RD GSG +     I Y+MD+ D++N++ G+ + LRIL AAGA E+GT
Sbjct  620   IRYSRTAHIFALARDKGSGTISSPSTISYQMDETDEENLKRGMEKLLRILAAAGAEEIGT  679

Query  519   FRSDGQKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGA  340
                +G+ I  K + +   E F    V      +  +  T  CSAHQMGSCRMG      A
Sbjct  680   HNCNGRSINVKKVSSHAFEKF----VKEESSRALRDLSTPVCSAHQMGSCRMGVDPRSSA  735

Query  339   IDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             ++  GE WE +GLYV D SV P+A+GVNPM+T+ + AY  +  + + L   K
Sbjct  736   VNQMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYSTAKSVVEVLRRKK  787



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   524 bits (1349),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 309/723 (43%), Positives = 447/723 (62%), Gaps = 38/723 (5%)
 Frame = -3

Query  2298  QALAAICEALIPPIPLPQDSD-DEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFR  2122
             ++L AIC+ LIP I   +    D+ +  +YS+SASQ   PD VA ++  R      +I R
Sbjct  2     ESLVAICDTLIPSIDGSEVGHVDDGVAGYYSASASQTGAPDRVARLISERLDHPKKWILR  61

Query  2121  LVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFM  1942
               +  LST +GSL+LCG   F   +P+   F  LP K+RE ILL W+    +L LR++F 
Sbjct  62    AAMWSLSTWIGSLVLCGRRSFTSEFPYFQRFCRLPEKQREEILLNWASSYFLL-LRMLFR  120

Query  1941  TIKIACYFIYFSWTDENYNNPAWEAIGF------HVDTNEVPPDQQTGR--------PLE  1804
             +IK+    ++F+  DE   N AW+AIG+      H D +E   +++T +        PL 
Sbjct  121   SIKLITSLVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHDEELNEKKTKKKKPEEIFGPLY  180

Query  1803  KGIIETINENGTTLKESLIKKGLNV-TESQNAN-------TLTIRCDvvivgsgcgggva  1648
              GII+  N     +K+ L   G  V T+ +N N        +TI+CD V+VGSG GGGV 
Sbjct  181   NGIIDLKNPREAVVKK-LTGHGFRVLTQKRNKNGSSISDPVMTIQCDAVVVGSGSGGGVV  239

Query  1647  aavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGG  1468
             A VLA +G+KV+V+EKG+Y+     S LEG ++ E+Y SGG+L T+D  V++ AG+ VGG
Sbjct  240   AGVLAKAGYKVLVVEKGNYYARNKLSLLEGQAMDEMYLSGGLLATSDMNVVILAGSTVGG  299

Query  1467  GSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQV  1288
             GS INWSASIKTP +V+ EWS   ++ +FGS  Y+ AMD VC+R+GV     +EG  N++
Sbjct  300   GSTINWSASIKTPEHVMKEWSENSELEMFGSDLYRKAMDVVCERMGVQCGFVEEGFNNEI  359

Query  1287  LRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGC  1111
             LRKGCE LGL V+++PRN    HYCG C  GC+ G K+G   T+LVD V +G  +IL GC
Sbjct  360   LRKGCEELGLTVKNIPRNSPSDHYCGFCCLGCKKGQKQGTSETWLVDLVKSGNGLILPGC  419

Query  1110  QAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKN  931
             +A + + E     +KK    +A +    ++  +E++AT+ ACG+L TP LL  SGLKN+N
Sbjct  420   EAMEVLYECQNGKKKKTATGLAFAF-EEEVYVVESKATIVACGALRTPHLLKRSGLKNRN  478

Query  930   IGSNLHLHPVLFAWGYF--PESMAEMEGKNHQGGIITSIHKVVSEGTKQA---AIIEAVS  766
             IG NL LHPV+ AWG+F   E   E + K+++GGI+T++  VV+  TK +    +I+  +
Sbjct  479   IGRNLCLHPVVMAWGWFPEEEKWPEKKKKSYEGGIMTAMSGVVNTETKTSYGETVIQTPA  538

Query  765   LGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDN  586
             L P  F+ + PWTSG + K RM K+SRT ++F+++RD G+G V     I Y ++  D+++
Sbjct  539   LHPGMFSGIIPWTSGEEFKSRMLKFSRTAHVFTLLRDKGTGTVNSKSCIDYNLNDEDEES  598

Query  585   IRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG-GPMSGEEN  409
             ++ GL + L IL+AAGA E+GT  S+G+ +  +     E+E F+    + G   ++G+  
Sbjct  599   LKKGLERVLNILIAAGAEEIGTHNSEGKSLNVRTASEAEIERFVREESSKGLKDLAGQ--  656

Query  408   WTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTA  229
                 CSAHQMGSCRMG   E+ A+   GE WE  GLYV D SV P+A+GVNPM+T+ S A
Sbjct  657   ---ICSAHQMGSCRMGIRPEESAVRPTGETWEVGGLYVADTSVFPTALGVNPMVTVQSIA  713

Query  228   YCI  220
             YCI
Sbjct  714   YCI  716



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   524 bits (1350),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 294/752 (39%), Positives = 445/752 (59%), Gaps = 53/752 (7%)
 Frame = -3

Query  2298  QALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRL  2119
             ++L A+C+  +P I +   + + ++ +FY +SAS    P  V  ++  R     +++ RL
Sbjct  2     ESLTALCDTFLPSIDVSDATTNASLVAFYRTSASMAGTPQRVGGLISERLKHPKLWLMRL  61

Query  2118  VLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMT  1939
              L  LST +GS +LCG      ++P+  +F ++  ++RE ILL WS     L LR++F T
Sbjct  62    ALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYL-LRMLFKT  120

Query  1938  IKIACYFIYFSWTDENYNNPAWEAIGF--------------------------HVDTNEV  1837
             +K+  + ++F+  +E   N +W+AI +                          + + N  
Sbjct  121   MKLLTFLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKFKASTTIGNQRPNNEEQNAC  180

Query  1836  PPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANT--------LTIRCDvv  1681
             P +++   PL + II  +++    + ++L   G+  +   +  T        LTIRCD V
Sbjct  181   PHEEELFGPLNRCII-NLDKPKDLVVDALSTFGIPASVLHSEKTVNCPSNPSLTIRCDAV  239

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             ++GSG GGGV A VLA +G+KVVV+EKG+Y   ++ + LEGP++ ++Y SGG++ T D  
Sbjct  240   VIGSGSGGGVVAGVLAKAGYKVVVIEKGNYHARKNLTLLEGPAMDQMYLSGGLIATDDMG  299

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
             V V AG+ VGGGSAINWSASI+TP +V+ EW  + ++ LF S  YQ A+D V +++GV  
Sbjct  300   VFVLAGSTVGGGSAINWSASIRTPQHVIKEWCNDHELELFDSKLYQEALDVVSEKMGVQS  359

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
                +EG  N++LRKGC+ LG  V ++PRN    HYCG C +GC+ G K+G   T+LVD V
Sbjct  360   QVQEEGFNNEILRKGCQELGYPVNNIPRNSPPNHYCGWCCFGCKDGRKRGTTETWLVDLV  419

Query  1140  NNG-AVILTGCQAEKFILEEDETARKK--CLGVIAKSK--GNNKILRIEARATVSACGSL  976
             N+G   ILTGC+A K + +  +  R +    GV  K +  G  +I  +E++ T+ ACG+L
Sbjct  420   NSGNGAILTGCEAIKVLHKRKKGRRDRNTATGVAFKFEHGGGKEIGFVESKVTIVACGAL  479

Query  975   FTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-----EMEGKNHQGGIITSIHKV  811
              TP LL  SGLKN NIG NLHLHPV  AWGYFP+S       E E K+++GGI+T++  V
Sbjct  480   CTPKLLKRSGLKNVNIGENLHLHPVAMAWGYFPDSQVFDGWPEREKKSYEGGIMTAMSTV  539

Query  810   VSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQV  637
             V+E  K    A+I+  +L P  F+ V PW SG D+K RM ++SRT ++F++ RD GSG V
Sbjct  540   VAEFNKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSRFSRTAHVFALARDKGSGTV  599

Query  636   KK-AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELES  460
                   I Y M+ +D++N++ GL ++LRIL AAGA ++GT    G+ +  K    +E E 
Sbjct  600   NAPPDSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHVKKANLDEFER  659

Query  459   FLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSV  280
             F+     +  P+   E  +  CSAHQMGSCRMG   +   ++  GE WE +GL+V D SV
Sbjct  660   FVKE--ESSRPL--REISSAICSAHQMGSCRMGVDSKQSVVNQMGETWEVEGLFVADTSV  715

Query  279   LPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
              P+A+GVNPM+T+ + AYC S  + + L   K
Sbjct  716   FPTALGVNPMVTVQAIAYCTSQSILQVLRRKK  747



>emb|CDX77517.1| BnaA07g06550D [Brassica napus]
Length=540

 Score =   516 bits (1330),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 273/519 (53%), Positives = 366/519 (71%), Gaps = 20/519 (4%)
 Frame = -3

Query  2337  RNSYNHGLSSSQYQALAAICEALIPPIPLPQD---SDD-----EAMCSFYSSSASQPPFP  2182
             RN  +  +++++ ++LA+ CEA++PP+P P++    DD     EA+ SFY++  SQ P  
Sbjct  8     RNFGHREVTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVA  67

Query  2181  DEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRRE  2002
              +  +++++R   +A    RLVL +L+TRLG+LL+CG  C    WPF+  FSEL L++RE
Sbjct  68    RQTIDLIIKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEKRE  127

Query  2001  AILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQ-  1825
              +L K  R   + P+R  F+ IK+A  F +FS    N  NPAWEAIG+ V+ +E  P + 
Sbjct  128   RVLQKQFRNWFLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIGYRVNLDENKPSET  187

Query  1824  QTGRPLEKGIIETINENGTTLKESLIKKGLNVTESQNANTLTIRCDvvivgsgcgggvaa  1645
             +  RPLEKG++ET+ E   TL ESL +KGL      +A  + I+CD V+VGSG GGGVAA
Sbjct  188   RKERPLEKGVVETMKETEQTLLESLTQKGLEADTDHDA--IRIKCDAVVVGSGSGGGVAA  245

Query  1644  avlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGG  1465
             +VLA +G KV+V+EKG Y+   DY   EG  + +LYE+GG+L + DG +M+ AG  VGGG
Sbjct  246   SVLAKAGLKVIVMEKGSYYTESDYPPFEGHGMEKLYENGGILPSIDGCLMILAGATVGGG  305

Query  1464  SAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVL  1285
             SA+NWSA IKTP +VL EWS + KIPLFG+ EY SAMD V KR+GVTE C KEG QNQVL
Sbjct  306   SAVNWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLVWKRMGVTETCEKEGFQNQVL  365

Query  1284  RKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNGAVILTGCQA  1105
             RKGCENLG+ V++V RN SEKHYCGSCGYGCR G+KKG D T+LVDAV++GAV+LTGC+A
Sbjct  366   RKGCENLGINVQNVARNSSEKHYCGSCGYGCRQGEKKGSDRTWLVDAVSHGAVVLTGCKA  425

Query  1104  EKFILEEDETARK-----KCLGVIAKSKGNN--KILRIEARATVSACGSLFTPPLLISSG  946
             E+FILE++    +     KCLGV++KS   N  K ++IEA+ TVSA GSL TPPL+ISSG
Sbjct  426   ERFILEKNGNKNRGGKKMKCLGVLSKSLNGNIAKKIKIEAKVTVSAAGSLLTPPLMISSG  485

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMAEMEGKNHQGGII  829
             L+N++IG NLHLHPVL AWGYF +   E    N +G ++
Sbjct  486   LRNRHIGKNLHLHPVLMAWGYFSDK--ESSSSNFKGEVL  522



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   525 bits (1352),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 304/731 (42%), Positives = 443/731 (61%), Gaps = 38/731 (5%)
 Frame = -3

Query  2325  NHGLSSSQYQALAAICEALIPPIPLPQ--DSDDEAMCSFYSSSASQPPFPDEVAEVVMRR  2152
             N  L+  + ++L AIC+ LIP I        DD+++  ++S+SASQ   PD VA+++  R
Sbjct  39    NSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSER  98

Query  2151  FLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRET  1972
                   +I R+ L  LST +GS +LCG   F G +P+   F  LP K+RE +LL WS   
Sbjct  99    LDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASY  158

Query  1971  LILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH---VDTNEV---------PPD  1828
               L LR+ F  IK+    ++F+  D    N +W+AIG++   +D +++          P+
Sbjct  159   FSL-LRMFFRCIKLISALVFFTQVDGKGRNLSWKAIGYNGPNLDNSDLQEELNEKKKKPE  217

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVT--------ESQNANTLTIRCDvvivg  1672
             +  G PL  GI++  +      K+ L  +G  V+         S +   +TIRCD V+VG
Sbjct  218   EIFG-PLYNGIVDLKSPREVVTKK-LTDRGFTVSTPKKNPKGSSLSNRVMTIRCDAVVVG  275

Query  1671  sgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMV  1492
             SG GGGV A VLAN+GHKV+V+E G+Y+     S LEG ++ E+Y SGG+L T+D  V+V
Sbjct  276   SGSGGGVVAGVLANAGHKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVVV  335

Query  1491  FAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCS  1312
              AG+ VGGGS INWSASIKTP +V+NEW+ + K+ +FGS  Y+ AMD VCKR+GV     
Sbjct  336   LAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLEMFGSDSYREAMDVVCKRMGVXXXXX  395

Query  1311  KEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG  1132
                     LRKGCE LGL V+++PRN    HYCG C  GC+ G K+G   T+LVD V +G
Sbjct  396   XXXXXXXXLRKGCEELGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESG  455

Query  1131  -AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLI  955
               +IL GC+  + + + ++  +KK    ++ + G  +I  +E+RATV ACG+L TP LL 
Sbjct  456   NGLILPGCEVMEVLYDCEQGKKKKKASGVSFAFG-EEIYVVESRATVVACGALRTPHLLK  514

Query  954   SSGLKNKNIGSNLHLHPVLFAWGYFPES--MAEMEGKNHQGGIITSIHKVVSEGTKQA--  787
              SGL N NIG NL LHPV+ AWG+FPE     E +  +++GGI+T +  V++  T+ +  
Sbjct  515   RSGLTNGNIGRNLCLHPVVMAWGWFPEEDRWPEKKKMSYEGGIMTVMSSVINSETQSSYG  574

Query  786   -AIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYR  610
               +I+  +L P  F+ V+PWTS  D K RM K+SRT +IF+++RD G+G V     I Y 
Sbjct  575   ETVIQTPALHPGMFSGVTPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSCIDYN  634

Query  609   MDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL-DGVVATG  433
             ++  D+++++ GL + L+IL A+GA E+GT   +G+ +  +     E+E F+ +      
Sbjct  635   LNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREESSKPL  694

Query  432   GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNP  253
               +SG+      CSAHQMGSCRMG   E+ A+   GE WE +GL+V D SV P+A+GVNP
Sbjct  695   KDLSGQ-----LCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNP  749

Query  252   MITILSTAYCI  220
             M+T+ S AYCI
Sbjct  750   MVTVQSIAYCI  760



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   524 bits (1350),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 298/740 (40%), Positives = 441/740 (60%), Gaps = 33/740 (4%)
 Frame = -3

Query  2328  YNHGLSSSQYQALAAICEALIPPIPLPQDSD--DEAMCSFYSSSASQPPFPDEVAEVVMR  2155
             Y + LS  + ++L+A+C+  +P   +   S   D+++  F+ SSAS    P  +  ++ +
Sbjct  27    YVNSLSFPEMESLSALCDTFLPSNDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQ  86

Query  2154  RFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRE  1975
             R      ++ R+VL +LSTR+G+ +LCG +     +PF   FS++ L +RE IL  WS  
Sbjct  87    RLKHPKKWLIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREKILHSWSLS  146

Query  1974  TLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGR------  1813
                L LR++F T+K+ C  ++FS  DE   N AW+A+ +     E   +Q+         
Sbjct  147   FFSL-LRMLFKTVKLLCLLVFFSQVDEKGENLAWKAMDYPGPDPEFKKEQEAALKLVKNN  205

Query  1812  ---------PLEKGIIETINENGTTLKESLIKKGLNVTESQ---NANTLTIRCDvvivgs  1669
                      PL KG+I+ +N        SL   G  V   +   N  +L I+CD V+VGS
Sbjct  206   EEEKEKLFGPLYKGLID-MNLPRDITANSLRLSGFPVFTYRPKINNPSLVIKCDAVVVGS  264

Query  1668  gcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVF  1489
             G GGGV A VLA +G+KVVV+EKG+YF   + S LEGPS+ ++Y S G++ T D  V+V 
Sbjct  265   GSGGGVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPSMDQMYLSAGLMATDDMGVVVL  324

Query  1488  AGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSK  1309
             AG+ VGGGS INWSASI+TP +V +EWS    + +F S  Y+ A+D VC+++GV    ++
Sbjct  325   AGSTVGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSKLYKEALDVVCEKMGVQSEINE  384

Query  1308  EGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-  1132
             EG  N +LRKGCE LG  V ++PRN S  HYCG C  GC+ G KKG   T+L+D VN+G 
Sbjct  385   EGFNNAILRKGCEELGYNVNTIPRNSSSDHYCGWCCLGCKDGKKKGTCETWLLDLVNSGN  444

Query  1131  AVILTGCQAEKFILEEDETARKKCLGVIAKSKGNNKILRIEARATVSACGSLFTPPLLIS  952
              +IL  C+A K + +      ++    +A + G  ++  ++++ T+ ACG+L TPPLL  
Sbjct  445   GLILPNCEAIKVLHKRRRRGNRRVASGVAFAFG-KEVCVVQSKVTIVACGALSTPPLLKR  503

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPE----SMAEMEGKNHQGGIITSIHKVVSEGTKQAA  784
             SGLKN NIG +LHLHPV  AWGYFP+    +  E   K++QGGI+T++  V S+ +   A
Sbjct  504   SGLKNSNIGKHLHLHPVTMAWGYFPDDQPLAWPEKHKKSYQGGIMTAMSLVNSDKS-YGA  562

Query  783   IIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMD  604
             +I+  SL P  FA++ PW S +DMK +  ++SRT +IF++ RD GSG+V     I Y+M+
Sbjct  563   VIQTPSLHPGMFASLMPWVSCVDMKMKRGRFSRTAHIFALARDKGSGKVNSPNSISYQME  622

Query  603   QIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATGGPM  424
               D++N++ GL + LRIL AAGA E+GT  S G+ +  K    +E + F    V      
Sbjct  623   APDEENLQKGLEKVLRILAAAGAEEIGTHHSKGRSLNVKKASYKEFDKF----VKRESSR  678

Query  423   SGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMIT  244
             S  +  T  CSAHQMGSCRMG    +  ++  GE WE +GL++ D SV P+A+GVNPM+T
Sbjct  679   SLRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTSVFPTALGVNPMVT  738

Query  243   ILSTAYCISNGLAKSLNSGK  184
             + + AYC +  + + L   K
Sbjct  739   VQAIAYCTAQSVLQLLKRKK  758



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   524 bits (1349),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 299/756 (40%), Positives = 447/756 (59%), Gaps = 52/756 (7%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPI---PLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFL  2146
             LS SQ  +L+AIC+  +P I    L Q++ D+++  F  +SAS    P  +A +V  R  
Sbjct  24    LSFSQMDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQ  83

Query  2145  PDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLI  1966
                + + +L L +LSTR+G+ +LCG      ++P++ NFS +   +RE I+  WS     
Sbjct  84    HPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFK  143

Query  1965  LPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF---------------------HVD  1849
             L ++++F+ +K+    ++F+  DE   NP+W+A+G+                     H +
Sbjct  144   L-IKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEE  202

Query  1848  TNEVPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE---SQNANTLTIRCDvvi  1678
              ++   D+    PL KGI+ T+ +    L   L K G +V++   S N  +  I CD V+
Sbjct  203   LSD-KRDEHLYGPLYKGIL-TLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVV  260

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSG GGGV A VLAN+GHKV+VLEKG Y    + S LEGPS+ +++   G++ T D  V
Sbjct  261   VGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDV  320

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
              + AG+ VGGGS INWSASI TP++VL EW    ++ LF S  Y+ A++ + +++GV + 
Sbjct  321   FLLAGSTVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDK  380

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
               +EG QN +LRKGCE LG  VE++PRN    HYCG C  GC+ G KKG + T+LVD V 
Sbjct  381   IDEEGFQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVK  440

Query  1137  NG-AVILTGCQAEKFILEEDETARK-KCLGVIAKSKGNN---KILRIEARATVSACGSLF  973
             +G   I+  C+A + I E      K K +GV  + + +N   +I  ++++ T+ ACG+L 
Sbjct  441   SGNGAIIQECEALEVIHEHKNNYNKSKAIGVACEFQHDNGVKEIFMVKSKVTIVACGALS  500

Query  972   TPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-----------EMEGKNHQGGIIT  826
             TP LL  SGLKN NIG NLH+HPV+FAWG+FP++ +           E + K+++GGI++
Sbjct  501   TPSLLKRSGLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMS  560

Query  825   SIHKVV--SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDH  652
              + KVV  +E      +I+  +L P  F+ V PW SGLD+K RM KYSRT +IF++ RD 
Sbjct  561   VMSKVVANTEEPGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDK  620

Query  651   GSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTE  472
             GSG+      I Y++DQID+ N++ G+ + LRIL AAGA E+GT    G+K   K    +
Sbjct  621   GSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVD  680

Query  471   ELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVC  292
             E ESF+    + G         T  CSAHQMGSCRMG   +   ++  GE WE + L++ 
Sbjct  681   EFESFVKEESSRGLKNLS----TPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIG  736

Query  291   DGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             D SV P+A+GVNPM+T+ + +YC +  + + L + K
Sbjct  737   DTSVFPTALGVNPMLTVQAISYCTAQNVLQLLKAKK  772



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   524 bits (1349),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 313/782 (40%), Positives = 451/782 (58%), Gaps = 68/782 (9%)
 Frame = -3

Query  2355  LLRGGRRNS--YNHGLSSSQYQALAAICEALIPPI----PLPQDSDD---EAMCSFYSSS  2203
             L  GG + S  Y + LSS + ++L A+C+ L P +     +   +DD    ++ +FY SS
Sbjct  26    LFLGGEKQSCSYVNSLSSREMESLTALCDTLFPSVYNSSMIAASADDGSTNSISTFYQSS  85

Query  2202  ASQPPFPDEVAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSE  2023
             AS    P  V E+   R      ++ RL L +LST +G+ +LCG       +P+   FS+
Sbjct  86    ASMAGTPQRVGELFCERVQHPKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFQRFSQ  145

Query  2022  LPLKRREAILLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFH-VDT  1846
             +   +RE I+  W+     L LR++F +IK+    ++FS  DE   N  W+AIG+   D 
Sbjct  146   ISQSKREQIVFSWATSFFYL-LRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDP  204

Query  1845  NEVPPDQQT-GRP-------------------------LEKGIIETINENGTTLKESL--  1750
               +    QT G+P                         L +G+++ +N     + +SL  
Sbjct  205   AALKRQTQTCGQPETLYASLKDDDDDEHDCKEEHLFGPLYRGLVD-LNLPRDRVADSLRQ  263

Query  1749  ------IKKGLNVTESQNANT----LTIRCDvvivgsgcgggvaaavlANSGHKVVVLEK  1600
                   I +G N+  S++ +T    L I+CD V+VGSG GGGV A VLA +G+KV+VLEK
Sbjct  264   IGFPVSILRGKNIDSSRDFSTSNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEK  323

Query  1599  GHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNV  1420
             G+YF   + S LEGPS+ ++Y  GGML + D  V++ AG+ VGGGS INWSASIKTP +V
Sbjct  324   GNYFARNNLSLLEGPSMDQMYLGGGMLASDDMGVVILAGSTVGGGSTINWSASIKTPQHV  383

Query  1419  LNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVP  1240
             +NEWS    + LF S  Y+ A+DAVC+++GV     +EG  + VLR+GCE LG  V ++P
Sbjct  384   INEWSESYDLELFDSKLYKEALDAVCEKMGVQSDIDEEGFNSAVLRRGCEELGYPVNTIP  443

Query  1239  RNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKK  1063
             RN    HYCG C +GCR G KK    T+L D VN+G   IL GC+A K + E  +   + 
Sbjct  444   RNSVPDHYCGWCCFGCRDGRKKDTCETWLKDMVNSGNGAILPGCKAIKVLHERKKGKDRS  503

Query  1062  CLGVIA---KSKGNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFA  892
                 +A   +  G   +  +E++ TV A G+L TP LL +SGLKN NIG +LHLHPV  A
Sbjct  504   TASGVAFGFEYNGMKDLCVVESKVTVVAGGALSTPALLKASGLKNANIGKHLHLHPVTMA  563

Query  891   WGYFPE------SMAEMEGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVS  736
             WGYFPE      +  E + K+++GGI+T++  VV+   K    A+I+  SL P  F+ + 
Sbjct  564   WGYFPEAPNSTAAWPEEQKKSYEGGIMTAMSTVVANVNKSGYGAVIQTPSLHPGMFSGLI  623

Query  735   PWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALR  556
             PW SG DMK RM ++SRT ++F++ RD GSG V     I YRMD  D+ N++ GL + LR
Sbjct  624   PWISGADMKRRMFRFSRTAHVFALARDRGSGTVNSPSSINYRMDAEDEKNLQEGLEKTLR  683

Query  555   ILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVATG-GPMSGEENWTLYCSAHQM  379
             IL AAGA E+GT  S G+ +  K +   E E F+    A     ++G+      CSAHQM
Sbjct  684   ILAAAGAEEIGTHHSTGKILNVKKVSYREFERFVKEESARPLRDLTGQ-----ICSAHQM  738

Query  378   GSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKS  199
             GSCRMG   ++ A++  GE WE +GL+V D SV P+A+GVNPM+T+ + AYC +  + + 
Sbjct  739   GSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTAQSVVQL  798

Query  198   LN  193
             L+
Sbjct  799   LS  800



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   525 bits (1351),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 310/823 (38%), Positives = 456/823 (55%), Gaps = 68/823 (8%)
 Frame = -3

Query  2487  QYLWHYLAVRESVA-----SITAKQREREREGEKIFKREKKMNERKCHPLLRGGRRNSYN  2323
             QYL  YL   E +A      I           ++  K EK  N+            N Y 
Sbjct  23    QYLQEYLTDTEYLAGCRDIKINIANVGTSSTADQAMKEEKSRNDN-------NNVFNIYE  75

Query  2322  HGLSSSQYQALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLP  2143
               LS  Q   L A+ +A +P + +   + DE++  FY++SAS    P  +  ++  R   
Sbjct  76    SSLSRRQMDTLIAVSDAFLPSVDVSDLTADESLLKFYATSASMAATPQRLGGMISERLKH  135

Query  2142  DAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLIL  1963
                ++ ++ L  LST  G+ ++CG       +P+ H+F  L  +RR+ IL  WS+    L
Sbjct  136   PKKWLLKVALWALSTWFGTFVMCGIASVSTTFPYFHSFPNLSHQRRQEILNSWSQSYFFL  195

Query  1962  PLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF------------------HVDTNEV  1837
              LR+++ ++K+  + ++F+  D   +N +W+AIG+                   +D  + 
Sbjct  196   -LRLLYWSLKLLTFLVFFTQVDSKDHNVSWKAIGYTGPDPDFKVQNTTTAATTKLDEQQQ  254

Query  1836  PPDQQTGRPLEKGIIETIN-ENGTTLKESLIKKGLNVTESQNANT---------------  1705
                +    PL  GI++     +  TL  +L + G  V   +   +               
Sbjct  255   QQQEILFGPLSSGIVDFKTLPHDLTLINTLKRHGFPVKRRRPCTSILPQERSTHNNKVPS  314

Query  1704  ------LTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGE  1543
                   L IRCD V+VGSG GGGV A +LA +G+KV+VLEKG+Y+   + + LEGP+L +
Sbjct  315   SIFDPFLKIRCDAVVVGSGSGGGVVAGLLARAGYKVLVLEKGNYYARNNLTLLEGPTLDQ  374

Query  1542  LYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQ  1363
             +Y S G++ T D  V++ AG+ VGGGS INWSASI TP +V  EW  E ++ LFGS  Y+
Sbjct  375   MYLSNGLMATADMDVLLLAGSTVGGGSTINWSASIPTPQHVRKEWCDEYELELFGSKLYE  434

Query  1362  SAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTG  1183
              A+D VCKR+ V     +EG  N VLRKGCE LG  V+++PRN    HYCG C  GC+ G
Sbjct  435   EALDVVCKRMQVQSEIEEEGFNNAVLRKGCEELGYPVDNIPRNAPSDHYCGWCCLGCKDG  494

Query  1182  DKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKK--CLGV---IAKSKGNNKI  1021
              KKG   T+L+D V +G  VIL G +A K +L + ++ R++    GV      SKG+ +I
Sbjct  495   RKKGTSETWLLDLVESGNGVILPGSEAVK-VLHQRKSGRERNTATGVAFEFENSKGDKEI  553

Query  1020  LRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMAEM--EGKN  847
               +E+R TV ACG+L TP LL  SGL+N NIG NLHLHPV  AWGYFP++ +    E K+
Sbjct  554   CVVESRVTVVACGALRTPTLLKRSGLRNPNIGKNLHLHPVAMAWGYFPDNSSSFLAEKKS  613

Query  846   HQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNI  673
             ++GGI+T++  V ++  K     +I+  +L P  F+ + PW SG DMK+RMR++SRT ++
Sbjct  614   YEGGIMTAMSTVAADLKKSGYGTVIQTPALHPGMFSILMPWVSGKDMKDRMRRFSRTAHV  673

Query  672   FSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKIC  493
             F++ RD GSG V     I+Y ++  D++ +R G+ + LRIL AAGA E+GT    G+ I 
Sbjct  674   FALARDQGSGTVNSDSEIRYSVEARDEEKLRAGVEKVLRILAAAGAEEIGTHHGKGKSIN  733

Query  492   CKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWE  313
              K     ELE F+     +G  M G   W + CSAHQMGSCRMG      A++  GE WE
Sbjct  734   VKSASYHELERFVKE--ESGREMRGLR-WPI-CSAHQMGSCRMGVAAATSAVNPMGETWE  789

Query  312   AKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
              +GL+V D SV P+A+GVNPM+T+ + AYC +  + + L   K
Sbjct  790   VEGLFVADTSVFPTALGVNPMVTVQAIAYCTALSVLQLLKRKK  832



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   523 bits (1348),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 305/763 (40%), Positives = 439/763 (58%), Gaps = 59/763 (8%)
 Frame = -3

Query  2316  LSSSQYQALAAICEALIPPIPLPQ--DSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLP  2143
             LS  Q ++L A+C+ +IP I       S  E++ +FY +SAS    P  +  +++ +   
Sbjct  69    LSPRQMKSLVALCDTIIPSIEGNNVVHSSHESVNNFYRTSASMAGTPQRLG-ILIEKLKH  127

Query  2142  DAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLIL  1963
              +  +  + L +LST  G+L+LCG       +PF  +F +L  + R+ ++  WS ++   
Sbjct  128   PSTRLLMVTLWLLSTWFGTLILCGKASLSTNFPFFRSFPDLSSETRQNVMKCWS-QSYFH  186

Query  1962  PLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTG-----------  1816
              LR+ F TIK+    ++F+  DE  NNP+W+AIG+     E    Q+             
Sbjct  187   HLRMFFRTIKLLTLLVFFTQLDEEENNPSWKAIGYSGPHEEFKRQQKNHILQKSSKEGLQ  246

Query  1815  -------------------RPLEKGIIETINENGTTLKESL--IKKGLNVTESQN-----  1714
                                 PL +G++  +N     + +SL   K  ++VT   N     
Sbjct  247   KEKQEDNNDDDNDNNEEILGPLYRGLVH-LNHPCDIIADSLRRFKFHVSVTPPNNKPSTI  305

Query  1713  -ANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELY  1537
              + +L I+CDVV+VGSG GGGV A VLA SG+KV+VLEKG YF   + S LEGP++ ++Y
Sbjct  306   SSPSLVIQCDVVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYFARNNVSLLEGPTMDQMY  365

Query  1536  ESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSA  1357
              S G++ TTD  V++ AG+ VGGGS INWSASIKTP++V  EW    ++ LF S+ Y+ A
Sbjct  366   LSNGLIATTDMSVLILAGSTVGGGSTINWSASIKTPHHVCKEWCDIHELELFESTLYKEA  425

Query  1356  MDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDK  1177
             MD VCK++GV     +EG  N VLRKGC  +G  V ++PRN    HYCG C  GC+ G K
Sbjct  426   MDVVCKKMGVQSDFEEEGFNNAVLRKGCHEMGYPVNNIPRNAPPNHYCGWCCMGCKDGTK  485

Query  1176  KGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSKGNNKILRIE  1009
             KG   T+LVD V +G   IL  C+A + +  E + + +K    +A   +  GN  I  +E
Sbjct  486   KGTSETWLVDLVKSGNGAILPKCEAIQILHREKKGSDRKTASGVAFAIEYNGNKDICVVE  545

Query  1008  ARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA------EMEGKN  847
             ++ T+ ACG+L TP LL  SGLKN+NIG NLHLHPV  AWGYFP S +      E   K+
Sbjct  546   SKVTIIACGALSTPSLLKRSGLKNENIGRNLHLHPVTMAWGYFPNSPSSSKLWPEEHKKS  605

Query  846   HQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNI  673
             ++GGI+T++  VV+E  K    A+I+  SL P  F+ + PW SG+D+K+RMRK+SRT ++
Sbjct  606   YEGGIMTAMSTVVAEFNKSGYGAVIQTPSLHPGLFSILMPWNSGMDIKDRMRKFSRTAHV  665

Query  672   FSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKIC  493
             F++ RD GSG V     I Y M   DK+N++ G+ + LRIL AAGA E+GT  + G ++ 
Sbjct  666   FALARDQGSGTVDSPSCISYHMKDADKENLKKGIEKVLRILAAAGAEEIGTHNNKGNRLN  725

Query  492   CKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWE  313
              K +   E E F    V     M   +  T  CSAHQMGSCRMG   +D  ++  GE WE
Sbjct  726   VKKVSYHEFEKF----VKEESSMELTDLSTPICSAHQMGSCRMGNNPKDSVVNQMGETWE  781

Query  312   AKGLYVCDGSVLPSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
              + LY+ D SV P+A+GVNPM+TI + AYC +  + + L   K
Sbjct  782   VEDLYIADASVFPTALGVNPMVTIQAIAYCTAQHVLEVLRRKK  824



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   520 bits (1338),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 302/748 (40%), Positives = 439/748 (59%), Gaps = 53/748 (7%)
 Frame = -3

Query  2298  QALAAICEALIPPI----PLPQDSDD---EAMCSFYSSSASQPPFPDEVAEVVMRRFLPD  2140
             ++L AIC+ L P +     +   +DD    ++ +FY SSAS    P  V E+   R    
Sbjct  2     ESLTAICDTLFPSVYNSSMMAASADDGSTNSISTFYQSSASMAGTPQRVGELFCDRVQHP  61

Query  2139  AVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILP  1960
               ++ RL L +LST +G+ +LCG       +P+   FS++   +RE I+  W+     L 
Sbjct  62    KKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFLRFSQISQSKREQIVFSWATSFFYL-  120

Query  1959  LRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF----------HVDTNEVP----PDQQ  1822
             LR++F +IK+    ++FS  DE   N  W+AIG+             T  +P      + 
Sbjct  121   LRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDPAALKRQTQTCGLPETLYAKEH  180

Query  1821  TGRPLEKGIIETINENGTTLKESL--------IKKGLNVTESQNANT----LTIRCDvvi  1678
                PL +G+++ +N     + +SL        I++G ++  S++ +T    L I+CD V+
Sbjct  181   LFGPLYRGLVD-LNLPRDRVADSLRQIGFPVSIRRGKDIDSSRDFSTSNPSLVIKCDAVV  239

Query  1677  vgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKV  1498
             VGSG GGGV A VLA +G+KV+VLEKG+YF   + S LEGPS+ ++Y   GML + D  V
Sbjct  240   VGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLSLLEGPSMDQMYLGAGMLASDDMGV  299

Query  1497  MVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEV  1318
             +V AG+ VGGGS INWSASIKTP +V+NEWS    + LF S  Y+ A+DAVC+++GV   
Sbjct  300   VVLAGSTVGGGSTINWSASIKTPQHVINEWSETYDLELFDSKLYKEALDAVCEKMGVQSD  359

Query  1317  CSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVN  1138
               +EG  + VLR+GCE LG  V ++PRN    HYCG C +GC+ G KKG   T+L D VN
Sbjct  360   IDEEGFNSAVLRRGCEELGYPVNTIPRNSVPDHYCGWCCFGCKDGRKKGTCETWLKDMVN  419

Query  1137  NG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSKGNNKILRIEARATVSACGSLFT  970
             +G   IL GC+A K + E  +   +     +A   +  G   +  +E++ T+ A G+L T
Sbjct  420   SGNGAILPGCEAIKVLHERKKGKDRSTASGVAFGFEHNGMKDLCVVESKVTIVAGGALST  479

Query  969   PPLLISSGLKNKNIGSNLHLHPVLFAWGYFPE------SMAEMEGKNHQGGIITSIHKVV  808
             P LL +SGLKN NIG +LHLHPV  AWGYFPE      +  E + K+++GGI+T++  VV
Sbjct  480   PALLKASGLKNANIGKHLHLHPVTMAWGYFPEAPISTTAWPEEQKKSYEGGIMTAMSTVV  539

Query  807   SEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVK  634
             +   K    A+I+  SL P  F+ + PW SG DMK RM ++SRT ++F++ RD GSG V 
Sbjct  540   ANVNKSGYGAVIQTPSLHPGMFSGLIPWISGADMKRRMCRFSRTAHVFALARDRGSGTVN  599

Query  633   KAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFL  454
                 I YRMD  D+ N++ GL + LRIL AAGA E+GT  S G+ +  K +   E E F+
Sbjct  600   SPSSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHSTGKSLNVKKVSYREFERFV  659

Query  453   DGVVATG-GPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVL  277
                 A     ++G+      CSAHQMGSCRMG   ++ A++  GE WE +GL+V D SV 
Sbjct  660   KEESARPLRDLTGQ-----ICSAHQMGSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVF  714

Query  276   PSAIGVNPMITILSTAYCISNGLAKSLN  193
             P+A+GVNPM+T+ + AYC +  + + L+
Sbjct  715   PTALGVNPMVTVQAIAYCTAQSVVQLLS  742



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   522 bits (1344),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 300/750 (40%), Positives = 451/750 (60%), Gaps = 48/750 (6%)
 Frame = -3

Query  2340  RRNSYNHGLSSSQYQALAAICEALIPPIP---LPQDSDDEAMCSFYSSSASQPPFPDEVA  2170
             +R    + LS  Q ++L A+C+ L+P I    +   SDDE++ +FY +SAS    P+ + 
Sbjct  70    QRKPLTNSLSPRQMKSLVALCDTLLPSINNNNVVWGSDDESVANFYKTSASMAGTPEHLG  129

Query  2169  EVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILL  1990
              ++  +    + ++  L L +LST  G+ +LCG +    ++PF H++ EL L +R+ ++ 
Sbjct  130   ILISEKLKHPSTWLLLLTLWLLSTWFGTFILCGTLSLSTKFPFFHSYPELSLLKRQKVMQ  189

Query  1989  KWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF-------------HVD  1849
              WS  + + PLR+ F TIK+    ++F+  DE  +NP+W+AIG+             H  
Sbjct  190   SWSL-SYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDPEFKSQLKNHFF  248

Query  1848  TNEVPPDQQTGR-------PLEKGIIETINENGTTLKESLIKKGLNVTESQ--------N  1714
             T +   +++          PL KG+I  IN     + +SL + G +V+ +         +
Sbjct  249   TKQRGQEEKEDDGTEDVRGPLYKGLIR-INNPRDIITDSLRRVGFSVSATPKKTKASTLS  307

Query  1713  ANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYE  1534
             + +L I+CD V+VGSG GGGV A VLAN+G+KV+VLEKG Y    + S LEGPS+ ++Y 
Sbjct  308   SPSLVIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMYL  367

Query  1533  SGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAM  1354
             S G++ T D  V++ AG+ VGGGSAINWSASI+TP +V  EW    ++ LF S  Y+ A+
Sbjct  368   SNGLVATNDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDRHELELFESMLYKEAL  427

Query  1353  DAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKK  1174
             D VC+++GV      EG  N VLR+GC  +G  V ++PRN +  HYCG C  GC+ G KK
Sbjct  428   DVVCEKMGVQSEIDDEGFNNAVLRRGCVEMGYPVCNIPRNATSDHYCGWCCLGCKDGRKK  487

Query  1173  GVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSKGNNKILRIEA  1006
             G   T+LVD V +G   I+  C+A + + ++ +   +K    +A   + KG   I  +E+
Sbjct  488   GTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRHRKIARGVAFAIEYKGKKDICVVES  547

Query  1005  RATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-----EMEGKNHQ  841
             + T+ ACG+L TP LL  SGLKN+NIG NLHLHPV  AWGYFP+S +     E   K+++
Sbjct  548   KVTIVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSPSPELWPEKHKKSYE  607

Query  840   GGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFS  667
             GGI+T++  VV++  K     +I+  +L P  F+ + PWTSG D+K+RMRK+SRT ++F+
Sbjct  608   GGIMTAMSTVVAQFDKSGYGTVIQTPALHPGMFSILMPWTSGADIKDRMRKFSRTAHVFA  667

Query  666   MVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCK  487
             + RD GSG V     I Y++  IDK+N++ GL + LRIL AAGA E+GT  + G++I  K
Sbjct  668   LARDQGSGTVNSPSCISYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRRINVK  727

Query  486   GIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAK  307
              +   E E F    V     MS  +  T  CSAHQMGSC+MG    +  ++  GE WE +
Sbjct  728   QVSYHEFEKF----VKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVE  783

Query  306   GLYVCDGSVLPSAIGVNPMITILSTAYCIS  217
             GLY+ D SV P+A+GVNPM+T+ + +YC +
Sbjct  784   GLYLADSSVFPTALGVNPMVTVQAISYCTA  813



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   519 bits (1337),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 296/749 (40%), Positives = 440/749 (59%), Gaps = 52/749 (7%)
 Frame = -3

Query  2295  ALAAICEALIPPI---PLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIF  2125
             +L AIC+  +P I    L Q++ D+++  F  +SAS    P  +A +V  R     + + 
Sbjct  3     SLTAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNETPQHLAWMVSERIQHPKLNLC  62

Query  2124  RLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVF  1945
             +L L +LSTR+G+ +LCG      ++P++ NFS++   +RE I+  WS     L ++++F
Sbjct  63    KLALWLLSTRIGTFILCGKASLSSQFPYLQNFSKVSPNKREEIVQSWSCSNFKL-IKLLF  121

Query  1944  MTIKIACYFIYFSWTDENYNNPAWEAIGF---------------------HVDTNEVPPD  1828
             + +K+    ++F+  DE   NP+W+A+G+                     H + ++   D
Sbjct  122   VALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEELSD-KRD  180

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE---SQNANTLTIRCDvvivgsgcgg  1657
             +    PL KGI+ T+ +    L   L K G +V++   S N  +  I CD V+VGSG GG
Sbjct  181   EHLYGPLYKGIL-TLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGG  239

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GV A VLAN+GHKV+VLEKG Y    + S LEGPS+ +++   G++ T D  V + AG+ 
Sbjct  240   GVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGST  299

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGS INWSASI TP++VL EW     + LF S  Y+ A++ + +++GV +   +EG Q
Sbjct  300   VGGGSTINWSASIDTPSHVLKEWCDIYNLELFQSEFYKEALETIREKMGVQDKIDEEGFQ  359

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVIL  1120
             N +LRKGCE LG  VE++PRN    HYCG C  GC+ G KKG + T+LVD V +G   I+
Sbjct  360   NMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAII  419

Query  1119  TGCQAEKFILEEDETARK-KCLGV---IAKSKGNNKILRIEARATVSACGSLFTPPLLIS  952
               C+A + I E      K K +GV        G  +I  ++++ T+ ACG+L TP LL  
Sbjct  420   QECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVKSKVTIVACGALSTPSLLKR  479

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMA-----------EMEGKNHQGGIITSIHKVV-  808
             SGLKN NIG NLH+HPV+FAWG+FP++ +           E + K+++GGI++++ KVV 
Sbjct  480   SGLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSAMSKVVA  539

Query  807   -SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
              +E      +I+  SL P  F+ V PW SGLD+K RM KYSRT +IF++ RD GSG+   
Sbjct  540   NTEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVS  599

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                I Y++DQID+ N++ G+ + LRIL AAGA E+GT    G+K   K    +E ESF+ 
Sbjct  600   PYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVK  659

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
                + G         T  CSAHQMGSCRMG   +   ++  GE WE + L++ D SV P+
Sbjct  660   EESSRGLKNLS----TPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPT  715

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             A+GVNPM+T+ + +YC +  + + L + K
Sbjct  716   ALGVNPMLTVQAISYCTAQNVLQLLKAKK  744



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   519 bits (1336),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 300/751 (40%), Positives = 442/751 (59%), Gaps = 57/751 (8%)
 Frame = -3

Query  2295  ALAAICEALIPPI---PLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIF  2125
             +L+AIC+  +P I    L Q++ D+++  F  +SAS    P  +A +V  R     + + 
Sbjct  3     SLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLNLC  62

Query  2124  RLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVF  1945
             +L L +LSTR+G+ +LCG      ++P++ NFS +   +RE I+  WS     L ++++F
Sbjct  63    KLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKL-IKLLF  121

Query  1944  MTIKIACYFIYFSWTDENYNNPAWEAIGF---------------------HVDTNEVPPD  1828
             + +K+    ++F+  DE   NP+W+A+G+                     H + ++   D
Sbjct  122   VALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEEFSD-KRD  180

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE---SQNANTLTIRCDvvivgsgcgg  1657
             +    PL KGI+ T+ +    L   L K G +V++   S N  +  I CD V+VGSG GG
Sbjct  181   EHLYGPLYKGIL-TLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGG  239

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GV A VLAN+GHKV+VLEKG Y    + S LEGPS+ +++   G++ T D  V + AG+ 
Sbjct  240   GVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGST  299

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGS INWSASI TP++VL EW    ++ LF S  Y+ A++ + K++GV +   +EG Q
Sbjct  300   VGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIRKKMGVQDKIDEEGFQ  359

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVIL  1120
             N +LRKGCE LG  VE++PRN    HYCG C  GC+ G KKG + T+LVD V +G   I+
Sbjct  360   NMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAII  419

Query  1119  TGCQAEKFILEEDETARK-KCLGV---IAKSKGNNKILRIEARATVSACGSLFTPPLLIS  952
               C+A + I E      K K +GV        G  +I  + ++ T+ ACG+L TP LL  
Sbjct  420   QECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVTIVACGALSTPSLLKR  479

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMA-----------EMEGKNHQGGIITSIHKVV-  808
             SGLKN NIG NLH+HPV+FAWG+FP++ +           E E K+++GGI++ + KVV 
Sbjct  480   SGLKNPNIGKNLHVHPVVFAWGHFPDTDSTDNVKNFEVWPESEKKSYEGGIMSVMSKVVA  539

Query  807   -SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
              +E      +I+  SL P  F+ V PW SGLD+K RM KYSRT +IF++ RD GSG+   
Sbjct  540   NTEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVS  599

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                I Y++DQID+ N++ G+ + LRIL AAGA E+GT    G+K   K    +E ESF+ 
Sbjct  600   PYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVK  659

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
                + G     ++  T  CSAHQMGSCRMG   +   ++  GE WE + L++ D SV P+
Sbjct  660   EESSRG----LKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPT  715

Query  270   AIGVNPMITILSTAYCISNGL-----AKSLN  193
             A+GVNPM+T+ + +YC +  +     AK+LN
Sbjct  716   ALGVNPMLTVQAISYCTAQNVLQLLKAKNLN  746



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   519 bits (1336),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 295/749 (39%), Positives = 443/749 (59%), Gaps = 52/749 (7%)
 Frame = -3

Query  2295  ALAAICEALIPPI---PLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIF  2125
             +L+AIC+  +P I    L Q++ D+++  F  +SAS    P  +A +V  R     + + 
Sbjct  3     SLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLNLC  62

Query  2124  RLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVF  1945
             +L L +LSTR+G+ +LCG      ++P++ NFS +   +RE I+  WS     L ++++F
Sbjct  63    KLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKL-IKLLF  121

Query  1944  MTIKIACYFIYFSWTDENYNNPAWEAIGF---------------------HVDTNEVPPD  1828
             + +K+    ++F+  DE   NP+W+A+G+                     H + ++   D
Sbjct  122   VALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEELSD-KRD  180

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE---SQNANTLTIRCDvvivgsgcgg  1657
             +    PL KGI+ T+ +    L   L K G +V++   S N  +  I CD V+VGSG GG
Sbjct  181   EHLYGPLYKGIL-TLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGG  239

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GV A VLAN+GHKV+VLEKG Y    + S LEGPS+ +++   G++ T D  V + AG+ 
Sbjct  240   GVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGST  299

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGS INWSASI TP++VL EW    ++ LF S  Y+ A++ + +++GV +   +EG Q
Sbjct  300   VGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQ  359

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVIL  1120
             N +LRKGCE LG  VE++PRN    HYCG C  GC+ G KKG + T+LVD V +G   I+
Sbjct  360   NMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAII  419

Query  1119  TGCQAEKFILEEDETARK-KCLGVIAKSKGNN---KILRIEARATVSACGSLFTPPLLIS  952
               C+A + I E      K K +GV  + + +N   +I  ++++ T+ ACG+L TP LL  
Sbjct  420   QECEALEVIHEHKNNYNKSKAIGVACEFQHDNGVKEIFMVKSKVTIVACGALSTPSLLKR  479

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMA-----------EMEGKNHQGGIITSIHKVV-  808
             SGLKN NIG NLH+HPV+FAWG+FP++ +           E + K+++GGI++ + KVV 
Sbjct  480   SGLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSVMSKVVA  539

Query  807   -SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
              +E      +I+  +L P  F+ V PW SGLD+K RM KYSRT +IF++ RD GSG+   
Sbjct  540   NTEEPGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVS  599

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                I Y++DQID+ N++ G+ + LRIL AAGA E+GT    G+K   K    +E ESF+ 
Sbjct  600   PYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVK  659

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
                + G         T  CSAHQMGSCRMG   +   ++  GE WE + L++ D SV P+
Sbjct  660   EESSRGLKNLS----TPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPT  715

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             A+GVNPM+T+ + +YC +  + + L + K
Sbjct  716   ALGVNPMLTVQAISYCTAQNVLQLLKAKK  744



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   518 bits (1335),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 296/747 (40%), Positives = 444/747 (59%), Gaps = 49/747 (7%)
 Frame = -3

Query  2295  ALAAICEALIPPI---PLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIF  2125
             +L+AIC+  +P I    L Q++ D+++  F  +SAS    P  +A +V  R     + + 
Sbjct  3     SLSAICDTFLPSIDTNSLHQENMDDSVIKFLHTSASMNGTPQHLAWMVSERIQHPKLNLC  62

Query  2124  RLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVF  1945
             +L L +LSTR+G+ +LCG      ++P++ NFS +   +RE I+  WS     L ++++F
Sbjct  63    KLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKL-IKLLF  121

Query  1944  MTIKIACYFIYFSWTDENYNNPAWEAIGF-HVDTNEVPPDQQTGR---------------  1813
             + +K+    ++F+  DE   NP+W+A+G+   D +   P Q+                  
Sbjct  122   VALKVLTLLVFFTQVDEKCQNPSWKALGYCGQDPDFKKPKQEKMNSKQSKHEEFSDKRDE  181

Query  1812  ----PLEKGIIETINENGTTLKESLIKKGLNVTE---SQNANTLTIRCDvvivgsgcggg  1654
                 PL KGII T+ +    L   L K G +V++   S N  +  I CD V+VGSG GGG
Sbjct  182   HLYGPLYKGII-TLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGGG  240

Query  1653  vaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMV  1474
             V A VLAN+GHKV+VLEKG Y    + S LEGPSL +++   G++ T D +V + AG+ V
Sbjct  241   VIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSLDQMFLGNGLMMTKDMEVFLLAGSTV  300

Query  1473  GGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQN  1294
             GGGS INWSASI TP++VL EW    ++ +F S  Y+ A++A+ +++GV +   +EG QN
Sbjct  301   GGGSTINWSASIDTPSHVLKEWCGIYELEMFQSESYKEALEAIREKMGVQDKIDEEGFQN  360

Query  1293  QVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILT  1117
              +LRKGCE LG  VE++PRN    H CG C  GC+ G KKG + T+LVD V +G   I+ 
Sbjct  361   MILRKGCEELGYHVENIPRNAPSNHNCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQ  420

Query  1116  GCQAEKFILEEDETARK-KCLGVIA--KSKGNNKILRIEARATVSACGSLFTPPLLISSG  946
              C+A + I E      K K +GV    + +G  +I  ++++ T+ ACG+L TP LL  SG
Sbjct  421   ECEALEVIHEHKNNYNKSKAIGVACEFQHEGVKEIFMVKSKVTIVACGALSTPSLLKRSG  480

Query  945   LKNKNIGSNLHLHPVLFAWGYFPESMA-----------EMEGKNHQGGIITSIHKVVS--  805
             LKN NIG NLH+HPV+FAWG+FP++ +           E + K+++GGI++ + KVV+  
Sbjct  481   LKNPNIGKNLHVHPVVFAWGHFPDTNSSDNVKNFEVWPESKKKSYEGGIMSVMSKVVANF  540

Query  804   EGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAG  625
             E +    +I+  +L P  F+ V PW SGLD+K RM KYSRT +IF++ RD GSG+   + 
Sbjct  541   EESGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGEAISSN  600

Query  624   RIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGV  445
              I Y++DQID+ N++ G+ + LRIL AAGA E+GT    G+ +  K    +E ESF+   
Sbjct  601   SISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGKTLKVKESSVDEFESFVKEE  660

Query  444   VATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAI  265
              + G         T  CSAHQMGSCRMG   +   ++  GE WE + L++ D SV P+A+
Sbjct  661   SSRGFKNLS----TPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTAL  716

Query  264   GVNPMITILSTAYCISNGLAKSLNSGK  184
             GVNPM+T+ + +YC +  + + L + K
Sbjct  717   GVNPMVTVQAISYCTAQNVLQVLKAKK  743



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   517 bits (1332),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 308/751 (41%), Positives = 444/751 (59%), Gaps = 60/751 (8%)
 Frame = -3

Query  2298  QALAAICEALIPPIPLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIFRL  2119
             + L A+C+  +P I L   SD      FY +SAS    P  +AE++  +     +++ RL
Sbjct  2     EELTAVCDTFLPSIHL---SDHHRHHQFYQTSASMTQTPHHLAELLGEKIKHPKIYLSRL  58

Query  2118  VLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVFMT  1939
              L  LSTRLG+ +LCG      ++P++  FS +   +RE ILL WS     L LRI++  
Sbjct  59    ALFSLSTRLGTFILCGRKSLSEKFPYLQRFSRVLPHKREQILLSWSESCFSL-LRILYAG  117

Query  1938  IKIACYFIYFSWTDENYNNPAWEAIGFHVDTNEVPPDQQTGRPL----------EKGIIE  1789
             +KI    ++F+  ++   N +W+AIG+        PD +  +P+          EKG  E
Sbjct  118   LKIFTLLVFFTLVNDKDENVSWKAIGY------TRPDHKARKPVVHNTPHEKAREKGE-E  170

Query  1788  TINE--------NG-TTLKES-------LIKKGLNVT--ESQNAN------TLTIRCDvv  1681
              I+E        NG   L +S       L K G  V+   S  A       +  ++CDVV
Sbjct  171   CISEKERFGPLYNGIVNLNQSREIALCKLEKSGFPVSIPHSNGAKIKSSDPSFIVKCDVV  230

Query  1680  ivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGK  1501
             +VGSG GGGV A VLA +G+KV+VLEKG Y    + S LEG ++ ++Y   G+L T +  
Sbjct  231   VVGSGSGGGVVAGVLAEAGYKVLVLEKGCYIARSNLSLLEGQTIDQMYLGNGVLGTDNMD  290

Query  1500  VMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTE  1321
             V++ AG+ VGGGS INWSASI+TP +V  +WS   K+ +F    Y++A+D VC+++GV  
Sbjct  291   VLLLAGSTVGGGSTINWSASIRTPPHVRKDWSENHKLEMFDGEIYENALDVVCEKMGVQS  350

Query  1320  VCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAV  1141
                +EG  + +LRKGCE LG  VES+PRN    H+CG C  GCR G KKGV  T+LVD V
Sbjct  351   EFKQEGFNSTILRKGCEKLGYPVESIPRNAGPDHHCGWCNLGCRDGKKKGVSETWLVDLV  410

Query  1140  NNG-AVILTGCQAEKFILEEDETARKKC-LGVIAKSKGNNKILRIEARATVSACGSLFTP  967
              +G   ILT C+A K I+++ +  ++ C +  +  S    +I  IE++ TV ACG++ TP
Sbjct  411   ESGNGAILTECEALKVIVDQKDRKKRACGVSFMFGSDEVKEIAVIESKITVVACGAICTP  470

Query  966   PLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA---------EMEGKNHQGGIITSIHK  814
             PLL  SGLKN+NIG NLHLHPV+ AWGYFP+S +         E E ++++G I+T++ K
Sbjct  471   PLLKRSGLKNRNIGRNLHLHPVVNAWGYFPDSPSSSNCNYVWPEAEKRSYEGAIMTAMSK  530

Query  813   VVSEGT-KQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQV  637
             VV E +   AAII+  +L P  F+A+ PW SG D+K+RM KYSRT ++F++VRD GSG V
Sbjct  531   VVEEHSGYSAAIIQTPALHPGMFSALMPWLSGRDIKDRMVKYSRTAHLFALVRDRGSGFV  590

Query  636   KKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESF  457
                  + Y+MD  D++N+R G+ + LR+L AAGA E+GT   +G+ +  K    EELE F
Sbjct  591   ASPDHVGYKMDGADRENLRKGIERVLRVLAAAGAEEIGTHHRNGRVLKVKEAGEEELERF  650

Query  456   LDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVL  277
             +  V  +   +    +W +  SAHQMGSCRMG      A+   GE WE   L+V D SV 
Sbjct  651   V--VEESSRVLEENLSWPI-SSAHQMGSCRMGVGPRGSAVGPTGESWEVGALFVADASVF  707

Query  276   PSAIGVNPMITILSTAYCISNGLAKSLNSGK  184
             P+A+GVNPM+T+ + AYC++  + +SL   K
Sbjct  708   PTALGVNPMVTVQAIAYCVAQCVVQSLGGKK  738



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   520 bits (1340),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 300/757 (40%), Positives = 449/757 (59%), Gaps = 54/757 (7%)
 Frame = -3

Query  2340  RRNSYNHGLSSSQYQALAAICEALIPPIPLPQDS-----DDEAMCSFYSSSASQPPFPDE  2176
             ++    + LS  Q ++L A+C+ L+P I    ++     DDE++ +FY +SAS    P+ 
Sbjct  67    QKKPLTNSLSPRQMKSLVALCDTLLPSINNNSNNVCGSDDDESVANFYKTSASMAGTPEH  126

Query  2175  VAEVVMRRFLPDAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAI  1996
             +  ++  +    + ++  L L +LST  G+ +LCG +    ++PF H++ EL L +++ +
Sbjct  127   LGILISEKLRHPSTWLLLLSLWLLSTWFGTFILCGMLSLSTKFPFFHSYPELSLLKQQKV  186

Query  1995  LLKWSRETLILPLRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF-------------H  1855
             +  WS  + + PLR++F TIK+    ++F+  DE  +NP+W+AI +             H
Sbjct  187   MQSWSL-SYLRPLRMLFRTIKLLTLLVFFTQLDEAEDNPSWKAINYCGPDPEFKSQLKNH  245

Query  1854  VDTNE-----------VPPDQQTGRPLEKGIIETINENGTTLKESLIKKGLNVT------  1726
               T E               +    PL KG+I  IN     + +SL + G +V+      
Sbjct  246   FFTKERGQEEKEDEDYDDGTEDVRGPLYKGLI-YINYPRDIITDSLRRVGFSVSATPKKT  304

Query  1725  --ESQNANTLTIRCDvvivgsgcgggvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPS  1552
                S ++ +L I+CD V+VGSG GGGV A VLAN+G+KV+VLEKG Y    + S LEGPS
Sbjct  305   KASSLSSPSLVIQCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPS  364

Query  1551  LGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSS  1372
             + ++Y S G++ T D  V++ AG+ VGGGSAINWSASI+TP +V  EW    ++ LF S 
Sbjct  365   MDQMYLSNGLVATKDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDGHELELFESK  424

Query  1371  EYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGC  1192
              Y+ A+D VC+++GV      EG  N VLR+GC  +G  V  +PRN S  HYCG C  GC
Sbjct  425   LYKEALDVVCEKMGVQSEIDDEGFNNAVLRRGCLEMGYPVCDIPRNASSDHYCGWCCMGC  484

Query  1191  RTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDETARKKCLGVIA---KSKGNNK  1024
             + G KKG   T+LVD V +G   I+  C+A + + ++ +   +K    +A   + KG   
Sbjct  485   KDGRKKGTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRDRKIARGVAFAIEYKGKRD  544

Query  1023  ILRIEARATVSACGSLFTPPLLISSGLKNKNIGSNLHLHPVLFAWGYFPESMA-----EM  859
             I  +E++ TV ACG+L TP LL  SGLKN+NIG NLHLHPV  AWGYFP+S++     E 
Sbjct  545   ICVVESKVTVVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSLSPELWPEK  604

Query  858   EGKNHQGGIITSIHKVVSEGTKQ--AAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSR  685
               K+++GGI+T++  VV++  K    A+I+  +L P  F+ + PWTSG D+K+RMRK+SR
Sbjct  605   HKKSYEGGIMTAMSTVVAQFDKSGYGAVIQTPALHPGMFSILMPWTSGKDIKDRMRKFSR  664

Query  684   TVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDG  505
             T ++F++ RD GSG V     I Y++  +DK+N++ GL + LRIL AAGA E+GT  + G
Sbjct  665   TAHVFALARDQGSGTVNSPSHISYQLKDVDKENLKIGLEKVLRILAAAGAEEIGTHNNKG  724

Query  504   QKICCKGIKTEELESFLDGVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNG  325
             + I  K +   E E F    V     MS  +  T  CSAHQMGSC+MG    +  ++  G
Sbjct  725   RSINVKQVSYHEFEKF----VKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMG  780

Query  324   ECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             E WE +GLY+ D SV P+A+GVNPM+T+ + +YC + 
Sbjct  781   ETWEVEGLYLADTSVFPTALGVNPMVTVQAISYCTAQ  817



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   515 bits (1327),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 310/730 (42%), Positives = 429/730 (59%), Gaps = 27/730 (4%)
 Frame = -3

Query  2319  GLSSSQYQALAAICEALIPPIPLPQDSDDE-AMCSFYSSSASQPPFPDEVAEVVMRRFLP  2143
             G  +   + L+A+C+A +P I      D + +   FY +SAS    P  V E++ +   P
Sbjct  3     GTGAGVLETLSAVCDAFLPSIDDGGGIDIDPSAADFYRTSASMSETPRGVMEMLAKARHP  62

Query  2142  DAVFIFRLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLIL  1963
               + +    L  LSTR+GS++LCG  C  G    +  FSELP++ RE IL  WSR    L
Sbjct  63    K-ISLAVPALWFLSTRIGSVVLCGRRCVGGG-KLVKRFSELPVEEREEILAYWSRH--FL  118

Query  1962  P-LRIVFMTIKIACYFIYFSWTDENYNNPAWEAIGF-HVDTNEVPPDQQTGRPLEKGIIE  1789
             P LRI + ++K      +F+  DEN  N +W+AIG+   D        + G PL +GII 
Sbjct  119   PHLRIFYHSLKFFTLLRFFTHVDENGENVSWKAIGYCGPDPTRNGGPFEVG-PLHRGIIN  177

Query  1788  TINENGTTLKESLIKKGLNVTES-QNANTLTIRCDvvivgsgcgggvaaavlANSGHKVV  1612
                E       +L   G  V++  +   + TI CD V+VGSG GGGV A VLA SGHKV+
Sbjct  178   LDREREPPPSRALSLYGFPVSKGGEGGVSFTIECDAVVVGSGSGGGVVAGVLAKSGHKVL  237

Query  1611  VLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTMVGGGSAINWSASIKT  1432
             V+EKG Y    D + LEG S+  +Y   G+L + D  V+  AG+ VGGGS INWSASI+T
Sbjct  238   VIEKGSYSARSDLTLLEGQSMERMYLEKGLLASDDMSVLFVAGSTVGGGSTINWSASIRT  297

Query  1431  PNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQNQVLRKGCENLGLKV  1252
             P +V  EWS E  + LF S +Y  A+D V +R+ V +    EGL N VLR+GCE LG  V
Sbjct  298   PPHVRREWSDECGLRLFQSEDYDDALDVVSERMSVQKEVEDEGLANMVLRRGCETLGYAV  357

Query  1251  ESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVILTGCQAEKFILEEDET  1075
             E++PRN    HYCG C +GCR G K G   T+LVD V +G   IL  C+A K I +  +T
Sbjct  358   ENIPRNAPSDHYCGWCSFGCRDGRKHGTSETWLVDLVESGNGAILPNCEAIKVITQMKKT  417

Query  1074  A------RKKCLGVIAKSK---GNNKILRIEARATVSACGSLFTPPLLISSGLKNKNIGS  922
                     KK +G+  + +   G+ +I  + ARA VS+CG++ TPPLL  SGLKN NIG 
Sbjct  418   TTINDGRSKKAVGITFRFRNPNGDEEIAAVRARAVVSSCGAICTPPLLKRSGLKNPNIGR  477

Query  921   NLHLHPVLFAWGYFPES--MAEMEGKNHQGGIITSIHKVVSEGTKQAAIIEAVSLGPAGF  748
             NLH+HPV+ AWGYFP +    E + ++++GGI+T++ K  +  T    II+  SL P  F
Sbjct  478   NLHIHPVVMAWGYFPATNPWPEADKRSYEGGIMTAMAKSRTGDT----IIQTPSLHPGMF  533

Query  747   AAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKKAGRIQYRMDQIDKDNIRTGLR  568
             +A++PW SG D+K RM K+SRT +IFS+ RD GSG V     I YR+D  D++N+ +GL 
Sbjct  534   SALTPWISGRDIKNRMLKFSRTAHIFSLARDAGSGTVTSESNISYRLDDADRENLGSGLE  593

Query  567   QALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLDGVVA--TGGPMSGEENWTLYC  394
             + LR+L AAGA E+GT   DG+ +  K    ++  + L+  +   +  P+  E   +  C
Sbjct  594   EVLRVLAAAGAEEIGTHHRDGRSLKVKKKDRDDQAALLERFIKEESRKPLEKESLSSPIC  653

Query  393   SAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPSAIGVNPMITILSTAYCISN  214
             SAHQMGSCRMG      A+D NGE WE  GL+V D SV P+A+GVNPM+T+ + +YCIS 
Sbjct  654   SAHQMGSCRMGTDPLRSAVDPNGETWEVGGLFVADTSVFPTALGVNPMLTVQAISYCISK  713

Query  213   GLAKSLNSGK  184
              +   L   K
Sbjct  714   SVLNHLKCNK  723



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   516 bits (1328),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 295/749 (39%), Positives = 441/749 (59%), Gaps = 52/749 (7%)
 Frame = -3

Query  2295  ALAAICEALIPPI---PLPQDSDDEAMCSFYSSSASQPPFPDEVAEVVMRRFLPDAVFIF  2125
             +L+AIC+  +P I    L Q++ D+++  F  +SAS    P  +A ++  R     + + 
Sbjct  3     SLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMLSERIQHPKLNLC  62

Query  2124  RLVLIILSTRLGSLLLCGFVCFDGRWPFIHNFSELPLKRREAILLKWSRETLILPLRIVF  1945
             +L L +LSTR+G+ +LCG      ++P++ NFS +   +RE I+  WS   L   ++++F
Sbjct  63    KLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNLKF-IKLLF  121

Query  1944  MTIKIACYFIYFSWTDENYNNPAWEAIGF---------------------HVDTNEVPPD  1828
             + +K+    ++F+  +E   NP+W+A+G+                     H + ++   D
Sbjct  122   VALKVLTLLVFFTQVNEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEEFSD-KRD  180

Query  1827  QQTGRPLEKGIIETINENGTTLKESLIKKGLNVTE---SQNANTLTIRCDvvivgsgcgg  1657
             +    PL KGI+ T+ +    L   L K G +V++   S N  +  I CD V+VGSG GG
Sbjct  181   EHLYGPLYKGIL-TLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGG  239

Query  1656  gvaaavlANSGHKVVVLEKGHYFVSEDYSGLEGPSLGELYESGGMLTTTDGKVMVFAGTM  1477
             GV A VLAN+GHKV+VLEKG Y    + S LEGPS+ +++   G++ T D  V + AG+ 
Sbjct  240   GVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGST  299

Query  1476  VGGGSAINWSASIKTPNNVLNEWSLEQKIPLFGSSEYQSAMDAVCKRIGVTEVCSKEGLQ  1297
             VGGGS INWSASI TP++VL EW    ++ LF S  Y+ A++ + +++GV +   +EG Q
Sbjct  300   VGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQ  359

Query  1296  NQVLRKGCENLGLKVESVPRNCSEKHYCGSCGYGCRTGDKKGVDTTYLVDAVNNG-AVIL  1120
             N +LRKGCE LG  VE++PRN    HYCG C  GC+ G KKG + T+LVD V +G   I+
Sbjct  360   NMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAII  419

Query  1119  TGCQAEKFILEEDETARK-KCLGV---IAKSKGNNKILRIEARATVSACGSLFTPPLLIS  952
               C+A + I E      K K +GV        G  +I  + ++ T+ ACG+L TP LL  
Sbjct  420   QECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVTIVACGALSTPSLLKR  479

Query  951   SGLKNKNIGSNLHLHPVLFAWGYFPESMA-----------EMEGKNHQGGIITSIHKVV-  808
             SGLKN NIG NLH+HPV+FAWG+FP++ +           E + K+++GGI++ + KVV 
Sbjct  480   SGLKNPNIGKNLHVHPVVFAWGHFPDTDSTDNVKNFEVWPESDKKSYEGGIMSVMSKVVA  539

Query  807   -SEGTKQAAIIEAVSLGPAGFAAVSPWTSGLDMKERMRKYSRTVNIFSMVRDHGSGQVKK  631
              +E      +I+  SL P  F+ V PW SGLD+K RM KYSRT +IF++ RD GSG+   
Sbjct  540   NTEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVS  599

Query  630   AGRIQYRMDQIDKDNIRTGLRQALRILVAAGAAEVGTFRSDGQKICCKGIKTEELESFLD  451
                I Y++DQID+ NI+ G+ + LRIL AAGA E+GT    G+K   K    +E ESF+ 
Sbjct  600   PYSISYKLDQIDEQNIKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVK  659

Query  450   GVVATGGPMSGEENWTLYCSAHQMGSCRMGATEEDGAIDNNGECWEAKGLYVCDGSVLPS  271
                + G     ++  T  CSAHQMGSCRMG   +   ++  GE WE + L++ D SV P+
Sbjct  660   EESSRG----LKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPT  715

Query  270   AIGVNPMITILSTAYCISNGLAKSLNSGK  184
             A+GVNPM+T+ + +YC +  + + L + K
Sbjct  716   ALGVNPMLTVQAISYCTAQNVLQLLKAKK  744



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9591144833754