BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26207_g1_i1 len=1021 path=[999:0-1020]

Length=1021
                                                                      Score     E

ref|XP_010325477.1|  PREDICTED: oxysterol-binding protein-related...    278   2e-85   
ref|XP_009611020.1|  PREDICTED: oxysterol-binding protein-related...    281   2e-84   
ref|XP_004245745.1|  PREDICTED: oxysterol-binding protein-related...    279   1e-83   
ref|XP_006355481.1|  PREDICTED: oxysterol-binding protein-related...    278   3e-83   
ref|XP_010325476.1|  PREDICTED: oxysterol-binding protein-related...    273   4e-81   
ref|XP_009768056.1|  PREDICTED: oxysterol-binding protein-related...    265   1e-80   
ref|XP_009768054.1|  PREDICTED: oxysterol-binding protein-related...    267   5e-79   
emb|CDP09928.1|  unnamed protein product                                263   2e-77   
ref|XP_007039894.1|  OSBP(oxysterol binding protein)-related prot...    253   1e-75   
emb|CBI31900.3|  unnamed protein product                                251   5e-75   
ref|XP_007039892.1|  OSBP(oxysterol binding protein)-related prot...    250   4e-74   
ref|XP_007039893.1|  OSBP(oxysterol binding protein)-related prot...    254   4e-74   
ref|XP_003608754.1|  Oxysterol-binding protein-related protein          240   5e-74   
ref|XP_007039890.1|  OSBP(oxysterol binding protein)-related prot...    254   5e-74   
ref|XP_008238577.1|  PREDICTED: oxysterol-binding protein-related...    249   7e-74   
ref|XP_011070104.1|  PREDICTED: oxysterol-binding protein-related...    251   8e-74   
ref|XP_006368192.1|  hypothetical protein POPTR_0001s00390g             248   2e-73   
ref|XP_011070101.1|  PREDICTED: oxysterol-binding protein-related...    251   6e-73   
gb|EYU18569.1|  hypothetical protein MIMGU_mgv1a025714mg                251   6e-73   
gb|EYU24744.1|  hypothetical protein MIMGU_mgv1a001762mg                250   2e-72   
ref|XP_008238570.1|  PREDICTED: oxysterol-binding protein-related...    250   2e-72   
gb|KHN04341.1|  Oxysterol-binding protein-related protein 2A            248   2e-72   
ref|XP_007211302.1|  hypothetical protein PRUPE_ppa001777mg             250   2e-72   
ref|XP_008238572.1|  PREDICTED: oxysterol-binding protein-related...    249   3e-72   
ref|XP_010053447.1|  PREDICTED: oxysterol-binding protein-related...    244   4e-72   
ref|XP_010662335.1|  PREDICTED: oxysterol-binding protein-related...    249   4e-72   
ref|XP_011018287.1|  PREDICTED: oxysterol-binding protein-related...    248   8e-72   
ref|XP_006368190.1|  hypothetical protein POPTR_0001s00390g             248   8e-72   
ref|XP_011018289.1|  PREDICTED: oxysterol-binding protein-related...    248   8e-72   
ref|XP_010053446.1|  PREDICTED: oxysterol-binding protein-related...    248   1e-71   
gb|KEH31653.1|  OSBP(oxysterol-binding protein)-related protein 1C      243   2e-71   
ref|XP_006579627.1|  PREDICTED: oxysterol-binding protein-related...    248   2e-71   
ref|XP_004171732.1|  PREDICTED: oxysterol-binding protein-related...    243   3e-71   
ref|XP_010264228.1|  PREDICTED: oxysterol-binding protein-related...    246   4e-71   
ref|XP_011033947.1|  PREDICTED: oxysterol-binding protein-related...    246   5e-71   
ref|XP_010093701.1|  Oxysterol-binding protein-related protein 2A       246   6e-71   
ref|XP_008238569.1|  PREDICTED: oxysterol-binding protein-related...    246   6e-71   
ref|XP_008238568.1|  PREDICTED: oxysterol-binding protein-related...    246   6e-71   
ref|XP_008238571.1|  PREDICTED: oxysterol-binding protein-related...    246   6e-71   
ref|XP_006600834.1|  PREDICTED: oxysterol-binding protein-related...    244   6e-71   
ref|XP_011033949.1|  PREDICTED: oxysterol-binding protein-related...    242   1e-70   
ref|XP_006573731.1|  PREDICTED: oxysterol-binding protein-related...    239   1e-70   
ref|XP_002303585.2|  hypothetical protein POPTR_0003s11090g             244   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_008358133.1|  PREDICTED: oxysterol-binding protein-related...    238   1e-70   
ref|XP_002304422.2|  hypothetical protein POPTR_0003s11090g             244   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004298651.1|  PREDICTED: oxysterol-binding protein-related...    244   2e-70   
ref|XP_011018285.1|  PREDICTED: oxysterol-binding protein-related...    245   2e-70   
ref|XP_011018286.1|  PREDICTED: oxysterol-binding protein-related...    244   2e-70   
ref|XP_009333672.1|  PREDICTED: oxysterol-binding protein-related...    238   2e-70   
ref|XP_009376026.1|  PREDICTED: oxysterol-binding protein-related...    237   3e-70   
ref|XP_010053444.1|  PREDICTED: oxysterol-binding protein-related...    244   3e-70   
ref|XP_011081219.1|  PREDICTED: oxysterol-binding protein-related...    241   4e-70   
ref|XP_006368188.1|  hypothetical protein POPTR_0001s00390g             244   4e-70   
gb|KEH31652.1|  OSBP(oxysterol-binding protein)-related protein 1C      244   4e-70   
ref|XP_007155634.1|  hypothetical protein PHAVU_003G218400g             243   5e-70   
ref|XP_006600833.1|  PREDICTED: oxysterol-binding protein-related...    243   5e-70   
ref|XP_004147593.1|  PREDICTED: oxysterol-binding protein-related...    243   7e-70   
ref|XP_006573730.1|  PREDICTED: oxysterol-binding protein-related...    240   9e-70   
gb|KHN09795.1|  Oxysterol-binding protein-related protein 2A            243   1e-69   
ref|XP_008437116.1|  PREDICTED: oxysterol-binding protein-related...    243   1e-69   
ref|XP_010264227.1|  PREDICTED: oxysterol-binding protein-related...    243   1e-69   
ref|XP_011033948.1|  PREDICTED: oxysterol-binding protein-related...    243   1e-69   
ref|XP_010264229.1|  PREDICTED: oxysterol-binding protein-related...    243   1e-69   
ref|XP_011033946.1|  PREDICTED: oxysterol-binding protein-related...    243   1e-69   
ref|XP_011081218.1|  PREDICTED: oxysterol-binding protein-related...    241   2e-69   
ref|XP_006590559.1|  PREDICTED: oxysterol-binding protein-related...    241   2e-69   
ref|XP_008373893.1|  PREDICTED: oxysterol-binding protein-related...    237   3e-69   
ref|XP_011081217.1|  PREDICTED: oxysterol-binding protein-related...    241   3e-69   
gb|KDO61482.1|  hypothetical protein CISIN_1g042453mg                   239   3e-69   
gb|KHN34952.1|  Oxysterol-binding protein-related protein 2A            241   4e-69   
ref|XP_006590558.1|  PREDICTED: oxysterol-binding protein-related...    241   4e-69   
ref|XP_006590555.1|  PREDICTED: oxysterol-binding protein-related...    241   4e-69   
ref|XP_009333604.1|  PREDICTED: oxysterol-binding protein-related...    234   4e-69   
ref|XP_006573728.1|  PREDICTED: oxysterol-binding protein-related...    241   7e-69   
ref|XP_008358131.1|  PREDICTED: oxysterol-binding protein-related...    241   7e-69   
ref|XP_006573727.1|  PREDICTED: oxysterol-binding protein-related...    241   7e-69   
ref|XP_008358132.1|  PREDICTED: oxysterol-binding protein-related...    240   8e-69   
ref|XP_006477224.1|  PREDICTED: oxysterol-binding protein-related...    240   9e-69   
ref|XP_006477228.1|  PREDICTED: oxysterol-binding protein-related...    236   1e-68   
ref|XP_008381152.1|  PREDICTED: oxysterol-binding protein-related...    235   1e-68   
ref|XP_009333668.1|  PREDICTED: oxysterol-binding protein-related...    240   1e-68   
ref|XP_009333669.1|  PREDICTED: oxysterol-binding protein-related...    240   1e-68   
ref|XP_006477222.1|  PREDICTED: oxysterol-binding protein-related...    240   1e-68   
ref|XP_009376024.1|  PREDICTED: oxysterol-binding protein-related...    240   1e-68   
gb|KCW77741.1|  hypothetical protein EUGRSUZ_D02035                     240   2e-68   
gb|KDP25642.1|  hypothetical protein JCGZ_20798                         239   2e-68   
ref|XP_006841158.1|  hypothetical protein AMTR_s00086p00150620          235   6e-68   
ref|XP_006440341.1|  hypothetical protein CICLE_v10018970mg             233   6e-68   
ref|XP_004516841.1|  PREDICTED: oxysterol-binding protein-related...    238   6e-68   
ref|XP_004516840.1|  PREDICTED: oxysterol-binding protein-related...    238   7e-68   
ref|XP_008373891.1|  PREDICTED: oxysterol-binding protein-related...    238   8e-68   
ref|XP_008373890.1|  PREDICTED: oxysterol-binding protein-related...    238   8e-68   
ref|XP_009333600.1|  PREDICTED: oxysterol-binding protein-related...    237   2e-67   
ref|XP_009333601.1|  PREDICTED: oxysterol-binding protein-related...    237   2e-67   
ref|XP_006477223.1|  PREDICTED: oxysterol-binding protein-related...    236   2e-67   
ref|XP_006477225.1|  PREDICTED: oxysterol-binding protein-related...    236   2e-67   
ref|XP_006477221.1|  PREDICTED: oxysterol-binding protein-related...    236   3e-67   
ref|XP_010258993.1|  PREDICTED: oxysterol-binding protein-related...    236   4e-67   
ref|XP_006440340.1|  hypothetical protein CICLE_v10018970mg             234   1e-66   
ref|XP_007157338.1|  hypothetical protein PHAVU_002G061800g             234   2e-66   
ref|XP_010676158.1|  PREDICTED: oxysterol-binding protein-related...    226   3e-66   
ref|XP_010439327.1|  PREDICTED: oxysterol-binding protein-related...    228   3e-66   
ref|XP_010676157.1|  PREDICTED: oxysterol-binding protein-related...    226   4e-66   
ref|XP_010676156.1|  PREDICTED: oxysterol-binding protein-related...    227   8e-66   
ref|XP_010434043.1|  PREDICTED: oxysterol-binding protein-related...    226   2e-65   
ref|XP_010448880.1|  PREDICTED: oxysterol-binding protein-related...    222   3e-65   
ref|XP_002529779.1|  Oxysterol-binding protein, putative                226   7e-65   Ricinus communis
ref|XP_010439326.1|  PREDICTED: oxysterol-binding protein-related...    229   8e-65   
ref|XP_010439325.1|  PREDICTED: oxysterol-binding protein-related...    229   8e-65   
gb|EPS74065.1|  hypothetical protein M569_00684                         228   1e-64   
ref|XP_010448876.1|  PREDICTED: oxysterol-binding protein-related...    223   2e-64   
ref|XP_010676155.1|  PREDICTED: oxysterol-binding protein-related...    228   2e-64   
ref|XP_006413649.1|  hypothetical protein EUTSA_v10024514mg             220   2e-64   
ref|XP_010434040.1|  PREDICTED: oxysterol-binding protein-related...    228   3e-64   
ref|XP_010434042.1|  PREDICTED: oxysterol-binding protein-related...    228   3e-64   
ref|XP_008448874.1|  PREDICTED: oxysterol-binding protein-related...    223   5e-64   
ref|XP_004972815.1|  PREDICTED: oxysterol-binding protein-related...    226   1e-63   
gb|KGN55890.1|  hypothetical protein Csa_3G027730                       226   1e-63   
ref|XP_006413650.1|  hypothetical protein EUTSA_v10024514mg             221   1e-63   
ref|XP_004163646.1|  PREDICTED: oxysterol-binding protein-related...    225   2e-63   
ref|XP_004150860.1|  PREDICTED: LOW QUALITY PROTEIN: oxysterol-bi...    225   2e-63   
ref|NP_001065340.2|  Os10g0554100                                       216   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009135978.1|  PREDICTED: oxysterol-binding protein-related...    221   2e-63   
ref|XP_010448881.1|  PREDICTED: oxysterol-binding protein-related...    224   6e-63   
ref|XP_008782271.1|  PREDICTED: oxysterol-binding protein-related...    216   7e-63   
dbj|BAD95307.1|  hypothetical protein                                   216   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170325.1|  uncharacterized protein LOC100384294               213   8e-63   Zea mays [maize]
ref|XP_006286273.1|  hypothetical protein CARUB_v10007850mg             223   1e-62   
ref|XP_008448873.1|  PREDICTED: oxysterol-binding protein-related...    223   1e-62   
ref|NP_974592.1|  oxysterol binding protein-related protein 2A          218   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413648.1|  hypothetical protein EUTSA_v10024514mg             222   3e-62   
ref|XP_007137366.1|  hypothetical protein PHAVU_009G121300g             223   3e-62   
gb|KDO80772.1|  hypothetical protein CISIN_1g0036641mg                  218   3e-62   
ref|XP_008801048.1|  PREDICTED: oxysterol-binding protein-related...    219   3e-62   
ref|XP_009135969.1|  PREDICTED: oxysterol-binding protein-related...    221   4e-62   
gb|KDO80774.1|  hypothetical protein CISIN_1g0036641mg                  217   4e-62   
ref|XP_009135974.1|  PREDICTED: oxysterol-binding protein-related...    221   4e-62   
emb|CDX79161.1|  BnaA01g12280D                                          221   5e-62   
gb|KHN09173.1|  Oxysterol-binding protein-related protein 1C            220   5e-62   
ref|XP_008782270.1|  PREDICTED: oxysterol-binding protein-related...    217   5e-62   
emb|CDX82950.1|  BnaC01g14000D                                          221   5e-62   
gb|AFW61213.1|  putative oxysterol binding domain family protein        210   6e-62   
ref|XP_006650469.1|  PREDICTED: oxysterol-binding protein-related...    219   6e-62   
ref|XP_003559029.1|  PREDICTED: oxysterol-binding protein-related...    221   8e-62   
ref|XP_011074874.1|  PREDICTED: oxysterol-binding protein-related...    221   8e-62   
ref|XP_007018961.1|  OSBP(oxysterol binding protein)-related prot...    221   9e-62   
ref|XP_007018960.1|  OSBP(oxysterol binding protein)-related prot...    221   9e-62   
gb|ABR16670.1|  unknown                                                 221   9e-62   Picea sitchensis
ref|XP_010916543.1|  PREDICTED: oxysterol-binding protein-related...    220   9e-62   
ref|XP_010529488.1|  PREDICTED: oxysterol-binding protein-related...    221   1e-61   
gb|ACF22755.1|  oxysterol-binding protein                               221   1e-61   Brachypodium distachyon [annual false brome]
ref|XP_010529487.1|  PREDICTED: oxysterol-binding protein-related...    221   1e-61   
ref|XP_008782269.1|  PREDICTED: oxysterol-binding protein-related...    218   1e-61   
ref|XP_002867764.1|  oxysterol-binding family protein                   220   1e-61   
ref|XP_010926457.1|  PREDICTED: oxysterol-binding protein-related...    221   1e-61   
ref|NP_001236590.1|  oxysterol-binding protein                          220   2e-61   
ref|XP_006580908.1|  PREDICTED: oxysterol-binding protein isoform X1    220   2e-61   
ref|XP_010926456.1|  PREDICTED: oxysterol-binding protein-related...    221   2e-61   
ref|XP_008465816.1|  PREDICTED: oxysterol-binding protein-related...    221   2e-61   
ref|XP_008465817.1|  PREDICTED: oxysterol-binding protein-related...    220   2e-61   
ref|NP_001173604.1|  Os03g0704700                                       213   2e-61   
ref|XP_011097690.1|  PREDICTED: oxysterol-binding protein-related...    217   3e-61   
ref|XP_010916541.1|  PREDICTED: oxysterol-binding protein-related...    220   3e-61   
ref|XP_008801047.1|  PREDICTED: oxysterol-binding protein-related...    220   3e-61   
ref|XP_010916542.1|  PREDICTED: oxysterol-binding protein-related...    220   3e-61   
ref|XP_002443874.1|  hypothetical protein SORBIDRAFT_07g003630          219   3e-61   Sorghum bicolor [broomcorn]
ref|XP_006434122.1|  hypothetical protein CICLE_v10000313mg             220   3e-61   
gb|EAZ16928.1|  hypothetical protein OsJ_32410                          218   3e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KHN26039.1|  Oxysterol-binding protein-related protein 1C            218   4e-61   
ref|XP_010916540.1|  PREDICTED: oxysterol-binding protein-related...    220   4e-61   
ref|XP_006593585.1|  PREDICTED: oxysterol-binding protein-related...    219   4e-61   
ref|XP_006593584.1|  PREDICTED: oxysterol-binding protein-related...    219   4e-61   
ref|NP_567662.1|  oxysterol binding protein-related protein 2A          219   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010664259.1|  PREDICTED: oxysterol-binding protein-related...    216   5e-61   
gb|KHG20800.1|  Oxysterol-binding-related protein 2A -like protein      213   6e-61   
ref|XP_008796825.1|  PREDICTED: oxysterol-binding protein-related...    215   6e-61   
ref|XP_006472715.1|  PREDICTED: oxysterol-binding protein-related...    219   8e-61   
ref|XP_010529489.1|  PREDICTED: oxysterol-binding protein-related...    216   8e-61   
ref|XP_008665273.1|  PREDICTED: oxysterol-binding protein-related...    218   9e-61   
gb|AAK15443.1|AC037426_5  putative oxysterol-binding protein            218   1e-60   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79468.1|  hypothetical protein OsI_34597                          218   1e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_008809039.1|  PREDICTED: oxysterol-binding protein-related...    214   1e-60   
ref|XP_008809037.1|  PREDICTED: oxysterol-binding protein-related...    218   1e-60   
ref|XP_009367301.1|  PREDICTED: oxysterol-binding protein-related...    214   2e-60   
ref|XP_010539671.1|  PREDICTED: oxysterol-binding protein-related...    216   2e-60   
gb|KHF99943.1|  Oxysterol-binding-related protein 1C -like protein      218   2e-60   
ref|XP_009393560.1|  PREDICTED: oxysterol-binding protein-related...    218   2e-60   
ref|XP_010529486.1|  PREDICTED: oxysterol-binding protein-related...    217   2e-60   
ref|XP_010529485.1|  PREDICTED: oxysterol-binding protein-related...    217   2e-60   
ref|XP_011097681.1|  PREDICTED: oxysterol-binding protein-related...    217   3e-60   
ref|XP_007141093.1|  hypothetical protein PHAVU_008G166800g             217   3e-60   
gb|ABF98451.1|  Oxysterol-binding protein, expressed                    214   3e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KHG02843.1|  Oxysterol-binding-related protein 1C -like protein      217   3e-60   
emb|CDX75168.1|  BnaC09g25140D                                          212   3e-60   
ref|XP_010272886.1|  PREDICTED: oxysterol-binding protein-related...    217   4e-60   
ref|XP_002466599.1|  hypothetical protein SORBIDRAFT_01g010720          216   5e-60   Sorghum bicolor [broomcorn]
gb|KHN47055.1|  Oxysterol-binding protein-related protein 1C            216   5e-60   
gb|EAZ28298.1|  hypothetical protein OsJ_12273                          217   5e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KHN34455.1|  Oxysterol-binding protein-related protein 1C            214   5e-60   
ref|XP_003560718.2|  PREDICTED: oxysterol-binding protein-related...    216   6e-60   
ref|XP_010230954.1|  PREDICTED: oxysterol-binding protein-related...    216   6e-60   
ref|XP_002284383.1|  PREDICTED: oxysterol-binding protein-related...    216   6e-60   Vitis vinifera
ref|XP_003523465.1|  PREDICTED: oxysterol-binding protein-related...    216   6e-60   
ref|XP_006578982.1|  PREDICTED: oxysterol-binding protein-related...    216   7e-60   
ref|XP_008378497.1|  PREDICTED: oxysterol-binding protein-related...    216   7e-60   
ref|XP_008378498.1|  PREDICTED: oxysterol-binding protein-related...    216   7e-60   
ref|XP_009366989.1|  PREDICTED: oxysterol-binding protein-related...    209   8e-60   
ref|XP_007225264.1|  hypothetical protein PRUPE_ppa001539mg             216   9e-60   
gb|KHG14097.1|  Oxysterol-binding-related protein 1C -like protein      211   9e-60   
ref|XP_008796823.1|  PREDICTED: oxysterol-binding protein-related...    215   9e-60   
gb|KDP32753.1|  hypothetical protein JCGZ_12045                         216   9e-60   
ref|XP_009341681.1|  PREDICTED: oxysterol-binding protein-related...    216   1e-59   
gb|AFW61214.1|  putative oxysterol binding domain family protein        211   1e-59   
ref|XP_008234096.1|  PREDICTED: oxysterol-binding protein-related...    215   1e-59   
ref|XP_006659844.1|  PREDICTED: oxysterol-binding protein-related...    213   1e-59   
dbj|BAD93875.1|  hypothetical protein                                   208   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004983704.1|  PREDICTED: oxysterol-binding protein-related...    214   2e-59   
gb|EAY91566.1|  hypothetical protein OsI_13201                          215   2e-59   Oryza sativa Indica Group [Indian rice]
ref|NP_001183756.1|  uncharacterized protein LOC100502349               205   2e-59   
dbj|BAJ85478.1|  predicted protein                                      215   2e-59   
dbj|BAJ85382.1|  predicted protein                                      210   2e-59   
ref|XP_006662588.1|  PREDICTED: oxysterol-binding protein-related...    214   2e-59   
gb|EAZ41553.1|  hypothetical protein OsJ_26076                          212   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001760064.1|  predicted protein                                  207   2e-59   
ref|XP_006596306.1|  PREDICTED: oxysterol-binding protein-related...    214   2e-59   
ref|XP_004982038.1|  PREDICTED: oxysterol-binding protein-related...    215   2e-59   
ref|XP_006596305.1|  PREDICTED: oxysterol-binding protein-related...    214   2e-59   
gb|EMT32902.1|  Oxysterol-binding protein-related protein 6             213   2e-59   
ref|XP_008677600.1|  PREDICTED: uncharacterized protein LOC100383...    214   2e-59   
ref|XP_010544433.1|  PREDICTED: oxysterol-binding protein-related...    215   2e-59   
ref|XP_010544439.1|  PREDICTED: oxysterol-binding protein-related...    214   2e-59   
ref|XP_009407157.1|  PREDICTED: oxysterol-binding protein-related...    211   3e-59   
ref|XP_002513820.1|  Oxysterol-binding protein, putative                214   3e-59   Ricinus communis
ref|XP_004292674.1|  PREDICTED: oxysterol-binding protein-related...    214   3e-59   
ref|XP_006396755.1|  hypothetical protein EUTSA_v10028479mg             213   3e-59   
ref|XP_008809036.1|  PREDICTED: oxysterol-binding protein-related...    214   3e-59   
gb|AAM97165.2|  putative oxysterol binding protein                      214   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|EMS56556.1|  hypothetical protein TRIUR3_30704                       212   3e-59   
ref|XP_003601101.1|  Oxysterol-binding protein-related protein          214   4e-59   
gb|KEH34850.1|  OSBP(oxysterol-binding protein)-related protein 1C      214   4e-59   
ref|XP_011027610.1|  PREDICTED: oxysterol-binding protein-related...    210   4e-59   
ref|XP_010496544.1|  PREDICTED: oxysterol-binding protein-related...    206   4e-59   
gb|EMS63065.1|  Oxysterol-binding protein-related protein 2A            212   5e-59   
gb|KGN50972.1|  hypothetical protein Csa_5G381780                       214   5e-59   
ref|XP_009380271.1|  PREDICTED: oxysterol-binding protein-related...    214   6e-59   
gb|EMT12148.1|  Oxysterol-binding protein-C2F12.05c-like protein        212   7e-59   
ref|XP_004168382.1|  PREDICTED: oxysterol-binding protein-related...    213   7e-59   
ref|XP_009380272.1|  PREDICTED: oxysterol-binding protein-related...    213   7e-59   
ref|XP_002872658.1|  hypothetical protein ARALYDRAFT_490050             212   8e-59   
ref|NP_001061017.1|  Os08g0154900                                       212   1e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389586.1|  PREDICTED: oxysterol-binding protein-related...    212   1e-58   
ref|XP_009134271.1|  PREDICTED: oxysterol-binding protein-related...    211   1e-58   
emb|CBI21644.3|  unnamed protein product                                212   1e-58   
ref|XP_009134270.1|  PREDICTED: oxysterol-binding protein-related...    211   1e-58   
ref|XP_009384473.1|  PREDICTED: oxysterol-binding protein-related...    209   2e-58   
ref|XP_010312787.1|  PREDICTED: oxysterol-binding protein-related...    209   2e-58   
emb|CDY21272.1|  BnaC03g29560D                                          211   2e-58   
ref|XP_002272577.2|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   Vitis vinifera
gb|EYU22915.1|  hypothetical protein MIMGU_mgv1a001538mg                212   2e-58   
ref|NP_001141495.1|  uncharacterized protein LOC100273607               212   2e-58   Zea mays [maize]
ref|XP_009761155.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
gb|EPS63197.1|  hypothetical protein M569_11590                         197   2e-58   
ref|XP_009761156.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
ref|XP_009108571.1|  PREDICTED: oxysterol-binding protein-related...    207   2e-58   
ref|XP_002466038.1|  hypothetical protein SORBIDRAFT_01g050400          211   2e-58   Sorghum bicolor [broomcorn]
ref|XP_010063340.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
tpg|DAA46236.1|  TPA: putative oxysterol binding domain family pr...    208   2e-58   
ref|XP_010063342.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
ref|XP_010246723.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
ref|XP_008338793.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
ref|XP_009341680.1|  PREDICTED: oxysterol-binding protein-related...    207   2e-58   
ref|XP_010246724.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
ref|XP_009366990.1|  PREDICTED: oxysterol-binding protein-related...    212   2e-58   
emb|CDX90832.1|  BnaA03g25120D                                          212   3e-58   
ref|XP_010246725.1|  PREDICTED: oxysterol-binding protein-related...    212   3e-58   
ref|XP_008338794.1|  PREDICTED: oxysterol-binding protein-related...    211   3e-58   
gb|KCW70556.1|  hypothetical protein EUGRSUZ_F03748                     211   3e-58   
ref|XP_009341678.1|  PREDICTED: oxysterol-binding protein-related...    208   3e-58   
ref|XP_010669271.1|  PREDICTED: oxysterol-binding protein-related...    211   4e-58   
gb|AFW87906.1|  putative oxysterol binding domain family protein        211   4e-58   
emb|CDP12441.1|  unnamed protein product                                211   4e-58   
ref|XP_009341679.1|  PREDICTED: oxysterol-binding protein-related...    207   4e-58   
ref|XP_011027608.1|  PREDICTED: oxysterol-binding protein-related...    211   5e-58   
ref|XP_009407154.1|  PREDICTED: oxysterol-binding protein-related...    210   5e-58   
ref|XP_002467519.1|  hypothetical protein SORBIDRAFT_01g029480          209   6e-58   
ref|XP_009587907.1|  PREDICTED: oxysterol-binding protein-related...    211   6e-58   
ref|XP_009587906.1|  PREDICTED: oxysterol-binding protein-related...    211   7e-58   
ref|NP_192558.2|  OSBP(oxysterol binding protein)-related protein 1C    210   8e-58   
ref|NP_849343.2|  OSBP(oxysterol binding protein)-related protein 1C    210   8e-58   
ref|XP_004250338.1|  PREDICTED: oxysterol-binding protein-related...    210   9e-58   
emb|CDX76366.1|  BnaA08g10340D                                          209   9e-58   
dbj|BAJ94113.1|  predicted protein                                      209   1e-57   
ref|XP_010091342.1|  Oxysterol-binding protein-related protein 1C       209   2e-57   
ref|XP_001764326.1|  predicted protein                                  202   2e-57   
ref|XP_009108569.1|  PREDICTED: oxysterol-binding protein-related...    208   3e-57   
emb|CDY42177.1|  BnaC03g64980D                                          209   3e-57   
ref|XP_009108570.1|  PREDICTED: oxysterol-binding protein-related...    208   3e-57   
emb|CDY59861.1|  BnaAnng16330D                                          204   3e-57   
ref|XP_009108568.1|  PREDICTED: oxysterol-binding protein-related...    208   3e-57   
ref|XP_009108566.1|  PREDICTED: oxysterol-binding protein-related...    208   3e-57   
ref|XP_010933694.1|  PREDICTED: oxysterol-binding protein-related...    208   3e-57   
emb|CDX83144.1|  BnaA03g23620D                                          208   3e-57   
ref|XP_010530189.1|  PREDICTED: oxysterol-binding protein-related...    206   4e-57   
ref|XP_009384471.1|  PREDICTED: oxysterol-binding protein-related...    208   4e-57   
ref|XP_009134083.1|  PREDICTED: oxysterol-binding protein-related...    208   4e-57   
ref|XP_009134085.1|  PREDICTED: oxysterol-binding protein-related...    208   4e-57   
ref|XP_010496543.1|  PREDICTED: oxysterol-binding protein-related...    208   5e-57   
ref|XP_010496541.1|  PREDICTED: oxysterol-binding protein-related...    208   5e-57   
emb|CDY34011.1|  BnaC03g28040D                                          208   5e-57   
ref|XP_006287186.1|  hypothetical protein CARUB_v10000358mg             207   6e-57   
ref|XP_008647662.1|  PREDICTED: uncharacterized protein LOC100502...    207   6e-57   
ref|XP_001784871.1|  predicted protein                                  201   7e-57   
ref|XP_010234986.1|  PREDICTED: oxysterol-binding protein-related...    204   7e-57   
tpg|DAA50904.1|  TPA: putative oxysterol binding domain family pr...    207   8e-57   
ref|XP_010422215.1|  PREDICTED: oxysterol-binding protein-related...    199   9e-57   
ref|XP_001755537.1|  predicted protein                                  201   9e-57   
ref|XP_010919508.1|  PREDICTED: oxysterol-binding protein-related...    204   1e-56   
ref|XP_010933696.1|  PREDICTED: oxysterol-binding protein-related...    206   1e-56   
ref|XP_002301011.1|  oxysterol-binding family protein                   207   1e-56   
ref|XP_010234407.1|  PREDICTED: LOW QUALITY PROTEIN: oxysterol-bi...    206   1e-56   
ref|XP_010455693.1|  PREDICTED: oxysterol-binding protein-related...    199   1e-56   
ref|XP_006397334.1|  hypothetical protein EUTSA_v10028436mg             207   1e-56   
ref|XP_010530187.1|  PREDICTED: oxysterol-binding protein-related...    207   2e-56   
ref|XP_010530188.1|  PREDICTED: oxysterol-binding protein-related...    207   2e-56   
ref|XP_011001413.1|  PREDICTED: oxysterol-binding protein-related...    206   2e-56   
ref|XP_009761157.1|  PREDICTED: oxysterol-binding protein-related...    206   2e-56   
ref|XP_010438506.1|  PREDICTED: oxysterol-binding protein-related...    206   2e-56   
ref|XP_010438521.1|  PREDICTED: oxysterol-binding protein-related...    206   2e-56   
ref|XP_010422214.1|  PREDICTED: oxysterol-binding protein-related...    202   2e-56   
ref|XP_002879298.1|  oxysterol-binding family protein                   201   3e-56   
emb|CAB41716.1|  putative SWH1 protein                                  205   3e-56   
ref|XP_010455692.1|  PREDICTED: oxysterol-binding protein-related...    201   3e-56   
ref|XP_010933693.1|  PREDICTED: oxysterol-binding protein-related...    206   3e-56   
ref|NP_192983.2|  OSBP(oxysterol binding protein)-related protein 2B    205   3e-56   
ref|XP_010933695.1|  PREDICTED: oxysterol-binding protein-related...    205   3e-56   
gb|KFK32152.1|  hypothetical protein AALP_AA6G204700                    206   4e-56   
ref|XP_010455691.1|  PREDICTED: oxysterol-binding protein-related...    201   4e-56   
gb|KFK32151.1|  hypothetical protein AALP_AA6G204700                    206   4e-56   
ref|NP_974518.1|  OSBP(oxysterol binding protein)-related protein 1C    206   4e-56   
ref|XP_002872370.1|  oxysterol-binding family protein                   205   5e-56   
ref|XP_002990539.1|  hypothetical protein SELMODRAFT_236037             204   5e-56   
ref|XP_010455240.1|  PREDICTED: oxysterol-binding protein-related...    205   6e-56   
ref|XP_009587908.1|  PREDICTED: oxysterol-binding protein-related...    205   7e-56   
ref|XP_006827910.1|  hypothetical protein AMTR_s00008p00153070          204   9e-56   
gb|KEH35651.1|  OSBP(oxysterol-binding protein)-related protein 1C      204   1e-55   
ref|XP_002983671.1|  hypothetical protein SELMODRAFT_234344             203   1e-55   
ref|XP_002879297.1|  oxysterol-binding family protein                   204   1e-55   
ref|XP_009382408.1|  PREDICTED: oxysterol-binding protein-related...    201   1e-55   
ref|XP_009382409.1|  PREDICTED: oxysterol-binding protein-related...    201   1e-55   
ref|XP_006287079.1|  hypothetical protein CARUB_v10000237mg             204   1e-55   
ref|XP_010919503.1|  PREDICTED: oxysterol-binding protein-related...    203   2e-55   
ref|XP_008658267.1|  PREDICTED: uncharacterized protein LOC100273...    203   2e-55   
emb|CAN65635.1|  hypothetical protein VITISV_007120                     197   2e-55   
ref|XP_009382407.1|  PREDICTED: oxysterol-binding protein-related...    202   2e-55   
ref|XP_009382406.1|  PREDICTED: oxysterol-binding protein-related...    202   2e-55   
ref|XP_004503009.1|  PREDICTED: oxysterol-binding protein-related...    203   2e-55   
ref|XP_010433415.1|  PREDICTED: oxysterol-binding protein-related...    202   2e-55   
ref|NP_180659.1|  oxysterol binding protein-related protein 1A          203   3e-55   
ref|XP_010422212.1|  PREDICTED: oxysterol-binding protein-related...    202   3e-55   
ref|XP_010422213.1|  PREDICTED: oxysterol-binding protein-related...    202   3e-55   
ref|XP_010455689.1|  PREDICTED: oxysterol-binding protein-related...    202   3e-55   
ref|XP_010455690.1|  PREDICTED: oxysterol-binding protein-related...    202   4e-55   
gb|KFK32891.1|  hypothetical protein AALP_AA6G301300                    202   4e-55   
gb|KHN09668.1|  Oxysterol-binding protein-related protein 1C            201   4e-55   
ref|XP_002307417.2|  hypothetical protein POPTR_0005s16130g             202   4e-55   
ref|XP_006466182.1|  PREDICTED: oxysterol-binding protein-related...    202   5e-55   
gb|KDO58715.1|  hypothetical protein CISIN_1g003654mg                   202   5e-55   
ref|XP_008786994.1|  PREDICTED: oxysterol-binding protein-related...    202   5e-55   
ref|XP_010063997.1|  PREDICTED: oxysterol-binding protein-related...    202   5e-55   
ref|XP_010063996.1|  PREDICTED: oxysterol-binding protein-related...    202   5e-55   
gb|KEH28023.1|  OSBP(oxysterol-binding protein)-related protein 1C      202   6e-55   
gb|KCW71284.1|  hypothetical protein EUGRSUZ_F043732                    202   6e-55   
ref|NP_001078376.1|  OSBP(oxysterol binding protein)-related prot...    195   6e-55   
ref|XP_009141043.1|  PREDICTED: oxysterol-binding protein-related...    195   7e-55   
ref|XP_009382403.1|  PREDICTED: oxysterol-binding protein-related...    201   1e-54   
ref|XP_009401673.1|  PREDICTED: oxysterol-binding protein-related...    201   1e-54   
ref|XP_009401674.1|  PREDICTED: oxysterol-binding protein-related...    201   1e-54   
ref|XP_006426441.1|  hypothetical protein CICLE_v10024939mg             201   1e-54   
ref|XP_003528078.2|  PREDICTED: oxysterol-binding protein-related...    201   1e-54   
ref|XP_008808012.1|  PREDICTED: oxysterol-binding protein-related...    198   2e-54   
emb|CAB45788.1|  putative protein                                       200   4e-54   
ref|XP_011001291.1|  PREDICTED: oxysterol-binding protein-related...    199   8e-54   
ref|XP_011015919.1|  PREDICTED: oxysterol-binding protein-related...    199   8e-54   
ref|XP_006293708.1|  hypothetical protein CARUB_v10022666mg             199   8e-54   
ref|XP_009415989.1|  PREDICTED: oxysterol-binding protein-related...    199   9e-54   
ref|XP_008808011.1|  PREDICTED: oxysterol-binding protein-related...    198   2e-53   
emb|CBI16832.3|  unnamed protein product                                198   2e-53   
ref|XP_002282089.1|  PREDICTED: oxysterol-binding protein-related...    198   2e-53   
ref|XP_006852225.1|  hypothetical protein AMTR_s00049p00141620          198   2e-53   
ref|XP_010510257.1|  PREDICTED: oxysterol-binding protein-related...    197   2e-53   
ref|XP_010510255.1|  PREDICTED: oxysterol-binding protein-related...    197   3e-53   
ref|XP_010469771.1|  PREDICTED: oxysterol-binding protein-related...    197   3e-53   
ref|XP_010469772.1|  PREDICTED: oxysterol-binding protein-related...    197   3e-53   
ref|XP_010250933.1|  PREDICTED: oxysterol-binding protein-related...    196   6e-53   
gb|AFW89886.1|  putative oxysterol binding domain family protein        192   7e-53   
ref|XP_010250934.1|  PREDICTED: oxysterol-binding protein-related...    196   7e-53   
gb|KHN44383.1|  Oxysterol-binding protein-related protein 1D            195   9e-53   
ref|XP_009382405.1|  PREDICTED: oxysterol-binding protein-related...    195   1e-52   
ref|XP_003538585.1|  PREDICTED: oxysterol-binding protein-related...    196   1e-52   
gb|KHN24120.1|  Oxysterol-binding protein-related protein 1D            195   1e-52   
ref|XP_003538586.1|  PREDICTED: oxysterol-binding protein-related...    196   1e-52   
ref|XP_002325696.2|  hypothetical protein POPTR_0019s01140g             195   2e-52   
ref|XP_004962595.1|  PREDICTED: oxysterol-binding protein-related...    195   2e-52   
ref|XP_004962594.1|  PREDICTED: oxysterol-binding protein-related...    195   2e-52   
ref|XP_007044894.1|  OSBP(oxysterol binding protein)-related prot...    195   2e-52   
ref|XP_009403635.1|  PREDICTED: oxysterol-binding protein-related...    192   2e-52   
ref|XP_003551955.1|  PREDICTED: oxysterol-binding protein-related...    194   3e-52   
ref|XP_007137808.1|  hypothetical protein PHAVU_009G157300g             193   5e-52   
ref|XP_010929956.1|  PREDICTED: oxysterol-binding protein-related...    194   5e-52   
ref|XP_009403634.1|  PREDICTED: oxysterol-binding protein-related...    193   7e-52   
gb|KDP26707.1|  hypothetical protein JCGZ_17865                         193   8e-52   
ref|XP_008658035.1|  PREDICTED: uncharacterized protein LOC100192...    192   9e-52   
ref|NP_001130951.1|  putative oxysterol binding domain family pro...    192   1e-51   
gb|EEC69105.1|  hypothetical protein OsI_38013                          193   1e-51   
gb|EYU23919.1|  hypothetical protein MIMGU_mgv1a001556mg                192   1e-51   
ref|XP_008658032.1|  PREDICTED: uncharacterized protein LOC100192...    192   1e-51   
ref|XP_008658033.1|  PREDICTED: uncharacterized protein LOC100192...    192   1e-51   
gb|AFW89885.1|  putative oxysterol binding domain family protein        192   1e-51   
ref|XP_008658031.1|  PREDICTED: uncharacterized protein LOC100192...    192   2e-51   
ref|XP_009615128.1|  PREDICTED: oxysterol-binding protein-related...    191   2e-51   
ref|XP_010248737.1|  PREDICTED: oxysterol-binding protein-related...    192   3e-51   
gb|KHG00867.1|  Oxysterol-binding protein-related protein 1D            191   3e-51   
gb|KHG00866.1|  Oxysterol-binding protein-related protein 1D            192   3e-51   
ref|XP_004502376.1|  PREDICTED: oxysterol-binding protein-related...    191   4e-51   
ref|XP_010662535.1|  PREDICTED: oxysterol-binding protein-related...    190   6e-51   
ref|XP_010682358.1|  PREDICTED: oxysterol-binding protein-related...    191   6e-51   
ref|NP_180660.1|  oxysterol binding protein-related protein 1B          187   7e-51   
gb|EPS67163.1|  hypothetical protein M569_07612                         191   7e-51   
gb|KFK43589.1|  hypothetical protein AALP_AA1G145900                    190   8e-51   
ref|NP_001066586.1|  Os12g0285600                                       189   1e-50   
gb|KHN31211.1|  Oxysterol-binding protein-related protein 1C            189   2e-50   
ref|XP_011042361.1|  PREDICTED: oxysterol-binding protein-related...    189   2e-50   
ref|XP_008340131.1|  PREDICTED: oxysterol-binding protein-related...    189   2e-50   
ref|XP_008340132.1|  PREDICTED: oxysterol-binding protein-related...    189   2e-50   
ref|XP_009619089.1|  PREDICTED: oxysterol-binding protein-related...    188   2e-50   
ref|XP_008353029.1|  PREDICTED: oxysterol-binding protein-related...    189   2e-50   
ref|XP_008353028.1|  PREDICTED: oxysterol-binding protein-related...    189   2e-50   
emb|CBI31899.3|  unnamed protein product                                189   2e-50   
ref|XP_008446122.1|  PREDICTED: oxysterol-binding protein-related...    187   2e-50   
ref|XP_002515042.1|  Oxysterol-binding protein, putative                189   2e-50   
ref|XP_002314577.1|  oxysterol-binding family protein                   189   3e-50   
ref|XP_006417148.1|  hypothetical protein EUTSA_v10006816mg             189   3e-50   
ref|XP_009804010.1|  PREDICTED: oxysterol-binding protein-related...    181   5e-50   
ref|XP_011086698.1|  PREDICTED: oxysterol-binding protein-related...    188   5e-50   
ref|XP_004135286.1|  PREDICTED: oxysterol-binding protein-related...    188   6e-50   
ref|XP_008446121.1|  PREDICTED: oxysterol-binding protein-related...    188   6e-50   
ref|XP_004165539.1|  PREDICTED: LOW QUALITY PROTEIN: oxysterol-bi...    188   6e-50   
ref|XP_004239157.1|  PREDICTED: oxysterol-binding protein-related...    188   6e-50   
ref|XP_010044524.1|  PREDICTED: oxysterol-binding protein-related...    188   6e-50   
ref|XP_009781512.1|  PREDICTED: oxysterol-binding protein-related...    187   6e-50   
emb|CDP13265.1|  unnamed protein product                                188   6e-50   
ref|XP_006341788.1|  PREDICTED: oxysterol-binding protein-related...    187   8e-50   
ref|XP_009619088.1|  PREDICTED: oxysterol-binding protein-related...    187   9e-50   
gb|EMT32068.1|  Oxysterol-binding protein-related protein 3             183   9e-50   
ref|XP_007163698.1|  hypothetical protein PHAVU_001G256600g             187   1e-49   
emb|CDY19393.1|  BnaC05g09020D                                          187   1e-49   
ref|XP_004310001.1|  PREDICTED: oxysterol-binding protein-related...    187   1e-49   
ref|XP_006664501.1|  PREDICTED: LOW QUALITY PROTEIN: oxysterol-bi...    187   1e-49   
ref|XP_010495042.1|  PREDICTED: oxysterol-binding protein-related...    187   1e-49   
emb|CDX98007.1|  BnaA06g07580D                                          186   2e-49   
ref|XP_009148542.1|  PREDICTED: oxysterol-binding protein-related...    187   2e-49   
ref|XP_003578711.1|  PREDICTED: oxysterol-binding protein-related...    186   2e-49   
ref|XP_008221950.1|  PREDICTED: oxysterol-binding protein-related...    186   2e-49   
ref|XP_009618360.1|  PREDICTED: oxysterol-binding protein-related...    186   2e-49   
ref|XP_010100333.1|  Oxysterol-binding protein-related protein 1D       186   2e-49   
ref|XP_010528073.1|  PREDICTED: oxysterol-binding protein-related...    186   3e-49   
ref|XP_010476308.1|  PREDICTED: oxysterol-binding protein-related...    186   3e-49   
ref|XP_009359252.1|  PREDICTED: oxysterol-binding protein-related...    186   3e-49   
ref|XP_008221949.1|  PREDICTED: oxysterol-binding protein-related...    186   4e-49   
ref|XP_010458762.1|  PREDICTED: oxysterol-binding protein-related...    186   4e-49   
ref|XP_003601874.1|  Oxysterol-binding protein-related protein          186   4e-49   
ref|XP_007225262.1|  hypothetical protein PRUPE_ppa001529mg             185   4e-49   
ref|XP_002892731.1|  oxysterol-binding family protein                   185   5e-49   
ref|NP_001184980.1|  oxysterol binding protein-related protein 1D       185   6e-49   
ref|XP_006303153.1|  hypothetical protein CARUB_v10008320mg             185   6e-49   
ref|NP_172776.1|  oxysterol binding protein-related protein 1D          185   6e-49   
ref|XP_002443139.1|  hypothetical protein SORBIDRAFT_08g011100          184   8e-49   
ref|XP_009781514.1|  PREDICTED: oxysterol-binding protein-related...    183   2e-48   
ref|XP_009799520.1|  PREDICTED: oxysterol-binding protein-related...    183   2e-48   
ref|XP_009781511.1|  PREDICTED: oxysterol-binding protein-related...    183   2e-48   
ref|XP_004242997.2|  PREDICTED: oxysterol-binding protein-related...    183   3e-48   
ref|XP_008389753.1|  PREDICTED: oxysterol-binding protein-related...    183   3e-48   
ref|XP_006343588.1|  PREDICTED: oxysterol-binding protein-related...    181   4e-48   
ref|XP_009799519.1|  PREDICTED: oxysterol-binding protein-related...    182   8e-48   
gb|EYU30598.1|  hypothetical protein MIMGU_mgv1a001454mg                182   8e-48   
ref|XP_011071165.1|  PREDICTED: oxysterol-binding protein-related...    182   9e-48   
ref|XP_006343587.1|  PREDICTED: oxysterol-binding protein-related...    181   1e-47   
gb|EMS50596.1|  hypothetical protein TRIUR3_20355                       178   3e-47   
gb|ABB43279.1|  oxysterol-binding related protein 1                     180   3e-47   
ref|XP_002966346.1|  hypothetical protein SELMODRAFT_439664             179   6e-47   
ref|XP_006350064.1|  PREDICTED: oxysterol-binding protein-related...    173   2e-46   
ref|XP_002978214.1|  hypothetical protein SELMODRAFT_417928             179   5e-46   
tpg|DAA46975.1|  TPA: putative oxysterol binding domain family pr...    166   6e-46   
tpg|DAA46974.1|  TPA: putative oxysterol binding domain family pr...    164   1e-45   
ref|XP_010314069.1|  PREDICTED: oxysterol-binding protein-related...    173   4e-45   
ref|XP_004140382.1|  PREDICTED: oxysterol-binding protein-related...    171   4e-44   
tpg|DAA46976.1|  TPA: putative oxysterol binding domain family pr...    166   1e-43   
gb|KHG04248.1|  Oxysterol-binding-related protein 2A -like protein      154   2e-43   
ref|NP_001169596.1|  uncharacterized protein LOC100383477               169   2e-43   
gb|KDO82128.1|  hypothetical protein CISIN_1g003720mg                   168   7e-43   



>ref|XP_010325477.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X3 [Solanum lycopersicum]
 ref|XP_010325478.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X3 [Solanum lycopersicum]
Length=517

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW+ES+YY+NGEW SKPKD S  SLLW  N PP NLTRYN+SSFAITLNELTPGLKE 
Sbjct  363  FGKWNESMYYINGEWTSKPKDSSILSLLWTRNNPPPNLTRYNLSSFAITLNELTPGLKEM  422

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKANAEKLRLE RQRMSRKLQENGWKPRWF+REGEDGTFR
Sbjct  423  LPPTDSRLRPDQRHLENGEYDKANAEKLRLETRQRMSRKLQENGWKPRWFQREGEDGTFR  482

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            Y+GGYWE RE   WDGCPNIFG++DQ L+NSFEG
Sbjct  483  YMGGYWEARETATWDGCPNIFGEIDQDLLNSFEG  516



>ref|XP_009611020.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Nicotiana tomentosiformis]
Length=727

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW+E++YY+NGEW SKPKDLSD++LLW  NKPP NLTRYN+SSFAITLNELTPGL+EK
Sbjct  573  FGKWNENMYYMNGEWTSKPKDLSDSALLWTRNKPPLNLTRYNLSSFAITLNELTPGLEEK  632

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKAN+EKLRLE RQRMSRKLQENGW+PRWF+REGEDGTFR
Sbjct  633  LPPTDSRLRPDQRHLENGEYDKANSEKLRLETRQRMSRKLQENGWRPRWFQREGEDGTFR  692

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            Y GGYWE R+ G WDGCPNIFG++DQ L+ SFEG
Sbjct  693  YTGGYWEARDMGTWDGCPNIFGEIDQELLTSFEG  726



>ref|XP_004245745.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Solanum lycopersicum]
Length=727

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW+ES+YY+NGEW SKPKD S  SLLW  N PP NLTRYN+SSFAITLNELTPGLKE 
Sbjct  573  FGKWNESMYYINGEWTSKPKDSSILSLLWTRNNPPPNLTRYNLSSFAITLNELTPGLKEM  632

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKANAEKLRLE RQRMSRKLQENGWKPRWF+REGEDGTFR
Sbjct  633  LPPTDSRLRPDQRHLENGEYDKANAEKLRLETRQRMSRKLQENGWKPRWFQREGEDGTFR  692

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            Y+GGYWE RE   WDGCPNIFG++DQ L+NSFEG
Sbjct  693  YMGGYWEARETATWDGCPNIFGEIDQDLLNSFEG  726



>ref|XP_006355481.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Solanum tuberosum]
Length=727

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW+ES+YY+NGEW SKPKD S  SLLW  N PP NLTRYN+SSFAITLNELTPGLKE 
Sbjct  573  FGKWNESMYYINGEWASKPKDSSVLSLLWTRNNPPPNLTRYNLSSFAITLNELTPGLKEM  632

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKANAEKLRLE RQRMSRKLQENGWKPRWF+REGEDGTFR
Sbjct  633  LPPTDSRLRPDQRHLENGEYDKANAEKLRLETRQRMSRKLQENGWKPRWFQREGEDGTFR  692

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            Y+GGYWE RE   WDGCPNIFG++DQ L+NSFEG
Sbjct  693  YMGGYWEARETATWDGCPNIFGEIDQDLLNSFEG  726



>ref|XP_010325476.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Solanum lycopersicum]
Length=726

 Score =   273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW+ES+YY+NGEW SKPKD S  SLLW  N PP NLTRYN+SSFAITLNELTPGLK  
Sbjct  573  FGKWNESMYYINGEWTSKPKDSSILSLLWTRNNPPPNLTRYNLSSFAITLNELTPGLK-M  631

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKANAEKLRLE RQRMSRKLQENGWKPRWF+REGEDGTFR
Sbjct  632  LPPTDSRLRPDQRHLENGEYDKANAEKLRLETRQRMSRKLQENGWKPRWFQREGEDGTFR  691

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            Y+GGYWE RE   WDGCPNIFG++DQ L+NSFEG
Sbjct  692  YMGGYWEARETATWDGCPNIFGEIDQDLLNSFEG  725



>ref|XP_009768056.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Nicotiana sylvestris]
Length=467

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW+ES+YY+NGEW SKPKD SD+SLLW  NKPP NLTRYN+SSFAITLNELTPGLKEK
Sbjct  313  FGKWNESMYYMNGEWTSKPKDSSDSSLLWTRNKPPLNLTRYNLSSFAITLNELTPGLKEK  372

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKAN+EKLRLE RQRMSRKLQENGW+PRWF+REGEDGTFR
Sbjct  373  LPPTDSRLRPDQRHLENGEYDKANSEKLRLETRQRMSRKLQENGWRPRWFQREGEDGTFR  432

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            Y GGYWE RE G WDGCPNIFG++DQ L+ SFEG
Sbjct  433  YTGGYWEARETGTWDGCPNIFGEIDQELLTSFEG  466



>ref|XP_009768054.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Nicotiana sylvestris]
Length=725

 Score =   267 bits (682),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW+ES+YY+NGEW SKPKD SD+SLLW  NKPP NLTRYN+SSFAITLNELTPGLKEK
Sbjct  571  FGKWNESMYYMNGEWTSKPKDSSDSSLLWTRNKPPLNLTRYNLSSFAITLNELTPGLKEK  630

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKAN+EKLRLE RQRMSRKLQENGW+PRWF+REGEDGTFR
Sbjct  631  LPPTDSRLRPDQRHLENGEYDKANSEKLRLETRQRMSRKLQENGWRPRWFQREGEDGTFR  690

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            Y GGYWE RE G WDGCPNIFG++DQ L+ SFEG
Sbjct  691  YTGGYWEARETGTWDGCPNIFGEIDQELLTSFEG  724



>emb|CDP09928.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES+Y++NGE NSKPKD+ +ASLLWK N PP NLTRYN++SFAITLNELTPGLKEK
Sbjct  605  FGKWDESMYFVNGEGNSKPKDMYNASLLWKKNMPPANLTRYNLTSFAITLNELTPGLKEK  664

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKANAEKLRLEMRQRMSRKLQE+GWKPRWF+R+GE+GTFR
Sbjct  665  LPPTDSRLRPDQRHLENGEYDKANAEKLRLEMRQRMSRKLQEHGWKPRWFQRDGENGTFR  724

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            Y GGYWE RE   W+GC +I+G++ + L++SF+
Sbjct  725  YTGGYWEAREQRNWNGCQSIYGEISEDLLDSFK  757



>ref|XP_007039894.1| OSBP(oxysterol binding protein)-related protein 2A isoform 5 
[Theobroma cacao]
 ref|XP_007039895.1| OSBP(oxysterol binding protein)-related protein 2A isoform 5 
[Theobroma cacao]
 gb|EOY24395.1| OSBP(oxysterol binding protein)-related protein 2A isoform 5 
[Theobroma cacao]
 gb|EOY24396.1| OSBP(oxysterol binding protein)-related protein 2A isoform 5 
[Theobroma cacao]
Length=540

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY++G+ +++PKD    S+ASLLWK NKPP NLTRYN++SFAITLNELTPGL
Sbjct  383  IGKWDDSMYYVSGDGSARPKDCNPSSNASLLWKRNKPPPNLTRYNLTSFAITLNELTPGL  442

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSRKLQENGW PRWFEREGE+G
Sbjct  443  QEKLPPTDSRLRPDQRHLENGEYERANAEKQRLERRQRMSRKLQENGWNPRWFEREGENG  502

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            +FRYVGGYWE RE GKWDGCPNIFG+ ++ L++S E
Sbjct  503  SFRYVGGYWEAREQGKWDGCPNIFGEFNEELVDSTE  538



>emb|CBI31900.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+   K KD +   DASLLWK N+PP  LTRYN++SFAITLNELT GL
Sbjct  362  FGKWDDSMYYVLGDRTGKLKDCNGSPDASLLWKRNRPPPCLTRYNLTSFAITLNELTSGL  421

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMSRKLQENGWKP+WFEREGEDG
Sbjct  422  QEKLPPTDSRLRPDQRHLENGEYEKANAEKLRLEKRQRMSRKLQENGWKPKWFEREGEDG  481

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
             FRY+GGYWE R+ GKWDGCPNIFG+  + L+NS+EG
Sbjct  482  PFRYMGGYWEARDQGKWDGCPNIFGEFTEDLVNSYEG  518



>ref|XP_007039892.1| OSBP(oxysterol binding protein)-related protein 2A isoform 3 
[Theobroma cacao]
 gb|EOY24393.1| OSBP(oxysterol binding protein)-related protein 2A isoform 3 
[Theobroma cacao]
Length=542

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 139/158 (88%), Gaps = 5/158 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY++G+ +++PKD    S+ASLLWK NKPP NLTRYN++SFAITLNELTPGL
Sbjct  383  IGKWDDSMYYVSGDGSARPKDCNPSSNASLLWKRNKPPPNLTRYNLTSFAITLNELTPGL  442

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSRKLQENGW PRWFEREGE
Sbjct  443  QIKEKLPPTDSRLRPDQRHLENGEYERANAEKQRLERRQRMSRKLQENGWNPRWFEREGE  502

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            +G+FRYVGGYWE RE GKWDGCPNIFG+ ++ L++S E
Sbjct  503  NGSFRYVGGYWEAREQGKWDGCPNIFGEFNEELVDSTE  540



>ref|XP_007039893.1| OSBP(oxysterol binding protein)-related protein 2A isoform 4 
[Theobroma cacao]
 gb|EOY24394.1| OSBP(oxysterol binding protein)-related protein 2A isoform 4 
[Theobroma cacao]
Length=768

 Score =   254 bits (650),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY++G+ +++PKD    S+ASLLWK NKPP NLTRYN++SFAITLNELTPGL
Sbjct  611  IGKWDDSMYYVSGDGSARPKDCNPSSNASLLWKRNKPPPNLTRYNLTSFAITLNELTPGL  670

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSRKLQENGW PRWFEREGE+G
Sbjct  671  QEKLPPTDSRLRPDQRHLENGEYERANAEKQRLERRQRMSRKLQENGWNPRWFEREGENG  730

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            +FRYVGGYWE RE GKWDGCPNIFG+ ++ L++S E
Sbjct  731  SFRYVGGYWEAREQGKWDGCPNIFGEFNEELVDSTE  766



>ref|XP_003608754.1| Oxysterol-binding protein-related protein [Medicago truncatula]
Length=242

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+SIYY +G+ N KPKD   S+ +LLWK  +PP NLTRYN++SFAITLNELTPGLK
Sbjct  86   FGKWDDSIYYFDGDVNVKPKDYTSSNGTLLWKRTRPPPNLTRYNLTSFAITLNELTPGLK  145

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGE++KAN EK RLE RQRMSRK+QENGW+P+WF +EGE+GT
Sbjct  146  EKLPPTDSRLRPDQRHLENGEFEKANMEKQRLEKRQRMSRKMQENGWEPKWFRKEGENGT  205

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            FRY GGYWE R  G WDGCPNIFG+  +++I+ F+ 
Sbjct  206  FRYTGGYWEARAVGSWDGCPNIFGEFQESIIDPFDA  241



>ref|XP_007039890.1| OSBP(oxysterol binding protein)-related protein 2A isoform 1 
[Theobroma cacao]
 gb|EOY24391.1| OSBP(oxysterol binding protein)-related protein 2A isoform 1 
[Theobroma cacao]
Length=782

 Score =   254 bits (650),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY++G+ +++PKD    S+ASLLWK NKPP NLTRYN++SFAITLNELTPGL
Sbjct  625  IGKWDDSMYYVSGDGSARPKDCNPSSNASLLWKRNKPPPNLTRYNLTSFAITLNELTPGL  684

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSRKLQENGW PRWFEREGE+G
Sbjct  685  QEKLPPTDSRLRPDQRHLENGEYERANAEKQRLERRQRMSRKLQENGWNPRWFEREGENG  744

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            +FRYVGGYWE RE GKWDGCPNIFG+ ++ L++S E
Sbjct  745  SFRYVGGYWEAREQGKWDGCPNIFGEFNEELVDSTE  780



>ref|XP_008238577.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X8 [Prunus mume]
Length=535

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDESI+Y+NG+ + KP + SDASLLWKS+KPP N+TRYN++SFAITLNELTPGL+EK
Sbjct  383  FGKWDESIHYVNGDGSGKP-NPSDASLLWKSSKPP-NVTRYNLTSFAITLNELTPGLQEK  440

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG FR
Sbjct  441  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFQREGEDGPFR  500

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+  + L  + EG
Sbjct  501  YVGGYWETRKQGKWDECPDIFGEFSEGLDETLEG  534



>ref|XP_011070104.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Sesamum indicum]
Length=636

 Score =   251 bits (641),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+Y++NGE     KD S+ASLLW  NKPP+NLTRYN++SFAIT+NELTPGLKEK
Sbjct  483  FGKWDDSMYFVNGEGTGNVKDRSEASLLWTRNKPPENLTRYNLTSFAITMNELTPGLKEK  542

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGE++KANAEKLRLE RQRMSRKLQE+GWKPRWF R+ +DG FR
Sbjct  543  LPPTDSRLRPDQRHLENGEFEKANAEKLRLETRQRMSRKLQEHGWKPRWFHRD-DDGPFR  601

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            Y+GGYWE RE GKWDGCP+IFG++ + L+ SF+
Sbjct  602  YIGGYWEAREQGKWDGCPDIFGEISEDLVTSFQ  634



>ref|XP_006368192.1| hypothetical protein POPTR_0001s00390g [Populus trichocarpa]
 gb|ERP64761.1| hypothetical protein POPTR_0001s00390g [Populus trichocarpa]
Length=535

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y  G+   K KD    S+A+LLWKSNKPP NLTRYN+SSFAITLNELTPGL
Sbjct  378  FGKWDDSMHYTTGDGTGKSKDRITSSNATLLWKSNKPPPNLTRYNLSSFAITLNELTPGL  437

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GWKPRWF++EGE+G
Sbjct  438  QEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLEKRQRMSRKLQEHGWKPRWFQKEGENG  497

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +FRYVGGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  498  SFRYVGGYWEARERGNWDGCPNIFGEFNEELVESSEG  534



>ref|XP_011070101.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Sesamum indicum]
Length=750

 Score =   251 bits (641),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+Y++NGE     KD S+ASLLW  NKPP+NLTRYN++SFAIT+NELTPGLKEK
Sbjct  597  FGKWDDSMYFVNGEGTGNVKDRSEASLLWTRNKPPENLTRYNLTSFAITMNELTPGLKEK  656

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGE++KANAEKLRLE RQRMSRKLQE+GWKPRWF R+ +DG FR
Sbjct  657  LPPTDSRLRPDQRHLENGEFEKANAEKLRLETRQRMSRKLQEHGWKPRWFHRD-DDGPFR  715

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            Y+GGYWE RE GKWDGCP+IFG++ + L+ SF+
Sbjct  716  YIGGYWEAREQGKWDGCPDIFGEISEDLVTSFQ  748



>gb|EYU18569.1| hypothetical protein MIMGU_mgv1a025714mg [Erythranthe guttata]
Length=765

 Score =   251 bits (642),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDAS-LLWKSNKPPQNLTRYNMSSFAITLNELTPGLKE  178
            FGKWD+S+Y++NG+ +S  KD SD+S LLWK NKPP +LTRYN++SFAITLNELTPGL+E
Sbjct  610  FGKWDDSMYFVNGDGSSNAKDRSDSSSLLWKRNKPPPDLTRYNLTSFAITLNELTPGLEE  669

Query  179  KLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTF  358
            KLPPTDSRLRPDQR LENGE+DKAN EKLRLE RQRMSRK+QE+GW+PRWFEREGE+G F
Sbjct  670  KLPPTDSRLRPDQRHLENGEFDKANVEKLRLETRQRMSRKMQEHGWRPRWFEREGEEGPF  729

Query  359  RYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
             Y+GGYWE RENGKWDG PNIFG++ + L+NS + 
Sbjct  730  HYIGGYWEARENGKWDGSPNIFGEISEDLVNSVQA  764



>gb|EYU24744.1| hypothetical protein MIMGU_mgv1a001762mg [Erythranthe guttata]
Length=762

 Score =   250 bits (639),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDAS-LLWKSNKPPQNLTRYNMSSFAITLNELTPGLKE  178
            FGKWD+S+Y++NG+ +S  KD SD+S LLWK NKPP +LTRYN++SFAITLNELTPGL+E
Sbjct  607  FGKWDDSMYFVNGDGSSNAKDRSDSSSLLWKRNKPPPDLTRYNLTSFAITLNELTPGLEE  666

Query  179  KLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTF  358
            KLPPTDSRLRPDQR LENGE+DKAN EKLRLE RQRMSRK+QE+GW+PRWFEREGE+G F
Sbjct  667  KLPPTDSRLRPDQRHLENGEFDKANVEKLRLETRQRMSRKMQEHGWRPRWFEREGEEGPF  726

Query  359  RYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
             Y+GGYWE RE+GKWDG PNIFG++ + L+NS + 
Sbjct  727  HYIGGYWEAREHGKWDGSPNIFGEISEDLVNSVQA  761



>ref|XP_008238570.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X3 [Prunus mume]
Length=769

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDESI+Y+NG+ + KP + SDASLLWKS+KPP N+TRYN++SFAITLNELTPGL+EK
Sbjct  617  FGKWDESIHYVNGDGSGKP-NPSDASLLWKSSKPP-NVTRYNLTSFAITLNELTPGLQEK  674

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG FR
Sbjct  675  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFQREGEDGPFR  734

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+  + L  + EG
Sbjct  735  YVGGYWETRKQGKWDECPDIFGEFSEGLDETLEG  768



>gb|KHN04341.1| Oxysterol-binding protein-related protein 2A, partial [Glycine 
soja]
Length=668

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD--LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+SIYY+NGE N KPKD  +SD +LLWK  KPP NLTRYN++SFAITLNELTPGLK
Sbjct  473  FGKWDDSIYYVNGEVNVKPKDFTMSDTNLLWKRTKPPSNLTRYNLTSFAITLNELTPGLK  532

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QENGW+PRWF R+ E+GT
Sbjct  533  EKLPPTDSRLRPDQRHLENGEYEKANMEKQRLEKRQRMSRKMQENGWQPRWFHRQSENGT  592

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRY GGYWE R  G+W+GCPNIFG++ +
Sbjct  593  FRYTGGYWEARAQGRWNGCPNIFGEIHE  620



>ref|XP_007211302.1| hypothetical protein PRUPE_ppa001777mg [Prunus persica]
 gb|EMJ12501.1| hypothetical protein PRUPE_ppa001777mg [Prunus persica]
Length=766

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDESI+Y+NG+ + KP + SDASLLWKS+KPP N+TRYN++SFAITLNELTPGL+EK
Sbjct  614  FGKWDESIHYVNGDGSGKP-NPSDASLLWKSSKPP-NVTRYNLTSFAITLNELTPGLQEK  671

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG FR
Sbjct  672  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFQREGEDGPFR  731

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+  + L  + EG
Sbjct  732  YVGGYWETRKQGKWDECPDIFGEFSEGLDEALEG  765



>ref|XP_008238572.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X5 [Prunus mume]
 ref|XP_008238573.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X5 [Prunus mume]
Length=766

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDESI+Y+NG+ + KP + SDASLLWKS+KPP N+TRYN++SFAITLNELTPGL+EK
Sbjct  614  FGKWDESIHYVNGDGSGKP-NPSDASLLWKSSKPP-NVTRYNLTSFAITLNELTPGLQEK  671

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG FR
Sbjct  672  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFQREGEDGPFR  731

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+  + L  + EG
Sbjct  732  YVGGYWETRKQGKWDECPDIFGEFSEGLDETLEG  765



>ref|XP_010053447.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X3 [Eucalyptus grandis]
Length=539

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL--K  175
             GKWDE+IYY++GE   K K+ SDASLLWK NKPP  LTRYNMSSFAITLNELTPGL  K
Sbjct  383  VGKWDEAIYYVDGELTRKLKNYSDASLLWKCNKPPPTLTRYNMSSFAITLNELTPGLQIK  442

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSR+LQENGWKPRWF+REGE+G 
Sbjct  443  EKLPPTDSRLRPDQRHLENGEYERANAEKQRLEKRQRMSRQLQENGWKPRWFQREGENGP  502

Query  356  FRYVGGYWETRENGKWDGCPNIFGQ  430
            FRYVGGYWE R+ GKW+GCP+IFG+
Sbjct  503  FRYVGGYWEARQQGKWEGCPDIFGE  527



>ref|XP_010662335.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Vitis vinifera]
Length=765

 Score =   249 bits (636),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+   K KD +   DASLLWK N+PP  LTRYN++SFAITLNELT GL
Sbjct  604  FGKWDDSMYYVLGDRTGKLKDCNGSPDASLLWKRNRPPPCLTRYNLTSFAITLNELTSGL  663

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMSRKLQENGWKP+WFEREGE
Sbjct  664  QIKEKLPPTDSRLRPDQRHLENGEYEKANAEKLRLEKRQRMSRKLQENGWKPKWFEREGE  723

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            DG FRY+GGYWE R+ GKWDGCPNIFG+  + L+NS+EG
Sbjct  724  DGPFRYMGGYWEARDQGKWDGCPNIFGEFTEDLVNSYEG  762



>ref|XP_011018287.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Populus euphratica]
Length=761

 Score =   248 bits (634),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y  G+   K KD    S+A+LLWKSNKPP NLTRYN+SSFAITLNELTPGL
Sbjct  604  FGKWDDSMHYTTGDGTGKSKDRITSSNATLLWKSNKPPPNLTRYNLSSFAITLNELTPGL  663

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GWKPRWF++EGE+G
Sbjct  664  QEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLEKRQRMSRKLQEHGWKPRWFQKEGENG  723

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +FRYVGGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  724  SFRYVGGYWEARERGNWDGCPNIFGEFNEELVESSEG  760



>ref|XP_006368190.1| hypothetical protein POPTR_0001s00390g [Populus trichocarpa]
 ref|XP_006368191.1| oxysterol-binding family protein [Populus trichocarpa]
 gb|ERP64759.1| hypothetical protein POPTR_0001s00390g [Populus trichocarpa]
 gb|ERP64760.1| oxysterol-binding family protein [Populus trichocarpa]
Length=760

 Score =   248 bits (634),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y  G+   K KD    S+A+LLWKSNKPP NLTRYN+SSFAITLNELTPGL
Sbjct  603  FGKWDDSMHYTTGDGTGKSKDRITSSNATLLWKSNKPPPNLTRYNLSSFAITLNELTPGL  662

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GWKPRWF++EGE+G
Sbjct  663  QEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLEKRQRMSRKLQEHGWKPRWFQKEGENG  722

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +FRYVGGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  723  SFRYVGGYWEARERGNWDGCPNIFGEFNEELVESSEG  759



>ref|XP_011018289.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Populus euphratica]
Length=760

 Score =   248 bits (634),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y  G+   K KD    S+A+LLWKSNKPP NLTRYN+SSFAITLNELTPGL
Sbjct  603  FGKWDDSMHYTTGDGTGKSKDRITSSNATLLWKSNKPPPNLTRYNLSSFAITLNELTPGL  662

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GWKPRWF++EGE+G
Sbjct  663  QEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLEKRQRMSRKLQEHGWKPRWFQKEGENG  722

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +FRYVGGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  723  SFRYVGGYWEARERGNWDGCPNIFGEFNEELVESSEG  759



>ref|XP_010053446.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Eucalyptus grandis]
 gb|KCW77739.1| hypothetical protein EUGRSUZ_D02035 [Eucalyptus grandis]
 gb|KCW77740.1| hypothetical protein EUGRSUZ_D02035 [Eucalyptus grandis]
Length=783

 Score =   248 bits (633),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
             GKWDE+IYY++GE   K K+ SDASLLWK NKPP  LTRYNMSSFAITLNELTPGL+EK
Sbjct  629  VGKWDEAIYYVDGELTRKLKNYSDASLLWKCNKPPPTLTRYNMSSFAITLNELTPGLQEK  688

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSR+LQENGWKPRWF+REGE+G FR
Sbjct  689  LPPTDSRLRPDQRHLENGEYERANAEKQRLEKRQRMSRQLQENGWKPRWFQREGENGPFR  748

Query  362  YVGGYWETRENGKWDGCPNIFGQ  430
            YVGGYWE R+ GKW+GCP+IFG+
Sbjct  749  YVGGYWEARQQGKWEGCPDIFGE  771



>gb|KEH31653.1| OSBP(oxysterol-binding protein)-related protein 1C [Medicago 
truncatula]
Length=539

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+SIYY +G+ N KPKD   S+ +LLWK  +PP NLTRYN++SFAITLNELTPGLK
Sbjct  383  FGKWDDSIYYFDGDVNVKPKDYTSSNGTLLWKRTRPPPNLTRYNLTSFAITLNELTPGLK  442

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGE++KAN EK RLE RQRMSRK+QENGW+P+WF +EGE+GT
Sbjct  443  EKLPPTDSRLRPDQRHLENGEFEKANMEKQRLEKRQRMSRKMQENGWEPKWFRKEGENGT  502

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            FRY GGYWE R  G WDGCPNIFG+  +++I+ F+ 
Sbjct  503  FRYTGGYWEARAVGSWDGCPNIFGEFQESIIDPFDA  538



>ref|XP_006579627.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Glycine max]
Length=770

 Score =   248 bits (632),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD--LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+SIYY+NGE N KPKD  +SD +LLWK  KPP NLTRYN++SFAITLNELTPGLK
Sbjct  614  FGKWDDSIYYVNGEVNVKPKDFTMSDTNLLWKRTKPPSNLTRYNLTSFAITLNELTPGLK  673

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QENGW+PRWF R+ E+GT
Sbjct  674  EKLPPTDSRLRPDQRHLENGEYEKANMEKQRLEKRQRMSRKMQENGWQPRWFHRQSENGT  733

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRY GGYWE R  G+W+GCPNIFG++ +
Sbjct  734  FRYTGGYWEARAQGRWNGCPNIFGEIHE  761



>ref|XP_004171732.1| PREDICTED: oxysterol-binding protein-related protein 2A-like, 
partial [Cucumis sativus]
Length=588

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+YY+NG  N   K   D +LLWKS++PPQNLTRYN++SFAITLNELTPGLKE 
Sbjct  439  FGKWDDSMYYINGHENINSKSC-DGTLLWKSSEPPQNLTRYNLTSFAITLNELTPGLKEL  497

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENG+YDKANAEKLRLE RQR+SRKLQENGWKPRWF+REGEDG FR
Sbjct  498  LPPTDSRLRPDQRHLENGQYDKANAEKLRLEQRQRISRKLQENGWKPRWFQREGEDGPFR  557

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            YVGGYWE RE  KWD C +IFG++++ ++
Sbjct  558  YVGGYWEAREESKWDDCADIFGELNEEVM  586



>ref|XP_010264228.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Nelumbo nucifera]
Length=765

 Score =   246 bits (629),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+ IYY+ G+ ++K KD    S+ASLLWKS+KPP NLTRYNM+SFAITLNELTPGL
Sbjct  613  FGKWDDCIYYIEGDGSAKLKDCNLSSEASLLWKSSKPPPNLTRYNMTSFAITLNELTPGL  672

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMSRKLQENGWKPRWF+++GE+G
Sbjct  673  QEKLPPTDSRLRPDQRYLENGEYEKANAEKLRLEQRQRMSRKLQENGWKPRWFQKDGENG  732

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
             FRYVGGYWE RE  KWDGCP IFG+  + ++
Sbjct  733  YFRYVGGYWEARERRKWDGCPEIFGEFKEEMV  764



>ref|XP_011033947.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Populus euphratica]
Length=765

 Score =   246 bits (629),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+   KPKD    S+A+LLWK NKPP NLTRYN+++FAITLNELTPGL
Sbjct  608  FGKWDDSMYYTTGDDTGKPKDRIPSSNATLLWKRNKPPLNLTRYNLTTFAITLNELTPGL  667

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E+LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GWKPRWF++EGE+G
Sbjct  668  QERLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQEHGWKPRWFQKEGENG  727

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +FRY GGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  728  SFRYGGGYWEAREQGNWDGCPNIFGEFNEDLVESSEG  764



>ref|XP_010093701.1| Oxysterol-binding protein-related protein 2A [Morus notabilis]
 gb|EXB54481.1| Oxysterol-binding protein-related protein 2A [Morus notabilis]
Length=789

 Score =   246 bits (629),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+NG+ ++ PKD    S++SLLWK  KPP NLTRYN++SFAITLNEL PGL
Sbjct  632  FGKWDDSMYYVNGDRSNNPKDCTSSSESSLLWKRTKPPPNLTRYNLTSFAITLNELIPGL  691

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKP+WFER+G +G
Sbjct  692  QEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPKWFERDGGNG  751

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
             FRYVGGYWE RE GKWDGCP+IFG+ ++ L +  EG
Sbjct  752  PFRYVGGYWEAREQGKWDGCPDIFGEFNEGLADPLEG  788



>ref|XP_008238569.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Prunus mume]
Length=770

 Score =   246 bits (628),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL--K  175
            FGKWDESI+Y+NG+ + KP + SDASLLWKS+KPP N+TRYN++SFAITLNELTPGL  K
Sbjct  616  FGKWDESIHYVNGDGSGKP-NPSDASLLWKSSKPP-NVTRYNLTSFAITLNELTPGLQIK  673

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG 
Sbjct  674  EKLPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFQREGEDGP  733

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            FRYVGGYWETR+ GKWD CP+IFG+  + L  + EG
Sbjct  734  FRYVGGYWETRKQGKWDECPDIFGEFSEGLDETLEG  769



>ref|XP_008238568.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Prunus mume]
Length=771

 Score =   246 bits (628),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL--K  175
            FGKWDESI+Y+NG+ + KP + SDASLLWKS+KPP N+TRYN++SFAITLNELTPGL  K
Sbjct  617  FGKWDESIHYVNGDGSGKP-NPSDASLLWKSSKPP-NVTRYNLTSFAITLNELTPGLQIK  674

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG 
Sbjct  675  EKLPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFQREGEDGP  734

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            FRYVGGYWETR+ GKWD CP+IFG+  + L  + EG
Sbjct  735  FRYVGGYWETRKQGKWDECPDIFGEFSEGLDETLEG  770



>ref|XP_008238571.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X4 [Prunus mume]
Length=768

 Score =   246 bits (628),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL--K  175
            FGKWDESI+Y+NG+ + KP + SDASLLWKS+KPP N+TRYN++SFAITLNELTPGL  K
Sbjct  614  FGKWDESIHYVNGDGSGKP-NPSDASLLWKSSKPP-NVTRYNLTSFAITLNELTPGLQIK  671

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG 
Sbjct  672  EKLPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFQREGEDGP  731

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            FRYVGGYWETR+ GKWD CP+IFG+  + L  + EG
Sbjct  732  FRYVGGYWETRKQGKWDECPDIFGEFSEGLDETLEG  767



>ref|XP_006600834.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Glycine max]
Length=642

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 127/149 (85%), Gaps = 3/149 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDAS---LLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+SIYY+NGE N KPKD + +S   LLWK   PP NLTRYN++SFAITLNELTPGL
Sbjct  485  FGKWDDSIYYVNGEVNVKPKDFTMSSVTNLLWKRTMPPSNLTRYNLTSFAITLNELTPGL  544

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QENGW+PRWF RE E+G
Sbjct  545  KEKLPPTDSRLRPDQRHLENGEYEKANMEKQRLEKRQRMSRKMQENGWQPRWFHRENENG  604

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            TFRY+GGYWE R  G+W GCPNIFG++ +
Sbjct  605  TFRYIGGYWEARAQGRWIGCPNIFGEIHE  633



>ref|XP_011033949.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Populus euphratica]
Length=595

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 135/159 (85%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+   KPKD    S+A+LLWK NKPP NLTRYN+++FAITLNELTPGL
Sbjct  436  FGKWDDSMYYTTGDDTGKPKDRIPSSNATLLWKRNKPPLNLTRYNLTTFAITLNELTPGL  495

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KE+LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GWKPRWF++EGE
Sbjct  496  QIKERLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQEHGWKPRWFQKEGE  555

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +G+FRY GGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  556  NGSFRYGGGYWEAREQGNWDGCPNIFGEFNEDLVESSEG  594



>ref|XP_006573731.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X5 [Glycine max]
Length=497

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+++YY++G  N KPKD   ++ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  340  FGKWDDNMYYMSGNINVKPKDFTSANASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  399

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  400  EKLPPTDSRLRPDQRHLENGEYEKANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  459

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPNIFG+ ++
Sbjct  460  FRYVGGYWEAREHGRWDGCPNIFGEFNE  487



>ref|XP_002303585.2| hypothetical protein POPTR_0003s11090g [Populus trichocarpa]
 gb|EEE78564.2| hypothetical protein POPTR_0003s11090g [Populus trichocarpa]
Length=734

 Score =   244 bits (624),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+   KPKD    S+A+LLWK NKPP NLTRYN+++FAITLNELTPGL
Sbjct  577  FGKWDDSMYYTTGDETGKPKDRIPSSNATLLWKRNKPPLNLTRYNLTTFAITLNELTPGL  636

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E+LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GWKPRWF++EG++G
Sbjct  637  QERLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQEHGWKPRWFQKEGDNG  696

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +FRY GGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  697  SFRYGGGYWEAREQGNWDGCPNIFGEFNEDLVESSEG  733



>ref|XP_008358133.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Malus domestica]
Length=449

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+  S+  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  297  FGKWDESMHYVNGD-GSRKLNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  354

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWFERE EDG+FR
Sbjct  355  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFEREREDGSFR  414

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR  G+WD CP+IFG+ ++ L    EG
Sbjct  415  YVGGYWETRNQGQWDECPDIFGEFNEGLDEQSEG  448



>ref|XP_002304422.2| hypothetical protein POPTR_0003s11090g [Populus trichocarpa]
 gb|EEE79401.2| hypothetical protein POPTR_0003s11090g [Populus trichocarpa]
Length=733

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+   KPKD    S+A+LLWK NKPP NLTRYN+++FAITLNELTPGL
Sbjct  576  FGKWDDSMYYTTGDETGKPKDRIPSSNATLLWKRNKPPLNLTRYNLTTFAITLNELTPGL  635

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E+LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GWKPRWF++EG++G
Sbjct  636  QERLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQEHGWKPRWFQKEGDNG  695

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +FRY GGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  696  SFRYGGGYWEAREQGNWDGCPNIFGEFNEDLVESSEG  732



>ref|XP_004298651.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Fragaria vesca subsp. vesca]
Length=727

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 137/154 (89%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+YY++GE   KP ++SDASLLWK +KPP ++TRYN++SFAITLNELT GL+EK
Sbjct  576  FGKWDDSMYYVDGEVGGKP-NVSDASLLWKGSKPP-DITRYNLTSFAITLNELTRGLQEK  633

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF+REGEDG FR
Sbjct  634  LPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFQREGEDGPFR  693

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWE+R+ GKWD CPNIFG+ D+ L +S EG
Sbjct  694  YVGGYWESRKQGKWDECPNIFGEFDEGL-DSLEG  726



>ref|XP_011018285.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Populus euphratica]
Length=763

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y  G+   K KD    S+A+LLWKSNKPP NLTRYN+SSFAITLNELTPGL
Sbjct  604  FGKWDDSMHYTTGDGTGKSKDRITSSNATLLWKSNKPPPNLTRYNLSSFAITLNELTPGL  663

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GWKPRWF++EGE
Sbjct  664  QIKEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLEKRQRMSRKLQEHGWKPRWFQKEGE  723

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +G+FRYVGGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  724  NGSFRYVGGYWEARERGNWDGCPNIFGEFNEELVESSEG  762



>ref|XP_011018286.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Populus euphratica]
Length=762

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y  G+   K KD    S+A+LLWKSNKPP NLTRYN+SSFAITLNELTPGL
Sbjct  603  FGKWDDSMHYTTGDGTGKSKDRITSSNATLLWKSNKPPPNLTRYNLSSFAITLNELTPGL  662

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GWKPRWF++EGE
Sbjct  663  QIKEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLEKRQRMSRKLQEHGWKPRWFQKEGE  722

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +G+FRYVGGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  723  NGSFRYVGGYWEARERGNWDGCPNIFGEFNEELVESSEG  761



>ref|XP_009333672.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Pyrus x bretschneideri]
Length=449

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+  S+  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  297  FGKWDESMHYVNGD-GSRKLNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  354

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQR+SRKLQENGWKPRWFEREGED  FR
Sbjct  355  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRLSRKLQENGWKPRWFEREGEDEPFR  414

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  415  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQTEG  448



>ref|XP_009376026.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Pyrus x bretschneideri]
Length=449

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+ + K  + SDASLLWKS+K P N+TRYN++SFA+TLNELTPGL+EK
Sbjct  297  FGKWDESMHYVNGDGSGK-LNPSDASLLWKSSKLP-NVTRYNLTSFAMTLNELTPGLQEK  354

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWFEREGEDG FR
Sbjct  355  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFEREGEDGPFR  414

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  415  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQSEG  448



>ref|XP_010053444.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Eucalyptus grandis]
 ref|XP_010053445.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Eucalyptus grandis]
Length=785

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL--K  175
             GKWDE+IYY++GE   K K+ SDASLLWK NKPP  LTRYNMSSFAITLNELTPGL  K
Sbjct  629  VGKWDEAIYYVDGELTRKLKNYSDASLLWKCNKPPPTLTRYNMSSFAITLNELTPGLQIK  688

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSR+LQENGWKPRWF+REGE+G 
Sbjct  689  EKLPPTDSRLRPDQRHLENGEYERANAEKQRLEKRQRMSRQLQENGWKPRWFQREGENGP  748

Query  356  FRYVGGYWETRENGKWDGCPNIFGQ  430
            FRYVGGYWE R+ GKW+GCP+IFG+
Sbjct  749  FRYVGGYWEARQQGKWEGCPDIFGE  773



>ref|XP_011081219.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Sesamum indicum]
Length=629

 Score =   241 bits (616),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+ ++NG+     K  S+ASLLWK NKP  N TRYN++SFAITLNELTPGLKEK
Sbjct  476  FGKWDDSMCFINGDGTGNVKGRSEASLLWKRNKPSPNPTRYNLTSFAITLNELTPGLKEK  535

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKAN EKLRLEMRQRMSRKLQE+GWKP+WF+R+GE G F 
Sbjct  536  LPPTDSRLRPDQRYLENGEYDKANVEKLRLEMRQRMSRKLQEHGWKPKWFQRDGE-GAFH  594

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            YVGGYWE R+  KWD CP+IFG++ Q LINS E
Sbjct  595  YVGGYWEARQQAKWDSCPDIFGEISQELINSLE  627



>ref|XP_006368188.1| hypothetical protein POPTR_0001s00390g [Populus trichocarpa]
 gb|ERP64757.1| hypothetical protein POPTR_0001s00390g [Populus trichocarpa]
Length=761

 Score =   244 bits (622),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 135/158 (85%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y  G+   K KD    S+A+LLWKSNKPP NLTRYN+SSFAITLNELTPGL
Sbjct  603  FGKWDDSMHYTTGDGTGKSKDRITSSNATLLWKSNKPPPNLTRYNLSSFAITLNELTPGL  662

Query  173  K-EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGED  349
            + EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GWKPRWF++EGE+
Sbjct  663  QVEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLEKRQRMSRKLQEHGWKPRWFQKEGEN  722

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            G+FRYVGGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  723  GSFRYVGGYWEARERGNWDGCPNIFGEFNEELVESSEG  760



>gb|KEH31652.1| OSBP(oxysterol-binding protein)-related protein 1C [Medicago 
truncatula]
Length=770

 Score =   244 bits (622),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+SIYY +G+ N KPKD   S+ +LLWK  +PP NLTRYN++SFAITLNELTPGLK
Sbjct  614  FGKWDDSIYYFDGDVNVKPKDYTSSNGTLLWKRTRPPPNLTRYNLTSFAITLNELTPGLK  673

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGE++KAN EK RLE RQRMSRK+QENGW+P+WF +EGE+GT
Sbjct  674  EKLPPTDSRLRPDQRHLENGEFEKANMEKQRLEKRQRMSRKMQENGWEPKWFRKEGENGT  733

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            FRY GGYWE R  G WDGCPNIFG+  +++I+ F+ 
Sbjct  734  FRYTGGYWEARAVGSWDGCPNIFGEFQESIIDPFDA  769



>ref|XP_007155634.1| hypothetical protein PHAVU_003G218400g [Phaseolus vulgaris]
 gb|ESW27628.1| hypothetical protein PHAVU_003G218400g [Phaseolus vulgaris]
Length=761

 Score =   243 bits (621),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (86%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD--LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+S+YY+NGE N KPKD  L   + LWK  KPP NLTRYN++SFAITLNELTPGLK
Sbjct  609  FGKWDDSMYYVNGEANVKPKDCTLPGTNFLWKRTKPPSNLTRYNLTSFAITLNELTPGLK  668

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LE+GEY+KAN EK RLE RQRMSRKLQENGW+PRWF +EGE+GT
Sbjct  669  EKLPPTDSRLRPDQRHLEDGEYEKANIEKQRLEKRQRMSRKLQENGWQPRWFHKEGENGT  728

Query  356  FRYVGGYWETRENGKWDGCPNIFGQV-DQTLI  448
            FRY+GGYWE R  GKW+GCPNIFG+V D  LI
Sbjct  729  FRYIGGYWEARALGKWNGCPNIFGEVYDGNLI  760



>ref|XP_006600833.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Glycine max]
Length=768

 Score =   243 bits (621),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 127/149 (85%), Gaps = 3/149 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDAS---LLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+SIYY+NGE N KPKD + +S   LLWK   PP NLTRYN++SFAITLNELTPGL
Sbjct  611  FGKWDDSIYYVNGEVNVKPKDFTMSSVTNLLWKRTMPPSNLTRYNLTSFAITLNELTPGL  670

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QENGW+PRWF RE E+G
Sbjct  671  KEKLPPTDSRLRPDQRHLENGEYEKANMEKQRLEKRQRMSRKMQENGWQPRWFHRENENG  730

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            TFRY+GGYWE R  G+W GCPNIFG++ +
Sbjct  731  TFRYIGGYWEARAQGRWIGCPNIFGEIHE  759



>ref|XP_004147593.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Cucumis sativus]
 gb|KGN50228.1| hypothetical protein Csa_5G161280 [Cucumis sativus]
Length=756

 Score =   243 bits (620),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+YY+NG  N   K   D +LLWKS++PPQNLTRYN++SFAITLNELTPGLKE 
Sbjct  607  FGKWDDSMYYINGHENINSKSC-DGTLLWKSSEPPQNLTRYNLTSFAITLNELTPGLKEL  665

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENG+YDKANAEKLRLE RQR+SRKLQENGWKPRWF+REGEDG FR
Sbjct  666  LPPTDSRLRPDQRHLENGQYDKANAEKLRLEQRQRISRKLQENGWKPRWFQREGEDGPFR  725

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            YVGGYWE RE  KWD C +IFG++++ ++
Sbjct  726  YVGGYWEAREESKWDDCADIFGELNEEVM  754



>ref|XP_006573730.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Glycine max]
Length=631

 Score =   240 bits (613),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS--DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+++YY++G  N KPKD +  +ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  474  FGKWDDNMYYMSGNINVKPKDFTSANASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  533

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  534  EKLPPTDSRLRPDQRHLENGEYEKANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  593

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPNIFG+ ++
Sbjct  594  FRYVGGYWEAREHGRWDGCPNIFGEFNE  621



>gb|KHN09795.1| Oxysterol-binding protein-related protein 2A [Glycine soja]
Length=781

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 127/149 (85%), Gaps = 3/149 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDAS---LLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+SIYY+NGE N KPKD + +S   LLWK   PP NLTRYN++SFAITLNELTPGL
Sbjct  624  FGKWDDSIYYVNGEVNVKPKDFTMSSVTNLLWKRTMPPSNLTRYNLTSFAITLNELTPGL  683

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QENGW+PRWF RE E+G
Sbjct  684  KEKLPPTDSRLRPDQRHLENGEYEKANMEKQRLEKRQRMSRKMQENGWQPRWFHRENENG  743

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            TFRY+GGYWE R  G+W GCPNIFG++ +
Sbjct  744  TFRYIGGYWEARAQGRWIGCPNIFGEIHE  772



>ref|XP_008437116.1| PREDICTED: oxysterol-binding protein-related protein 2B-like 
[Cucumis melo]
 ref|XP_008437117.1| PREDICTED: oxysterol-binding protein-related protein 2B-like 
[Cucumis melo]
Length=765

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+YY+NG  N   K   D +LLWKS++PPQNLTRYN++SFAITLNELTPGLKE 
Sbjct  616  FGKWDDSMYYVNGHNNVNSKSC-DGTLLWKSSEPPQNLTRYNLTSFAITLNELTPGLKEL  674

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENG+YDKANAEKLRLE RQR+SRKLQENGWKPRWF+REGEDG+FR
Sbjct  675  LPPTDSRLRPDQRHLENGQYDKANAEKLRLEQRQRISRKLQENGWKPRWFQREGEDGSFR  734

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTL  445
            YVGGYWE RE  KWD C +IFG++++ +
Sbjct  735  YVGGYWEAREERKWDDCADIFGELNEEV  762



>ref|XP_010264227.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Nelumbo nucifera]
Length=767

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+ IYY+ G+ ++K KD    S+ASLLWKS+KPP NLTRYNM+SFAITLNELTPGL
Sbjct  613  FGKWDDCIYYIEGDGSAKLKDCNLSSEASLLWKSSKPPPNLTRYNMTSFAITLNELTPGL  672

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMSRKLQENGWKPRWF+++GE
Sbjct  673  QIKEKLPPTDSRLRPDQRYLENGEYEKANAEKLRLEQRQRMSRKLQENGWKPRWFQKDGE  732

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            +G FRYVGGYWE RE  KWDGCP IFG+  + ++
Sbjct  733  NGYFRYVGGYWEARERRKWDGCPEIFGEFKEEMV  766



>ref|XP_011033948.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Populus euphratica]
Length=762

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 135/159 (85%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+   KPKD    S+A+LLWK NKPP NLTRYN+++FAITLNELTPGL
Sbjct  603  FGKWDDSMYYTTGDDTGKPKDRIPSSNATLLWKRNKPPLNLTRYNLTTFAITLNELTPGL  662

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KE+LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GWKPRWF++EGE
Sbjct  663  QIKERLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQEHGWKPRWFQKEGE  722

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +G+FRY GGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  723  NGSFRYGGGYWEAREQGNWDGCPNIFGEFNEDLVESSEG  761



>ref|XP_010264229.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Nelumbo nucifera]
 ref|XP_010264230.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Nelumbo nucifera]
Length=762

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+ IYY+ G+ ++K KD    S+ASLLWKS+KPP NLTRYNM+SFAITLNELTPGL
Sbjct  608  FGKWDDCIYYIEGDGSAKLKDCNLSSEASLLWKSSKPPPNLTRYNMTSFAITLNELTPGL  667

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMSRKLQENGWKPRWF+++GE
Sbjct  668  QIKEKLPPTDSRLRPDQRYLENGEYEKANAEKLRLEQRQRMSRKLQENGWKPRWFQKDGE  727

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            +G FRYVGGYWE RE  KWDGCP IFG+  + ++
Sbjct  728  NGYFRYVGGYWEARERRKWDGCPEIFGEFKEEMV  761



>ref|XP_011033946.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Populus euphratica]
Length=767

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 135/159 (85%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+   KPKD    S+A+LLWK NKPP NLTRYN+++FAITLNELTPGL
Sbjct  608  FGKWDDSMYYTTGDDTGKPKDRIPSSNATLLWKRNKPPLNLTRYNLTTFAITLNELTPGL  667

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KE+LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GWKPRWF++EGE
Sbjct  668  QIKERLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQEHGWKPRWFQKEGE  727

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            +G+FRY GGYWE RE G WDGCPNIFG+ ++ L+ S EG
Sbjct  728  NGSFRYGGGYWEAREQGNWDGCPNIFGEFNEDLVESSEG  766



>ref|XP_011081218.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Sesamum indicum]
Length=698

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+ ++NG+     K  S+ASLLWK NKP  N TRYN++SFAITLNELTPGLKEK
Sbjct  545  FGKWDDSMCFINGDGTGNVKGRSEASLLWKRNKPSPNPTRYNLTSFAITLNELTPGLKEK  604

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKAN EKLRLEMRQRMSRKLQE+GWKP+WF+R+GE G F 
Sbjct  605  LPPTDSRLRPDQRYLENGEYDKANVEKLRLEMRQRMSRKLQEHGWKPKWFQRDGE-GAFH  663

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            YVGGYWE R+  KWD CP+IFG++ Q LINS E
Sbjct  664  YVGGYWEARQQAKWDSCPDIFGEISQELINSLE  696



>ref|XP_006590559.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X5 [Glycine max]
Length=688

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+S+YY+NG  N KPKD   S+ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  532  FGKWDDSMYYMNGNVNVKPKDFTSSNASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  591

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY++AN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  592  EKLPPTDSRLRPDQRDLENGEYERANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  651

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPN FG+ ++
Sbjct  652  FRYVGGYWEAREHGRWDGCPNTFGEFNE  679



>ref|XP_008373893.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Malus domestica]
 ref|XP_008346603.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Malus domestica]
Length=535

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+ + K  + SDASLLWKS+KPP ++TRYN++SFA+TLNELTPGL+EK
Sbjct  383  FGKWDESMHYVNGDGSGK-LNPSDASLLWKSSKPP-DVTRYNLTSFAMTLNELTPGLQEK  440

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE GWKPRWFEREGE G FR
Sbjct  441  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQEXGWKPRWFEREGEGGPFR  500

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L +  EG
Sbjct  501  YVGGYWETRKQGKWDECPDIFGEFNEGLDDQTEG  534



>ref|XP_011081217.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Sesamum indicum]
Length=750

 Score =   241 bits (615),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+ ++NG+     K  S+ASLLWK NKP  N TRYN++SFAITLNELTPGLKEK
Sbjct  597  FGKWDDSMCFINGDGTGNVKGRSEASLLWKRNKPSPNPTRYNLTSFAITLNELTPGLKEK  656

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEYDKAN EKLRLEMRQRMSRKLQE+GWKP+WF+R+GE G F 
Sbjct  657  LPPTDSRLRPDQRYLENGEYDKANVEKLRLEMRQRMSRKLQEHGWKPKWFQRDGE-GAFH  715

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFE  460
            YVGGYWE R+  KWD CP+IFG++ Q LINS E
Sbjct  716  YVGGYWEARQQAKWDSCPDIFGEISQELINSLE  748



>gb|KDO61482.1| hypothetical protein CISIN_1g042453mg [Citrus sinensis]
Length=666

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD S+YY++G+ + K KD +   DASLLWKSNK P NLTRYN++SFAITLNELTPGL
Sbjct  510  FGKWDNSMYYISGDGSGKLKDGNVSPDASLLWKSNKAPLNLTRYNLTSFAITLNELTPGL  569

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF REGE+G
Sbjct  570  QEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRREGENG  629

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +FRYVGGYWE RE  KWD CPNIFG+  + + +S
Sbjct  630  SFRYVGGYWEAREQLKWDECPNIFGEFCEDVHSS  663



>gb|KHN34952.1| Oxysterol-binding protein-related protein 2A [Glycine soja]
Length=762

 Score =   241 bits (615),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+S+YY+NG  N KPKD   S+ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  606  FGKWDDSMYYMNGNVNVKPKDFTSSNASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  665

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY++AN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  666  EKLPPTDSRLRPDQRDLENGEYERANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  725

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPN FG+ ++
Sbjct  726  FRYVGGYWEAREHGRWDGCPNTFGEFNE  753



>ref|XP_006590558.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Glycine max]
Length=766

 Score =   241 bits (615),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+S+YY+NG  N KPKD   S+ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  610  FGKWDDSMYYMNGNVNVKPKDFTSSNASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  669

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY++AN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  670  EKLPPTDSRLRPDQRDLENGEYERANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  729

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPN FG+ ++
Sbjct  730  FRYVGGYWEAREHGRWDGCPNTFGEFNE  757



>ref|XP_006590555.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Glycine max]
 ref|XP_006590556.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Glycine max]
 ref|XP_006590557.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Glycine max]
Length=767

 Score =   241 bits (615),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+S+YY+NG  N KPKD   S+ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  611  FGKWDDSMYYMNGNVNVKPKDFTSSNASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  670

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY++AN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  671  EKLPPTDSRLRPDQRDLENGEYERANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  730

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPN FG+ ++
Sbjct  731  FRYVGGYWEAREHGRWDGCPNTFGEFNE  758



>ref|XP_009333604.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Pyrus x bretschneideri]
Length=449

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y++G  + K  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  297  FGKWDESMHYVDGNGSGK-LNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  354

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQR+SRKLQENGWKPRWFEREGED  FR
Sbjct  355  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRLSRKLQENGWKPRWFEREGEDEPFR  414

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  415  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQTEG  448



>ref|XP_006573728.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Glycine max]
Length=769

 Score =   241 bits (614),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+++YY++G  N KPKD   ++ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  612  FGKWDDNMYYMSGNINVKPKDFTSANASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  671

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  672  EKLPPTDSRLRPDQRHLENGEYEKANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  731

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPNIFG+ ++
Sbjct  732  FRYVGGYWEAREHGRWDGCPNIFGEFNE  759



>ref|XP_008358131.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Malus domestica]
Length=770

 Score =   241 bits (614),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+  S+  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  618  FGKWDESMHYVNGD-GSRKLNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  675

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWFERE EDG+FR
Sbjct  676  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFEREREDGSFR  735

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR  G+WD CP+IFG+ ++ L    EG
Sbjct  736  YVGGYWETRNQGQWDECPDIFGEFNEGLDEQSEG  769



>ref|XP_006573727.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Glycine max]
Length=770

 Score =   241 bits (614),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+++YY++G  N KPKD   ++ASLLWK   P  NLTRYN++ FAITLNELTPGLK
Sbjct  613  FGKWDDNMYYMSGNINVKPKDFTSANASLLWKRTMPSPNLTRYNLTPFAITLNELTPGLK  672

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QE+GWKPRWF REGE+GT
Sbjct  673  EKLPPTDSRLRPDQRHLENGEYEKANLEKQRLEKRQRMSRKIQESGWKPRWFRREGENGT  732

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRYVGGYWE RE+G+WDGCPNIFG+ ++
Sbjct  733  FRYVGGYWEAREHGRWDGCPNIFGEFNE  760



>ref|XP_008358132.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Malus domestica]
Length=768

 Score =   240 bits (613),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+  S+  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  616  FGKWDESMHYVNGD-GSRKLNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  673

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWFERE EDG+FR
Sbjct  674  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFEREREDGSFR  733

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR  G+WD CP+IFG+ ++ L    EG
Sbjct  734  YVGGYWETRNQGQWDECPDIFGEFNEGLDEQSEG  767



>ref|XP_006477224.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Citrus sinensis]
Length=764

 Score =   240 bits (613),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+ + K KD +   DASLLWK NK P NLTRYN++SFAITLNELTPGL
Sbjct  608  FGKWDDSMYYISGDGSGKLKDGNVSPDASLLWKRNKAPLNLTRYNLTSFAITLNELTPGL  667

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF REGE+G
Sbjct  668  QEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRREGENG  727

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +FRYVGGYWE RE  KWD CPNIFG+  + + NS
Sbjct  728  SFRYVGGYWEAREQLKWDECPNIFGEFCEDVHNS  761



>ref|XP_006477228.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X8 [Citrus sinensis]
 ref|XP_006477229.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X9 [Citrus sinensis]
Length=541

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+ + K KD +   DASLLWK NK P NLTRYN++SFAITLNELTPGL
Sbjct  383  FGKWDDSMYYISGDGSGKLKDGNVSPDASLLWKRNKAPLNLTRYNLTSFAITLNELTPGL  442

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF REGE
Sbjct  443  QIKEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRREGE  502

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +G+FRYVGGYWE RE  KWD CPNIFG+  + + NS
Sbjct  503  NGSFRYVGGYWEAREQLKWDECPNIFGEFCEDVHNS  538



>ref|XP_008381152.1| PREDICTED: oxysterol-binding protein-related protein 2B-like 
[Malus domestica]
Length=507

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+  S+  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  355  FGKWDESMHYVNGD-GSRKLNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  412

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KAN EK RLE  QRMSRKLQENGWKPRWFERE EDG+FR
Sbjct  413  LPPTDSRLRPDQRHLENGEYEKANXEKQRLEKXQRMSRKLQENGWKPRWFEREREDGSFR  472

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR  G+WD CP+IFG+ ++ L    EG
Sbjct  473  YVGGYWETRNQGQWDECPDIFGEFNEGLDEQSEG  506



>ref|XP_009333668.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Pyrus x bretschneideri]
Length=768

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+  S+  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  616  FGKWDESMHYVNGD-GSRKLNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  673

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQR+SRKLQENGWKPRWFEREGED  FR
Sbjct  674  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRLSRKLQENGWKPRWFEREGEDEPFR  733

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  734  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQTEG  767



>ref|XP_009333669.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Pyrus x bretschneideri]
Length=766

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+  S+  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  614  FGKWDESMHYVNGD-GSRKLNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  671

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQR+SRKLQENGWKPRWFEREGED  FR
Sbjct  672  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRLSRKLQENGWKPRWFEREGEDEPFR  731

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  732  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQTEG  765



>ref|XP_006477222.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Citrus sinensis]
Length=766

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+ + K KD +   DASLLWK NK P NLTRYN++SFAITLNELTPGL
Sbjct  610  FGKWDDSMYYISGDGSGKLKDGNVSPDASLLWKRNKAPLNLTRYNLTSFAITLNELTPGL  669

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF REGE+G
Sbjct  670  QEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRREGENG  729

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +FRYVGGYWE RE  KWD CPNIFG+  + + NS
Sbjct  730  SFRYVGGYWEAREQLKWDECPNIFGEFCEDVHNS  763



>ref|XP_009376024.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Pyrus x bretschneideri]
Length=768

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+ + K  + SDASLLWKS+K P N+TRYN++SFA+TLNELTPGL+EK
Sbjct  616  FGKWDESMHYVNGDGSGK-LNPSDASLLWKSSKLP-NVTRYNLTSFAMTLNELTPGLQEK  673

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWFEREGEDG FR
Sbjct  674  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQENGWKPRWFEREGEDGPFR  733

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  734  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQSEG  767



>gb|KCW77741.1| hypothetical protein EUGRSUZ_D02035 [Eucalyptus grandis]
Length=781

 Score =   240 bits (612),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
             GKWDE+IYY++GE   K K+ SDASLLWK NKPP  LTRYNMSSFAITLNELTPGL+  
Sbjct  629  VGKWDEAIYYVDGELTRKLKNYSDASLLWKCNKPPPTLTRYNMSSFAITLNELTPGLQ--  686

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY++ANAEK RLE RQRMSR+LQENGWKPRWF+REGE+G FR
Sbjct  687  LPPTDSRLRPDQRHLENGEYERANAEKQRLEKRQRMSRQLQENGWKPRWFQREGENGPFR  746

Query  362  YVGGYWETRENGKWDGCPNIFGQ  430
            YVGGYWE R+ GKW+GCP+IFG+
Sbjct  747  YVGGYWEARQQGKWEGCPDIFGE  769



>gb|KDP25642.1| hypothetical protein JCGZ_20798 [Jatropha curcas]
Length=764

 Score =   239 bits (610),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+  SK KD +   +  LLWKS K P N+TRYN++SFAITLNELTPGL
Sbjct  607  FGKWDDSMYYTKGDGTSKTKDSNSSPNTMLLWKSTKTPPNITRYNLTSFAITLNELTPGL  666

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GWKPRWF+REGE+G
Sbjct  667  KEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQEHGWKPRWFQREGENG  726

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
             FRYVGGYWE RE   WDGCPNIFG+ ++    S EG
Sbjct  727  PFRYVGGYWEAREQANWDGCPNIFGEFNEEFAESSEG  763



>ref|XP_006841158.1| hypothetical protein AMTR_s00086p00150620 [Amborella trichopoda]
 gb|ERN02833.1| hypothetical protein AMTR_s00086p00150620 [Amborella trichopoda]
Length=625

 Score =   235 bits (600),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  +KP+     SDA+LLWK + PP NLTRYN+SSFAITLNELTPGL
Sbjct  471  FGKWDDSMYYVAGDVCTKPRGYNPSSDATLLWKRSMPPPNLTRYNLSSFAITLNELTPGL  530

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            K+K+PPTDSRLRPDQR LENGEYD ANAEKLRLE RQRMSRKLQENGWKPRWF  +  +G
Sbjct  531  KDKIPPTDSRLRPDQRHLENGEYDMANAEKLRLETRQRMSRKLQENGWKPRWFRNDVGEG  590

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            TFRYVGGYWE RE  KWDGCP IFGQ    +I+
Sbjct  591  TFRYVGGYWEAREEKKWDGCPCIFGQFTGDVIS  623



>ref|XP_006440341.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
 ref|XP_006440342.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
 ref|XP_006440343.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
 gb|ESR53581.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
 gb|ESR53582.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
 gb|ESR53583.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
Length=539

 Score =   233 bits (595),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD S+YY++G+ + K KD +   DASLLWKSNK P NLTRYN++SFAITLNELTPGL
Sbjct  383  FGKWDNSMYYISGDGSGKLKDGNVSPDASLLWKSNKAPLNLTRYNLTSFAITLNELTPGL  442

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF  EGE+G
Sbjct  443  QEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRGEGENG  502

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +FRYVGGYWE R   KWD CPNIFG+  + + +S
Sbjct  503  SFRYVGGYWEARRQLKWDECPNIFGEFCEDVHSS  536



>ref|XP_004516841.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Cicer arietinum]
Length=739

 Score =   238 bits (606),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDAS---LLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+SI Y  G+ N KPKD +++S   LLWK  KPP NLTRYN++SFAITLNELTPGL
Sbjct  582  FGKWDDSINYFGGDVNVKPKDFTNSSSGTLLWKRTKPPPNLTRYNLTSFAITLNELTPGL  641

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QENGW+P+WF +E E+G
Sbjct  642  KEKLPPTDSRLRPDQRHLENGEYEKANMEKQRLEKRQRMSRKMQENGWEPKWFRKEDENG  701

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            TFRY GGYWE R  G WDGCPNIFG+  + +++ F+ 
Sbjct  702  TFRYTGGYWEARALGTWDGCPNIFGEFHEGIVDPFDA  738



>ref|XP_004516840.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Cicer arietinum]
Length=769

 Score =   238 bits (606),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDAS---LLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+SI Y  G+ N KPKD +++S   LLWK  KPP NLTRYN++SFAITLNELTPGL
Sbjct  612  FGKWDDSINYFGGDVNVKPKDFTNSSSGTLLWKRTKPPPNLTRYNLTSFAITLNELTPGL  671

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QENGW+P+WF +E E+G
Sbjct  672  KEKLPPTDSRLRPDQRHLENGEYEKANMEKQRLEKRQRMSRKMQENGWEPKWFRKEDENG  731

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            TFRY GGYWE R  G WDGCPNIFG+  + +++ F+ 
Sbjct  732  TFRYTGGYWEARALGTWDGCPNIFGEFHEGIVDPFDA  768



>ref|XP_008373891.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Malus domestica]
 ref|XP_008346602.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Malus domestica]
Length=766

 Score =   238 bits (606),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+ + K  + SDASLLWKS+KPP ++TRYN++SFA+TLNELTPGL+EK
Sbjct  614  FGKWDESMHYVNGDGSGK-LNPSDASLLWKSSKPP-DVTRYNLTSFAMTLNELTPGLQEK  671

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE GWKPRWFEREGE G FR
Sbjct  672  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQEXGWKPRWFEREGEGGPFR  731

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L +  EG
Sbjct  732  YVGGYWETRKQGKWDECPDIFGEFNEGLDDQTEG  765



>ref|XP_008373890.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Malus domestica]
 ref|XP_008346601.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Malus domestica]
Length=768

 Score =   238 bits (606),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y+NG+ + K  + SDASLLWKS+KPP ++TRYN++SFA+TLNELTPGL+EK
Sbjct  616  FGKWDESMHYVNGDGSGK-LNPSDASLLWKSSKPP-DVTRYNLTSFAMTLNELTPGLQEK  673

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE GWKPRWFEREGE G FR
Sbjct  674  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRMSRKLQEXGWKPRWFEREGEGGPFR  733

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L +  EG
Sbjct  734  YVGGYWETRKQGKWDECPDIFGEFNEGLDDQTEG  767



>ref|XP_009333600.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009333603.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Pyrus x bretschneideri]
Length=768

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y++G  + K  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  616  FGKWDESMHYVDGNGSGK-LNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  673

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQR+SRKLQENGWKPRWFEREGED  FR
Sbjct  674  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRLSRKLQENGWKPRWFEREGEDEPFR  733

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  734  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQTEG  767



>ref|XP_009333601.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Pyrus x bretschneideri]
Length=766

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWDES++Y++G  + K  + SDASLLWKS+KPP N+TRYN++SFA+TLNELTPGL+EK
Sbjct  614  FGKWDESMHYVDGNGSGK-LNPSDASLLWKSSKPP-NVTRYNLTSFAMTLNELTPGLQEK  671

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KANAEK RLE RQR+SRKLQENGWKPRWFEREGED  FR
Sbjct  672  LPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRLSRKLQENGWKPRWFEREGEDEPFR  731

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINSFEG  463
            YVGGYWETR+ GKWD CP+IFG+ ++ L    EG
Sbjct  732  YVGGYWETRKQGKWDECPDIFGEFNEGLDEQTEG  765



>ref|XP_006477223.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Citrus sinensis]
Length=766

 Score =   236 bits (603),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+ + K KD +   DASLLWK NK P NLTRYN++SFAITLNELTPGL
Sbjct  608  FGKWDDSMYYISGDGSGKLKDGNVSPDASLLWKRNKAPLNLTRYNLTSFAITLNELTPGL  667

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF REGE
Sbjct  668  QIKEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRREGE  727

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +G+FRYVGGYWE RE  KWD CPNIFG+  + + NS
Sbjct  728  NGSFRYVGGYWEAREQLKWDECPNIFGEFCEDVHNS  763



>ref|XP_006477225.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X5 [Citrus sinensis]
Length=747

 Score =   236 bits (602),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+ + K KD +   DASLLWK NK P NLTRYN++SFAITLNELTPGL
Sbjct  589  FGKWDDSMYYISGDGSGKLKDGNVSPDASLLWKRNKAPLNLTRYNLTSFAITLNELTPGL  648

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF REGE
Sbjct  649  QIKEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRREGE  708

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +G+FRYVGGYWE RE  KWD CPNIFG+  + + NS
Sbjct  709  NGSFRYVGGYWEAREQLKWDECPNIFGEFCEDVHNS  744



>ref|XP_006477221.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Citrus sinensis]
Length=768

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+ + K KD +   DASLLWK NK P NLTRYN++SFAITLNELTPGL
Sbjct  610  FGKWDDSMYYISGDGSGKLKDGNVSPDASLLWKRNKAPLNLTRYNLTSFAITLNELTPGL  669

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF REGE
Sbjct  670  QIKEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRREGE  729

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +G+FRYVGGYWE RE  KWD CPNIFG+  + + NS
Sbjct  730  NGSFRYVGGYWEAREQLKWDECPNIFGEFCEDVHNS  765



>ref|XP_010258993.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Nelumbo nucifera]
Length=760

 Score =   236 bits (601),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y++G+  +K +     S ASLLWKS+KPP NLTRYN++SFAITLNELTPGL
Sbjct  608  FGKWDDSMHYISGDGVAKSRSSNLPSGASLLWKSSKPPPNLTRYNLTSFAITLNELTPGL  667

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGE+++ANAEKLRLE RQRMSRKLQENGWKPRWFE++GE+G
Sbjct  668  QEKLPPTDSRLRPDQRHLENGEFERANAEKLRLEQRQRMSRKLQENGWKPRWFEKDGENG  727

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            ++RYVGGYWE RE  +WDGCP+IFG+  + +
Sbjct  728  SYRYVGGYWEAREQRRWDGCPDIFGEFKEGM  758



>ref|XP_006440340.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
 gb|ESR53580.1| hypothetical protein CICLE_v10018970mg [Citrus clementina]
Length=764

 Score =   234 bits (597),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD S+YY++G+ + K KD +   DASLLWKSNK P NLTRYN++SFAITLNELTPGL
Sbjct  608  FGKWDNSMYYISGDGSGKLKDGNVSPDASLLWKSNKAPLNLTRYNLTSFAITLNELTPGL  667

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF  EGE+G
Sbjct  668  QEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFRGEGENG  727

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            +FRYVGGYWE R   KWD CPNIFG+  + + +S
Sbjct  728  SFRYVGGYWEARRQLKWDECPNIFGEFCEDVHSS  761



>ref|XP_007157338.1| hypothetical protein PHAVU_002G061800g [Phaseolus vulgaris]
 gb|ESW29332.1| hypothetical protein PHAVU_002G061800g [Phaseolus vulgaris]
Length=767

 Score =   234 bits (597),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS--DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWD+S+YY++G  N KPKD S  +ASLLWK +    NLTRYN++ FAITLNELTPGLK
Sbjct  611  FGKWDDSMYYMSGNVNVKPKDFSSPNASLLWKRSMSSPNLTRYNLTPFAITLNELTPGLK  670

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            E LPPTDSRLRPDQR LENGEYDKAN EK RLE RQRMSRK+QENGWKPRWF R+GE GT
Sbjct  671  ENLPPTDSRLRPDQRHLENGEYDKANLEKQRLEKRQRMSRKIQENGWKPRWFRRDGESGT  730

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRY+GGYWE RE G WDGCP+IF ++ +
Sbjct  731  FRYIGGYWEARELGSWDGCPDIFSEIKE  758



>ref|XP_010676158.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010676159.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=424

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            +G+WD+SIYY+ G+  +  K L+   DASL+WK  KP  NLTRYN++SFAITLNELTPGL
Sbjct  267  YGRWDDSIYYIKGDGKNNRKALNPSDDASLIWKRTKPTPNLTRYNLTSFAITLNELTPGL  326

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEYD+ANAEKLRLE RQRMSRKLQE+GW+P+WFE+EGEDG
Sbjct  327  EEKLPPTDSRLRPDQRHLENGEYDRANAEKLRLETRQRMSRKLQEDGWRPQWFEQEGEDG  386

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
             + Y GGYWE RE G WD CPNIFG++
Sbjct  387  PYHYKGGYWEAREQGNWDDCPNIFGEI  413



>ref|XP_010439327.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Camelina sativa]
 ref|XP_010439328.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Camelina sativa]
Length=510

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  356  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  415

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  416  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  475

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +G WD CP+IFG++ + L++S
Sbjct  476  TFKYTGGYWEARGHGNWDDCPDIFGEITEELVDS  509



>ref|XP_010676157.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=428

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            +G+WD+SIYY+ G+  +  K L+   DASL+WK  KP  NLTRYN++SFAITLNELTPGL
Sbjct  271  YGRWDDSIYYIKGDGKNNRKALNPSDDASLIWKRTKPTPNLTRYNLTSFAITLNELTPGL  330

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEYD+ANAEKLRLE RQRMSRKLQE+GW+P+WFE+EGEDG
Sbjct  331  EEKLPPTDSRLRPDQRHLENGEYDRANAEKLRLETRQRMSRKLQEDGWRPQWFEQEGEDG  390

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
             + Y GGYWE RE G WD CPNIFG++
Sbjct  391  PYHYKGGYWEAREQGNWDDCPNIFGEI  417



>ref|XP_010676156.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            +G+WD+SIYY+ G+  +  K L+   DASL+WK  KP  NLTRYN++SFAITLNELTPGL
Sbjct  354  YGRWDDSIYYIKGDGKNNRKALNPSDDASLIWKRTKPTPNLTRYNLTSFAITLNELTPGL  413

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEYD+ANAEKLRLE RQRMSRKLQE+GW+P+WFE+EGEDG
Sbjct  414  EEKLPPTDSRLRPDQRHLENGEYDRANAEKLRLETRQRMSRKLQEDGWRPQWFEQEGEDG  473

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
             + Y GGYWE RE G WD CPNIFG++
Sbjct  474  PYHYKGGYWEAREQGNWDDCPNIFGEI  500



>ref|XP_010434043.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Camelina sativa]
Length=510

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  356  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  415

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  416  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  475

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +G WD CP+IFG++ + L +S
Sbjct  476  TFKYTGGYWEARGHGNWDDCPDIFGEITEELADS  509



>ref|XP_010448880.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Camelina sativa]
Length=374

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  220  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNITRYNLTSFAITLNELTPGL  279

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  280  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  339

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG++ + L +S
Sbjct  340  TFKYTGGYWEARGHRNWDDCPDIFGEITEELADS  373



>ref|XP_002529779.1| Oxysterol-binding protein, putative [Ricinus communis]
 gb|EEF32593.1| Oxysterol-binding protein, putative [Ricinus communis]
Length=563

 Score =   226 bits (576),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY  G+ +SK KD S   +A+LLW+S KPP NLTRYN++SFAITLNELTPGL
Sbjct  382  FGKWDDSMYYTKGDGSSKTKDCSSSPNATLLWRSTKPPPNLTRYNLTSFAITLNELTPGL  441

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQR+SRKLQE+GWKPRWF+REGEDG
Sbjct  442  QEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLEKRQRLSRKLQEHGWKPRWFQREGEDG  501

Query  353  TFRYVGGYWETRENGKWDGCPNIF  424
             F Y GGYWE RE   W+ CP+IF
Sbjct  502  AFCYGGGYWEAREQRNWEECPDIF  525



>ref|XP_010439326.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Camelina sativa]
Length=743

 Score =   229 bits (584),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  589  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  648

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  649  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  708

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +G WD CP+IFG++ + L++S
Sbjct  709  TFKYTGGYWEARGHGNWDDCPDIFGEITEELVDS  742



>ref|XP_010439325.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Camelina sativa]
Length=744

 Score =   229 bits (584),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  590  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  649

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  650  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  709

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +G WD CP+IFG++ + L++S
Sbjct  710  TFKYTGGYWEARGHGNWDDCPDIFGEITEELVDS  743



>gb|EPS74065.1| hypothetical protein M569_00684, partial [Genlisea aurea]
Length=731

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKWD+S+Y+  G+ +   KD  +  LLWK NKPP NLTRYN++SFAITLNELTPGL+EK
Sbjct  589  FGKWDDSMYFAYGDGSCDAKD-EEKFLLWKRNKPPVNLTRYNLTSFAITLNELTPGLEEK  647

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENG +D+ANAEKLRLEMRQRMSRKLQENGWKPRWF ++GE+G +R
Sbjct  648  LPPTDSRLRPDQRHLENGAFDRANAEKLRLEMRQRMSRKLQENGWKPRWFRQDGEEGPYR  707

Query  362  YVGGYWETRENGKWDGCPNIFGQV  433
            Y GGYWE RE   WDGCP+IFG+V
Sbjct  708  YAGGYWEARERRDWDGCPDIFGEV  731



>ref|XP_010448876.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Camelina sativa]
 ref|XP_010448877.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Camelina sativa]
 ref|XP_010448879.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Camelina sativa]
Length=510

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  356  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNITRYNLTSFAITLNELTPGL  415

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  416  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  475

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG++ + L +S
Sbjct  476  TFKYTGGYWEARGHRNWDDCPDIFGEITEELADS  509



>ref|XP_010676155.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=774

 Score =   228 bits (582),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            +G+WD+SIYY+ G+  +  K L+   DASL+WK  KP  NLTRYN++SFAITLNELTPGL
Sbjct  617  YGRWDDSIYYIKGDGKNNRKALNPSDDASLIWKRTKPTPNLTRYNLTSFAITLNELTPGL  676

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEYD+ANAEKLRLE RQRMSRKLQE+GW+P+WFE+EGEDG
Sbjct  677  EEKLPPTDSRLRPDQRHLENGEYDRANAEKLRLETRQRMSRKLQEDGWRPQWFEQEGEDG  736

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
             + Y GGYWE RE G WD CPNIFG++
Sbjct  737  PYHYKGGYWEAREQGNWDDCPNIFGEI  763



>ref|XP_006413649.1| hypothetical protein EUTSA_v10024514mg [Eutrema salsugineum]
 gb|ESQ55102.1| hypothetical protein EUTSA_v10024514mg [Eutrema salsugineum]
Length=374

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  220  FGKWDDSLYYVAGDGVSKTKVSDPSSNASLLWKRTKPPHNVTRYNLTSFAITLNELTPGL  279

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE  
Sbjct  280  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGESE  339

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L++S
Sbjct  340  TFKYTGGYWEARGHRNWDDCPDIFGEFKEELVDS  373



>ref|XP_010434040.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Camelina sativa]
 ref|XP_010434041.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Camelina sativa]
Length=743

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  589  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  648

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  649  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  708

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +G WD CP+IFG++ + L +S
Sbjct  709  TFKYTGGYWEARGHGNWDDCPDIFGEITEELADS  742



>ref|XP_010434042.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Camelina sativa]
Length=742

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  588  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  647

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  648  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  707

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +G WD CP+IFG++ + L +S
Sbjct  708  TFKYTGGYWEARGHGNWDDCPDIFGEITEELADS  741



>ref|XP_008448874.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Cucumis melo]
Length=529

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDE +YY+ GE N   K     SD  +LWKS KP  +LTRYN++SFAITLNELTP L
Sbjct  376  FGKWDEGMYYMEGEINGNRKRNSPPSDEFMLWKSEKPAPDLTRYNLTSFAITLNELTPDL  435

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE+LPPTDSRLRPDQR LENGEY+KAN EK RLE RQR+SRKLQ+NGWKPRWF REGEDG
Sbjct  436  KERLPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRISRKLQDNGWKPRWFCREGEDG  495

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
             +RY+GGYWE RE G WD CP++FG+++++++
Sbjct  496  PYRYMGGYWEAREEGNWDNCPDVFGELNESMV  527



>ref|XP_004972815.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Setaria italica]
Length=730

 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGE-WNSKPKD-LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
             GKWDES+YY N + +  +  D L  ASLLW+ NKP  N TRYN+SSFA+TLNELTPGL+
Sbjct  582  IGKWDESMYYSNSDTFKVRSADQLKGASLLWEKNKPAPNPTRYNLSSFAVTLNELTPGLQ  641

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMS KLQ+NGWKP+WFE++ EDGT
Sbjct  642  EKLPPTDSRLRPDQRHLENGEYEKANAEKLRLERRQRMSTKLQDNGWKPQWFEQDSEDGT  701

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            +RY GGYWETRE G+WDGCP+IFG+  +T
Sbjct  702  YRYKGGYWETREKGRWDGCPDIFGEFTET  730



>gb|KGN55890.1| hypothetical protein Csa_3G027730 [Cucumis sativus]
Length=754

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDE +YY+ GE N  PK     SD  +LWKS KPP +LTRYN++SFAITLNELTP L
Sbjct  601  FGKWDEGMYYVEGEKNWNPKRNRPPSDELMLWKSEKPPPDLTRYNLTSFAITLNELTPDL  660

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE+LPPTDSRLRPDQR LENGEY+KAN EK RLE RQR+SRKLQ+NGWKPRWF REGEDG
Sbjct  661  KERLPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRISRKLQDNGWKPRWFCREGEDG  720

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
             +RY+GGYWE R+ G WD CP++FG+++++++
Sbjct  721  PYRYMGGYWEARKEGNWDSCPDVFGELNESMV  752



>ref|XP_006413650.1| hypothetical protein EUTSA_v10024514mg [Eutrema salsugineum]
 gb|ESQ55103.1| hypothetical protein EUTSA_v10024514mg [Eutrema salsugineum]
Length=519

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  365  FGKWDDSLYYVAGDGVSKTKVSDPSSNASLLWKRTKPPHNVTRYNLTSFAITLNELTPGL  424

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE  
Sbjct  425  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGESE  484

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L++S
Sbjct  485  TFKYTGGYWEARGHRNWDDCPDIFGEFKEELVDS  518



>ref|XP_004163646.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Cucumis sativus]
Length=726

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDE +YY+ GE N  PK     SD  +LWKS KPP +LTRYN++SFAITLNELTP L
Sbjct  573  FGKWDEGMYYVEGEKNWNPKRNRPPSDELMLWKSEKPPPDLTRYNLTSFAITLNELTPDL  632

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE+LPPTDSRLRPDQR LENGEY+KAN EK RLE RQR+SRKLQ+NGWKPRWF REGEDG
Sbjct  633  KERLPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRISRKLQDNGWKPRWFCREGEDG  692

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
             +RY+GGYWE R+ G WD CP++FG+++++++
Sbjct  693  PYRYMGGYWEARKEGNWDSCPDVFGELNESMV  724



>ref|XP_004150860.1| PREDICTED: LOW QUALITY PROTEIN: oxysterol-binding protein-related 
protein 2A-like [Cucumis sativus]
Length=728

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDE +YY+ GE N  PK     SD  +LWKS KPP +LTRYN++SFAITLNELTP L
Sbjct  575  FGKWDEGMYYVEGEKNWNPKRNRPPSDELMLWKSEKPPPDLTRYNLTSFAITLNELTPDL  634

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE+LPPTDSRLRPDQR LENGEY+KAN EK RLE RQR+SRKLQ+NGWKPRWF REGEDG
Sbjct  635  KERLPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRISRKLQDNGWKPRWFCREGEDG  694

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
             +RY+GGYWE R+ G WD CP++FG+++++++
Sbjct  695  PYRYMGGYWEARKEGNWDSCPDVFGELNESMV  726



>ref|NP_001065340.2| Os10g0554100 [Oryza sativa Japonica Group]
 dbj|BAF27177.2| Os10g0554100 [Oryza sativa Japonica Group]
Length=326

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 122/156 (78%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES+  + G+  SK         + A+LLW+ N PP N TRYN+SSFAITLNELTP
Sbjct  168  MGKWDESMSCIIGDDASKVNSRNANQSTGATLLWEKNVPPANPTRYNLSSFAITLNELTP  227

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
            GLKEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQRM+RK+QE+GWKPRWF+R+ E
Sbjct  228  GLKEKLPPTDSRLRPDQRHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTE  287

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            DGTFRYVGGYWE RE  KW GC +IFG    TL  S
Sbjct  288  DGTFRYVGGYWEAREQRKWVGCNDIFGNNVSTLCTS  323



>ref|XP_009135978.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X3 [Brassica rapa]
Length=510

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 3/146 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLW+  KPP N+TRYN++SFAITLNELTPGL
Sbjct  355  FGKWDDSLYYVAGDGVSKTKVSDPASNASLLWRRTKPPLNVTRYNLTSFAITLNELTPGL  414

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE+ 
Sbjct  415  KEMLPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGENE  474

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQ  430
            TF+Y GGYWE R + KWD CPNIFG+
Sbjct  475  TFKYTGGYWEARGHRKWDDCPNIFGE  500



>ref|XP_010448881.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X3 [Camelina sativa]
Length=742

 Score =   224 bits (571),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  588  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTKPPPNITRYNLTSFAITLNELTPGL  647

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  648  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  707

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG++ + L +S
Sbjct  708  TFKYTGGYWEARGHRNWDDCPDIFGEITEELADS  741



>ref|XP_008782271.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X3 [Phoenix dactylifera]
Length=404

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES+++++G+   K K    LS+A +LW  +KPP+N TRYN++ FAITLNELTPGL
Sbjct  251  VGKWDESMHFVHGDCLGKGKGSEPLSEAHILWNRSKPPKNPTRYNLTRFAITLNELTPGL  310

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  311  KEKLPPTDSRLRPDQRCLENGEYEKANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGSD  370

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTLI  448
             +RY+GGYWE RE GKWDGCP+IFGQ+  DQ + 
Sbjct  371  AYRYIGGYWEAREKGKWDGCPDIFGQIPSDQIIC  404



>dbj|BAD95307.1| hypothetical protein [Arabidopsis thaliana]
Length=404

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  +K K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  250  FGKWDDSLYYVAGDGINKSKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  309

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFER+GE  
Sbjct  310  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFERQGESD  369

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L ++
Sbjct  370  TFKYTGGYWEARGHRNWDDCPDIFGEFTEELADA  403



>ref|NP_001170325.1| uncharacterized protein LOC100384294 [Zea mays]
 gb|ACN36619.1| unknown [Zea mays]
 gb|AFW87904.1| putative oxysterol binding domain family protein [Zea mays]
Length=277

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 5/152 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES++Y+     SK       + S A+LLW+ N+PP N TRYN+S+FAITLNELTP
Sbjct  112  MGKWDESMHYIINNDASKTNSHGSHEGSGATLLWEKNEPPVNPTRYNLSTFAITLNELTP  171

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
             LKEKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRM+RK+QE+GWKPRWF+R+ E
Sbjct  172  ELKEKLPPTDSRLRPDQRHLENGEYEKANAEKLRLETRQRMARKMQESGWKPRWFQRDSE  231

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            DGT+RYVGGYWE RE   W GC +IFG +  +
Sbjct  232  DGTYRYVGGYWEAREQRTWVGCNDIFGNLSSS  263



>ref|XP_006286273.1| hypothetical protein CARUB_v10007850mg [Capsella rubella]
 gb|EOA19171.1| hypothetical protein CARUB_v10007850mg [Capsella rubella]
Length=704

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY++G+  SK K     S+ASLLWK  +PP N+TRYN++SFAITLNELTPGL
Sbjct  550  FGKWDDSLYYVSGDGISKTKVSDPASNASLLWKRTRPPPNVTRYNLTSFAITLNELTPGL  609

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFEREGE  
Sbjct  610  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEREGESE  669

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L++S
Sbjct  670  TFKYTGGYWEARGHRNWDDCPDIFGEFTEELVDS  703



>ref|XP_008448873.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Cucumis melo]
Length=754

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDE +YY+ GE N   K     SD  +LWKS KP  +LTRYN++SFAITLNELTP L
Sbjct  601  FGKWDEGMYYMEGEINGNRKRNSPPSDEFMLWKSEKPAPDLTRYNLTSFAITLNELTPDL  660

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE+LPPTDSRLRPDQR LENGEY+KAN EK RLE RQR+SRKLQ+NGWKPRWF REGEDG
Sbjct  661  KERLPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRISRKLQDNGWKPRWFCREGEDG  720

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
             +RY+GGYWE RE G WD CP++FG+++++++
Sbjct  721  PYRYMGGYWEAREEGNWDNCPDVFGELNESMV  752



>ref|NP_974592.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
 ref|NP_001031698.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
 ref|NP_001190800.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
 dbj|BAF01642.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84619.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
 gb|AEE84621.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
 gb|AEE84622.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
Length=510

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  +K K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  356  FGKWDDSLYYVAGDGINKSKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  415

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFER+GE  
Sbjct  416  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFERQGESD  475

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L ++
Sbjct  476  TFKYTGGYWEARGHRNWDDCPDIFGEFTEELADA  509



>ref|XP_006413648.1| hypothetical protein EUTSA_v10024514mg [Eutrema salsugineum]
 gb|ESQ55101.1| hypothetical protein EUTSA_v10024514mg [Eutrema salsugineum]
Length=735

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  581  FGKWDDSLYYVAGDGVSKTKVSDPSSNASLLWKRTKPPHNVTRYNLTSFAITLNELTPGL  640

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE  
Sbjct  641  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGESE  700

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L++S
Sbjct  701  TFKYTGGYWEARGHRNWDDCPDIFGEFKEELVDS  734



>ref|XP_007137366.1| hypothetical protein PHAVU_009G121300g [Phaseolus vulgaris]
 gb|ESW09360.1| hypothetical protein PHAVU_009G121300g [Phaseolus vulgaris]
Length=785

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LSDA LLWK +K P+  TRYN + FAITLNELTPGL
Sbjct  626  FGKWDESMHYVNGDYTGKGKGHESLSDAHLLWKRSKAPKIPTRYNFTRFAITLNELTPGL  685

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN+EKLRLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  686  KEKLPPTDSRLRPDQRYLENGEYDMANSEKLRLEQRQRQARKMQESGWKPRWFAKDKTSG  745

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE R+ G WD CP+IFGQ+
Sbjct  746  TYRYVGGYWEARQRGNWDSCPDIFGQI  772



>gb|KDO80772.1| hypothetical protein CISIN_1g0036641mg, partial [Citrus sinensis]
 gb|KDO80773.1| hypothetical protein CISIN_1g0036641mg, partial [Citrus sinensis]
Length=507

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+Y+ GE + K K+L   S+A LLWK +KPP+  TRYN + FAITLNE+TPGL
Sbjct  354  FGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPKYPTRYNFTRFAITLNEVTPGL  413

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QENGWKPRWF ++   G
Sbjct  414  KEKLPPTDSRLRPDQRCLENGEYEMANSEKLRLEQRQRQARKMQENGWKPRWFAKDRATG  473

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE G W+ CP+IFG +  DQ L
Sbjct  474  TYRYIGGYWEARETGDWNLCPDIFGHIPSDQML  506



>ref|XP_008801048.1| PREDICTED: oxysterol-binding protein-related protein 1B-like 
isoform X2 [Phoenix dactylifera]
Length=591

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+ + K K    LS+A +LWK  KPP+N TRYN++ FAITLNELTPGL
Sbjct  438  FGKWDESMHFVHGDCSGKGKGSELLSEACVLWKCAKPPKNPTRYNLTRFAITLNELTPGL  497

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  498  KEMLPPTDSRLRPDQRCLENGEYEMANAEKLRLEHRQRQARKMQESGWKPRWFAKDKGSD  557

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE G WDGCP+IFGQ+  DQ +
Sbjct  558  TYRYIGGYWEAREKGNWDGCPDIFGQIPSDQII  590



>ref|XP_009135969.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X1 [Brassica rapa]
Length=728

 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 3/146 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLW+  KPP N+TRYN++SFAITLNELTPGL
Sbjct  573  FGKWDDSLYYVAGDGVSKTKVSDPASNASLLWRRTKPPLNVTRYNLTSFAITLNELTPGL  632

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE+ 
Sbjct  633  KEMLPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGENE  692

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQ  430
            TF+Y GGYWE R + KWD CPNIFG+
Sbjct  693  TFKYTGGYWEARGHRKWDDCPNIFGE  718



>gb|KDO80774.1| hypothetical protein CISIN_1g0036641mg, partial [Citrus sinensis]
Length=494

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+Y+ GE + K K+L   S+A LLWK +KPP+  TRYN + FAITLNE+TPGL
Sbjct  341  FGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPKYPTRYNFTRFAITLNEVTPGL  400

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QENGWKPRWF ++   G
Sbjct  401  KEKLPPTDSRLRPDQRCLENGEYEMANSEKLRLEQRQRQARKMQENGWKPRWFAKDRATG  460

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE G W+ CP+IFG +  DQ L
Sbjct  461  TYRYIGGYWEARETGDWNLCPDIFGHIPSDQML  493



>ref|XP_009135974.1| PREDICTED: oxysterol-binding protein-related protein 2A isoform 
X2 [Brassica rapa]
Length=727

 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLW+  KPP N+TRYN++SFAITLNELTPGL
Sbjct  572  FGKWDDSLYYVAGDGVSKTKVSDPASNASLLWRRTKPPLNVTRYNLTSFAITLNELTPGL  631

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE+ 
Sbjct  632  KEMLPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGENE  691

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            TF+Y GGYWE R + KWD CPNIFG+  +
Sbjct  692  TFKYTGGYWEARGHRKWDDCPNIFGEFTE  720



>emb|CDX79161.1| BnaA01g12280D [Brassica napus]
Length=727

 Score =   221 bits (564),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLW+  KPP N+TRYN++SFAITLNELTPGL
Sbjct  572  FGKWDDSLYYVAGDGVSKTKVSDPASNASLLWRRTKPPLNVTRYNLTSFAITLNELTPGL  631

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE+ 
Sbjct  632  KEMLPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGENE  691

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            TF+Y GGYWE R + KWD CPNIFG+  +
Sbjct  692  TFKYTGGYWEARGHRKWDDCPNIFGEFTE  720



>gb|KHN09173.1| Oxysterol-binding protein-related protein 1C [Glycine soja]
Length=674

 Score =   220 bits (561),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LSDA LLWK ++ P+  TRYN + FAITLNELTPGL
Sbjct  515  FGKWDESMHYVNGDYTGKGKGHESLSDARLLWKRSRAPKFPTRYNFTRFAITLNELTPGL  574

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD ANAEKLRLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  575  KEKLPPTDSRLRPDQRYLENGEYDMANAEKLRLEQRQRQARKMQESGWKPRWFAKDKASG  634

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            ++RY+GGYWE R+ G WD CP+IFGQ+    I+
Sbjct  635  SYRYLGGYWEARQRGNWDSCPDIFGQIPSVHIS  667



>ref|XP_008782270.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Phoenix dactylifera]
Length=519

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES+++++G+   K K    LS+A +LW  +KPP+N TRYN++ FAITLNELTPGL
Sbjct  366  VGKWDESMHFVHGDCLGKGKGSEPLSEAHILWNRSKPPKNPTRYNLTRFAITLNELTPGL  425

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  426  KEKLPPTDSRLRPDQRCLENGEYEKANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGSD  485

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTLI  448
             +RY+GGYWE RE GKWDGCP+IFGQ+  DQ + 
Sbjct  486  AYRYIGGYWEAREKGKWDGCPDIFGQIPSDQIIC  519



>emb|CDX82950.1| BnaC01g14000D [Brassica napus]
Length=727

 Score =   221 bits (563),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLW+  KPP N+TRYN++SFAITLNELTPGL
Sbjct  572  FGKWDDSLYYVAGDGVSKTKVSDPASNASLLWRRTKPPPNVTRYNLTSFAITLNELTPGL  631

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFE++GE+ 
Sbjct  632  KEMLPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFEKQGENE  691

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            TF+Y GGYWE R + KWD CPNIFG+  +
Sbjct  692  TFKYTGGYWEARGHRKWDDCPNIFGEFTE  720



>gb|AFW61213.1| putative oxysterol binding domain family protein [Zea mays]
Length=263

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             G WDESIY  N +  SK K    L  ASLLW+ NKP  N TRYN+SSFAITLNELTPGL
Sbjct  115  IGMWDESIYCSNSD-TSKVKSADQLKGASLLWEKNKPAPNPTRYNLSSFAITLNELTPGL  173

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMS KLQ+NGWK RWFE++ EDG
Sbjct  174  QEKLPPTDSRLRPDQRHLENGEYEKANAEKLRLERRQRMSTKLQDNGWKSRWFEQDTEDG  233

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            T+ Y GGYWETRE G WDGC +IFG+  +T
Sbjct  234  TYCYKGGYWETRERGFWDGCLDIFGEFVET  263



>ref|XP_006650469.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Oryza brachyantha]
Length=583

 Score =   219 bits (557),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   +LS+A LLWK ++PP+  TRYN + FAITLNELTPGL
Sbjct  429  FGKWDESMHYVMGDCFGKGKGSENLSEAHLLWKRSRPPKFPTRYNFTRFAITLNELTPGL  488

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  489  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  548

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE G W+GCP+IFGQV   L+
Sbjct  549  TYRYIGGYWESREKGSWEGCPDIFGQVPNDLM  580



>ref|XP_003559029.1| PREDICTED: oxysterol-binding protein-related protein 1B-like 
[Brachypodium distachyon]
Length=728

 Score =   221 bits (562),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  5    GKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEKL  184
            GKWDES+YY   +        + A+LLW+ N+PP N TRYN+SSFAITLNELTP LKEKL
Sbjct  575  GKWDESMYYTVTQDIPGVNSSAGATLLWEKNEPPSNPTRYNLSSFAITLNELTPNLKEKL  634

Query  185  PPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFRY  364
            PPTDSRLRPDQR LENGEYDKAN+EKLRLE RQRM+RK+Q+NGWKPRWF+R+ EDGTFRY
Sbjct  635  PPTDSRLRPDQRHLENGEYDKANSEKLRLETRQRMARKMQDNGWKPRWFDRDAEDGTFRY  694

Query  365  VGGYWETRENGKWDGCPNIFGQV  433
             GGYW+ RE G WDGC +IFG++
Sbjct  695  TGGYWDAREEGTWDGCRDIFGEL  717



>ref|XP_011074874.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Sesamum indicum]
Length=794

 Score =   221 bits (564),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+ +SK K    LS+A LLWK +KPP+  TRYN + FAITLNEL PGL
Sbjct  640  FGKWDESMHYVNGDCSSKGKGHESLSEAHLLWKRSKPPKFPTRYNFTRFAITLNELIPGL  699

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  700  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGSD  759

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE R+ GKWD CP+IFGQ+
Sbjct  760  TYRYVGGYWEARKEGKWDACPDIFGQI  786



>ref|XP_007018961.1| OSBP(oxysterol binding protein)-related protein 1C isoform 2 
[Theobroma cacao]
 gb|EOY16186.1| OSBP(oxysterol binding protein)-related protein 1C isoform 2 
[Theobroma cacao]
Length=822

 Score =   221 bits (564),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+ ++K K    LS++ LLWK +KPP+  TRYN++ FAITLNELTPGL
Sbjct  669  FGKWDESMHYVNGDCSAKGKGQESLSESRLLWKRSKPPKYATRYNLTRFAITLNELTPGL  728

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  729  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  788

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE GKWD CP+IFGQ+  DQ L
Sbjct  789  TYRYIGGYWEAREQGKWDSCPDIFGQIPSDQLL  821



>ref|XP_007018960.1| OSBP(oxysterol binding protein)-related protein 1C isoform 1 
[Theobroma cacao]
 gb|EOY16185.1| OSBP(oxysterol binding protein)-related protein 1C isoform 1 
[Theobroma cacao]
Length=823

 Score =   221 bits (564),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+ ++K K    LS++ LLWK +KPP+  TRYN++ FAITLNELTPGL
Sbjct  670  FGKWDESMHYVNGDCSAKGKGQESLSESRLLWKRSKPPKYATRYNLTRFAITLNELTPGL  729

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  730  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  789

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE GKWD CP+IFGQ+  DQ L
Sbjct  790  TYRYIGGYWEAREQGKWDSCPDIFGQIPSDQLL  822



>gb|ABR16670.1| unknown [Picea sitchensis]
Length=785

 Score =   221 bits (563),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 3/151 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+YY+N +  SK K     S+A LLW+ NKPP+N TRYN++ FAITLNELTPGL
Sbjct  632  FGKWDESLYYINDDAASKSKGDDPSSEAVLLWERNKPPKNPTRYNLTRFAITLNELTPGL  691

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN EKLRLE RQR +RKLQE GW+P+WF +E  + 
Sbjct  692  KEKLPPTDSRLRPDQRHLENGEYDLANVEKLRLEQRQRQARKLQETGWQPQWFHKEKGND  751

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            T++Y+GGYWETRE  KWD CP+IFGQ++  +
Sbjct  752  TYQYIGGYWETREQSKWDSCPDIFGQINSDI  782



>ref|XP_010916543.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X4 [Elaeis guineensis]
Length=707

 Score =   220 bits (561),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+ + K K    LS+A +LWK  KPP+N TRYN++ FAIT+NELTPGL
Sbjct  554  FGKWDESMHFVHGDCSGKGKGSEPLSEACILWKCGKPPKNPTRYNLTRFAITVNELTPGL  613

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  614  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQERGWKPRWFAKDRGSD  673

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE +E G WDGCP+IFGQ+  DQ +
Sbjct  674  TYRYIGGYWEAKEKGNWDGCPDIFGQIPGDQII  706



>ref|XP_010529488.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Tarenaya hassleriana]
Length=732

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 124/152 (82%), Gaps = 5/152 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDA----SLLWKSNKPPQNLTRYNMSSFAITLNELTPG  169
            FGKWD+SIYY  G+  SK K ++D     SLLWK  KPP NLTRYN++SFAITLNELTPG
Sbjct  582  FGKWDDSIYYAVGDGISKTK-VADPTVNDSLLWKRTKPPPNLTRYNLTSFAITLNELTPG  640

Query  170  LKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGED  349
            L+EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GW+PRWFER+GE+
Sbjct  641  LQEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLERRQRMSRKLQESGWRPRWFERDGEN  700

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            GTF+Y GGYWE R+   W  CP+IFG+  + L
Sbjct  701  GTFKYTGGYWEARKQRSWVNCPDIFGEFTEEL  732



>gb|ACF22755.1| oxysterol-binding protein [Brachypodium distachyon]
Length=751

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  5    GKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEKL  184
            GKWDES+YY   +        + A+LLW+ N+PP N TRYN+SSFAITLNELTP LKEKL
Sbjct  598  GKWDESMYYTVTQDIPGVNSSAGATLLWEKNEPPSNPTRYNLSSFAITLNELTPNLKEKL  657

Query  185  PPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFRY  364
            PPTDSRLRPDQR LENGEYDKAN+EKLRLE RQRM+RK+Q+NGWKPRWF+R+ EDGTFRY
Sbjct  658  PPTDSRLRPDQRHLENGEYDKANSEKLRLETRQRMARKMQDNGWKPRWFDRDAEDGTFRY  717

Query  365  VGGYWETRENGKWDGCPNIFGQV  433
             GGYW+ RE G WDGC +IFG++
Sbjct  718  TGGYWDAREEGTWDGCRDIFGEL  740



>ref|XP_010529487.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Tarenaya hassleriana]
Length=733

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 124/152 (82%), Gaps = 5/152 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDA----SLLWKSNKPPQNLTRYNMSSFAITLNELTPG  169
            FGKWD+SIYY  G+  SK K ++D     SLLWK  KPP NLTRYN++SFAITLNELTPG
Sbjct  583  FGKWDDSIYYAVGDGISKTK-VADPTVNDSLLWKRTKPPPNLTRYNLTSFAITLNELTPG  641

Query  170  LKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGED  349
            L+EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GW+PRWFER+GE+
Sbjct  642  LQEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLERRQRMSRKLQESGWRPRWFERDGEN  701

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            GTF+Y GGYWE R+   W  CP+IFG+  + L
Sbjct  702  GTFKYTGGYWEARKQRSWVNCPDIFGEFTEEL  733



>ref|XP_008782269.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Phoenix dactylifera]
Length=591

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES+++++G+   K K    LS+A +LW  +KPP+N TRYN++ FAITLNELTPGL
Sbjct  438  VGKWDESMHFVHGDCLGKGKGSEPLSEAHILWNRSKPPKNPTRYNLTRFAITLNELTPGL  497

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  498  KEKLPPTDSRLRPDQRCLENGEYEKANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGSD  557

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTLI  448
             +RY+GGYWE RE GKWDGCP+IFGQ+  DQ + 
Sbjct  558  AYRYIGGYWEAREKGKWDGCPDIFGQIPSDQIIC  591



>ref|XP_002867764.1| oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44023.1| oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata]
Length=721

 Score =   220 bits (561),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  SK K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  567  FGKWDDSLYYVAGDGISKSKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  626

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFER+GE  
Sbjct  627  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFERQGESE  686

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L +S
Sbjct  687  TFKYTGGYWEARGHRNWDDCPDIFGEFTEELADS  720



>ref|XP_010926457.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Elaeis guineensis]
Length=879

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+   K K    LS+A +LW  +KPP+N TRYN++ FAITLNELTPGL
Sbjct  726  FGKWDESMHFVHGDCLGKGKGSEPLSEAHILWNRSKPPKNPTRYNLTRFAITLNELTPGL  785

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  786  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGSD  845

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE GKWDGCP+IFGQ+  DQ L
Sbjct  846  TYRYIGGYWEARERGKWDGCPDIFGQIPSDQIL  878



>ref|NP_001236590.1| oxysterol-binding protein [Glycine max]
 dbj|BAF96543.1| oxysterol-binding protein [Glycine max]
Length=789

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LSDA LLWK ++ P+  TRYN + FAITLNELTPGL
Sbjct  630  FGKWDESMHYVNGDYTGKGKGHESLSDARLLWKRSRAPKFPTRYNFTRFAITLNELTPGL  689

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD ANAEKLRLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  690  KEKLPPTDSRLRPDQRYLENGEYDMANAEKLRLEQRQRQARKMQESGWKPRWFAKDKASG  749

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            ++RY+GGYWE R+ G WD CP+IFGQ+    I+
Sbjct  750  SYRYLGGYWEARQRGNWDSCPDIFGQIPSVHIS  782



>ref|XP_006580908.1| PREDICTED: oxysterol-binding protein isoform X1 [Glycine max]
Length=788

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LSDA LLWK ++ P+  TRYN + FAITLNELTPGL
Sbjct  629  FGKWDESMHYVNGDYTGKGKGHESLSDARLLWKRSRAPKFPTRYNFTRFAITLNELTPGL  688

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD ANAEKLRLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  689  KEKLPPTDSRLRPDQRYLENGEYDMANAEKLRLEQRQRQARKMQESGWKPRWFAKDKASG  748

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            ++RY+GGYWE R+ G WD CP+IFGQ+    I+
Sbjct  749  SYRYLGGYWEARQRGNWDSCPDIFGQIPSVHIS  781



>ref|XP_010926456.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Elaeis guineensis]
Length=907

 Score =   221 bits (563),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+   K K    LS+A +LW  +KPP+N TRYN++ FAITLNELTPGL
Sbjct  754  FGKWDESMHFVHGDCLGKGKGSEPLSEAHILWNRSKPPKNPTRYNLTRFAITLNELTPGL  813

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  814  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGSD  873

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE GKWDGCP+IFGQ+  DQ L
Sbjct  874  TYRYIGGYWEARERGKWDGCPDIFGQIPSDQIL  906



>ref|XP_008465816.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Cucumis melo]
Length=828

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+Y+NG+ + K K    LS++ LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  658  FGKWDESIHYMNGDCSHKGKGLDSLSESHLLWKRSKPPKFSTRYNFTRFAITLNELTPGL  717

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  718  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  777

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE RE GKWD CP+IFGQ+
Sbjct  778  TYRYVGGYWEAREQGKWDSCPDIFGQI  804



>ref|XP_008465817.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Cucumis melo]
Length=817

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+Y+NG+ + K K    LS++ LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  658  FGKWDESIHYMNGDCSHKGKGLDSLSESHLLWKRSKPPKFSTRYNFTRFAITLNELTPGL  717

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  718  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  777

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE RE GKWD CP+IFGQ+
Sbjct  778  TYRYVGGYWEAREQGKWDSCPDIFGQI  804



>ref|NP_001173604.1| Os03g0704700 [Oryza sativa Japonica Group]
 gb|ABF98450.1| Oxysterol-binding protein, expressed [Oryza sativa Japonica Group]
 dbj|BAH92332.1| Os03g0704700 [Oryza sativa Japonica Group]
Length=412

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN + FAITLNELT GL
Sbjct  258  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFAITLNELTAGL  317

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  318  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  377

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE G W+GCP+IFGQV   L+
Sbjct  378  TYRYLGGYWESREKGSWEGCPDIFGQVPNDLM  409



>ref|XP_011097690.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Sesamum indicum]
Length=593

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+YY +G+ +SK K     SDA LLWK +KPP+  TRYN++ FAITLNEL PGL
Sbjct  440  FGKWDESMYYSSGDCSSKRKGHESPSDAHLLWKRSKPPKFPTRYNLTRFAITLNELIPGL  499

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +R +QE GWKP+WF ++   G
Sbjct  500  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARMMQERGWKPQWFAKDEASG  559

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE+G W+ CPNIFGQ+
Sbjct  560  TYRYIGGYWEAREHGNWESCPNIFGQI  586



>ref|XP_010916541.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Elaeis guineensis]
Length=806

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+ + K K    LS+A +LWK  KPP+N TRYN++ FAIT+NELTPGL
Sbjct  653  FGKWDESMHFVHGDCSGKGKGSEPLSEACILWKCGKPPKNPTRYNLTRFAITVNELTPGL  712

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  713  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQERGWKPRWFAKDRGSD  772

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE +E G WDGCP+IFGQ+  DQ +
Sbjct  773  TYRYIGGYWEAKEKGNWDGCPDIFGQIPGDQII  805



>ref|XP_008801047.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Phoenix dactylifera]
Length=816

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+ + K K    LS+A +LWK  KPP+N TRYN++ FAITLNELTPGL
Sbjct  663  FGKWDESMHFVHGDCSGKGKGSELLSEACVLWKCAKPPKNPTRYNLTRFAITLNELTPGL  722

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  723  KEMLPPTDSRLRPDQRCLENGEYEMANAEKLRLEHRQRQARKMQESGWKPRWFAKDKGSD  782

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE G WDGCP+IFGQ+  DQ +
Sbjct  783  TYRYIGGYWEAREKGNWDGCPDIFGQIPSDQII  815



>ref|XP_010916542.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X3 [Elaeis guineensis]
Length=805

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+ + K K    LS+A +LWK  KPP+N TRYN++ FAIT+NELTPGL
Sbjct  652  FGKWDESMHFVHGDCSGKGKGSEPLSEACILWKCGKPPKNPTRYNLTRFAITVNELTPGL  711

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  712  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQERGWKPRWFAKDRGSD  771

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE +E G WDGCP+IFGQ+  DQ +
Sbjct  772  TYRYIGGYWEAKEKGNWDGCPDIFGQIPGDQII  804



>ref|XP_002443874.1| hypothetical protein SORBIDRAFT_07g003630 [Sorghum bicolor]
 gb|EES13369.1| hypothetical protein SORBIDRAFT_07g003630 [Sorghum bicolor]
Length=744

 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGE-WNSKPKD-LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
             GKWDES+Y  + + +  K  D L  ASLLW+ NKP  N TRYN+SSFAITLNELTPGL+
Sbjct  596  IGKWDESMYCSDSDTFKVKSADQLKGASLLWEKNKPAPNPTRYNLSSFAITLNELTPGLQ  655

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMS KLQ+NGWKPRWFE++ EDGT
Sbjct  656  EKLPPTDSRLRPDQRHLENGEYEKANAEKLRLERRQRMSTKLQDNGWKPRWFEQDTEDGT  715

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            +RY GGYWETRE G WDGC +IFG+  +T
Sbjct  716  YRYKGGYWETREKGCWDGCLDIFGEFVET  744



>ref|XP_006434122.1| hypothetical protein CICLE_v10000313mg [Citrus clementina]
 gb|ESR47362.1| hypothetical protein CICLE_v10000313mg [Citrus clementina]
Length=806

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+Y+ GE + K K+L   S+A LLWK +KPP+  TRYN + FAITLNE+TPGL
Sbjct  653  FGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPKYATRYNFTRFAITLNEVTPGL  712

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QENGWKPRWF ++   G
Sbjct  713  KEKLPPTDSRLRPDQRCLENGEYEMANSEKLRLEQRQRQARKMQENGWKPRWFAKDRATG  772

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE G W+ CP+IFG +  DQ L
Sbjct  773  TYRYIGGYWEARETGDWNLCPDIFGHIPSDQML  805



>gb|EAZ16928.1| hypothetical protein OsJ_32410 [Oryza sativa Japonica Group]
Length=697

 Score =   218 bits (556),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 122/156 (78%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES+  + G+  SK         + A+LLW+ N PP N TRYN+SSFAITLNELTP
Sbjct  539  MGKWDESMSCIIGDDASKVNSRNANQSTGATLLWEKNVPPANPTRYNLSSFAITLNELTP  598

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
            GLKEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQRM+RK+QE+GWKPRWF+R+ E
Sbjct  599  GLKEKLPPTDSRLRPDQRHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTE  658

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            DGTFRYVGGYWE RE  KW GC +IFG    TL  S
Sbjct  659  DGTFRYVGGYWEAREQRKWVGCNDIFGNNVSTLCTS  694



>gb|KHN26039.1| Oxysterol-binding protein-related protein 1C [Glycine soja]
Length=655

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY+NG+++ K K    +SDA LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  499  LGKWDDSMYYINGDYSGKGKGYESMSDAHLLWKRSKPPKFPTRYNFTRFAITLNELTPGL  558

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN+EKLRLE RQR +RK+QE+GW+PRWF R+   G
Sbjct  559  KEKLPPTDSRLRPDQRHLENGEYDMANSEKLRLEQRQRQARKMQESGWEPRWFGRDKASG  618

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE R+ G W+ CP+IFG +
Sbjct  619  TYRYLGGYWEARKQGNWNSCPDIFGHI  645



>ref|XP_010916540.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Elaeis guineensis]
Length=810

 Score =   220 bits (560),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+++++G+ + K K    LS+A +LWK  KPP+N TRYN++ FAIT+NELTPGL
Sbjct  657  FGKWDESMHFVHGDCSGKGKGSEPLSEACILWKCGKPPKNPTRYNLTRFAITVNELTPGL  716

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  717  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQERGWKPRWFAKDRGSD  776

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE +E G WDGCP+IFGQ+  DQ +
Sbjct  777  TYRYIGGYWEAKEKGNWDGCPDIFGQIPGDQII  809



>ref|XP_006593585.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Glycine max]
Length=789

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY+NG+++ K K    +SDA LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  630  LGKWDDSMYYINGDYSGKGKGYESMSDAHLLWKRSKPPKFPTRYNFTRFAITLNELTPGL  689

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN+EKLRLE RQR +RK+QE+GW+PRWF R+ E G
Sbjct  690  KEKLPPTDSRLRPDQRHLENGEYDMANSEKLRLEQRQRQARKMQESGWEPRWFGRDKESG  749

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE R+ G W+ CP+IFG +
Sbjct  750  TYRYLGGYWEARKQGNWNSCPDIFGHI  776



>ref|XP_006593584.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Glycine max]
Length=790

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY+NG+++ K K    +SDA LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  631  LGKWDDSMYYINGDYSGKGKGYESMSDAHLLWKRSKPPKFPTRYNFTRFAITLNELTPGL  690

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN+EKLRLE RQR +RK+QE+GW+PRWF R+ E G
Sbjct  691  KEKLPPTDSRLRPDQRHLENGEYDMANSEKLRLEQRQRQARKMQESGWEPRWFGRDKESG  750

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE R+ G W+ CP+IFG +
Sbjct  751  TYRYLGGYWEARKQGNWNSCPDIFGHI  777



>ref|NP_567662.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
 sp|Q940Y1.1|ORP2A_ARATH RecName: Full=Oxysterol-binding protein-related protein 2A; AltName: 
Full=OSBP-related protein 2A [Arabidopsis thaliana]
 gb|AAK96552.1| AT4g22540/F7K2_120 [Arabidopsis thaliana]
 gb|AAN46892.1| At4g22540/F7K2_120 [Arabidopsis thaliana]
 gb|AEE84620.1| oxysterol binding protein-related protein 2A [Arabidopsis thaliana]
Length=721

 Score =   219 bits (557),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S+YY+ G+  +K K     S+ASLLWK  KPP N+TRYN++SFAITLNELTPGL
Sbjct  567  FGKWDDSLYYVAGDGINKSKVSDPASNASLLWKRTKPPPNVTRYNLTSFAITLNELTPGL  626

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +E LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR+LQE+GW+PRWFER+GE  
Sbjct  627  QEILPPTDSRLRPDQRHLENGEYEKANLEKQRLERRQRMSRQLQESGWRPRWFERQGESD  686

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            TF+Y GGYWE R +  WD CP+IFG+  + L ++
Sbjct  687  TFKYTGGYWEARGHRNWDDCPDIFGEFTEELADA  720



>ref|XP_010664259.1| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X2 [Vitis vinifera]
Length=568

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+ + K K    LS++ LLWK  +PP+  TRYN++ FAITLNELTPGL
Sbjct  415  FGKWDESMHYVIGDCSGKGKGNDTLSESHLLWKQCRPPKFPTRYNLTRFAITLNELTPGL  474

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQR SRK+QE GWKPRWF ++    
Sbjct  475  KEKLPPTDSRLRPDQRCLENGEYEKANSEKLRLEQRQRQSRKMQERGWKPRWFVKDKGSD  534

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            T+RYVGGYWE RE G WD CP+IFGQ+    I+
Sbjct  535  TYRYVGGYWEAREKGNWDSCPDIFGQISTDQIS  567



>gb|KHG20800.1| Oxysterol-binding-related protein 2A -like protein [Gossypium 
arboreum]
Length=439

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 127/150 (85%), Gaps = 5/150 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEW--NSKPKDL--SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPG  169
            FGKWD+S+YY+NGE   + KPK    S+A+LLWK N+P  N TRYN++SFAITLNE+TPG
Sbjct  242  FGKWDDSMYYVNGEVKRSGKPKVCCPSEATLLWKRNEPAPNPTRYNLTSFAITLNEITPG  301

Query  170  LKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGED  349
            L+EKLPPTDSRLRPDQR LE+GE+D+AN+EK RLE RQRMSRKLQE+GWKPRWF ++G +
Sbjct  302  LQEKLPPTDSRLRPDQRHLESGEFDRANSEKQRLERRQRMSRKLQESGWKPRWFRKDG-N  360

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            G++ YVGGYWE RE   WDGCP+IFG+ ++
Sbjct  361  GSYHYVGGYWEAREQANWDGCPDIFGEFNE  390



>ref|XP_008796825.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Phoenix dactylifera]
Length=557

 Score =   215 bits (548),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS--DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
             GKWD+S+YY   + +     +S  DA+LLWK +KPP N TRYN+SSFAITLNEL P L+
Sbjct  402  MGKWDDSMYYTIDDISKTKGCISTQDATLLWKRSKPPANPTRYNLSSFAITLNELAPELQ  461

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF ++ +DGT
Sbjct  462  EKLPPTDSRLRPDQRYLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFWKDSDDGT  521

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRY+GGYWE RE  KWD CP+IFG+  +
Sbjct  522  FRYIGGYWEAREQRKWDNCPDIFGEFSE  549



>ref|XP_006472715.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Citrus sinensis]
Length=805

 Score =   219 bits (557),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+Y+ GE + K K+L   S+A LLWK +KPP+  TRYN + FAITLNE+TPGL
Sbjct  652  FGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPKYPTRYNFTRFAITLNEVTPGL  711

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QENGWKPRWF ++   G
Sbjct  712  KEKLPPTDSRLRPDQRCLENGEYEMANSEKLRLEQRQRQARKMQENGWKPRWFAKDRATG  771

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+RY+GGYWE RE G W+ CP+IFG +  DQ L
Sbjct  772  TYRYIGGYWEARETGDWNLCPDIFGHIPSDQML  804



>ref|XP_010529489.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X5 [Tarenaya hassleriana]
Length=613

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 122/153 (80%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS---DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+SIYY  G+  SK K      + SLLWK  KPP NLTRYN++SFAITLNELTPGL
Sbjct  461  FGKWDDSIYYAVGDGISKTKVADPTVNDSLLWKRTKPPPNLTRYNLTSFAITLNELTPGL  520

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GW+PRWFER+GE
Sbjct  521  QIKEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLERRQRMSRKLQESGWRPRWFERDGE  580

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            +GTF+Y GGYWE R+   W  CP+IFG+  + L
Sbjct  581  NGTFKYTGGYWEARKQRSWVNCPDIFGEFTEEL  613



>ref|XP_008665273.1| PREDICTED: oxysterol-binding protein-related protein 1C [Zea 
mays]
 tpg|DAA50903.1| TPA: putative oxysterol binding domain family protein [Zea mays]
Length=798

 Score =   218 bits (556),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K    LS+A LLWK +KPP+  TRYN++ FAITLNELTPGL
Sbjct  644  FGKWDESMHYVMGDCFGKGKGTEQLSEAHLLWKRSKPPKFPTRYNLTQFAITLNELTPGL  703

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  704  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  763

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RYVGGYWE+RE   W+GCP+IFGQV   L+
Sbjct  764  TYRYVGGYWESREKSSWEGCPDIFGQVPNDLM  795



>gb|AAK15443.1|AC037426_5 putative oxysterol-binding protein [Oryza sativa Japonica Group]
 gb|AAP54957.1| Oxysterol-binding protein, expressed [Oryza sativa Japonica Group]
Length=742

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 122/156 (78%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES+  + G+  SK         + A+LLW+ N PP N TRYN+SSFAITLNELTP
Sbjct  584  MGKWDESMSCIIGDDASKVNSRNANQSTGATLLWEKNVPPANPTRYNLSSFAITLNELTP  643

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
            GLKEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQRM+RK+QE+GWKPRWF+R+ E
Sbjct  644  GLKEKLPPTDSRLRPDQRHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTE  703

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            DGTFRYVGGYWE RE  KW GC +IFG    TL  S
Sbjct  704  DGTFRYVGGYWEAREQRKWVGCNDIFGNNVSTLCTS  739



>gb|EAY79468.1| hypothetical protein OsI_34597 [Oryza sativa Indica Group]
Length=742

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 122/156 (78%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES+  + G+  SK         + A+LLW+ N PP N TRYN+SSFAITLNELTP
Sbjct  584  MGKWDESMSCIIGDDASKVNSRNANQSTGATLLWEKNVPPANPTRYNLSSFAITLNELTP  643

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
            GLKEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQRM+RK+QE+GWKPRWF+R+ E
Sbjct  644  GLKEKLPPTDSRLRPDQRHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTE  703

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            DGTFRYVGGYWE RE  KW GC +IFG    TL  S
Sbjct  704  DGTFRYVGGYWEAREQRKWVGCNDIFGNNVSTLCTS  739



>ref|XP_008809039.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Phoenix dactylifera]
 ref|XP_008809040.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Phoenix dactylifera]
 ref|XP_008809041.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Phoenix dactylifera]
 ref|XP_008809042.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X4 [Phoenix dactylifera]
Length=560

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 118/149 (79%), Gaps = 5/149 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             G+WD+S+YY  G+  SK K       ASLLWK NKPP N TRYN+SSFAITLNELT  L
Sbjct  402  MGRWDDSMYYAKGDHISKIKGSNLTQSASLLWKRNKPPTNPTRYNLSSFAITLNELTSEL  461

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQENGWKPRWF+R+ E
Sbjct  462  QIKEKLPPTDSRLRPDQRHLENGEYEKANTEKQRLEKRQRMSRKLQENGWKPRWFQRDCE  521

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQV  433
              T+RY+GGYWE RE  KWDGC NIFG++
Sbjct  522  HDTYRYIGGYWEAREEKKWDGCLNIFGEI  550



>ref|XP_008809037.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Phoenix dactylifera]
Length=755

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             G+WD+S+YY  G+  SK K       ASLLWK NKPP N TRYN+SSFAITLNELT  L
Sbjct  599  MGRWDDSMYYAKGDHISKIKGSNLTQSASLLWKRNKPPTNPTRYNLSSFAITLNELTSEL  658

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQENGWKPRWF+R+ E  
Sbjct  659  QEKLPPTDSRLRPDQRHLENGEYEKANTEKQRLEKRQRMSRKLQENGWKPRWFQRDCEHD  718

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE  KWDGC NIFG++
Sbjct  719  TYRYIGGYWEAREEKKWDGCLNIFGEI  745



>ref|XP_009367301.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Pyrus x bretschneideri]
Length=539

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+ G+ + K K    LSDA LLW+ NKPP+  TRYN++ FAITLNELTPGL
Sbjct  386  VGKWDESMHYILGDCSGKGKGSDSLSDARLLWRRNKPPKFPTRYNLTRFAITLNELTPGL  445

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKP+WF ++    
Sbjct  446  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQEQGWKPQWFAKDKGSD  505

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE G WD CP+IFGQV
Sbjct  506  TYRYIGGYWEAREQGNWDSCPDIFGQV  532



>ref|XP_010539671.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Tarenaya hassleriana]
Length=635

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = +2

Query  2    FGKWDESIYY--LNGEWNSKPKD-LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+SIYY  ++G   +K  D   +ASLLWK  KPP NLTRYN++SFAITLNELT GL
Sbjct  483  FGKWDDSIYYTVMDGISKTKVGDPTVNASLLWKRTKPPPNLTRYNLTSFAITLNELTLGL  542

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQE+GW+PRWFER  EDG
Sbjct  543  KEKLPPTDSRLRPDQRHLENGEYEKANAEKQRLERRQRMSRKLQESGWRPRWFERREEDG  602

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            T+ Y GGYWE RE   W  CP+IFG+  + L
Sbjct  603  TYEYRGGYWEAREGRSWVDCPDIFGEFTEEL  633



>gb|KHF99943.1| Oxysterol-binding-related protein 1C -like protein [Gossypium 
arboreum]
Length=807

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKW+ES+ Y+NGE + K K    LS+A LLWK +KPP+  TRYN++ FAITLNE+TP L
Sbjct  658  FGKWNESMQYVNGECSVKGKGQESLSEADLLWKKSKPPKFPTRYNLTRFAITLNEVTPDL  717

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE GWKPRWF RE  + 
Sbjct  718  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQERGWKPRWFAREKNND  777

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE R+ GKWD CP+IFGQ+
Sbjct  778  TYRYVGGYWEARQKGKWDSCPDIFGQI  804



>ref|XP_009393560.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Musa acuminata subsp. malaccensis]
Length=836

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+ G+ + K K    LS+A LLWK +KPP+  TRYN++ FAIT+NELTPGL
Sbjct  683  IGKWDESMHYVYGDCSGKGKGSELLSEAHLLWKRSKPPKCPTRYNLTRFAITMNELTPGL  742

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLP TDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE+GWKP+WF ++ E  
Sbjct  743  KEKLPSTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARKMQESGWKPQWFAKDKESD  802

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE+GKWDGCP+IFGQV
Sbjct  803  TYRYLGGYWEAREDGKWDGCPDIFGQV  829



>ref|XP_010529486.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X2 [Tarenaya hassleriana]
Length=734

 Score =   217 bits (552),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 7/154 (5%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDA----SLLWKSNKPPQNLTRYNMSSFAITLNELTPG  169
            FGKWD+SIYY  G+  SK K ++D     SLLWK  KPP NLTRYN++SFAITLNELTPG
Sbjct  582  FGKWDDSIYYAVGDGISKTK-VADPTVNDSLLWKRTKPPPNLTRYNLTSFAITLNELTPG  640

Query  170  L--KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREG  343
            L  KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GW+PRWFER+G
Sbjct  641  LQIKEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLERRQRMSRKLQESGWRPRWFERDG  700

Query  344  EDGTFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            E+GTF+Y GGYWE R+   W  CP+IFG+  + L
Sbjct  701  ENGTFKYTGGYWEARKQRSWVNCPDIFGEFTEEL  734



>ref|XP_010529485.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Tarenaya hassleriana]
Length=735

 Score =   217 bits (552),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 7/154 (5%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDA----SLLWKSNKPPQNLTRYNMSSFAITLNELTPG  169
            FGKWD+SIYY  G+  SK K ++D     SLLWK  KPP NLTRYN++SFAITLNELTPG
Sbjct  583  FGKWDDSIYYAVGDGISKTK-VADPTVNDSLLWKRTKPPPNLTRYNLTSFAITLNELTPG  641

Query  170  L--KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREG  343
            L  KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQE+GW+PRWFER+G
Sbjct  642  LQIKEKLPPTDSRLRPDQRHLENGEYEKANGEKQRLERRQRMSRKLQESGWRPRWFERDG  701

Query  344  EDGTFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            E+GTF+Y GGYWE R+   W  CP+IFG+  + L
Sbjct  702  ENGTFKYTGGYWEARKQRSWVNCPDIFGEFTEEL  735



>ref|XP_011097681.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Sesamum indicum]
Length=798

 Score =   217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+YY +G+ +SK K     SDA LLWK +KPP+  TRYN++ FAITLNEL PGL
Sbjct  645  FGKWDESMYYSSGDCSSKRKGHESPSDAHLLWKRSKPPKFPTRYNLTRFAITLNELIPGL  704

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +R +QE GWKP+WF ++   G
Sbjct  705  KEKLPPTDSRLRPDQRCLENGEYEMANAEKLRLEQRQRQARMMQERGWKPQWFAKDEASG  764

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE+G W+ CPNIFGQ+
Sbjct  765  TYRYIGGYWEAREHGNWESCPNIFGQI  791



>ref|XP_007141093.1| hypothetical protein PHAVU_008G166800g [Phaseolus vulgaris]
 gb|ESW13087.1| hypothetical protein PHAVU_008G166800g [Phaseolus vulgaris]
Length=783

 Score =   217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY+NG+++ K K    +S+A L+WK +KPP+  TRYN + FAITLNELTPGL
Sbjct  626  LGKWDDSMYYINGDYSGKDKGYESMSNAHLIWKRSKPPKFPTRYNFTRFAITLNELTPGL  685

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            K+KLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQR +RK+QE+GW+PRWF +  E G
Sbjct  686  KDKLPPTDSRLRPDQRHLENGEYEKANSEKLRLEQRQRQARKMQESGWEPRWFRKNKESG  745

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T RYVGGYWE R+ G W+ CP+IFGQ+
Sbjct  746  THRYVGGYWEARKQGNWNSCPDIFGQI  772



>gb|ABF98451.1| Oxysterol-binding protein, expressed [Oryza sativa Japonica Group]
Length=583

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN + FAITLNELT GL
Sbjct  429  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFAITLNELTAGL  488

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  489  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  548

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE G W+GCP+IFGQV   L+
Sbjct  549  TYRYLGGYWESREKGSWEGCPDIFGQVPNDLM  580



>gb|KHG02843.1| Oxysterol-binding-related protein 1C -like protein [Gossypium 
arboreum]
 gb|KHG15754.1| Oxysterol-binding-related protein 1C -like protein [Gossypium 
arboreum]
Length=817

 Score =   217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+NG+++++ K    LS++ LLW+ +KPP+  TRYN++ FAITLNELTPGL
Sbjct  664  LGKWDESMHYVNGDYSARGKGQESLSESHLLWRRSKPPKYPTRYNLTRFAITLNELTPGL  723

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  724  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQESGWKPRWFAKDKNSG  783

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+ Y+GGYWE RE  KWD CP+IFGQ+  DQ L
Sbjct  784  TYHYIGGYWEAREQRKWDSCPDIFGQIPCDQIL  816



>emb|CDX75168.1| BnaC09g25140D [Brassica napus]
Length=499

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+ + K K   D+S A LLWK +KPP N T+YN++ FAITLNELTPGL
Sbjct  346  FGKWDESMHYVTGDCSGKGKLSEDMSGAQLLWKRSKPPGNATKYNLTRFAITLNELTPGL  405

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGE++ AN EKLRLE RQR +RK+QE GWKPRWF +E    
Sbjct  406  KEKLPPTDSRLRPDQRYLENGEFEMANTEKLRLEQRQRQARKMQERGWKPRWFTKEKGSE  465

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVD  436
             +RY GGYWE RE G WD CP+IFG +D
Sbjct  466  AYRYKGGYWEARERGSWDNCPDIFGHID  493



>ref|XP_010272886.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Nelumbo nucifera]
Length=827

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 120/153 (78%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+YY+NG+ + K K    LS A +LWK + P +  TRYN++ FAITLNELTPGL
Sbjct  674  FGKWDESMYYVNGDCSGKGKGSEPLSSAHMLWKRSMPSKYSTRYNLTRFAITLNELTPGL  733

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD ANAEKLRLE RQR +RK+QE GWKPRWF +E    
Sbjct  734  KEKLPPTDSRLRPDQRCLENGEYDLANAEKLRLEQRQRQARKMQERGWKPRWFAKEKGSD  793

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
            T+ YVGGYWE RE G WD CP+IFGQV  DQ L
Sbjct  794  TYCYVGGYWEAREQGNWDSCPDIFGQVPSDQML  826



>ref|XP_002466599.1| hypothetical protein SORBIDRAFT_01g010720 [Sorghum bicolor]
 gb|EER93597.1| hypothetical protein SORBIDRAFT_01g010720 [Sorghum bicolor]
Length=802

 Score =   216 bits (551),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K     S+A LLWK +KPP+  TRYN++ FAITLNELTPGL
Sbjct  648  FGKWDESMHYVMGDCFGKGKGTEQFSEAHLLWKRSKPPKFPTRYNLTRFAITLNELTPGL  707

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++ +  
Sbjct  708  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKDTD  767

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE   W+GCP+IFGQV   L+
Sbjct  768  TYRYLGGYWESREKSSWEGCPDIFGQVPNDLM  799



>gb|KHN47055.1| Oxysterol-binding protein-related protein 1C, partial [Glycine 
soja]
Length=735

 Score =   216 bits (550),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LSDA LLWK ++ P+  TRYN + FAITLNELTPGL
Sbjct  576  FGKWDESMHYVNGDYTGKGKGHESLSDARLLWKRSRAPKFPTRYNFTRFAITLNELTPGL  635

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN EK RLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  636  KEKLPPTDSRLRPDQRYLENGEYDMANVEKSRLEQRQRQARKMQESGWKPRWFAKDKASG  695

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE R+ G WD CP+IF Q+
Sbjct  696  TYRYVGGYWEARQRGNWDSCPDIFDQI  722



>gb|EAZ28298.1| hypothetical protein OsJ_12273 [Oryza sativa Japonica Group]
Length=960

 Score =   217 bits (553),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN + FAITLNELT GL
Sbjct  806  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFAITLNELTAGL  865

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  866  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  925

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE G W+GCP+IFGQV   L+
Sbjct  926  TYRYLGGYWESREKGSWEGCPDIFGQVPNDLM  957



>gb|KHN34455.1| Oxysterol-binding protein-related protein 1C [Glycine soja]
Length=657

 Score =   214 bits (546),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY+NG+++ K K    +SDA LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  499  LGKWDDSMYYINGDYSGKGKGYESMSDAHLLWKRSKPPKFPTRYNFTRFAITLNELTPGL  558

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN+EKLRLE RQR +RK+QE+GW+PRWF R+ + G
Sbjct  559  KEKLPPTDSRLRPDQRHLENGEYDMANSEKLRLEQRQRQARKMQESGWEPRWFGRD-KSG  617

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            T+RY+GGYWE R+ G W+ CP+IFG +    I+
Sbjct  618  TYRYLGGYWEARKQGNWNSCPDIFGHIHSDHIS  650



>ref|XP_003560718.2| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X1 [Brachypodium distachyon]
Length=851

 Score =   216 bits (551),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN +SFAITLNELT GL
Sbjct  697  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTSFAITLNELTAGL  756

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  757  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGTD  816

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RYVGGYWE+REN  WDGCP+IFGQ+   L+
Sbjct  817  TYRYVGGYWESRENSCWDGCPDIFGQLPNDLM  848



>ref|XP_010230954.1| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X2 [Brachypodium distachyon]
Length=850

 Score =   216 bits (551),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN +SFAITLNELT GL
Sbjct  696  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTSFAITLNELTAGL  755

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  756  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGTD  815

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RYVGGYWE+REN  WDGCP+IFGQ+   L+
Sbjct  816  TYRYVGGYWESRENSCWDGCPDIFGQLPNDLM  847



>ref|XP_002284383.1| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X1 [Vitis vinifera]
 emb|CBI19073.3| unnamed protein product [Vitis vinifera]
Length=797

 Score =   216 bits (550),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+ + K K    LS++ LLWK  +PP+  TRYN++ FAITLNELTPGL
Sbjct  644  FGKWDESMHYVIGDCSGKGKGNDTLSESHLLWKQCRPPKFPTRYNLTRFAITLNELTPGL  703

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQR SRK+QE GWKPRWF ++    
Sbjct  704  KEKLPPTDSRLRPDQRCLENGEYEKANSEKLRLEQRQRQSRKMQERGWKPRWFVKDKGSD  763

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            T+RYVGGYWE RE G WD CP+IFGQ+    I+
Sbjct  764  TYRYVGGYWEAREKGNWDSCPDIFGQISTDQIS  796



>ref|XP_003523465.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Glycine max]
Length=783

 Score =   216 bits (550),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LSDA LLWK ++ P+  TRYN + FAITLNELTPGL
Sbjct  624  FGKWDESMHYVNGDYTGKGKGHDTLSDARLLWKRSRAPKFPTRYNFTRFAITLNELTPGL  683

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN EK RLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  684  KEKLPPTDSRLRPDQRYLENGEYDMANVEKSRLEQRQRQARKMQESGWKPRWFAKDKASG  743

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE R+ G WD CP+IF Q+
Sbjct  744  TYRYVGGYWEARQRGNWDSCPDIFDQI  770



>ref|XP_006578982.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Glycine max]
Length=782

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LSDA LLWK ++ P+  TRYN + FAITLNELTPGL
Sbjct  623  FGKWDESMHYVNGDYTGKGKGHDTLSDARLLWKRSRAPKFPTRYNFTRFAITLNELTPGL  682

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN EK RLE RQR +RK+QE+GWKPRWF ++   G
Sbjct  683  KEKLPPTDSRLRPDQRYLENGEYDMANVEKSRLEQRQRQARKMQESGWKPRWFAKDKASG  742

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE R+ G WD CP+IF Q+
Sbjct  743  TYRYVGGYWEARQRGNWDSCPDIFDQI  769



>ref|XP_008378497.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Malus domestica]
Length=807

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+ G+ + K K    LSDA LLW+ NKPP+  TRYN++ FAIT+NELTPGL
Sbjct  654  VGKWDESMHYILGDCSGKGKGSDSLSDARLLWRRNKPPKFPTRYNLTRFAITMNELTPGL  713

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKP+WF ++    
Sbjct  714  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQEQGWKPQWFAKDKGSD  773

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE RE G+WD CP+IFGQV
Sbjct  774  TYRYVGGYWEAREQGRWDSCPDIFGQV  800



>ref|XP_008378498.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Malus domestica]
Length=802

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+ G+ + K K    LSDA LLW+ NKPP+  TRYN++ FAIT+NELTPGL
Sbjct  649  VGKWDESMHYILGDCSGKGKGSDSLSDARLLWRRNKPPKFPTRYNLTRFAITMNELTPGL  708

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKP+WF ++    
Sbjct  709  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQEQGWKPQWFAKDKGSD  768

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RYVGGYWE RE G+WD CP+IFGQV
Sbjct  769  TYRYVGGYWEAREQGRWDSCPDIFGQV  795



>ref|XP_009366989.1| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X1 [Pyrus x bretschneideri]
Length=404

 Score =   209 bits (531),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+ + K K    LSD+ LLW+ NKPP+  TRYN++ FAIT+NELTPGL
Sbjct  251  FGKWDESMHYVLGDCSGKGKGSDSLSDSRLLWRRNKPPKFPTRYNLTRFAITMNELTPGL  310

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKP+WF ++    
Sbjct  311  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQEQGWKPQWFAKDKGSD  370

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+ Y GGYWE RE G WD CP+IFGQV
Sbjct  371  TYSYTGGYWEAREQGNWDSCPDIFGQV  397



>ref|XP_007225264.1| hypothetical protein PRUPE_ppa001539mg [Prunus persica]
 gb|EMJ26463.1| hypothetical protein PRUPE_ppa001539mg [Prunus persica]
Length=805

 Score =   216 bits (550),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+ + K K    LS+A LLWK +KPP+  TRYN++ FAIT+NELTPGL
Sbjct  652  FGKWDESMHYVNGDCSGKGKGSDSLSEACLLWKRSKPPKFPTRYNLTRFAITMNELTPGL  711

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GW+P+WF ++    
Sbjct  712  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQEQGWRPQWFAKDKGSD  771

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T++Y+GGYWE RE G+WD CP+IFGQV
Sbjct  772  TYQYIGGYWEAREKGRWDSCPDIFGQV  798



>gb|KHG14097.1| Oxysterol-binding-related protein 1C -like protein [Gossypium 
arboreum]
Length=501

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWD+S++Y+NG+ ++K K    LS+  LLWK +KPP+  TRYN++ FAITLNELTPGL
Sbjct  348  FGKWDDSMHYVNGDCSAKGKGQDSLSETHLLWKRSKPPKYPTRYNLTRFAITLNELTPGL  407

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +R +QE GWKPRWF ++    
Sbjct  408  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARNMQERGWKPRWFAKDKNSD  467

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            ++RY+GGYWE RE  KWD CP+IFGQ+
Sbjct  468  SYRYIGGYWEAREQRKWDSCPDIFGQI  494



>ref|XP_008796823.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008796824.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Phoenix dactylifera]
Length=754

 Score =   215 bits (548),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLS--DASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
             GKWD+S+YY   + +     +S  DA+LLWK +KPP N TRYN+SSFAITLNEL P L+
Sbjct  599  MGKWDDSMYYTIDDISKTKGCISTQDATLLWKRSKPPANPTRYNLSSFAITLNELAPELQ  658

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEK RLE RQRMSRKLQENGWKPRWF ++ +DGT
Sbjct  659  EKLPPTDSRLRPDQRYLENGEYEKANAEKQRLERRQRMSRKLQENGWKPRWFWKDSDDGT  718

Query  356  FRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            FRY+GGYWE RE  KWD CP+IFG+  +
Sbjct  719  FRYIGGYWEAREQRKWDNCPDIFGEFSE  746



>gb|KDP32753.1| hypothetical protein JCGZ_12045 [Jatropha curcas]
Length=814

 Score =   216 bits (549),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 121/148 (82%), Gaps = 5/148 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+  +K K    L DA LLWK +KPPQ  TRYN++ FAITLNELTPGL
Sbjct  662  FGKWDESMHYVNGDCPTKGKGYESLKDAHLLWKRSKPPQFPTRYNLTRFAITLNELTPGL  721

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFERE-GED  349
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKPRWF ++ G D
Sbjct  722  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  781

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQV  433
            G +RY GGYWE RE G WD CP+IFGQV
Sbjct  782  G-YRYTGGYWEAREEGNWDLCPDIFGQV  808



>ref|XP_009341681.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X4 [Pyrus x bretschneideri]
Length=797

 Score =   216 bits (549),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+ G+ + K K    LSDA LLW+ NKPP+  TRYN++ FAITLNELTPGL
Sbjct  644  VGKWDESMHYILGDCSGKGKGSDSLSDARLLWRRNKPPKFPTRYNLTRFAITLNELTPGL  703

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GWKP+WF ++    
Sbjct  704  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQEQGWKPQWFAKDKGSD  763

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE G WD CP+IFGQV
Sbjct  764  TYRYIGGYWEAREQGNWDSCPDIFGQV  790



>gb|AFW61214.1| putative oxysterol binding domain family protein, partial [Zea 
mays]
Length=538

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             G WDESIY  N +  SK K    L  ASLLW+ NKP  N TRYN+SSFAITLNELTPGL
Sbjct  381  IGMWDESIYCSNSD-TSKVKSADQLKGASLLWEKNKPAPNPTRYNLSSFAITLNELTPGL  439

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMS KLQ+NGWK RWFE++ EDG
Sbjct  440  QEKLPPTDSRLRPDQRHLENGEYEKANAEKLRLERRQRMSTKLQDNGWKSRWFEQDTEDG  499

Query  353  TFRYVGGYWETRENGKWDGCPNIFG  427
            T+ Y GGYWETRE G WDGC +IFG
Sbjct  500  TYCYKGGYWETRERGFWDGCLDIFG  524



>ref|XP_008234096.1| PREDICTED: oxysterol-binding protein-related protein 1C-like, 
partial [Prunus mume]
Length=736

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+ + K K    LS+A LLWK +KPP+  TRYN++ FAIT+NELTPGL
Sbjct  583  FGKWDESMHYVNGDCSGKGKGSDSLSEACLLWKRSKPPKFPTRYNLTRFAITMNELTPGL  642

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ ANAEKLRLE RQR +RK+QE GW+P+WF ++    
Sbjct  643  KEKLPPTDSRLRPDQRYLENGEYEMANAEKLRLEQRQRQARKMQEQGWRPQWFAKDKGSD  702

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T++Y+GGYWE RE G WD CP+IFGQV
Sbjct  703  TYQYIGGYWEAREKGHWDSCPDIFGQV  729



>ref|XP_006659844.1| PREDICTED: oxysterol-binding protein-related protein 2A-like, 
partial [Oryza brachyantha]
Length=616

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 4/151 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDE++YY N +  SK K    L  ASLLW+ NKP  N TRYN+SSFAITLNEL+P L
Sbjct  467  IGKWDENMYYSNLD-TSKVKSADQLKGASLLWEKNKPSPNPTRYNLSSFAITLNELSPEL  525

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            ++KLPPTDSRLRPDQR LENGEY+KAN EKLRLE RQRMS KLQ+NGWKP+WF+++G+DG
Sbjct  526  QDKLPPTDSRLRPDQRHLENGEYEKANTEKLRLERRQRMSSKLQDNGWKPKWFQQDGQDG  585

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTL  445
            T+R+ GGYWE RE G WDGC +IFG+  +TL
Sbjct  586  TYRFKGGYWEAREQGHWDGCLDIFGEFSETL  616



>dbj|BAD93875.1| hypothetical protein [Arabidopsis thaliana]
Length=402

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+++ G+ + K K   D+S A LLWK +KPP N T+YN++ FAITLNELTPGL
Sbjct  248  FGKWDESIHFVTGDCSGKGKLSEDMSGAQLLWKRSKPPGNATKYNLTRFAITLNELTPGL  307

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE+LPPTDSRLRPDQR LENGE++ AN EKLRLE RQR +RK+QE GWKPRWF +E    
Sbjct  308  KERLPPTDSRLRPDQRYLENGEFEMANTEKLRLEQRQRQARKMQERGWKPRWFMKEKGSE  367

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVD  436
            ++RY GGYWE RE+G W  CP+IFG +D
Sbjct  368  SYRYKGGYWEAREDGSWVDCPDIFGHID  395



>ref|XP_004983704.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Setaria italica]
Length=742

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 121/151 (80%), Gaps = 5/151 (3%)
 Frame = +2

Query  5    GKWDESIYYLNGEWNSKPKDL-----SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPG  169
            GKWDES++ +  +  SK K       + A+LLWK N+P  N TRYN+SSFAITLNELTP 
Sbjct  578  GKWDESVHCVISDDASKVKSHGSHHSAGATLLWKKNEPSANPTRYNLSSFAITLNELTPE  637

Query  170  LKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGED  349
            LKEKLPPTDSRLRPDQR LENGE++KAN EKLRLE RQRM+RK+QE+GWKPRWF+R+ ED
Sbjct  638  LKEKLPPTDSRLRPDQRHLENGEHEKANGEKLRLETRQRMARKMQESGWKPRWFQRDSED  697

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            GTFRYVGGYWE RE  KWDGC +IFG +  +
Sbjct  698  GTFRYVGGYWEAREQRKWDGCNDIFGNLSSS  728



>gb|EAY91566.1| hypothetical protein OsI_13201 [Oryza sativa Indica Group]
Length=850

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN + FAITLNELT GL
Sbjct  696  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFAITLNELTAGL  755

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  756  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  815

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE G W+GCP+IFGQV   L+
Sbjct  816  TYRYLGGYWESREKGSWEGCPDIFGQVPNDLM  847



>ref|NP_001183756.1| uncharacterized protein LOC100502349 [Zea mays]
 gb|ACR38232.1| unknown [Zea mays]
Length=317

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = +2

Query  5    GKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPG  169
            GKWDES++ +     SK     P   S ++LLW+ N+PP N TRYN+S+FAITLNELTP 
Sbjct  156  GKWDESVHCVINNDASKVNSHGPHQSSGSTLLWEKNEPPVNPTRYNLSAFAITLNELTPE  215

Query  170  LKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGED  349
            L+EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE +QRM+RK+QE+GWKPRWF+R+ ED
Sbjct  216  LEEKLPPTDSRLRPDQRHLENGEYEKANAEKLRLETQQRMARKMQESGWKPRWFQRDSED  275

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            GT+RYVGGYWE RE   W GC +IFG +  +
Sbjct  276  GTYRYVGGYWEAREQRTWVGCNDIFGNLSSS  306



>dbj|BAJ85478.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN +SFAITLNELTPGL
Sbjct  660  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTSFAITLNELTPGL  719

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  720  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGSD  779

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE   W+GCP+IFGQ+   L+
Sbjct  780  TYRYLGGYWESREKSSWEGCPDIFGQLPNDLM  811



>dbj|BAJ85382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES+YY N +  SK K    L  ASLLW+ NKP  N TRYN+SSFAITLNELTP L
Sbjct  354  IGKWDESMYYSNLD-TSKVKSADQLQGASLLWEKNKPSPNPTRYNLSSFAITLNELTPEL  412

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KAN EKLRLE RQRMS KLQ+NGWK RWFE++ EDG
Sbjct  413  QEKLPPTDSRLRPDQRHLENGEYEKANTEKLRLERRQRMSTKLQDNGWKARWFEQDAEDG  472

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQ  439
            T+ Y GGYWE R+ G+WDGC +IFG+  +
Sbjct  473  TYHYKGGYWEARDQGRWDGCLDIFGEFSE  501



>ref|XP_006662588.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
[Oryza brachyantha]
Length=706

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 126/156 (81%), Gaps = 6/156 (4%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK--PKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES+  +  +  SK  P+++   + A+LLW+ N+P  N TRYN+SSFAITLNELTP
Sbjct  549  MGKWDESMSCIINDDASKVNPRNVNQSTGATLLWEKNQPAANPTRYNLSSFAITLNELTP  608

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
            GLKEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQRM+RK+QE+GWKPRWF+R+ E
Sbjct  609  GLKEKLPPTDSRLRPDQRHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTE  668

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            DGTFRYVGGYWE RE  KW GC +IFG V  TL  S
Sbjct  669  DGTFRYVGGYWEAREQRKWVGCNDIFGNV-TTLCTS  703



>gb|EAZ41553.1| hypothetical protein OsJ_26076 [Oryza sativa Japonica Group]
Length=603

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDE++YY N +  SK K    L  A LLW+ NKP  N TRYN+SSFAITLNEL+P L
Sbjct  455  IGKWDENMYYSNLD-TSKVKSVDQLKGAVLLWEKNKPSPNPTRYNLSSFAITLNELSPDL  513

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            ++KLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMS KLQ+NGWKPRWF+++GEDG
Sbjct  514  QDKLPPTDSRLRPDQRHLENGEYEKANAEKLRLERRQRMSSKLQDNGWKPRWFQKDGEDG  573

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            T+R+ GGYWE RE+G+WD C +IFG+  +T
Sbjct  574  TYRFKGGYWEAREHGQWDDCLDIFGEFSET  603



>ref|XP_001760064.1| predicted protein [Physcomitrella patens]
 gb|EDQ75189.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 117/145 (81%), Gaps = 3/145 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+YY+ G+ + KPK    +S+A LLW++  PP+ LTRY ++ F+ITLNE+TPGL
Sbjct  251  FGKWDESMYYVMGDISEKPKHYDPMSEAVLLWRAAAPPEKLTRYGLTGFSITLNEITPGL  310

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEYD AN+EKLRLE +QR +R LQE GW+PRWF +     
Sbjct  311  REKLPPTDSRLRPDQRHLENGEYDAANSEKLRLEQKQRRARTLQEKGWQPRWFRKGKGKD  370

Query  353  TFRYVGGYWETRENGKWDGCPNIFG  427
            TF Y+GGYWE R++G WDGCP+IFG
Sbjct  371  TFEYIGGYWEARDSGSWDGCPDIFG  395



>ref|XP_006596306.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Glycine max]
Length=783

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY+NG+++ K K    +SDA LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  625  LGKWDDSMYYINGDYSGKGKGYESMSDAHLLWKRSKPPKFPTRYNFTRFAITLNELTPGL  684

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN+EKLRLE RQR +RK+QE+GW+PRWF R+ + G
Sbjct  685  KEKLPPTDSRLRPDQRHLENGEYDMANSEKLRLEQRQRQARKMQESGWEPRWFGRD-KSG  743

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            T+RY+GGYWE R+ G W+ CP+IFG +    I+
Sbjct  744  TYRYLGGYWEARKQGNWNSCPDIFGHIHSDHIS  776



>ref|XP_004982038.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Setaria italica]
Length=801

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K     S+A LLWK +KPP+  TRYN++ FAITLNELTPGL
Sbjct  647  FGKWDESMHYVMGDCFGKGKGSEQFSEAHLLWKRSKPPKFPTRYNLTRFAITLNELTPGL  706

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  707  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  766

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE+RE   W+GCP+IFGQV
Sbjct  767  TYRYLGGYWESREKSSWEGCPDIFGQV  793



>ref|XP_006596305.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Glycine max]
Length=784

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWD+S+YY+NG+++ K K    +SDA LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  626  LGKWDDSMYYINGDYSGKGKGYESMSDAHLLWKRSKPPKFPTRYNFTRFAITLNELTPGL  685

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEYD AN+EKLRLE RQR +RK+QE+GW+PRWF R+ + G
Sbjct  686  KEKLPPTDSRLRPDQRHLENGEYDMANSEKLRLEQRQRQARKMQESGWEPRWFGRD-KSG  744

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLIN  451
            T+RY+GGYWE R+ G W+ CP+IFG +    I+
Sbjct  745  TYRYLGGYWEARKQGNWNSCPDIFGHIHSDHIS  777



>gb|EMT32902.1| Oxysterol-binding protein-related protein 6 [Aegilops tauschii]
Length=669

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 118/147 (80%), Gaps = 5/147 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES+Y +  +  SK         + A+LLWK N+PP + TRYN+SSFAITLNELTP
Sbjct  504  MGKWDESMYCVVSDDASKLSSHISHQSAGATLLWKKNEPPADPTRYNLSSFAITLNELTP  563

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
            GLKEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQRM+R +QE+GWKPRWF+R+ E
Sbjct  564  GLKEKLPPTDSRLRPDQRHLENGEYEKANSEKLRLETRQRMARNMQESGWKPRWFQRDSE  623

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFG  427
             GT+RYVGGYWE RE  KW GC +IFG
Sbjct  624  HGTYRYVGGYWEAREQTKWVGCSDIFG  650



>ref|XP_008677600.1| PREDICTED: uncharacterized protein LOC100383333 isoform X1 [Zea 
mays]
 gb|AFW61216.1| putative oxysterol binding domain family protein [Zea mays]
Length=736

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             G WDESIY  N +  SK K    L  ASLLW+ NKP  N TRYN+SSFAITLNELTPGL
Sbjct  588  IGMWDESIYCSNSD-TSKVKSADQLKGASLLWEKNKPAPNPTRYNLSSFAITLNELTPGL  646

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMS KLQ+NGWK RWFE++ EDG
Sbjct  647  QEKLPPTDSRLRPDQRHLENGEYEKANAEKLRLERRQRMSTKLQDNGWKSRWFEQDTEDG  706

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            T+ Y GGYWETRE G WDGC +IFG+  +T
Sbjct  707  TYCYKGGYWETRERGFWDGCLDIFGEFVET  736



>ref|XP_010544433.1| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X1 [Tarenaya hassleriana]
Length=818

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+ Y+NG+ + K K    LS + LLWK +KPP+  T+YN++ FAITLNELTPGL
Sbjct  662  FGKWDESMQYVNGDCSGKGKMNESLSGSHLLWKQSKPPECPTKYNLTRFAITLNELTPGL  721

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGE++ ANAEKLRLE RQR +RK+QE GWKPRWFE+E    
Sbjct  722  KEKLPPTDSRLRPDQRYLENGEFEMANAEKLRLEQRQRQARKMQERGWKPRWFEKEKGSD  781

Query  353  TFRYVGGYWETR-ENGKWDGCPNIFGQV  433
            T+RY+GGYWE R +NG+W+GCP+IFGQ+
Sbjct  782  TYRYIGGYWEARDDNGRWEGCPDIFGQI  809



>ref|XP_010544439.1| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X2 [Tarenaya hassleriana]
Length=817

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES+ Y+NG+ + K K    LS + LLWK +KPP+  T+YN++ FAITLNELTPGL
Sbjct  661  FGKWDESMQYVNGDCSGKGKMNESLSGSHLLWKQSKPPECPTKYNLTRFAITLNELTPGL  720

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGE++ ANAEKLRLE RQR +RK+QE GWKPRWFE+E    
Sbjct  721  KEKLPPTDSRLRPDQRYLENGEFEMANAEKLRLEQRQRQARKMQERGWKPRWFEKEKGSD  780

Query  353  TFRYVGGYWETR-ENGKWDGCPNIFGQV  433
            T+RY+GGYWE R +NG+W+GCP+IFGQ+
Sbjct  781  TYRYIGGYWEARDDNGRWEGCPDIFGQI  808



>ref|XP_009407157.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Musa acuminata subsp. malaccensis]
 ref|XP_009407158.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=546

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGE--WNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
             GKWD+ +Y   G+   N       +  LLW+ +KPP N TRYN++SFAITLNELT  L+
Sbjct  401  LGKWDDLMYRNKGDDVPNKTCNITQNMCLLWERSKPPANPTRYNLTSFAITLNELTSELQ  460

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMSRKLQENGWKPRWF++EGED T
Sbjct  461  EKLPPTDSRLRPDQRHLENGEYEKANAEKLRLEKRQRMSRKLQENGWKPRWFQQEGEDST  520

Query  356  FRYVGGYWETRENGKWDGCPNIFGQ  430
            + YVGGYWE RE  KWDGCP+IFG+
Sbjct  521  YHYVGGYWEAREQKKWDGCPDIFGE  545



>ref|XP_002513820.1| Oxysterol-binding protein, putative [Ricinus communis]
 gb|EEF48403.1| Oxysterol-binding protein, putative [Ricinus communis]
Length=795

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 5/148 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDL---SDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDESI+Y+NG+ + K K     +DA LLWK ++PPQ  TRYN++ FAITLNELTPGL
Sbjct  642  FGKWDESIHYVNGDCSGKGKGFESENDAQLLWKRSRPPQFPTRYNLTRFAITLNELTPGL  701

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFERE-GED  349
            KEKLPPTDSRLRPDQR LENGE++ AN+EKLRLE RQR +RK+QE GWKPRWF ++ G D
Sbjct  702  KEKLPPTDSRLRPDQRYLENGEFEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  761

Query  350  GTFRYVGGYWETRENGKWDGCPNIFGQV  433
            G +RY+GGYWE RE G WD CP+IFGQV
Sbjct  762  G-YRYIGGYWEAREQGIWDSCPDIFGQV  788



>ref|XP_004292674.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Fragaria vesca subsp. vesca]
Length=786

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK--DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLK  175
            FGKWDES++Y++G+ + K K   LSDA LLWK +KPP+  TRYN++ FAIT+NEL PGLK
Sbjct  635  FGKWDESMHYVDGDCSGKGKFESLSDARLLWKRSKPPKFPTRYNLTRFAITMNELLPGLK  694

Query  176  EKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGT  355
            EKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE+GWKP+WF ++    T
Sbjct  695  EKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQESGWKPQWFAKDKASDT  754

Query  356  FRYVGGYWETRENGKWDGCPNIFGQV  433
            +RY GGYWE RE GKWD CP+IFG V
Sbjct  755  YRYTGGYWEAREEGKWDACPDIFGHV  780



>ref|XP_006396755.1| hypothetical protein EUTSA_v10028479mg [Eutrema salsugineum]
 gb|ESQ38208.1| hypothetical protein EUTSA_v10028479mg [Eutrema salsugineum]
Length=697

 Score =   213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 4/148 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            +GKWD+S+YY+ G+  +K    + ASLLWK  KPP N+TRYN++SFAITLNELTPGL+EK
Sbjct  550  YGKWDDSLYYVAGDGLNK----ASASLLWKPTKPPPNVTRYNLTSFAITLNELTPGLEEK  605

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRK+QE+GW+PRWFE +GE  +++
Sbjct  606  LPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRMSRKIQESGWRPRWFEPQGESESYK  665

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTL  445
            Y GGYWE RE   WD CPNIFG+  + +
Sbjct  666  YTGGYWEAREERSWDDCPNIFGEFTEEI  693



>ref|XP_008809036.1| PREDICTED: oxysterol-binding protein-related protein 2A-like 
isoform X1 [Phoenix dactylifera]
Length=757

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 118/149 (79%), Gaps = 5/149 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             G+WD+S+YY  G+  SK K       ASLLWK NKPP N TRYN+SSFAITLNELT  L
Sbjct  599  MGRWDDSMYYAKGDHISKIKGSNLTQSASLLWKRNKPPTNPTRYNLSSFAITLNELTSEL  658

Query  173  --KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
              KEKLPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSRKLQENGWKPRWF+R+ E
Sbjct  659  QIKEKLPPTDSRLRPDQRHLENGEYEKANTEKQRLEKRQRMSRKLQENGWKPRWFQRDCE  718

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFGQV  433
              T+RY+GGYWE RE  KWDGC NIFG++
Sbjct  719  HDTYRYIGGYWEAREEKKWDGCLNIFGEI  747



>gb|AAM97165.2| putative oxysterol binding protein [Oryza sativa Japonica Group]
Length=804

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+ G+   K K   + S+A LLWK +KPP+  TRYN + FAITLNELT GL
Sbjct  650  FGKWDESMHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFAITLNELTAGL  709

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY++ANAEKLRLE RQR +RK+QE+GWKPRWF ++    
Sbjct  710  KEKLPPTDSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATD  769

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQTLI  448
            T+RY+GGYWE+RE G W+GCP+IFGQV   L+
Sbjct  770  TYRYLGGYWESREKGSWEGCPDIFGQVPNDLM  801



>gb|EMS56556.1| hypothetical protein TRIUR3_30704 [Triticum urartu]
Length=644

 Score =   212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 118/147 (80%), Gaps = 5/147 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSK-----PKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTP  166
             GKWDES+Y +  +  SK         + A+LLWK N+PP + TRYN+SSFAITLNELTP
Sbjct  479  MGKWDESMYCVVSDDASKLNSHISHQSAGATLLWKKNEPPADPTRYNLSSFAITLNELTP  538

Query  167  GLKEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGE  346
            GLKEKLPPTDSRLRPDQR LENGEY+KAN+EKLRLE RQRM+R +QE+GWKPRWF+R+ E
Sbjct  539  GLKEKLPPTDSRLRPDQRHLENGEYEKANSEKLRLETRQRMARNMQESGWKPRWFQRDSE  598

Query  347  DGTFRYVGGYWETRENGKWDGCPNIFG  427
             GT+RYVGGYWE RE  KW GC +IFG
Sbjct  599  HGTYRYVGGYWEAREQTKWVGCSDIFG  625



>ref|XP_003601101.1| Oxysterol-binding protein-related protein [Medicago truncatula]
 gb|AES71352.1| OSBP(oxysterol-binding protein)-related protein 1C [Medicago 
truncatula]
Length=785

 Score =   214 bits (544),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LS+A LLWK +K P   TRYN + FAITLNELTPGL
Sbjct  626  FGKWDESMHYVNGDYTGKGKGHESLSEAHLLWKRSKAPMFPTRYNFTRFAITLNELTPGL  685

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE+GW+PRWF ++   G
Sbjct  686  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQESGWRPRWFAKDKASG  745

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE   WD CP+IFGQ+
Sbjct  746  TYRYMGGYWEAREKRNWDTCPDIFGQI  772



>gb|KEH34850.1| OSBP(oxysterol-binding protein)-related protein 1C [Medicago 
truncatula]
Length=784

 Score =   214 bits (544),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG++  K K    LS+A LLWK +K P   TRYN + FAITLNELTPGL
Sbjct  625  FGKWDESMHYVNGDYTGKGKGHESLSEAHLLWKRSKAPMFPTRYNFTRFAITLNELTPGL  684

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE+GW+PRWF ++   G
Sbjct  685  KEKLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQESGWRPRWFAKDKASG  744

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
            T+RY+GGYWE RE   WD CP+IFGQ+
Sbjct  745  TYRYMGGYWEAREKRNWDTCPDIFGQI  771



>ref|XP_011027610.1| PREDICTED: oxysterol-binding protein-related protein 1C isoform 
X3 [Populus euphratica]
Length=526

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+++ K K    + +A +LWK +KPP+  TRYN++ FAITLNELTPGL
Sbjct  373  FGKWDESMHYMNGDFSGKGKGFESMKEAHMLWKRSKPPRFPTRYNLTRFAITLNELTPGL  432

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            +EKLPPTDSRLRPDQR LENGE+D AN+EKLRLE RQR +RK+QE GW+PRWF ++    
Sbjct  433  EEKLPPTDSRLRPDQRYLENGEFDMANSEKLRLEQRQRQARKMQERGWQPRWFAKDKGSD  492

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
             +RYVGGYWE R+ G WD CP+IFGQ+
Sbjct  493  AYRYVGGYWEARDKGDWDSCPDIFGQI  519



>ref|XP_010496544.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X3 [Camelina sativa]
 ref|XP_010496545.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X3 [Camelina sativa]
Length=374

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++++ G+ + K K    +S A LLWK +KPP N T+YN++ FAITLNELTPGL
Sbjct  220  FGKWDESMHFVTGDCSGKGKLSEAMSGAQLLWKRSKPPGNATKYNLTRFAITLNELTPGL  279

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE+LPPTDSRLRPDQR LENGE++ AN EKLRLE RQR +RK+QE GWKPRWF +E    
Sbjct  280  KERLPPTDSRLRPDQRYLENGEFEMANTEKLRLEQRQRQARKMQERGWKPRWFMKEKGSE  339

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVD  436
            ++RY GGYWE RENG W  CP+IFG VD
Sbjct  340  SYRYKGGYWEARENGLWADCPDIFGHVD  367



>gb|EMS63065.1| Oxysterol-binding protein-related protein 2A [Triticum urartu]
Length=669

 Score =   212 bits (540),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 6/145 (4%)
 Frame = +2

Query  5    GKWDESIY--YLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKE  178
            GKWDES+Y    N   NS     ++++LLW+ ++PP N TRYN+SSFAITLNELTP LKE
Sbjct  515  GKWDESLYCNVTNDGVNSS----AESTLLWEKHEPPTNPTRYNLSSFAITLNELTPNLKE  570

Query  179  KLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTF  358
            KLPPTDSRLRPDQR LENGEYDKAN+EKLRLE RQRM+RK+Q+NGWKPRWF+R+ EDG F
Sbjct  571  KLPPTDSRLRPDQRHLENGEYDKANSEKLRLETRQRMARKMQDNGWKPRWFDRDTEDGAF  630

Query  359  RYVGGYWETRENGKWDGCPNIFGQV  433
             Y GGYWE RE  KWDGC +IFG++
Sbjct  631  HYTGGYWEAREQRKWDGCRDIFGEL  655



>gb|KGN50972.1| hypothetical protein Csa_5G381780 [Cucumis sativus]
Length=811

 Score =   214 bits (544),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+   K K    LS++ LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  658  FGKWDESMHYMNGDCPHKGKGLDSLSESHLLWKRSKPPKFSTRYNFTRFAITLNELTPGL  717

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  718  KENLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  777

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
             +RY+GGYWE RE GKWD CP+IFGQ+
Sbjct  778  AYRYIGGYWEAREQGKWDSCPDIFGQI  804



>ref|XP_009380271.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=835

 Score =   214 bits (544),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+NG+ + K K     S+A +LWK +KPP+  TRYN++ FA+T+NELTPGL
Sbjct  682  IGKWDESMHYVNGDCSGKGKGSDPFSEAHILWKRSKPPKYPTRYNLTRFAMTINELTPGL  741

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGE++ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  742  KEKLPPTDSRLRPDQRCLENGEFEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  801

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
             +RY+GGYWE RE GKWDGCP+IFGQV  DQ +
Sbjct  802  MYRYIGGYWEAREEGKWDGCPDIFGQVAIDQMI  834



>gb|EMT12148.1| Oxysterol-binding protein-C2F12.05c-like protein [Aegilops tauschii]
Length=660

 Score =   212 bits (539),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 6/145 (4%)
 Frame = +2

Query  5    GKWDESIY--YLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKE  178
            GKWDES+Y    N   NS     ++++LLW+ ++PP N TRYN+SSFAITLNELTP LKE
Sbjct  506  GKWDESLYCNVTNDGVNSS----AESTLLWEKHEPPTNPTRYNLSSFAITLNELTPNLKE  561

Query  179  KLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTF  358
            KLPPTDSRLRPDQR LENGEYDKAN+EKLRLE RQRM+RK+Q+NGWKPRWF+R+ EDG F
Sbjct  562  KLPPTDSRLRPDQRHLENGEYDKANSEKLRLETRQRMARKMQDNGWKPRWFDRDTEDGAF  621

Query  359  RYVGGYWETRENGKWDGCPNIFGQV  433
             Y GGYWE RE  KWDGC +IFG++
Sbjct  622  HYTGGYWEAREQRKWDGCRDIFGEL  646



>ref|XP_004168382.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
[Cucumis sativus]
Length=731

 Score =   213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPK---DLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
            FGKWDES++Y+NG+   K K    LS++ LLWK +KPP+  TRYN + FAITLNELTPGL
Sbjct  578  FGKWDESMHYMNGDCPHKGKGLDSLSESHLLWKRSKPPKFSTRYNFTRFAITLNELTPGL  637

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KE LPPTDSRLRPDQR LENGEY+ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  638  KENLPPTDSRLRPDQRYLENGEYEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  697

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV  433
             +RY+GGYWE RE GKWD CP+IFGQ+
Sbjct  698  AYRYIGGYWEAREQGKWDSCPDIFGQI  724



>ref|XP_009380272.1| PREDICTED: oxysterol-binding protein-related protein 1C-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=834

 Score =   213 bits (543),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDES++Y+NG+ + K K     S+A +LWK +KPP+  TRYN++ FA+T+NELTPGL
Sbjct  681  IGKWDESMHYVNGDCSGKGKGSDPFSEAHILWKRSKPPKYPTRYNLTRFAMTINELTPGL  740

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            KEKLPPTDSRLRPDQR LENGE++ AN+EKLRLE RQR +RK+QE GWKPRWF ++    
Sbjct  741  KEKLPPTDSRLRPDQRCLENGEFEMANSEKLRLEQRQRQARKMQERGWKPRWFAKDKGSD  800

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQV--DQTL  445
             +RY+GGYWE RE GKWDGCP+IFGQV  DQ +
Sbjct  801  MYRYIGGYWEAREEGKWDGCPDIFGQVAIDQMI  833



>ref|XP_002872658.1| hypothetical protein ARALYDRAFT_490050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48917.1| hypothetical protein ARALYDRAFT_490050 [Arabidopsis lyrata subsp. 
lyrata]
Length=677

 Score =   212 bits (539),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 125/151 (83%), Gaps = 4/151 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKDLSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGLKEK  181
            FGKW++S+YY+ G+  +K    + ASLLWK+ KPP N+TRYN++SFA++LNELTPGL+EK
Sbjct  530  FGKWNDSLYYVAGDGLNK----ASASLLWKATKPPPNVTRYNLTSFAMSLNELTPGLQEK  585

Query  182  LPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDGTFR  361
            LPPTDSRLRPDQR LENGEY+KAN EK RLE RQRMSR++QE+GW+PRWFE +GE  +++
Sbjct  586  LPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRMSRQIQESGWRPRWFEPQGESESYK  645

Query  362  YVGGYWETRENGKWDGCPNIFGQVDQTLINS  454
            Y GGYWE R++  WD CPNIFG+  + +++ 
Sbjct  646  YTGGYWEARDDKSWDDCPNIFGEFTEEVVDC  676



>ref|NP_001061017.1| Os08g0154900 [Oryza sativa Japonica Group]
 dbj|BAC99388.1| putative oxysterol binding protein [Oryza sativa Japonica Group]
 dbj|BAF22931.1| Os08g0154900 [Oryza sativa Japonica Group]
 gb|EAZ05631.1| hypothetical protein OsI_27849 [Oryza sativa Indica Group]
Length=728

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    FGKWDESIYYLNGEWNSKPKD---LSDASLLWKSNKPPQNLTRYNMSSFAITLNELTPGL  172
             GKWDE++YY N +  SK K    L  A LLW+ NKP  N TRYN+SSFAITLNEL+P L
Sbjct  580  IGKWDENMYYSNLD-TSKVKSVDQLKGAVLLWEKNKPSPNPTRYNLSSFAITLNELSPDL  638

Query  173  KEKLPPTDSRLRPDQRSLENGEYDKANAEKLRLEMRQRMSRKLQENGWKPRWFEREGEDG  352
            ++KLPPTDSRLRPDQR LENGEY+KANAEKLRLE RQRMS KLQ+NGWKPRWF+++GEDG
Sbjct  639  QDKLPPTDSRLRPDQRHLENGEYEKANAEKLRLERRQRMSSKLQDNGWKPRWFQKDGEDG  698

Query  353  TFRYVGGYWETRENGKWDGCPNIFGQVDQT  442
            T+R+ GGYWE RE+G+WD C +IFG+  +T
Sbjct  699  TYRFKGGYWEAREHGQWDDCLDIFGEFSET  728



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2314958397494