BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26195_g1_i1 len=1552 path=[1:0-1551]

Length=1552
                                                                      Score     E

ref|XP_009612643.1|  PREDICTED: uncharacterized protein LOC104105915    427   4e-143   
ref|XP_009783461.1|  PREDICTED: uncharacterized protein LOC104232062    423   1e-141   
ref|XP_004238169.1|  PREDICTED: uncharacterized protein LOC101258254    418   9e-140   
ref|XP_009601778.1|  PREDICTED: uncharacterized protein LOC104096995    416   5e-139   
ref|XP_006354903.1|  PREDICTED: uncharacterized protein LOC102604212    416   1e-138   
ref|XP_009792186.1|  PREDICTED: uncharacterized protein LOC104239282    414   3e-138   
ref|XP_002284610.1|  PREDICTED: uncharacterized protein LOC100248838    410   9e-137   Vitis vinifera
ref|XP_011074450.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    401   4e-133   
emb|CDP01344.1|  unnamed protein product                                401   7e-133   
ref|XP_004152798.1|  PREDICTED: uncharacterized protein LOC101221262    398   7e-132   
ref|XP_010275596.1|  PREDICTED: uncharacterized protein LOC104610592    395   1e-130   
gb|KDP38372.1|  hypothetical protein JCGZ_04297                         391   4e-129   
ref|XP_007017291.1|  Uncharacterized protein TCM_033873                 389   4e-128   
ref|XP_010059954.1|  PREDICTED: uncharacterized protein LOC104447907    389   4e-128   
gb|EYU36295.1|  hypothetical protein MIMGU_mgv1a010118mg                387   1e-127   
ref|XP_010684214.1|  PREDICTED: uncharacterized protein LOC104898799    387   2e-127   
gb|EPS68441.1|  hypothetical protein M569_06330                         382   7e-126   
ref|XP_002510245.1|  conserved hypothetical protein                     381   4e-125   Ricinus communis
ref|XP_011017222.1|  PREDICTED: uncharacterized protein LOC105120...    379   2e-124   
ref|XP_008444635.1|  PREDICTED: uncharacterized protein LOC103487906    377   1e-123   
ref|XP_006434803.1|  hypothetical protein CICLE_v10001804mg             377   1e-123   
gb|KDO84229.1|  hypothetical protein CISIN_1g020080mg                   376   4e-123   
ref|XP_010269162.1|  PREDICTED: uncharacterized protein LOC104605907    375   4e-123   
ref|XP_002301192.2|  hypothetical protein POPTR_0002s12920g             375   9e-123   Populus trichocarpa [western balsam poplar]
gb|KHG27250.1|  (Dimethylallyl)adenosine tRNA methylthiotransfera...    374   3e-122   
ref|XP_006473351.1|  PREDICTED: uncharacterized protein LOC102618...    373   6e-122   
gb|KHN04513.1|  hypothetical protein glysoja_019600                     371   1e-121   
ref|XP_003523915.1|  PREDICTED: uncharacterized protein LOC100793928    370   5e-121   
ref|XP_006374963.1|  hypothetical protein POPTR_0014s03160g             369   1e-120   
gb|EYU25404.1|  hypothetical protein MIMGU_mgv1a010269mg                369   2e-120   
ref|XP_007222625.1|  hypothetical protein PRUPE_ppa008511mg             369   3e-120   
ref|XP_009349532.1|  PREDICTED: uncharacterized protein LOC103941076    368   6e-120   
ref|XP_008393822.1|  PREDICTED: uncharacterized protein LOC103455...    367   1e-119   
ref|XP_008376000.1|  PREDICTED: uncharacterized protein LOC103439233    367   1e-119   
ref|XP_011030205.1|  PREDICTED: uncharacterized protein LOC105129719    367   1e-119   
ref|XP_009359164.1|  PREDICTED: uncharacterized protein LOC103949765    366   2e-119   
ref|XP_006473352.1|  PREDICTED: uncharacterized protein LOC102618...    365   3e-119   
ref|XP_010092065.1|  hypothetical protein L484_003369                   364   2e-118   
ref|XP_003589221.1|  hypothetical protein MTR_1g019780                  364   2e-118   
ref|XP_003528257.1|  PREDICTED: uncharacterized protein LOC100789577    363   3e-118   
ref|XP_009359301.1|  PREDICTED: uncharacterized protein LOC103949885    363   3e-118   
ref|XP_009367374.1|  PREDICTED: uncharacterized protein LOC103957035    363   4e-118   
ref|XP_010525993.1|  PREDICTED: uncharacterized protein LOC104803681    363   4e-118   
ref|XP_004499070.1|  PREDICTED: uncharacterized protein LOC101510...    363   7e-118   
ref|XP_004242964.1|  PREDICTED: uncharacterized protein LOC101263039    361   1e-117   
ref|XP_004291123.1|  PREDICTED: uncharacterized protein LOC101308...    362   1e-117   
gb|KHN35670.1|  hypothetical protein glysoja_037580                     362   2e-117   
ref|XP_003544455.1|  PREDICTED: uncharacterized protein LOC100778720    360   4e-117   
ref|XP_010943021.1|  PREDICTED: uncharacterized protein LOC105060...    360   6e-117   
ref|XP_010943019.1|  PREDICTED: uncharacterized protein LOC105060...    359   1e-116   
ref|XP_004499072.1|  PREDICTED: uncharacterized protein LOC101510...    357   2e-115   
ref|XP_008220205.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    356   2e-115   
ref|XP_010943020.1|  PREDICTED: uncharacterized protein LOC105060...    355   8e-115   
ref|XP_007136669.1|  hypothetical protein PHAVU_009G063800g             354   8e-115   
emb|CDX68970.1|  BnaC01g04830D                                          352   1e-113   
gb|KHG12332.1|  IgA FC receptor                                         350   6e-113   
gb|AGI78250.1|  hypothetical protein                                    348   2e-112   
ref|XP_008805813.1|  PREDICTED: uncharacterized protein LOC103718...    348   4e-112   
ref|XP_009123198.1|  PREDICTED: uncharacterized protein LOC103847906    347   7e-112   
ref|XP_010447253.1|  PREDICTED: uncharacterized protein LOC104729925    344   1e-110   
ref|XP_003550342.1|  PREDICTED: uncharacterized protein LOC100816724    344   1e-110   
ref|XP_008805814.1|  PREDICTED: uncharacterized protein LOC103718...    343   2e-110   
gb|KHN12772.1|  hypothetical protein glysoja_008735                     342   6e-110   
ref|XP_002869217.1|  hypothetical protein ARALYDRAFT_913084             341   2e-109   
ref|XP_006286258.1|  hypothetical protein CARUB_v10007833mg             340   4e-109   
ref|XP_006412365.1|  hypothetical protein EUTSA_v10025691mg             340   4e-109   
ref|NP_195064.2|  uncharacterized protein                               339   9e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437770.1|  PREDICTED: uncharacterized protein LOC104721481    338   3e-108   
ref|XP_010432571.1|  PREDICTED: uncharacterized protein LOC104716823    336   1e-107   
gb|KFK29951.1|  hypothetical protein AALP_AA7G199000                    335   3e-107   
ref|XP_009393662.1|  PREDICTED: uncharacterized protein LOC103979...    334   1e-106   
ref|XP_007160839.1|  hypothetical protein PHAVU_001G021000g             335   3e-106   
ref|XP_009388027.1|  PREDICTED: uncharacterized protein LOC103974...    332   3e-106   
ref|NP_001190903.1|  uncharacterized protein                            332   4e-106   
ref|XP_006647945.1|  PREDICTED: uncharacterized protein LOC102718147    330   2e-105   
emb|CDX75347.1|  BnaA01g03550D                                          352   2e-105   
gb|KDO84230.1|  hypothetical protein CISIN_1g020080mg                   328   5e-105   
gb|EEC80221.1|  hypothetical protein OsI_22145                          329   8e-105   Oryza sativa Indica Group [Indian rice]
ref|NP_001057130.1|  Os06g0214100                                       329   9e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393663.1|  PREDICTED: uncharacterized protein LOC103979...    327   5e-104   
ref|XP_009388028.1|  PREDICTED: uncharacterized protein LOC103974...    323   8e-103   
ref|NP_001048198.1|  Os02g0761600                                       323   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003570582.1|  PREDICTED: uncharacterized protein LOC100838...    321   8e-102   
gb|EAY87620.1|  hypothetical protein OsI_09031                          320   2e-101   Oryza sativa Indica Group [Indian rice]
dbj|BAJ96744.1|  predicted protein                                      319   6e-101   
ref|XP_004964889.1|  PREDICTED: uncharacterized protein LOC101770...    318   8e-101   
ref|XP_004954004.1|  PREDICTED: uncharacterized protein LOC101768...    318   2e-100   
ref|XP_009403092.1|  PREDICTED: uncharacterized protein LOC103986723    315   1e-99    
ref|XP_006656766.1|  PREDICTED: uncharacterized protein LOC102717445    316   2e-99    
ref|XP_010236085.1|  PREDICTED: uncharacterized protein LOC100838...    315   2e-99    
ref|XP_004291122.1|  PREDICTED: uncharacterized protein LOC101308...    315   4e-99    
ref|XP_003603021.1|  hypothetical protein MTR_3g101480                  313   5e-99    
gb|AFW85338.1|  hypothetical protein ZEAMMB73_547025                    313   9e-99    
ref|XP_006434802.1|  hypothetical protein CICLE_v10001804mg             311   1e-98    
ref|XP_002454592.1|  hypothetical protein SORBIDRAFT_04g034000          312   3e-98    Sorghum bicolor [broomcorn]
ref|XP_004954005.1|  PREDICTED: uncharacterized protein LOC101768...    311   5e-98    
ref|XP_011017224.1|  PREDICTED: uncharacterized protein LOC105120...    307   2e-97    
ref|NP_001130057.1|  uncharacterized protein LOC100191149               308   6e-97    Zea mays [maize]
ref|XP_006829689.1|  hypothetical protein AMTR_s00126p00040820          308   1e-96    
gb|AFW73561.1|  hypothetical protein ZEAMMB73_717350                    307   2e-96    
gb|AFW73562.1|  hypothetical protein ZEAMMB73_717350                    305   2e-95    
ref|XP_002436698.1|  hypothetical protein SORBIDRAFT_10g007210          304   3e-95    Sorghum bicolor [broomcorn]
ref|XP_009388029.1|  PREDICTED: uncharacterized protein LOC103974...    299   9e-94    
ref|XP_008393823.1|  PREDICTED: uncharacterized protein LOC103455...    296   7e-93    
emb|CDY45040.1|  BnaA08g11790D                                          288   2e-89    
gb|ACN34596.1|  unknown                                                 287   2e-89    Zea mays [maize]
emb|CAB38796.1|  putative protein                                       289   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006434801.1|  hypothetical protein CICLE_v10001804mg             283   1e-88    
ref|XP_006362295.1|  PREDICTED: uncharacterized protein LOC102600761    287   1e-88    
gb|EMS60795.1|  Methionine aminopeptidase 1D, chloroplastic/mitoc...    293   1e-88    
gb|ADE75719.1|  unknown                                                 277   7e-85    
emb|CAN63228.1|  hypothetical protein VITISV_002667                     258   2e-77    Vitis vinifera
ref|XP_010229900.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    239   3e-70    
ref|XP_002984798.1|  hypothetical protein SELMODRAFT_423965             235   7e-69    
gb|ACF88235.1|  unknown                                                 220   3e-65    Zea mays [maize]
ref|XP_002985862.1|  hypothetical protein SELMODRAFT_234911             223   4e-64    
ref|XP_001774116.1|  predicted protein                                  213   2e-60    
ref|XP_001769776.1|  predicted protein                                  214   4e-58    
gb|ADZ13509.1|  putative protein B                                      186   8e-52    
emb|CAN80094.1|  hypothetical protein VITISV_010722                     185   8e-51    Vitis vinifera
gb|AFW76804.1|  hypothetical protein ZEAMMB73_272307                    169   1e-43    
gb|AFW76803.1|  hypothetical protein ZEAMMB73_272307                    169   1e-43    
ref|NP_001136953.1|  uncharacterized protein LOC100217112               150   1e-39    Zea mays [maize]
gb|ABR26066.1|  unknown                                                 137   3e-35    Oryza sativa Indica Group [Indian rice]
gb|AEI28159.1|  hypothetical protein                                    132   1e-33    
ref|XP_004959369.1|  PREDICTED: uncharacterized protein LOC101780882    133   2e-32    
gb|ADR78659.1|  hypothetical protein                                    129   2e-32    
gb|ADR78661.1|  hypothetical protein                                    126   2e-31    
gb|AFK49337.1|  unknown                                                 128   5e-31    
ref|XP_001762383.1|  predicted protein                                  135   9e-31    
gb|ADR78660.1|  hypothetical protein                                    122   2e-30    
gb|ACU20810.1|  unknown                                                 125   8e-30    Glycine max [soybeans]
emb|CDY68861.1|  BnaCnng60790D                                          117   5e-27    
ref|XP_001783035.1|  predicted protein                                  117   3e-25    
ref|XP_002505751.1|  predicted protein                                  107   5e-23    Micromonas commoda
ref|XP_007514565.1|  predicted protein                                99.4    3e-20    
ref|XP_007216613.1|  hypothetical protein PRUPE_ppa027086mg           99.0    4e-20    
gb|KFM24984.1|  hypothetical protein F751_1863                        96.3    6e-19    
ref|XP_002499513.1|  predicted protein                                94.4    2e-18    Micromonas commoda
ref|XP_002984742.1|  hypothetical protein SELMODRAFT_423876           90.9    1e-17    
gb|AFW69564.1|  hypothetical protein ZEAMMB73_060422                  90.1    3e-17    
ref|XP_001421288.1|  predicted protein                                89.4    1e-16    Ostreococcus lucimarinus CCE9901
ref|XP_002985804.1|  hypothetical protein SELMODRAFT_424824           87.4    2e-16    
ref|XP_002952736.1|  hypothetical protein VOLCADRAFT_105646           85.1    4e-15    
ref|XP_005847820.1|  hypothetical protein CHLNCDRAFT_134029           84.0    1e-14    
emb|CDY46120.1|  BnaA03g52480D                                        79.0    4e-14    
emb|CEG01776.1|  unnamed product                                      81.6    1e-13    
ref|XP_003083314.1|  unnamed protein product                          79.3    2e-13    
ref|XP_007513486.1|  predicted protein                                79.3    7e-13    
ref|XP_002973851.1|  hypothetical protein SELMODRAFT_414240           75.9    2e-12    
ref|XP_002983542.1|  hypothetical protein SELMODRAFT_445538           75.9    2e-12    
ref|XP_002505080.1|  predicted protein                                74.7    9e-12    Micromonas commoda
ref|XP_005758211.1|  hypothetical protein EMIHUDRAFT_219870           74.7    1e-11    
ref|XP_005794401.1|  hypothetical protein EMIHUDRAFT_194609           72.0    4e-11    
ref|XP_007514831.1|  predicted protein                                74.3    7e-11    
ref|XP_003060249.1|  predicted protein                                73.9    8e-11    
ref|XP_002946154.1|  hypothetical protein VOLCADRAFT_86136            72.4    2e-10    
ref|XP_001421253.1|  predicted protein                                69.3    4e-10    Ostreococcus lucimarinus CCE9901
ref|XP_005842701.1|  hypothetical protein CHLNCDRAFT_136271           69.7    5e-10    
ref|XP_001754137.1|  predicted protein                                70.5    5e-10    
ref|XP_005768484.1|  hypothetical protein EMIHUDRAFT_211123           68.6    1e-09    
ref|XP_005784426.1|  hypothetical protein EMIHUDRAFT_99002            66.6    7e-09    
ref|XP_001696577.1|  peptidyl-prolyl cis-trans isomerase, cycloph...  65.9    3e-08    Chlamydomonas reinhardtii
ref|XP_001690321.1|  hypothetical protein CHLREDRAFT_188317           64.7    4e-08    Chlamydomonas reinhardtii
gb|AFW73560.1|  hypothetical protein ZEAMMB73_717350                  62.4    5e-08    
gb|KDD75276.1|  hypothetical protein H632_c772p0                      62.0    9e-08    
ref|XP_002950021.1|  hypothetical protein VOLCADRAFT_74454            63.2    3e-07    
ref|XP_007512600.1|  predicted protein                                62.8    4e-07    
ref|XP_002955379.1|  hypothetical protein VOLCADRAFT_106781           62.0    8e-07    
ref|XP_002951719.1|  hypothetical protein VOLCADRAFT_105231           60.8    1e-06    
gb|AEJ54429.1|  hypothetical protein                                  56.2    1e-06    
ref|XP_001703364.1|  hypothetical protein CHLREDRAFT_205629           58.9    2e-06    Chlamydomonas reinhardtii
ref|XP_001689603.1|  predicted protein                                60.5    2e-06    Chlamydomonas reinhardtii
ref|XP_005761972.1|  hypothetical protein EMIHUDRAFT_198031           59.3    2e-06    
ref|XP_005758766.1|  hypothetical protein EMIHUDRAFT_219177           58.5    4e-06    
ref|XP_005648355.1|  hypothetical protein COCSUDRAFT_47447            58.9    7e-06    
ref|XP_005845157.1|  hypothetical protein CHLNCDRAFT_137318           58.5    8e-06    
gb|KDD74436.1|  cofilin/tropomyosin-type actin-binding protein        57.8    1e-05    
ref|XP_005790841.1|  hypothetical protein EMIHUDRAFT_251799           55.1    2e-05    
emb|CDO99331.1|  unnamed protein product                              54.7    2e-05    
ref|XP_009387579.1|  PREDICTED: uncharacterized protein LOC103974...  55.5    4e-05    
ref|XP_010936108.1|  PREDICTED: uncharacterized protein LOC105055808  53.1    5e-05    
ref|XP_009387578.1|  PREDICTED: uncharacterized protein LOC103974...  55.5    6e-05    
ref|XP_008656621.1|  PREDICTED: uncharacterized protein LOC103636...  52.8    7e-05    
emb|CEF96636.1|  Cyclophilin-like peptidyl-prolyl cis-trans isome...  55.5    7e-05    
ref|XP_005776861.1|  hypothetical protein EMIHUDRAFT_238469           54.7    7e-05    
ref|XP_009397926.1|  PREDICTED: uncharacterized protein LOC103982663  54.3    1e-04    
gb|KDD77051.1|  hypothetical protein H632_c31p0                       54.3    2e-04    
ref|XP_003061004.1|  predicted protein                                54.7    2e-04    
ref|XP_005781637.1|  hypothetical protein EMIHUDRAFT_421168           51.2    3e-04    
ref|XP_002502891.1|  predicted protein                                53.9    4e-04    Micromonas commoda
ref|XP_007515750.1|  predicted protein                                53.1    4e-04    
ref|XP_004954372.1|  PREDICTED: uncharacterized protein LOC101773...  50.4    4e-04    
ref|XP_002454780.1|  hypothetical protein SORBIDRAFT_04g037190        50.1    6e-04    Sorghum bicolor [broomcorn]
emb|CEG00521.1|  unnamed product                                      52.8    6e-04    
ref|XP_006854449.1|  hypothetical protein AMTR_s00039p00224620        50.1    7e-04    
ref|XP_003083819.1|  UbiE/COQ5 methyltransferase (ISS)                52.8    8e-04    
ref|XP_006648112.1|  PREDICTED: uncharacterized protein LOC102718148  49.7    0.001    
gb|EMT02411.1|  hypothetical protein F775_43189                       49.7    0.001    



>ref|XP_009612643.1| PREDICTED: uncharacterized protein LOC104105915 [Nicotiana tomentosiformis]
Length=324

 Score =   427 bits (1098),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 258/316 (82%), Gaps = 1/316 (0%)
 Frame = +3

Query  318   RGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTR  497
             RGKWC YK+T I++CS N+ V LYVL SL+ S+Y YPYN +Q+AFRYT DQIRKMEES +
Sbjct  9     RGKWCLYKQTMIVVCSTNIFVALYVLHSLYTSVYMYPYNHTQTAFRYTSDQIRKMEESIQ  68

Query  498   IRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQRE  677
             +RK+ EP ELI +V++LK E L +EKV ++PQ +K+KI DE+L TL+ ++ NA+ T+ ++
Sbjct  69    LRKQLEPIELINVVNRLKIELLKDEKVQQIPQHIKQKIADEILVTLKAVNANADATLLQD  128

Query  678   AVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINR  857
             AVESWR  KLKEA +II    S +TI PEEA +LAR L+ DW E+ EEIGLWIP  + N+
Sbjct  129   AVESWRKEKLKEAAEIIHEKTSNSTISPEEASLLARALEDDWTELSEEIGLWIPVQITNK  188

Query  858   EHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQ  1034
             EHDDKPEG  EL+ E+IAGK+LPPEC AE+HTDY GAAVRWGLTHHK+SAYECC AC+ Q
Sbjct  189   EHDDKPEGEVELDDEVIAGKQLPPECRAEIHTDYGGAAVRWGLTHHKKSAYECCMACLNQ  248

Query  1035  AKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAH  1214
             AK AK+  KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+E P LNF+ +Y E YRNAH
Sbjct  249   AKHAKTNQKKCNIWVYCPSETGCHSPDIYQHKHQECWLKYAETPTLNFKDRYPETYRNAH  308

Query  1215  PNAPLIVPWMSGVMSV  1262
             PNAP+IVPWMSGV+SV
Sbjct  309   PNAPVIVPWMSGVVSV  324



>ref|XP_009783461.1| PREDICTED: uncharacterized protein LOC104232062 [Nicotiana sylvestris]
Length=323

 Score =   423 bits (1088),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/316 (67%), Positives = 256/316 (81%), Gaps = 1/316 (0%)
 Frame = +3

Query  318   RGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTR  497
             RGKWC YKRT I+ICSIN+ V LYVL SL+ S+Y YPYN +Q+AFRYT DQIRKMEES +
Sbjct  8     RGKWCLYKRTMIVICSINIFVALYVLHSLYTSVYMYPYNHTQTAFRYTSDQIRKMEESIQ  67

Query  498   IRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQRE  677
             +RK+ EP ELI +V++LK E L +EKV ++PQ +K KI DE+L  L+ ++ NA+ TM ++
Sbjct  68    LRKQLEPIELINVVNRLKIELLKDEKVQQIPQHIKWKIADEILVILKAVNANADATMLQD  127

Query  678   AVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINR  857
             AVESWR  KL E  +II    S +TI PEEA +LAR L+ DW E+ EEIGLWIP  + N+
Sbjct  128   AVESWRREKLNEVAEIIHEKTSNSTISPEEASLLARALEDDWAELSEEIGLWIPVQITNK  187

Query  858   EHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQ  1034
             EHDDKPEG E L+ E+IAGK+LPPEC+AELHTDY GAAVRWGLTHHK+SAYECC AC+ Q
Sbjct  188   EHDDKPEGEEELDDEVIAGKQLPPECHAELHTDYGGAAVRWGLTHHKKSAYECCMACLNQ  247

Query  1035  AKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAH  1214
             AK A+   KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+E P LNF+ +Y E+YRNAH
Sbjct  248   AKHARPNQKKCNIWVYCPSETGCHSPDIYQHKHQECWLKYAETPTLNFKDRYPESYRNAH  307

Query  1215  PNAPLIVPWMSGVMSV  1262
             PNAP+IVPWMSGV+SV
Sbjct  308   PNAPVIVPWMSGVVSV  323



>ref|XP_004238169.1| PREDICTED: uncharacterized protein LOC101258254 [Solanum lycopersicum]
Length=329

 Score =   418 bits (1075),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 258/316 (82%), Gaps = 1/316 (0%)
 Frame = +3

Query  318   RGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTR  497
             RG W SYKRTTI+ICSIN+ V LYVL SL+ S+Y YP++D+Q AF+YTP QIRKMEES +
Sbjct  14    RGNWMSYKRTTIVICSINIFVALYVLHSLYTSVYMYPFSDTQKAFKYTPQQIRKMEESIQ  73

Query  498   IRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQRE  677
             +RK+ EP ELI +V+ LK +  ++EKV ++P+ +K+KITDE+L TL+G++ N + TM R+
Sbjct  74    LRKQLEPVELINVVNFLKNKLSMDEKVQQIPEHIKQKITDEILVTLKGVNANEDATMLRD  133

Query  678   AVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINR  857
             AVESWR  KLKE  ++I    S +TI  +EAR+L+R L  +W E+ EEIGLWIP  ++N 
Sbjct  134   AVESWRREKLKETTELIHEKTSNSTISLKEARLLSRALSDNWAELAEEIGLWIPVQIVNT  193

Query  858   EHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQ  1034
             EHDDKPEG E L+ E+IAGK+LP +C+AE+HTDY G AVRWGLTHHKE+AY+CC AC++Q
Sbjct  194   EHDDKPEGEEELDYEVIAGKQLPLQCHAEVHTDYGGDAVRWGLTHHKETAYDCCMACLDQ  253

Query  1035  AKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAH  1214
             AK+A    KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+E PKLNF+ +Y E+YRNAH
Sbjct  254   AKQAGPNQKKCNIWVYCPSETGCHSPDIYQHKHQECWLKYAENPKLNFKDRYPESYRNAH  313

Query  1215  PNAPLIVPWMSGVMSV  1262
             PNAP+IVPWMSGV+SV
Sbjct  314   PNAPVIVPWMSGVVSV  329



>ref|XP_009601778.1| PREDICTED: uncharacterized protein LOC104096995 [Nicotiana tomentosiformis]
Length=320

 Score =   416 bits (1070),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 216/318 (68%), Positives = 255/318 (80%), Gaps = 3/318 (1%)
 Frame = +3

Query  315   TRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPY-NDSQSAFRYTPDQIRKMEES  491
             T  KWCSYKRTTII+C+IN+ V LYVL S + S+Y Y   ND+Q AFRYTPDQ+RKM+ES
Sbjct  4     TEAKWCSYKRTTIIVCAINIFVALYVLHS-YTSVYMYTTRNDTQRAFRYTPDQVRKMDES  62

Query  492   TRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQ  671
              RIRK+ EP  LIKL+  LK+EF ++EK V+VPQ +K+KI DE+LATLRG++   N T Q
Sbjct  63    NRIRKQLEPVHLIKLIKGLKEEFFIDEKEVQVPQQIKQKIADEILATLRGVNAGDNATAQ  122

Query  672   REAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             REAVESWR  KLKEA  +I    S +TI PEEA +LA+ LDVDW ++ EEIGLWIP  VI
Sbjct  123   REAVESWRRKKLKEARKLINRKTSNSTIAPEEASVLAQALDVDWADLAEEIGLWIPVAVI  182

Query  852   NREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACV  1028
             N+E DDKPEG E  + EIIAG+RLPPECN E HTDY G AVRWGLTH KESAYECC AC+
Sbjct  183   NKERDDKPEGEEEFDNEIIAGRRLPPECNVEFHTDYGGDAVRWGLTHPKESAYECCMACL  242

Query  1029  EQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRN  1208
              QAK A   DKKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+EKPK  F+ +YSE+YRN
Sbjct  243   NQAKNAGRNDKKCNIWVYCPSETGCHSPDIYQHKHQECWLKYAEKPKTTFKDRYSESYRN  302

Query  1209  AHPNAPLIVPWMSGVMSV  1262
             AHPNAP++VPWMSG++SV
Sbjct  303   AHPNAPVVVPWMSGIVSV  320



>ref|XP_006354903.1| PREDICTED: uncharacterized protein LOC102604212 [Solanum tuberosum]
Length=329

 Score =   416 bits (1068),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 260/316 (82%), Gaps = 1/316 (0%)
 Frame = +3

Query  318   RGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTR  497
             RGKW SYKRTTI+IC+IN+ + LYVL SL+ S+Y YP++D+Q AF+YTP QIRKMEES +
Sbjct  14    RGKWMSYKRTTIVICTINIFIALYVLHSLYTSVYMYPFSDTQRAFKYTPQQIRKMEESIQ  73

Query  498   IRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQRE  677
             +RK+ EP ELI +V+ LK E L++EKV ++P+ +K+KITDE+L TL+G++ N + T+ ++
Sbjct  74    LRKQLEPVELINVVNGLKNELLMDEKVQQIPEHIKQKITDEILVTLKGVNANEDATVLQD  133

Query  678   AVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINR  857
             AVESWR  KLKEA ++I    S +TI  +EAR+LAR L  +W E+ EEIGLWIP  +IN 
Sbjct  134   AVESWRREKLKEATELIHEKTSNSTISLKEARLLARALGDNWAELSEEIGLWIPVQIINT  193

Query  858   EHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQ  1034
             EHDDKPEG E L+ E+IAGK+LP +C+ E+HTDY G AVRWGLTHHKESAY+CC AC++Q
Sbjct  194   EHDDKPEGEEELDYEVIAGKQLPLQCHTEVHTDYGGDAVRWGLTHHKESAYDCCMACLDQ  253

Query  1035  AKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAH  1214
             AK+A    KKCN+WVYCP+E GC+SPDIYQHKHQECWLKY+E PKLNF+ +Y E+YRNAH
Sbjct  254   AKQAGPNQKKCNVWVYCPSETGCHSPDIYQHKHQECWLKYAENPKLNFKDRYPESYRNAH  313

Query  1215  PNAPLIVPWMSGVMSV  1262
             PNAP+IVPWMSGV+SV
Sbjct  314   PNAPVIVPWMSGVVSV  329



>ref|XP_009792186.1| PREDICTED: uncharacterized protein LOC104239282 [Nicotiana sylvestris]
Length=320

 Score =   414 bits (1065),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 217/316 (69%), Positives = 257/316 (81%), Gaps = 3/316 (1%)
 Frame = +3

Query  321   GKWCSYKRTTIIICSINVVVTLYVLQSLFN-SLYTYPYNDSQSAFRYTPDQIRKMEESTR  497
              KWCSYKRTTI++CSIN+ V LYVL S  + S+YT   ND+Q AFRYTPDQ+RKM+ES R
Sbjct  6     AKWCSYKRTTIVVCSINIFVALYVLHSYTSVSMYT-TRNDTQRAFRYTPDQVRKMDESNR  64

Query  498   IRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQRE  677
             IRK+ EP +LIKL+  LK+EF ++EKVV+VPQ +K+KI DE+LATLRG++   N T QRE
Sbjct  65    IRKQLEPVQLIKLIKGLKEEFFIDEKVVQVPQQIKQKIADEILATLRGVNVGDNATAQRE  124

Query  678   AVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINR  857
             AVESWR  KLKEA  +I    S +TI PEEA +LA+ LDVDW ++ EEIGLWIP  +IN+
Sbjct  125   AVESWRRKKLKEARRLINRKTSNSTIAPEEASVLAQALDVDWADLAEEIGLWIPVAIINK  184

Query  858   EHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQ  1034
             EHDDKPEG E  + EIIAG+RLPPECN ELHTDY G AVRWGLTH KESAYECC AC+ Q
Sbjct  185   EHDDKPEGEEEFDNEIIAGRRLPPECNVELHTDYGGDAVRWGLTHPKESAYECCMACLNQ  244

Query  1035  AKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAH  1214
             A  A   DKKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+EKPK  F+ +YSE+YRNAH
Sbjct  245   ANNAGPNDKKCNIWVYCPSETGCHSPDIYQHKHQECWLKYAEKPKTTFKDRYSESYRNAH  304

Query  1215  PNAPLIVPWMSGVMSV  1262
             PNAP++VPWMSGV+SV
Sbjct  305   PNAPVVVPWMSGVVSV  320



>ref|XP_002284610.1| PREDICTED: uncharacterized protein LOC100248838 [Vitis vinifera]
 emb|CBI19538.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   410 bits (1055),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 203/315 (64%), Positives = 252/315 (80%), Gaps = 6/315 (2%)
 Frame = +3

Query  318   RGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTR  497
             RGKWCSYKRTT+IICSIN+ V LYVL SL+NS+Y     DSQSA +YTPDQIRKMEES R
Sbjct  11    RGKWCSYKRTTLIICSINIAVALYVLHSLYNSIYISSNIDSQSAVKYTPDQIRKMEESIR  70

Query  498   IRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQRE  677
             IR+ SEP EL+KLV +++KE   E   VE+PQP+K+KITDE+L  L+ LD N+N ++QRE
Sbjct  71    IRRASEPVELVKLVKEVEKELSREASEVELPQPIKQKITDEILQRLKSLDHNSNVSVQRE  130

Query  678   AVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINR  857
             AVESWR  K++E     +     +TI PEEA ML R L+ +W  + EEIGLW+P +VI +
Sbjct  131   AVESWRKEKIEE-----VKKSMNSTISPEEAGMLVRALESNWAVLFEEIGLWMPTEVIYK  185

Query  858   EHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQ  1034
             EHDDKPEG E  +  II G+ +PPEC+AE+HTDYDGAAVRWGLTHHK+SA +CC+AC +Q
Sbjct  186   EHDDKPEGEEEFDDGIIPGRPVPPECHAEIHTDYDGAAVRWGLTHHKDSAADCCQACFDQ  245

Query  1035  AKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAH  1214
             A  AK G+KKCNIWVYCP+E GC+SPDIY+HK+ ECWLKY+EKP+LNF+ +YSE+YRNAH
Sbjct  246   ANHAKPGEKKCNIWVYCPSETGCFSPDIYEHKNGECWLKYAEKPRLNFKDKYSESYRNAH  305

Query  1215  PNAPLIVPWMSGVMS  1259
             P+APL VPW+SGV S
Sbjct  306   PSAPLFVPWVSGVAS  320



>ref|XP_011074450.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105159179 
[Sesamum indicum]
Length=310

 Score =   401 bits (1030),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 199/308 (65%), Positives = 243/308 (79%), Gaps = 19/308 (6%)
 Frame = +3

Query  318   RGKW-----CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKM  482
             RG+W     CSYKRTTII+CS+N+VV LYVLQSL+ SLY YP++DSQS F+YT +QIRKM
Sbjct  3     RGEWGHNGRCSYKRTTIIVCSVNIVVALYVLQSLYTSLYMYPFSDSQSTFKYTANQIRKM  62

Query  483   EESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANT  662
             EES +IR+ SEPTELIKLVSQLK               LK+K+ +E+L  LR LD  AN 
Sbjct  63    EESNQIRRASEPTELIKLVSQLKIS-------------LKQKLINEILDRLRSLDAAANA  109

Query  663   TMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPA  842
             T+QREA++SWR  KL+E    I G    +TI PEEA  +A+ L  DWVE+ E+IGLWIP 
Sbjct  110   TLQREAIDSWRKKKLREVKKFIRGKTLNSTILPEEAGAVAKALSSDWVELSEQIGLWIPI  169

Query  843   DVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCR  1019
             +++N+EHDDKPEG E  + EI+ G++LPPEC+AELHTDYDGAAVRWGLTHHKESAY+CC 
Sbjct  170   EIVNKEHDDKPEGEEDFDEEILPGRKLPPECHAELHTDYDGAAVRWGLTHHKESAYDCCM  229

Query  1020  ACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEA  1199
             AC++QAKRAK G+ KCNIWVYCP+E GCYSPDIY+HK+QECWLKYSEKPKLNF+  YSE+
Sbjct  230   ACLDQAKRAKPGEMKCNIWVYCPSETGCYSPDIYEHKNQECWLKYSEKPKLNFKDTYSES  289

Query  1200  YRNAHPNA  1223
             YR++HP A
Sbjct  290   YRDSHPKA  297



>emb|CDP01344.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   401 bits (1031),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 258/324 (80%), Gaps = 2/324 (1%)
 Frame = +3

Query  297   GGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIR  476
              G  N  RGK CSYKR+T+++CSIN+VV L+VL SL+ SLY YPYNDS +AFRYT DQI 
Sbjct  15    SGIYNNGRGKLCSYKRSTLVVCSINIVVALFVLHSLYTSLYRYPYNDSTNAFRYTSDQIS  74

Query  477   KMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNA  656
             KM+ES RIRKESEPTELIKLV +LKKEFL EE+VVEVP  LK+KI DELL  LR ++ + 
Sbjct  75    KMKESIRIRKESEPTELIKLVEELKKEFLREERVVEVPLSLKQKIADELLLRLRAVNASG  134

Query  657   NTTMQR-EAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLW  833
             N+T+QR EAVE WR  KL+E   +  G P+ +T  PEEA +L R L   W E  EEIGLW
Sbjct  135   NSTVQRAEAVEGWRKEKLREVRLLTSGKPANSTFLPEEAGVLVRALGSGWAEFSEEIGLW  194

Query  834   IPADVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYE  1010
             IP  +I+ EHDDKPEG + L+ EI+ G++LPPEC+AELHTDYDGAAV+WGLT+ KESAY+
Sbjct  195   IPLQIIHEEHDDKPEGVDDLDREILPGRQLPPECHAELHTDYDGAAVKWGLTNPKESAYD  254

Query  1011  CCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQY  1190
             CC AC++QAK AK  +KKCNIWVYCP+E GCYSPDIY+HK+QECWLKY+E+PKLNF+  Y
Sbjct  255   CCMACLDQAKMAKPNEKKCNIWVYCPSETGCYSPDIYEHKNQECWLKYAEQPKLNFKDIY  314

Query  1191  SEAYRNAHPNAPLIVPWMSGVMSV  1262
              ++YR++H N P+ V W++GV+SV
Sbjct  315   PDSYRSSHRNVPVTVAWVAGVVSV  338



>ref|XP_004152798.1| PREDICTED: uncharacterized protein LOC101221262 [Cucumis sativus]
 ref|XP_004160043.1| PREDICTED: uncharacterized protein LOC101226883 [Cucumis sativus]
 gb|KGN62533.1| hypothetical protein Csa_2G360010 [Cucumis sativus]
Length=327

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 245/317 (77%), Gaps = 4/317 (1%)
 Frame = +3

Query  318   RGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEEST  494
             RGKW CSYK+TT+IICSIN++V LYV +SL+ SLY Y  NDS S  +YTPDQIRKMEE  
Sbjct  11    RGKWTCSYKKTTVIICSINIIVALYVFRSLYASLYLYSDNDSPSVVKYTPDQIRKMEEFV  70

Query  495   RIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR  674
             R+R+ SEP ELIKLV +LK+    +      P PLK+KIT+E+L  LR L+G++N+T QR
Sbjct  71    RVRRASEPVELIKLVKELKEFSQEQTVDEL-PLPLKQKITEEILLKLRSLNGSSNSTQQR  129

Query  675   EAVESWRVAKLKEANDIIIGNP-STATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             EAVE WR  KL+EAN +I       +T+  E+A  L + L+ DW    E IGLWIP +V+
Sbjct  130   EAVEIWRKEKLEEANKLITEQMLENSTLSFEDAGTLVKALEADWQVFSEAIGLWIPTEVV  189

Query  852   NREHDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACV  1028
             + EHDDKPEG  E + EI+ G+ +PPECNAELHTDYDGAAVRWGLTHHKESA +CC+AC+
Sbjct  190   HTEHDDKPEGVDEFDDEILPGRPVPPECNAELHTDYDGAAVRWGLTHHKESAADCCQACL  249

Query  1029  EQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRN  1208
             + AKRA+ GD+KCNIWVYCP+E GC+SPDIY+HKH ECWLKY+E PKLNF+  Y ++YRN
Sbjct  250   DHAKRAQPGDRKCNIWVYCPSETGCHSPDIYEHKHMECWLKYAENPKLNFKTNYPQSYRN  309

Query  1209  AHPNAPLIVPWMSGVMS  1259
             +HP AP +VPW+SGV+S
Sbjct  310   SHPTAPFVVPWVSGVVS  326



>ref|XP_010275596.1| PREDICTED: uncharacterized protein LOC104610592 [Nelumbo nucifera]
 ref|XP_010275597.1| PREDICTED: uncharacterized protein LOC104610592 [Nelumbo nucifera]
Length=326

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 253/316 (80%), Gaps = 3/316 (1%)
 Frame = +3

Query  318   RGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTR  497
             RGKWCSYKRTT+IIC IN+V  LYVL +L +S+Y +  N   +  +YTPDQIRKM++S R
Sbjct  11    RGKWCSYKRTTVIICCINIVAALYVLYTLCSSVYVF-NNAPPNVLKYTPDQIRKMQDSIR  69

Query  498   IRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQRE  677
             IRK SEP EL++LV ++K EF  E+ VVE+  P+K+KIT E+L  L+GL+ NAN + QRE
Sbjct  70    IRKASEPIELVRLVKEMKGEFSREKSVVELSIPMKQKITIEILQRLKGLNANANVSEQRE  129

Query  678   AVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVIN  854
              VE WR  KLKEA  +I    +  +TI+ +EAR L R L+  W  +LE+IGLWIPA+++N
Sbjct  130   LVEIWRKEKLKEAKQLIRSKKTLNSTIQAKEARNLIRALESGWTMLLEDIGLWIPAEIVN  189

Query  855   REHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVE  1031
              EHDDKPEG E L+ E++AG  +PPEC+AELHTDYDGAAVRWGLTH KESA +CC+AC+E
Sbjct  190   NEHDDKPEGEEELDDEVLAGPPVPPECHAELHTDYDGAAVRWGLTHPKESAADCCQACLE  249

Query  1032  QAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNA  1211
             QAKRAK G  KCNIWVYCP+E GCYSPDIY+HKHQECWLKY+EKPKLNF+ +YS++YR+A
Sbjct  250   QAKRAKRGAMKCNIWVYCPSETGCYSPDIYEHKHQECWLKYAEKPKLNFKDKYSDSYRSA  309

Query  1212  HPNAPLIVPWMSGVMS  1259
             HP APLIVPW+SGV+S
Sbjct  310   HPTAPLIVPWVSGVVS  325



>gb|KDP38372.1| hypothetical protein JCGZ_04297 [Jatropha curcas]
Length=321

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 251/319 (79%), Gaps = 4/319 (1%)
 Frame = +3

Query  315   TRG-KW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEE  488
              RG KW CSYKRTT+I+C IN+VV LYVL+SL+ SLY Y  ND  +  +YTPDQI KMEE
Sbjct  2     ARGVKWGCSYKRTTLIVCFINIVVALYVLRSLYGSLYIYSNNDLDNVVKYTPDQISKMEE  61

Query  489   STRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM  668
             S RIR+ +EP +L+K+V +LK E    EK+VE+P  +K +IT+E+L  LR L+ NAN T 
Sbjct  62    SIRIRRANEPVQLVKVVKELKNELKKYEKMVELPLEIKERITEEILLRLRSLNANANITE  121

Query  669   QREAVESWRVAKLKEANDIIIGN-PSTATIKPEEARMLARvldvdwvevleeIGLWIPAD  845
             QREAVE WR  KL E   +  G     +TI  EEA  L R L+ DW  +LE IGLWIPA+
Sbjct  122   QREAVERWRREKLHEVEQLTNGTWGLNSTILQEEAGPLVRALESDWAMLLENIGLWIPAE  181

Query  846   VINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             ++N+EHDDKPEG E  + +I+ G+ LPPEC AELHTDYDGAAVRWGLTHHKESA +CC+A
Sbjct  182   IVNQEHDDKPEGEEDPDEDILPGRPLPPECRAELHTDYDGAAVRWGLTHHKESAADCCQA  241

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C++QAKRAK G+KKCNIWVYCP+E GCYSPDIY HK+QECWLKY+EKP+LNF+ +YSE+Y
Sbjct  242   CLDQAKRAKPGEKKCNIWVYCPSETGCYSPDIYVHKNQECWLKYAEKPRLNFKDRYSESY  301

Query  1203  RNAHPNAPLIVPWMSGVMS  1259
             RN+HPNAPLIVPW+SGV+S
Sbjct  302   RNSHPNAPLIVPWVSGVVS  320



>ref|XP_007017291.1| Uncharacterized protein TCM_033873 [Theobroma cacao]
 gb|EOY14516.1| Uncharacterized protein TCM_033873 [Theobroma cacao]
Length=332

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 244/314 (78%), Gaps = 5/314 (2%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSYKR T+I+CS+N+V+ LYVL+ L+ SLY Y   D+    +YTPDQIRKMEES +IR+ 
Sbjct  21    CSYKRITLIVCSVNIVIALYVLRHLYASLYIYSNKDN--VVKYTPDQIRKMEESMKIRRA  78

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
             SEP EL+KLV QLK EF  EE V E+PQ +K KITDE+L  LR L  NAN + Q+E VE+
Sbjct  79    SEPVELVKLVKQLKHEFSGEESVAELPQAVKHKITDEILQRLRSLRPNANASEQQEVVET  138

Query  690   WRVAKLKEANDIIIGNPST-ATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KLKEA  + +G     +T+  EEA ML + L+  W  +LE+IGLWIP ++ N+EHD
Sbjct  139   WRKEKLKEAKMLALGGEGLKSTLSQEEAGMLVKTLESSWAMLLEDIGLWIPTEINNKEHD  198

Query  867   DKPEGAEL--EPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAK  1040
             DKPEG E   E +I+AG+ LPPEC AELHTDYDGAAVRWGLTH KESA +CC+AC++QAK
Sbjct  199   DKPEGVEDTDEDQILAGRPLPPECRAELHTDYDGAAVRWGLTHRKESAADCCQACLDQAK  258

Query  1041  RAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPN  1220
              AK G+KKCNIWVYCP E GCYSPDIY+HKH ECWLK SEKP+LNF+  YSEAYRN+HP 
Sbjct  259   HAKPGEKKCNIWVYCPLEGGCYSPDIYEHKHMECWLKASEKPRLNFKDSYSEAYRNSHPT  318

Query  1221  APLIVPWMSGVMSV  1262
             AP+IVPW+SGV+SV
Sbjct  319   APVIVPWVSGVVSV  332



>ref|XP_010059954.1| PREDICTED: uncharacterized protein LOC104447907 [Eucalyptus grandis]
 gb|KCW66443.1| hypothetical protein EUGRSUZ_F00240 [Eucalyptus grandis]
Length=348

 Score =   389 bits (1000),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 253/315 (80%), Gaps = 5/315 (2%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYN--DSQSAFRYTPDQIRKMEESTRIR  503
             CSYKRTT+I+CS+N++V L+VL+ L+ SLY +     D  +  +YTPDQI+KMEES RIR
Sbjct  35    CSYKRTTLIVCSVNILVALFVLRYLYASLYVHSSGAGDPTNVAKYTPDQIKKMEESIRIR  94

Query  504   KESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTT-MQREA  680
             + ++P +L+K+V +L+K+   E  V   P PLK+KITDE+L  L+GLDG+      QR+A
Sbjct  95    RAAKPVQLVKMVKKLEKQMSSEGAVQL-PHPLKQKITDEILQILKGLDGDGKANEQQRDA  153

Query  681   VESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINRE  860
             +ESWR  KL+EA  + +GN   +T+  ++A +L + LD +W  +LE+IGLWIP +VIN+E
Sbjct  154   IESWRKEKLQEAKRVTLGNRVNSTLLVKDAGLLLKALDSNWDVLLEQIGLWIPTEVINKE  213

Query  861   HDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQA  1037
             HDDKPEGA E+E E++ G+ LPPECNAELH+DY G AVRWGLTHHKESA +CC+AC++QA
Sbjct  214   HDDKPEGADEIEEEVLPGRPLPPECNAELHSDYGGDAVRWGLTHHKESAADCCQACLDQA  273

Query  1038  KRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHP  1217
             K A+ G+KKCNIWVYCP+E GCYSPDIY+HK+QECWLKY+E+PKLNF+ QYSEAYR+AHP
Sbjct  274   KYARRGEKKCNIWVYCPSETGCYSPDIYEHKNQECWLKYAEQPKLNFKDQYSEAYRDAHP  333

Query  1218  NAPLIVPWMSGVMSV  1262
             NAPL+VPW+SGV+SV
Sbjct  334   NAPLVVPWVSGVVSV  348



>gb|EYU36295.1| hypothetical protein MIMGU_mgv1a010118mg [Erythranthe guttata]
Length=321

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 252/321 (79%), Gaps = 8/321 (2%)
 Frame = +3

Query  318   RGKW-----CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKM  482
             RG+W     CSYKRTT+I+CS+N++V LYVL+SL  SLY Y  +      +YTP+QIRKM
Sbjct  3     RGEWLHNGRCSYKRTTLIVCSVNIIVALYVLRSLCTSLYIY--SGDYRTVKYTPNQIRKM  60

Query  483   EESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANT  662
             EE+ +IRK SEPTEL+KLV++LK+ F+ EE+ VE+PQ L++K+  E+L  LR LD  AN 
Sbjct  61    EEANQIRKASEPTELVKLVTRLKRNFVNEERAVELPQHLRQKLVHEILDRLRSLDSAANV  120

Query  663   TMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPA  842
             T QREAVESWR  K+KE  ++  G    +TI PEEAR +AR L  DW +  EEIGLWIP 
Sbjct  121   TEQREAVESWREEKIKEVQELNRGEYLNSTILPEEARAVARALSSDWSDFSEEIGLWIPL  180

Query  843   DVINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCR  1019
              +IN+EHDDKPEG +   E I+ G +LPPEC+ ELHTDYDGAAVRWGLTHHKESAY+CC 
Sbjct  181   QIINKEHDDKPEGEDEFEEEILPGTKLPPECHGELHTDYDGAAVRWGLTHHKESAYDCCM  240

Query  1020  ACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEA  1199
             +C++ AKRAK G+ KCNIWVYCP+E GCYSPDIY+HK+QECWLKY+E PKLNF+  Y E+
Sbjct  241   SCLDHAKRAKPGENKCNIWVYCPSETGCYSPDIYEHKNQECWLKYAETPKLNFKDTYPES  300

Query  1200  YRNAHPNAPLIVPWMSGVMSV  1262
             YR++HPNAP+IVPW+SGVMSV
Sbjct  301   YRDSHPNAPVIVPWVSGVMSV  321



>ref|XP_010684214.1| PREDICTED: uncharacterized protein LOC104898799 [Beta vulgaris 
subsp. vulgaris]
Length=327

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 246/319 (77%), Gaps = 4/319 (1%)
 Frame = +3

Query  312   GTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDS-QSAFRYTPDQIRKME  485
             GTR KW CSYKR T+I+CSIN+V+ LYVL  L++S+Y Y  N+S Q   +YTPDQ+ +ME
Sbjct  7     GTRVKWGCSYKRITLIVCSINIVIALYVLHCLYSSVYIYSNNNSSQDNVKYTPDQLMRME  66

Query  486   ESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTT  665
             ES RIR  SEP EL+ L+  L      ++++V++P  LK+ I DE+L  L+ L  +AN T
Sbjct  67    ESVRIRIASEPIELVNLLENLTTVLAEQKRMVKLPLHLKQMIRDEILQQLKALPASANVT  126

Query  666   MQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPA  842
              QREAVESWR AKL+EA  +I+G  + T TI  + A +L   ++  W  V++ +GLWIP 
Sbjct  127   EQREAVESWRQAKLREARQLILGEKNVTLTISRDHAALLVEAMESKWSSVMDVLGLWIPP  186

Query  843   DVINREHDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCR  1019
              +I++EHDDKP G  E E + + G+ +PPEC+AELHTDYDG AVRWGLTHHKESA +CC+
Sbjct  187   VIIHKEHDDKPPGLDEFENDPLPGRPVPPECHAELHTDYDGTAVRWGLTHHKESAADCCQ  246

Query  1020  ACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEA  1199
             AC++QAKRAKSGDKKCN+WVYCP+E GCYSPDIY+HKHQECWLKYSEKPKLNF+ +YSE+
Sbjct  247   ACLDQAKRAKSGDKKCNVWVYCPSETGCYSPDIYEHKHQECWLKYSEKPKLNFKDKYSES  306

Query  1200  YRNAHPNAPLIVPWMSGVM  1256
             YR++HP APL VPW+SGV+
Sbjct  307   YRSSHPGAPLFVPWVSGVV  325



>gb|EPS68441.1| hypothetical protein M569_06330, partial [Genlisea aurea]
Length=314

 Score =   382 bits (982),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 245/314 (78%), Gaps = 4/314 (1%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSY+RTT+ +CS+N+ V LYVL S+++SLY Y +  +Q  FRY+  Q R+ EES  IRK 
Sbjct  1     CSYRRTTLFMCSVNIAVALYVLYSIYSSLYVYSFGIAQPPFRYSSVQARRREESRVIRKA  60

Query  510   SEPTELIKLVSQlkkeflveekvv-evPQPLKRKITDELLATLRGLDGNANTTMQREAVE  686
              +PTELI+LV++L+++   E+  V  +PQ LK  +TDE+L  LR LD +ANTT QREAVE
Sbjct  61    LQPTELIRLVAELQEKLRGEQSFVGTLPQNLKHAMTDEILTALRRLDADANTTQQREAVE  120

Query  687   SWRVAKLKEANDII--IGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINRE  860
             +WRV KLK A  ++   G  S +TI  EEA ++A+VL   W    E IGLW+P +++NRE
Sbjct  121   AWRVEKLKAAEQLLHHQGKASNSTIPHEEAGIVAKVLSSGWSNFQEAIGLWMPVEILNRE  180

Query  861   HDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQA  1037
             HDDKPEGAE LE EI+ G++LPPECNAELHTDYDGAAV+WGLT+ KE+AY+CC AC++QA
Sbjct  181   HDDKPEGAEELEKEILPGRQLPPECNAELHTDYDGAAVKWGLTNPKETAYDCCMACMDQA  240

Query  1038  KRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHP  1217
             KRAK G+ +CN+WVYCP+E GCYSPDIY+H+ QECWLKYSE PKLNF+ +YS++YR  HP
Sbjct  241   KRAKPGENRCNVWVYCPSENGCYSPDIYEHRSQECWLKYSEAPKLNFKDRYSDSYRAVHP  300

Query  1218  NAPLIVPWMSGVMS  1259
             NAP IVPW+SGV+S
Sbjct  301   NAPEIVPWVSGVVS  314



>ref|XP_002510245.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52432.1| conserved hypothetical protein [Ricinus communis]
Length=321

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 201/319 (63%), Positives = 251/319 (79%), Gaps = 4/319 (1%)
 Frame = +3

Query  315   TRG-KW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEE  488
              RG KW CSYKRTT+++CSIN+VV LYVL+SL+ SLY Y  ++  +  +YT DQI KMEE
Sbjct  2     ARGVKWGCSYKRTTLMVCSINIVVALYVLRSLYASLYIYSNHEFNNVAKYTLDQISKMEE  61

Query  489   STRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM  668
             S RIRK  EP +L++LV +LK+E   +EKVVE+P  +K++ITDELL  LR LD NAN   
Sbjct  62    SIRIRKTKEPLQLVQLVKELKEELKRDEKVVELPVDVKQRITDELLLRLRSLDANANIKE  121

Query  669   QREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPAD  845
             QREAVESWR  KL+E   +  G     +TI  +EA ML R L+ DW  + E +GLWIP +
Sbjct  122   QREAVESWRKEKLQEVKQLTYGAGGLNSTILQDEAAMLVRALESDWAVLSENMGLWIPTE  181

Query  846   VINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             +IN EHDDKPEG E   E I+ G+ +PPEC+AELHTDYDGAAVRWGLTHHKESA +CC+A
Sbjct  182   IINEEHDDKPEGEEETEEEILPGRPVPPECHAELHTDYDGAAVRWGLTHHKESAADCCQA  241

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C++QAK AK G+KKCNIWV+CP+E GCYSPDIYQHK+QECWLKY+E P+LNF+ +YSE+Y
Sbjct  242   CLDQAKHAKPGEKKCNIWVFCPSETGCYSPDIYQHKNQECWLKYAETPRLNFKDKYSESY  301

Query  1203  RNAHPNAPLIVPWMSGVMS  1259
             RN+HPNAPL+VPW+SGV+S
Sbjct  302   RNSHPNAPLVVPWVSGVVS  320



>ref|XP_011017222.1| PREDICTED: uncharacterized protein LOC105120641 isoform X1 [Populus 
euphratica]
 ref|XP_011017223.1| PREDICTED: uncharacterized protein LOC105120641 isoform X1 [Populus 
euphratica]
Length=321

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/319 (64%), Positives = 252/319 (79%), Gaps = 4/319 (1%)
 Frame = +3

Query  315   TRG-KW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEE  488
              RG KW CSYKRTT+ +CSIN+ V LYVL+SL+ SLY Y  ND     +YTPDQIRKMEE
Sbjct  2     ARGVKWGCSYKRTTLFVCSINIFVALYVLRSLYASLYLYSNNDFNRVVKYTPDQIRKMEE  61

Query  489   STRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM  668
             S RIR+  EP EL+K+V +LK+EF  EE V+E+P+ +K KITDE+L  LR L+ NAN + 
Sbjct  62    SIRIRRAKEPLELVKIVKELKEEFNREETVIELPKEVKNKITDEILERLRSLNANANISE  121

Query  669   QREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPAD  845
             QR AVE+WR  KL+E   +       T++I  EEA +L R L+ DW  + E IGLW+PA+
Sbjct  122   QRNAVENWRKEKLQELKMLARETEGLTSSILKEEAGILVRALESDWAVLSENIGLWVPAE  181

Query  846   VINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             VI++EHDDKPEG E   E ++ G+ LPPEC+AELHTDYDGAAVRWGLTHHKESA +CC+A
Sbjct  182   VIHQEHDDKPEGEEEPEEEVLPGRPLPPECHAELHTDYDGAAVRWGLTHHKESAADCCQA  241

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C++QAK AK G+KKCN WVYCP+E GCYSPDIYQHK+QECWLKY+EKPKLNF+ +YSE+Y
Sbjct  242   CLDQAKYAKPGEKKCNTWVYCPSETGCYSPDIYQHKNQECWLKYAEKPKLNFKDRYSESY  301

Query  1203  RNAHPNAPLIVPWMSGVMS  1259
             R++HPNAPLIVPW+SGV+S
Sbjct  302   RDSHPNAPLIVPWVSGVVS  320



>ref|XP_008444635.1| PREDICTED: uncharacterized protein LOC103487906 [Cucumis melo]
Length=327

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 246/317 (78%), Gaps = 4/317 (1%)
 Frame = +3

Query  318   RGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEEST  494
             RGKW CSYK+TT+IICSIN++V LYV +SL+ SLY Y  NDS S  +YTPDQIRKMEE  
Sbjct  11    RGKWTCSYKKTTLIICSINIIVALYVFRSLYASLYLYSDNDSPSVVKYTPDQIRKMEEFV  70

Query  495   RIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR  674
             R+R+ SEP ELIKLV +LK+    +      P PLK+KIT+E+L  LR L+ ++N+T QR
Sbjct  71    RVRRASEPVELIKLVKELKEFSQEQTVDEL-PLPLKQKITEEILLRLRSLNSSSNSTEQR  129

Query  675   EAVESWRVAKLKEANDIIIGNP-STATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             EAVE WR  KL+EAN +I       +T+  E+A  L + L+ DW  + E IGLWIP +V+
Sbjct  130   EAVEIWRKEKLEEANKLIAERMIENSTLSLEDAGTLVKALETDWQLLSEAIGLWIPTEVV  189

Query  852   NREHDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACV  1028
             + EHDDKPEG  E + EI+ G+ +PPEC+AELHTDYDGAAVRWGLTHHKESA +CC+AC+
Sbjct  190   HMEHDDKPEGVDEFDDEILPGRPVPPECHAELHTDYDGAAVRWGLTHHKESAADCCQACL  249

Query  1029  EQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRN  1208
             + AKRA+ GD+KCNIWVYCP+E GC+SPDIY+HKH ECWLKY+E PKLNF+  Y ++YRN
Sbjct  250   DHAKRAQPGDRKCNIWVYCPSETGCHSPDIYEHKHMECWLKYAENPKLNFKTNYPQSYRN  309

Query  1209  AHPNAPLIVPWMSGVMS  1259
             +HP APL+VPW+SGV+S
Sbjct  310   SHPTAPLVVPWVSGVVS  326



>ref|XP_006434803.1| hypothetical protein CICLE_v10001804mg [Citrus clementina]
 gb|ESR48043.1| hypothetical protein CICLE_v10001804mg [Citrus clementina]
Length=331

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 251/320 (78%), Gaps = 6/320 (2%)
 Frame = +3

Query  318   RGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEEST  494
             RGKWC SYK+TT+IIC IN+V+ LYVL+S++ S+Y +  ND +   +YTPDQIR MEES 
Sbjct  13    RGKWCCSYKKTTLIICFINIVIALYVLRSIYASIYVFSRNDLK-VVKYTPDQIRNMEESV  71

Query  495   RIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR  674
             RIR+++EP  L+KLV+ LK+EF  +E V E+P+ +K ++ DE+L  L+  D   N + QR
Sbjct  72    RIRRDNEPMALVKLVNGLKQEFSRDESVFELPRAVKLRMIDEILRRLQSSDVKGNVSAQR  131

Query  675   EAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             EAVESWR  KL+EA  + IG     +TI  EEARML RVL+ DW  + EEIGLWIP ++I
Sbjct  132   EAVESWRREKLEEAKQLSIGRQGINSTILQEEARMLVRVLESDWAALSEEIGLWIPTEII  191

Query  852   NREHDDKPEGAE---LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             ++EH DKP+G E   L+ +++ G+  PPEC+AELHTDYDG A+RWGLTHH++SA +CC+A
Sbjct  192   HKEHGDKPKGVEDEDLDEDVLPGRPPPPECHAELHTDYDGVAIRWGLTHHRDSAADCCQA  251

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C+EQAKRAK G  KCNIWVYCPAE GC+SPD Y+HK+QECWLKY+EKPKLNF+ +YSE Y
Sbjct  252   CIEQAKRAKPGQMKCNIWVYCPAETGCHSPDKYEHKYQECWLKYAEKPKLNFKDRYSEKY  311

Query  1203  RNAHPNAPLIVPWMSGVMSV  1262
             RNAHP APL+VPW+SGV+S+
Sbjct  312   RNAHPAAPLVVPWVSGVVSL  331



>gb|KDO84229.1| hypothetical protein CISIN_1g020080mg [Citrus sinensis]
Length=331

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 250/320 (78%), Gaps = 6/320 (2%)
 Frame = +3

Query  318   RGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEEST  494
             RGKWC SYK+TT+IIC IN+V+ LYVL+S++ S+Y +  ND +   +YTPDQIR MEES 
Sbjct  13    RGKWCCSYKKTTLIICFINIVIALYVLRSIYASIYVFSRNDLK-VVKYTPDQIRNMEESV  71

Query  495   RIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR  674
             RIR ++EP  L+KLV+ LK+EF  +E V E+P+ +K ++ DE+L  L+  D   N + QR
Sbjct  72    RIRSDNEPMALVKLVNGLKQEFSRDESVFELPRAVKLRMIDEILRRLQSSDVKGNVSAQR  131

Query  675   EAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             EAVESWR  KL+EA  + IG     +TI  EEARML RVL+ DW  + EEIGLWIP ++I
Sbjct  132   EAVESWRREKLEEAKQLSIGRQGINSTILQEEARMLVRVLESDWAALSEEIGLWIPTEII  191

Query  852   NREHDDKPEGAE---LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             ++EH DKP+G E   L+ +++ G+  PPEC+AELHTDYDG A+RWGLTHH++SA +CC+A
Sbjct  192   HKEHGDKPKGVEDEDLDEDVLPGRPPPPECHAELHTDYDGVAIRWGLTHHRDSAADCCQA  251

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C+EQAKRAK G  KCNIWVYCPAE GC+SPD Y+HK+QECWLKY+EKPKLNF+ +YSE Y
Sbjct  252   CIEQAKRAKPGQMKCNIWVYCPAETGCHSPDKYEHKYQECWLKYAEKPKLNFKDRYSEKY  311

Query  1203  RNAHPNAPLIVPWMSGVMSV  1262
             RNAHP APL+VPW+SGV+S+
Sbjct  312   RNAHPAAPLVVPWVSGVVSL  331



>ref|XP_010269162.1| PREDICTED: uncharacterized protein LOC104605907 [Nelumbo nucifera]
Length=327

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 250/318 (79%), Gaps = 4/318 (1%)
 Frame = +3

Query  318   RGK-WCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEEST  494
             RGK WCSYKRTT +ICSIN+V  LYVL SL  SLY +  N S SAF+Y+ DQI KME+S 
Sbjct  11    RGKXWCSYKRTTAVICSINIVAALYVLHSLSTSLYIF-NNASPSAFKYSQDQIWKMEDSI  69

Query  495   RIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR  674
             RIRK SEP EL++ V ++K+EF  E+  VE+   +K+KIT E+L  L+GL+ NAN + Q+
Sbjct  70    RIRKASEPIELVRSVKEMKEEFSREKSAVEISHSMKQKITHEILQRLKGLNSNANVSEQQ  129

Query  675   EAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             E+VE WR  KL+EA  + +  P+  +TI+ +EA+ L R L+  W  +LEEIGLW+PA++ 
Sbjct  130   ESVELWRKEKLEEAKQLTVLKPTMNSTIQVKEAKNLVRALESGWTMLLEEIGLWMPAEIT  189

Query  852   NREHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACV  1028
             N+EHDDK EG  +L+ +I+ G+++PPEC+AELHTDY G AVRWGLTH KESA +CC+AC 
Sbjct  190   NKEHDDKAEGDQDLDDDILPGRQVPPECHAELHTDYGGTAVRWGLTHPKESAADCCQACF  249

Query  1029  EQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRN  1208
             EQAKRAK G  KCNIWVYCP+E GCYSPDIY+HK+QECWLKY+EKPKLNF+ +YS++YR+
Sbjct  250   EQAKRAKPGQMKCNIWVYCPSETGCYSPDIYEHKNQECWLKYAEKPKLNFKDKYSDSYRS  309

Query  1209  AHPNAPLIVPWMSGVMSV  1262
             AHP AP+IVPW+SGV+S 
Sbjct  310   AHPTAPVIVPWVSGVVST  327



>ref|XP_002301192.2| hypothetical protein POPTR_0002s12920g [Populus trichocarpa]
 gb|EEE80465.2| hypothetical protein POPTR_0002s12920g [Populus trichocarpa]
Length=321

 Score =   375 bits (962),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 250/319 (78%), Gaps = 4/319 (1%)
 Frame = +3

Query  315   TRG-KW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEE  488
              RG KW CSYKRTT+ +CSIN+ + LYVL+SL+ SLY Y  ND     +YTPDQIRKMEE
Sbjct  2     ARGVKWGCSYKRTTLFVCSINIFIALYVLRSLYASLYLYSNNDFNRVVKYTPDQIRKMEE  61

Query  489   STRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM  668
             S RIR+  EP EL+K+V +LK+EF  EE V+E+P+ +K KITDE+L  LR L+ NAN + 
Sbjct  62    SIRIRRAKEPLELVKIVKELKEEFNREETVIELPKEVKNKITDEILERLRSLNANANISE  121

Query  669   QREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPAD  845
             QR AVE WR  KL+E   +       T++I  EEA +L R L+  W  + E IGLW+PA+
Sbjct  122   QRNAVEKWRKEKLQEVKLLARETEGLTSSILKEEAGILVRALESYWAVLSENIGLWVPAE  181

Query  846   VINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             VI++EHDDKPEG E   E ++ G+ LPPEC+AELHTDYDGAAVRWGL+HHKESA +CC+A
Sbjct  182   VIHQEHDDKPEGEEEPEEEVLPGRPLPPECHAELHTDYDGAAVRWGLSHHKESAADCCQA  241

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C++QAK AK G+KKCN WVYCP+E GC+SPDIYQHK+QECWLKY+EKPKLNF+ +YS++Y
Sbjct  242   CLDQAKYAKPGEKKCNTWVYCPSETGCFSPDIYQHKNQECWLKYAEKPKLNFKDRYSDSY  301

Query  1203  RNAHPNAPLIVPWMSGVMS  1259
             R++HPNAPLIVPW+SGV+S
Sbjct  302   RDSHPNAPLIVPWVSGVVS  320



>gb|KHG27250.1| (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB [Gossypium 
arboreum]
Length=346

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 249/333 (75%), Gaps = 25/333 (8%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSYKR T+I+C +N+V+ L+VL+SL++SLY Y   D+    +YTPDQIR+MEES +IR+ 
Sbjct  15    CSYKRITLIVCVVNIVIALFVLRSLYSSLYIYSNKDN--VVKYTPDQIREMEESDKIRRA  72

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
             SEP EL+KL+ ++K EF  +E + E+P+ +K KITDE+L  LR L  NA+ + Q+EAVE+
Sbjct  73    SEPIELVKLIKRIKHEFSSDESLAELPRAVKHKITDEILQRLRSLRPNASISDQQEAVET  132

Query  690   WRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KLKEA  + +G     +T+  EEA ML + L  +W  + EEIGLWIP +VIN+EHD
Sbjct  133   WRKEKLKEAKTLALGGEGLNSTLLQEEAGMLVKALQSNWAALSEEIGLWIPTEVINQEHD  192

Query  867   DKPEGAE---LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQA  1037
             DKPEG E    E +I+AG+ LPP+C+AELHTDYDGAAVRWGLTHHKESA +CC+AC++QA
Sbjct  193   DKPEGVEDTEEEDQILAGRPLPPQCHAELHTDYDGAAVRWGLTHHKESAADCCQACLDQA  252

Query  1038  KRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKY-------------------SE  1160
             K AK G+KKCNIWVYCP+E GCYSPDIYQHKH ECWLK+                   SE
Sbjct  253   KNAKPGEKKCNIWVYCPSENGCYSPDIYQHKHMECWLKFEAFMVLLPSSYTSLQRNLMSE  312

Query  1161  KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             KP+LNF+++YSE YR+ HP AP++VPW+SG++S
Sbjct  313   KPRLNFKNRYSEQYRDRHPKAPVMVPWVSGIIS  345



>ref|XP_006473351.1| PREDICTED: uncharacterized protein LOC102618221 isoform X1 [Citrus 
sinensis]
Length=331

 Score =   373 bits (957),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 192/320 (60%), Positives = 250/320 (78%), Gaps = 6/320 (2%)
 Frame = +3

Query  318   RGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEEST  494
             RGKWC SYK+TT+IIC IN+V+ LYVL+S++ S+Y +  ND +   +YTPDQIR MEES 
Sbjct  13    RGKWCCSYKKTTLIICFINIVIALYVLRSIYASIYVFSRNDLK-VVKYTPDQIRNMEESV  71

Query  495   RIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR  674
             RIR ++EP  L+KLV+ LK+EF  +E V E+P+ +K ++ DE+L  LR  D   N + QR
Sbjct  72    RIRSDNEPMALVKLVNGLKQEFSRDESVFELPRAVKLRMIDEILRRLRSSDVKGNVSAQR  131

Query  675   EAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             EAVESWR  KL+EA  + IG     +TI  EEARML RVL+ DW  + EEIGLWIP ++I
Sbjct  132   EAVESWRREKLEEAKQLSIGRQGINSTILQEEARMLVRVLESDWAALSEEIGLWIPTEII  191

Query  852   NREHDDKPEGAE---LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             ++EH DKP+G E   L+ +++ G+  PPEC+AELHTDYDG AVRWGLTH+++SA +CC++
Sbjct  192   HKEHGDKPKGVEDEDLDEDVLPGRPPPPECHAELHTDYDGVAVRWGLTHNRDSAADCCQS  251

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C+EQAKRAK G  KCNIWVYCPAE GC+SPD Y+HK+QECWLKY+E+PKLNF+ +YSE Y
Sbjct  252   CIEQAKRAKPGQMKCNIWVYCPAETGCHSPDKYEHKYQECWLKYAEEPKLNFKDRYSEKY  311

Query  1203  RNAHPNAPLIVPWMSGVMSV  1262
             RNAHP APL+VPW+SGV+S+
Sbjct  312   RNAHPAAPLVVPWVSGVVSL  331



>gb|KHN04513.1| hypothetical protein glysoja_019600 [Glycine soja]
Length=320

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/318 (60%), Positives = 241/318 (76%), Gaps = 3/318 (1%)
 Frame = +3

Query  315   TRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEES  491
              RGKW CSYK+TT+++C  N+ V LY L SL++SLY Y  N S++   Y+PDQIRKME+S
Sbjct  2     ARGKWVCSYKKTTLLVCFFNIAVALYALHSLYSSLYIYSGNVSRNVALYSPDQIRKMEQS  61

Query  492   TRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD-GNANTTM  668
              +IR E +P ELIK V  L+ EF  E   VE+P+ LK+ I DE+L  LR L+    +   
Sbjct  62    IQIRGEFKPVELIKWVKALEGEFSSETVAVELPRHLKQNIIDEILQRLRSLNFSRTDIAK  121

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADV  848
             +RE VESWR  KL+E    ++   S +TI  EEA ML RVL+ +W  + EEIGLWIPA V
Sbjct  122   EREVVESWRKEKLEEVKSALVKGTSNSTIPHEEAGMLVRVLESNWAVLCEEIGLWIPAQV  181

Query  849   INREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
              N EHDDKPEGAE  E EI+ G+ + PEC+AELHTDYDGAAVRWGLT HK+SA +CC+AC
Sbjct  182   SNEEHDDKPEGAEEFEDEILPGRPVSPECHAELHTDYDGAAVRWGLTFHKDSAADCCQAC  241

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
             ++ AK AK G+KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+EKP+LNF+ +Y E+YR
Sbjct  242   LDHAKHAKEGEKKCNIWVYCPSEFGCHSPDIYQHKHQECWLKYAEKPRLNFKDKYPESYR  301

Query  1206  NAHPNAPLIVPWMSGVMS  1259
             N+HP+AP+IVPW+SGV+S
Sbjct  302   NSHPSAPVIVPWVSGVIS  319



>ref|XP_003523915.1| PREDICTED: uncharacterized protein LOC100793928 [Glycine max]
Length=320

 Score =   370 bits (950),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 239/318 (75%), Gaps = 3/318 (1%)
 Frame = +3

Query  315   TRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEES  491
              RGKW CSYK+TT+++C  N+ V LY L SL++SLY Y  N S++   Y+PDQIRKME S
Sbjct  2     ARGKWVCSYKKTTLLVCFFNIAVALYALHSLYSSLYIYSGNVSRNVALYSPDQIRKMELS  61

Query  492   TRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD-GNANTTM  668
              +IR E +P ELIK V  L+ EF  E   VE+P+ LK+ I DE+L  LR L+    +   
Sbjct  62    IQIRGEFKPVELIKWVKALEGEFSSETVAVELPRHLKQNIIDEILQRLRSLNFSRTDIAK  121

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADV  848
             +RE VESWR  KL+E    ++   S +TI  EEA ML R L+ +W  + EEIGLWIPA V
Sbjct  122   EREVVESWRKEKLEEVKSALVKGTSNSTIPHEEAGMLVRALESNWAVLCEEIGLWIPAQV  181

Query  849   INREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
              N EHDDKPEGAE  E EI+ G+ + PEC+AELHTDYDGAAVRWGLT HK+SA +CC+AC
Sbjct  182   SNEEHDDKPEGAEEFEDEILPGRPVSPECHAELHTDYDGAAVRWGLTFHKDSAADCCQAC  241

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
             ++ AK AK G+KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+EKP+LNF+ +Y E+YR
Sbjct  242   LDHAKHAKEGEKKCNIWVYCPSEFGCHSPDIYQHKHQECWLKYAEKPRLNFKDKYPESYR  301

Query  1206  NAHPNAPLIVPWMSGVMS  1259
             N+HP+AP+IVPW+SGV+S
Sbjct  302   NSHPSAPVIVPWVSGVIS  319



>ref|XP_006374963.1| hypothetical protein POPTR_0014s03160g [Populus trichocarpa]
 gb|ERP52760.1| hypothetical protein POPTR_0014s03160g [Populus trichocarpa]
Length=321

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 250/319 (78%), Gaps = 4/319 (1%)
 Frame = +3

Query  315   TRG-KW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEE  488
              RG KW CSYKR+T+I+CSIN+VV LYVL+SL+ SLY Y  +D     +YTPDQ+RKMEE
Sbjct  2     ARGVKWGCSYKRSTLIVCSINIVVALYVLRSLYASLYLYSNSDFNKVVKYTPDQVRKMEE  61

Query  489   STRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM  668
             S RIR+  EP EL+K+V +LK+EF   E V  +P+ +  +ITDE+L  LR L+ NAN + 
Sbjct  62    SIRIRRAKEPLELVKIVKELKEEFNRGEMVAGLPKEVTGRITDEILQRLRSLNANANISE  121

Query  669   QREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPAD  845
             QR+A+ESWR  KL+E   ++ G     ++I  +EA ML R L+ DW  + E IGLW+PA+
Sbjct  122   QRDAIESWRKEKLQEVKQLVHGTGGLNSSILKQEAGMLERALESDWAVLSENIGLWVPAE  181

Query  846   VINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             +I++EH+DKPEG E   E ++ G+ L PEC+AELHTDY G AVRWGLTHHKESA +CC+A
Sbjct  182   IIHQEHNDKPEGEEDPEEEVLPGRPLSPECHAELHTDYGGVAVRWGLTHHKESAADCCQA  241

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C++QAK AK G+KKCNIWVYCP+E GCYSPDIYQHK+QECWLK++EKPKLNF+ +YS+++
Sbjct  242   CLDQAKYAKPGEKKCNIWVYCPSETGCYSPDIYQHKNQECWLKHAEKPKLNFKDKYSDSF  301

Query  1203  RNAHPNAPLIVPWMSGVMS  1259
             R++HPNAPLIVPW+SGV+S
Sbjct  302   RDSHPNAPLIVPWVSGVVS  320



>gb|EYU25404.1| hypothetical protein MIMGU_mgv1a010269mg [Erythranthe guttata]
Length=317

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/312 (62%), Positives = 238/312 (76%), Gaps = 7/312 (2%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSY R T+I+CSIN+V  L+VL+SL+  L      DS + F Y+PDQIR+M+ S  IRK 
Sbjct  12    CSYNRATLIVCSINIVAALFVLRSLYTHLV-----DSHTTFSYSPDQIRQMQVSNGIRKA  66

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR-EAVE  686
             SEPT+L++LV++LKK    EE VVE+P+ LK K+ DE+L  LR LD   NTT QR   VE
Sbjct  67    SEPTKLVELVTRLKKRIAKEESVVELPRHLKVKLIDEILNRLRSLDAATNTTAQRANTVE  126

Query  687   SWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             +WR  KLKEA  ++ G    +TI PEEA ++ R L   WVE+ EEIGLWIP +++N+EHD
Sbjct  127   TWRKQKLKEAKKLVRGKILNSTILPEEAEIVVRALSSGWVELEEEIGLWIPVEIVNKEHD  186

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKP+G E E EI+ G++LP EC+AELHTDY G AVRWGLTH KESAY+CC AC++QAK A
Sbjct  187   DKPDGEE-EFEILPGRQLPAECHAELHTDYGGVAVRWGLTHPKESAYDCCMACLDQAKNA  245

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
                 KKCNIWVYCP+E GC+SPDIYQHK+QECWLKYSE PKLNF+  YSE+YR+ HPNAP
Sbjct  246   NLDGKKCNIWVYCPSETGCFSPDIYQHKNQECWLKYSETPKLNFKGTYSESYRDTHPNAP  305

Query  1227  LIVPWMSGVMSV  1262
             LIVPW+SGV+SV
Sbjct  306   LIVPWVSGVVSV  317



>ref|XP_007222625.1| hypothetical protein PRUPE_ppa008511mg [Prunus persica]
 gb|EMJ23824.1| hypothetical protein PRUPE_ppa008511mg [Prunus persica]
Length=328

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 193/324 (60%), Positives = 244/324 (75%), Gaps = 4/324 (1%)
 Frame = +3

Query  294   VGGNSNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             VG      R KW CSYK+TT+I+CSIN+VV LYVL+SL+ SLY Y   DS+    YTPDQ
Sbjct  4     VGEWGFKGRAKWGCSYKKTTLIVCSINIVVALYVLRSLYASLYIYSDRDSRPTLEYTPDQ  63

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDG  650
             IRKMEES RIRK +EP ELI+LV +  K+ L  E  VE+PQ LK KIT+E++  L+ L  
Sbjct  64    IRKMEESVRIRKAAEPVELIRLV-KALKKELSREVAVELPQSLKLKITNEIVERLKTLRP  122

Query  651   NANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIG  827
              AN T QRE VE W   KLKEA  + +  N S +TI  EEA ML + L+ +W  +LE++G
Sbjct  123   KANVTEQREFVERWCKEKLKEAKQLALETNASNSTILHEEAEMLVKALESNWTVLLEDMG  182

Query  828   LWIPADVINREHDDKPEGAELE-PEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             LWIPA+++N EH DKPEG E E  +I+ G+ LPPEC+AE+HTDYDGAAVRWGL HHK+SA
Sbjct  183   LWIPAEIVNTEHHDKPEGEEEELDQILPGRPLPPECHAEVHTDYDGAAVRWGLNHHKDSA  242

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QAKRAK  +K+CNIWVYCP+E GC+SPDIY+HK  ECWLKY+E PK NF+ 
Sbjct  243   ADCCQACLDQAKRAKPNEKRCNIWVYCPSEGGCHSPDIYEHKLGECWLKYAETPKRNFKD  302

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVM  1256
             +Y E+YRN HP+APL+VPW SG++
Sbjct  303   KYPESYRNNHPSAPLVVPWASGIV  326



>ref|XP_009349532.1| PREDICTED: uncharacterized protein LOC103941076 [Pyrus x bretschneideri]
Length=330

 Score =   368 bits (944),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 243/327 (74%), Gaps = 5/327 (2%)
 Frame = +3

Query  294   VGGN-SNGTRGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             VGG      RGKW  SYK+TT+I+CSIN+ V LYVL+SL+ SLY Y   D+   F YTPD
Sbjct  4     VGGEWGFKGRGKWAFSYKKTTLIVCSINIAVALYVLRSLYASLYIYSDKDTGPTFEYTPD  63

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             QIRKMEES RIRK +EP ELI+LV +  K+ L  E  VE+PQPLK K+T+E++  L+ L 
Sbjct  64    QIRKMEESIRIRKAAEPVELIRLV-KALKKELYREAAVELPQPLKLKMTNEIINRLKTLR  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeI  824
              NAN T QRE VESW   KLKEA  +      S +TI  EEA ML + L+ D    LE++
Sbjct  123   PNANITEQREVVESWCKEKLKEAKQLATETEASNSTILHEEAEMLVKALESDSTWPLEDL  182

Query  825   GLWIPADVINREHDDKPEGAELE-PEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             GLWIPA++ N EH DKPEG E +  EI+ G+ LPPEC+AE+HTDYDGAAVRWGL +HK+S
Sbjct  183   GLWIPAEIRNTEHHDKPEGEEDDLDEILPGRPLPPECHAEVHTDYDGAAVRWGLNYHKDS  242

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QA+RAK   K+CNIWVYCP+E GCYSPDIY+HK  ECWLKY+E PKLNF+
Sbjct  243   AADCCQACLDQARRAKPNQKRCNIWVYCPSETGCYSPDIYEHKLGECWLKYAETPKLNFK  302

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
              +YSE+YR+ HP+APL+VPW SG++  
Sbjct  303   DKYSESYRDRHPSAPLVVPWASGIVGA  329



>ref|XP_008393822.1| PREDICTED: uncharacterized protein LOC103455983 isoform X1 [Malus 
domestica]
Length=331

 Score =   367 bits (942),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 246/327 (75%), Gaps = 6/327 (2%)
 Frame = +3

Query  294   VGGN-SNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             VGG      RG W  SYK+TT+++CSIN+VV LYVL+SL+ SLY Y   D++  F YTPD
Sbjct  4     VGGEWGFKGRGIWGFSYKKTTLLVCSINIVVALYVLRSLYGSLYIYSDRDTRPTFEYTPD  63

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             QIRKMEES RIRK +EP ELI+LV +  K+ L  E  VE+PQPLK K+T++++  L+ L 
Sbjct  64    QIRKMEESVRIRKAAEPVELIRLV-KALKKELYREVAVELPQPLKLKMTNDIIDRLKTLR  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGN-PSTATIKPEEARMLARvldvdwvevleeI  824
              NAN T QRE VE W   KLKEA  + +    S +T+  EEA ML + L+ D   +LE++
Sbjct  123   PNANITEQREVVERWCKEKLKEAKQLAVETXASNSTVLHEEAEMLVKALESDSTWLLEDL  182

Query  825   GLWIPADVINREHDDKPEG--AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKE  998
             GLWIP ++ N EH DKPEG   EL+ +I+ G+ LPPEC+AE+HTDYDGAAVRWGLTHHK+
Sbjct  183   GLWIPPEIRNTEHHDKPEGEEXELDDQILPGRPLPPECHAEVHTDYDGAAVRWGLTHHKD  242

Query  999   SAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNF  1178
             SA +CC+AC++QAKRAK  +K+CNIWVYCP+E GC+SPDIY+HK  ECWLKY+E PKLNF
Sbjct  243   SAADCCQACLDQAKRAKPNEKRCNIWVYCPSETGCHSPDIYEHKLGECWLKYAETPKLNF  302

Query  1179  QHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             + +Y E+YRN HP+APL+VPW SG++ 
Sbjct  303   KDKYPESYRNRHPSAPLVVPWASGIVG  329



>ref|XP_008376000.1| PREDICTED: uncharacterized protein LOC103439233 [Malus domestica]
Length=329

 Score =   367 bits (942),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 196/327 (60%), Positives = 243/327 (74%), Gaps = 5/327 (2%)
 Frame = +3

Query  294   VGGN-SNGTRGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             VGG      RGKW  SYK+TT+I+CSIN+ V LYVL+SL+ SLY Y   D+   F YTPD
Sbjct  4     VGGEWGXKGRGKWAFSYKKTTLIVCSINIAVALYVLRSLYASLYIYSDKDTGPTFEYTPD  63

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             QIRKMEES RIRK +EP ELI+LV +  K+ L  E  VE+PQPLK K+T+E++  L+ L 
Sbjct  64    QIRKMEESVRIRKAAEPVELIRLV-KALKKELYGEAAVELPQPLKLKMTNEIIDRLKTLR  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeI  824
              NAN T QRE VESW   KLKEA  + I    S +TI  EEA ML + L+ DW  +LE+ 
Sbjct  123   PNANITEQREVVESWCKEKLKEAKQLAIETKASNSTILHEEAEMLVKALESDWTWLLEDX  182

Query  825   GLWIPADVINREHDDKPEGAELE-PEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             GLWIPA++ N EH DKPEG E +  EI+ G+ LPPEC+AE+HTDYDGAAV WGL HHK+S
Sbjct  183   GLWIPAEIHNTEHHDKPEGEEDDLDEILPGRPLPPECHAEVHTDYDGAAVXWGLNHHKDS  242

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QAKRAK    +CNIWVYCP+E GCYSPDIY+HK  ECWLKY+E PKLNF+
Sbjct  243   AADCCQACLDQAKRAKPNQXRCNIWVYCPSETGCYSPDIYEHKLGECWLKYAETPKLNFK  302

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
              +YSE+YR+ HP+APL+VPW SG++  
Sbjct  303   DKYSESYRDRHPSAPLVVPWASGIVGA  329



>ref|XP_011030205.1| PREDICTED: uncharacterized protein LOC105129719 [Populus euphratica]
Length=321

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 249/319 (78%), Gaps = 4/319 (1%)
 Frame = +3

Query  315   TRG-KW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEE  488
              RG KW CSYKR+T+I+CSIN+VV LYVL+SL+ SLY Y   D     +YTPDQ+RKMEE
Sbjct  2     ARGVKWGCSYKRSTLIVCSINIVVALYVLRSLYASLYLYSNIDFNKVVKYTPDQVRKMEE  61

Query  489   STRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM  668
             S RIR+  EP EL+K+V ++K+EF   E V  +P+ +  +ITDE+L  LR L+ NAN + 
Sbjct  62    SIRIRRAKEPLELVKIVKEVKEEFNRGEMVAGLPKQVTARITDEILQRLRSLNANANISE  121

Query  669   QREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPAD  845
             QR+A+ESWR  KL+E   ++ G     ++I  +EA ML R L+ DW  + E +GLW+PA+
Sbjct  122   QRDAIESWRKEKLQEVKQLVHGTGGLNSSILKQEAGMLERALESDWAVLSENVGLWVPAE  181

Query  846   VINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             +I++EH+DKPEG E   E ++ G+ L PEC+AELHTDY G AVRWGLTHHKESA +CC+A
Sbjct  182   IIHQEHNDKPEGEEDPEEEVLPGRPLSPECHAELHTDYGGVAVRWGLTHHKESAADCCQA  241

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C++QAK AK G+KKCNIWVYCP+E GCYSPDIYQHK+QECWLK++EKPKLNF+ +YS+++
Sbjct  242   CLDQAKYAKHGEKKCNIWVYCPSETGCYSPDIYQHKNQECWLKHAEKPKLNFKDKYSDSF  301

Query  1203  RNAHPNAPLIVPWMSGVMS  1259
             R++HP+APLIVPW+SGV+S
Sbjct  302   RDSHPSAPLIVPWVSGVVS  320



>ref|XP_009359164.1| PREDICTED: uncharacterized protein LOC103949765 [Pyrus x bretschneideri]
Length=330

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/327 (60%), Positives = 245/327 (75%), Gaps = 5/327 (2%)
 Frame = +3

Query  294   VGGN-SNGTRGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             VGG      RGKW  SYK+TT+I+CSIN+ V LYVL+SL+ SLY Y   D+   F YTPD
Sbjct  4     VGGEWGFKGRGKWAFSYKKTTLIVCSINIAVALYVLRSLYASLYIYSDKDTGPTFEYTPD  63

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             QIRKMEES RIRK +EP ELI+LV +  K+ L  E  VE+PQPLK K+T+E++  L+ L 
Sbjct  64    QIRKMEESIRIRKAAEPVELIRLV-KALKKELYREAAVELPQPLKLKMTNEIIDRLKTLR  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeI  824
              NAN T QRE VESW   KLKEA  +      S +TI  EEA ML + L+ DW  +LE++
Sbjct  123   PNANITEQREVVESWCKEKLKEAKQLATETEASNSTILHEEAEMLLKALESDWTWLLEDM  182

Query  825   GLWIPADVINREHDDKPEGAELE-PEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             GLWIPA++ N EH DKPEG E +  EI+ G+ LPPEC+AE+HTDYDGAAVRWGL +HK+S
Sbjct  183   GLWIPAEIRNTEHHDKPEGEEDDLDEILPGRPLPPECHAEVHTDYDGAAVRWGLNYHKDS  242

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QA+RAK   K+CNIWVYCP+E GCYSPDIY+HK  ECWLKY+E PKLNF+
Sbjct  243   AADCCQACLDQARRAKPNQKRCNIWVYCPSETGCYSPDIYEHKLGECWLKYAETPKLNFK  302

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
              +YSE+YR+ HP+APL+VPW SG++  
Sbjct  303   DKYSESYRDRHPSAPLVVPWASGIVGA  329



>ref|XP_006473352.1| PREDICTED: uncharacterized protein LOC102618221 isoform X2 [Citrus 
sinensis]
Length=325

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 245/320 (77%), Gaps = 12/320 (4%)
 Frame = +3

Query  318   RGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEEST  494
             RGKWC SYK+TT+IIC IN+V+ LYVL+S++ S+Y +  ND +   +YTPDQIR MEES 
Sbjct  13    RGKWCCSYKKTTLIICFINIVIALYVLRSIYASIYVFSRNDLK-VVKYTPDQIRNMEESV  71

Query  495   RIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQR  674
             RIR ++EP  L+KL      EF  +E V E+P+ +K ++ DE+L  LR  D   N + QR
Sbjct  72    RIRSDNEPMALVKL------EFSRDESVFELPRAVKLRMIDEILRRLRSSDVKGNVSAQR  125

Query  675   EAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVI  851
             EAVESWR  KL+EA  + IG     +TI  EEARML RVL+ DW  + EEIGLWIP ++I
Sbjct  126   EAVESWRREKLEEAKQLSIGRQGINSTILQEEARMLVRVLESDWAALSEEIGLWIPTEII  185

Query  852   NREHDDKPEGAE---LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             ++EH DKP+G E   L+ +++ G+  PPEC+AELHTDYDG AVRWGLTH+++SA +CC++
Sbjct  186   HKEHGDKPKGVEDEDLDEDVLPGRPPPPECHAELHTDYDGVAVRWGLTHNRDSAADCCQS  245

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C+EQAKRAK G  KCNIWVYCPAE GC+SPD Y+HK+QECWLKY+E+PKLNF+ +YSE Y
Sbjct  246   CIEQAKRAKPGQMKCNIWVYCPAETGCHSPDKYEHKYQECWLKYAEEPKLNFKDRYSEKY  305

Query  1203  RNAHPNAPLIVPWMSGVMSV  1262
             RNAHP APL+VPW+SGV+S+
Sbjct  306   RNAHPAAPLVVPWVSGVVSL  325



>ref|XP_010092065.1| hypothetical protein L484_003369 [Morus notabilis]
 gb|EXB50012.1| hypothetical protein L484_003369 [Morus notabilis]
Length=338

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 242/331 (73%), Gaps = 11/331 (3%)
 Frame = +3

Query  300   GNSNGTRGKW---------CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAF  452
             GN    R  W         CSYKRTT+I+C IN+VV LYVL SL+ SLY Y    S    
Sbjct  7     GNQGRERKLWGGVGAGFCNCSYKRTTLILCLINIVVALYVLHSLYASLYIYSDTYSSPVV  66

Query  453   RYTPDQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLAT  632
             +YTPDQIR MEES RIRKE+EP EL+KLV +L+KE   E  VVE+P+ LK+ I+++++  
Sbjct  67    KYTPDQIRNMEESIRIRKEAEPVELVKLVKKLEKELSSEVMVVELPKHLKQSISNDIIHR  126

Query  633   LRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwve  809
             L+ L  N N T QRE VESWR+ KL E   +     +  +TI  EEA ML R L+ +W  
Sbjct  127   LKTLGANPNITEQREVVESWRLEKLNETKKLTYERSAPNSTISHEEAEMLVRALESNWAV  186

Query  810   vleeIGLWIPADVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLT  986
             + EEIGLWIP ++I +EHDDKP+G E  E +I+ G+ +P EC+AELHTDY GAAVRWGLT
Sbjct  187   LSEEIGLWIPPEIIIKEHDDKPDGEEESEEDILPGRPVPLECHAELHTDYGGAAVRWGLT  246

Query  987   HHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKP  1166
              HKESA +CC+AC +QAK A+ G+KKCNIWVYCP+E GC+SPDIYQHK+QECWLKY+EKP
Sbjct  247   FHKESAADCCQACFDQAKHARPGEKKCNIWVYCPSEMGCHSPDIYQHKNQECWLKYAEKP  306

Query  1167  KLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             KLNF+ +Y ++YRN+H  APLIVPW+SGV++
Sbjct  307   KLNFKDKYPDSYRNSHLTAPLIVPWVSGVIT  337



>ref|XP_003589221.1| hypothetical protein MTR_1g019780 [Medicago truncatula]
 gb|AES59472.1| plant/F17M5-140 protein [Medicago truncatula]
Length=339

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 244/333 (73%), Gaps = 10/333 (3%)
 Frame = +3

Query  288   WAVGGNSNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP  464
             W +   S G  GKW CSYK+ TI++C  N+ + LY L+SL+ SLY Y  + S++   Y P
Sbjct  7     WGIQLQSRGG-GKWVCSYKKITILVCLFNIAIALYCLRSLYASLYIYSGSVSRNIVVYKP  65

Query  465   DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGL  644
             DQIRKMEES RIR   +P +L+KLV +L+ EF ++   VE+PQ LK+KI DE+L  L  L
Sbjct  66    DQIRKMEESNRIRTSYKPVKLMKLVKELEGEFSIQNTEVELPQHLKQKIIDEVLQRLVSL  125

Query  645   DGNANT-------TMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdw  803
             +  +N         M+R+AVE+WR  KL+E   +  G  S +TI  EEA ML + L+ DW
Sbjct  126   NSRSNNGSHSQGIAMERDAVENWRKEKLEEVKLVSAGGISNSTISHEEAGMLVKALESDW  185

Query  804   vevleeIGLWIPADVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWG  980
               + EEIGLWIP +V+N EH+DKP+G E LE E++ G+ LPPEC  ELHTDYDG+AVRWG
Sbjct  186   AVLAEEIGLWIPVEVVNVEHNDKPDGVEDLEEEVLPGRALPPECKPELHTDYDGSAVRWG  245

Query  981   LTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE  1160
             LTHHK+SA +CC+AC++ AKRAK G+KKCNIWVYCP+E GC+SPDIYQHKH ECWLKY+E
Sbjct  246   LTHHKDSAADCCQACLDHAKRAKEGEKKCNIWVYCPSEFGCHSPDIYQHKHMECWLKYAE  305

Query  1161  KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             KPKLNF+ +Y E YRN+ P+AP+IVPW SGV++
Sbjct  306   KPKLNFKDRYPEWYRNSRPSAPVIVPWASGVVA  338



>ref|XP_003528257.1| PREDICTED: uncharacterized protein LOC100789577 [Glycine max]
 gb|KHN22307.1| hypothetical protein glysoja_022063 [Glycine soja]
Length=320

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 192/318 (60%), Positives = 244/318 (77%), Gaps = 3/318 (1%)
 Frame = +3

Query  315   TRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEES  491
              RGKW CSYK+TT+++C  N+ V LYVL+SL+ SLY Y  N S++A  Y+PDQIRKMEES
Sbjct  2     ARGKWVCSYKKTTLLVCFFNIAVALYVLRSLYASLYIYSGNVSRNAALYSPDQIRKMEES  61

Query  492   TRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGN-ANTTM  668
              +IR E +P ELIK V  L+ EF  E + V++P  LK+ I DE+L  LR L+ +  +  M
Sbjct  62    IQIRWEFKPVELIKWVKALEAEFSSETEAVKLPWHLKQNIIDEILQRLRSLNSSRTDIAM  121

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADV  848
             +RE VESWR  KL+E    ++   S +TI  EEA ML R L+ DW  + EEIGLWIPA V
Sbjct  122   EREVVESWRKEKLEEVKSALVKGTSNSTIPHEEAGMLVRALESDWAVLCEEIGLWIPAQV  181

Query  849   INREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
              N+EHDDKPEGAE   E ++ G+ + PEC+AELHTDYDGAAVRWGLT HK+SA +CC+AC
Sbjct  182   SNKEHDDKPEGAEEFEEEVLPGRPVSPECHAELHTDYDGAAVRWGLTFHKDSAADCCQAC  241

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
             ++ AK AK G+KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+EKP+LNF+ +Y E+YR
Sbjct  242   LDHAKHAKEGEKKCNIWVYCPSEFGCHSPDIYQHKHQECWLKYAEKPRLNFKDKYPESYR  301

Query  1206  NAHPNAPLIVPWMSGVMS  1259
             N+HP+AP+IVPW+SGV+S
Sbjct  302   NSHPSAPVIVPWVSGVIS  319



>ref|XP_009359301.1| PREDICTED: uncharacterized protein LOC103949885 [Pyrus x bretschneideri]
Length=330

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 244/327 (75%), Gaps = 5/327 (2%)
 Frame = +3

Query  294   VGGN-SNGTRGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             VGG      RGKW  SYK+TT+I+CSIN+ V LYVL+SL+ SLY Y   D+   F YTPD
Sbjct  4     VGGEWGFKGRGKWAFSYKKTTLIVCSINIAVALYVLRSLYASLYIYSDKDTGPTFEYTPD  63

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             QIRKMEES RIRK +EP ELI+LV +  K+ L  E  VE+PQPLK K+T+E++  L+ L 
Sbjct  64    QIRKMEESIRIRKAAEPVELIRLV-KALKKELYREAAVELPQPLKLKMTNEIIDRLKTLR  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeI  824
              NAN T QRE VESW   KLKEA  +      S +TI  EEA ML + L+ DW  +LE++
Sbjct  123   PNANITEQREVVESWCKEKLKEAKQLATETEASNSTILHEEAEMLLKALESDWTWLLEDM  182

Query  825   GLWIPADVINREHDDKPEGAELE-PEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             GLWI A++ N EH DKPEG E +  EI+ G+ LPPEC+AE+HTDYDGAAVRWGL +HK+S
Sbjct  183   GLWITAEIRNTEHHDKPEGEEDDLDEILPGRPLPPECHAEVHTDYDGAAVRWGLNYHKDS  242

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QA+RAK   K+CNIWVYCP+E GCYSPDIY+HK  ECWLKY+E PKLNF+
Sbjct  243   AADCCQACLDQARRAKPNQKRCNIWVYCPSETGCYSPDIYEHKLGECWLKYAETPKLNFK  302

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
              +YSE+YR+ HP+APL+VPW SG++  
Sbjct  303   DKYSESYRDRHPSAPLVVPWASGIVGA  329



>ref|XP_009367374.1| PREDICTED: uncharacterized protein LOC103957035 [Pyrus x bretschneideri]
Length=331

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/327 (58%), Positives = 242/327 (74%), Gaps = 6/327 (2%)
 Frame = +3

Query  294   VGGN-SNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             VGG      RG W  SYK+TT+++CSIN+VV LYVL+SL+ SLY Y   D++  F YTPD
Sbjct  4     VGGEWGFKGRGIWGFSYKKTTLLVCSINIVVALYVLRSLYGSLYIYSDRDTRHTFEYTPD  63

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             QIRKMEES RIRK +EP ELI+LV +  K+ L  E  VE+PQPLK K+T+E++  L+ L 
Sbjct  64    QIRKMEESVRIRKAAEPVELIRLV-KALKKELYREVAVELPQPLKLKMTNEIIDRLKTLR  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeI  824
               AN T QRE VE W   KLKEA  + I    S +T+  EEA ML + L+ D    LE++
Sbjct  123   PKANITEQREVVERWCKEKLKEAKQLAIETETSNSTVLHEEAEMLVKALESDSTWPLEDL  182

Query  825   GLWIPADVINREHDDKPEGAE--LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKE  998
             GLWIP ++ N EH DKPEG E  L+ +I+ G+ LPPEC+AE+HTDYDGAAVRWGL HHK+
Sbjct  183   GLWIPPEIRNTEHHDKPEGEEEELDDQILPGRPLPPECHAEVHTDYDGAAVRWGLNHHKD  242

Query  999   SAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNF  1178
             SA +CC+AC++QAKRAK  +K+CNIWVYCP+E GC+SPDIY+HK  ECWLKY+E PKLNF
Sbjct  243   SAADCCQACLDQAKRAKPNEKRCNIWVYCPSETGCHSPDIYEHKLGECWLKYAETPKLNF  302

Query  1179  QHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             + +Y E+YRN HP+AP +VPW SG++ 
Sbjct  303   KDKYPESYRNRHPSAPFVVPWASGIVG  329



>ref|XP_010525993.1| PREDICTED: uncharacterized protein LOC104803681 [Tarenaya hassleriana]
Length=333

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/309 (58%), Positives = 240/309 (78%), Gaps = 1/309 (0%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKES  512
             S K+ T+++C +N++V LYVL+S + S   + Y++++   +YT D+ RKMEES RIR+  
Sbjct  25    SRKKITLLVCFLNILVALYVLRSRYVS-SLHLYSNNEQVAKYTADETRKMEESIRIRRSK  83

Query  513   EPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVESW  692
             EP EL++LV +L  EF +EE  +E+ QP+K++I D++L  L+ LD   N T QREAVE+W
Sbjct  84    EPIELVRLVKKLNHEFSIEEPRIELSQPVKQRIVDQILHRLKSLDEKLNVTQQREAVENW  143

Query  693   RVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHDDK  872
             R  KLKE  ++ +G+  T +   +EA MLAR L+ +W  + EEIGLW+PA+V N EHDDK
Sbjct  144   RQEKLKEVKELSLGSEGTNSTILQEAGMLARALESEWDVLSEEIGLWLPAEVFNVEHDDK  203

Query  873   PEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKS  1052
             PEG     E++AG+ +P +CNAELHTDYDGAAVRWGLTHHKESA ECC+AC++ AKRAK 
Sbjct  204   PEGETEPEEVLAGRPIPAQCNAELHTDYDGAAVRWGLTHHKESAAECCQACLDHAKRAKP  263

Query  1053  GDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLI  1232
             G+ +CNIWVYCP+E GCYSPDIY+HKHQECWLKY+EKPKLNF+ +YSE+YRN HP AP+I
Sbjct  264   GELRCNIWVYCPSEFGCYSPDIYEHKHQECWLKYAEKPKLNFKDRYSESYRNNHPKAPVI  323

Query  1233  VPWMSGVMS  1259
             VPW+SGV++
Sbjct  324   VPWVSGVVT  332



>ref|XP_004499070.1| PREDICTED: uncharacterized protein LOC101510596 isoform X1 [Cicer 
arietinum]
 ref|XP_004499071.1| PREDICTED: uncharacterized protein LOC101510596 isoform X2 [Cicer 
arietinum]
Length=339

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 242/333 (73%), Gaps = 9/333 (3%)
 Frame = +3

Query  288   WAVGGNSNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP  464
             W +   S    GKW CSYK+ TI++C  N+ + LY L+SL+ SLY Y  +  ++   Y P
Sbjct  6     WGIQLQSRSGGGKWICSYKKITILVCLFNIAIALYCLRSLYASLYIYSGSVGRNIVVYKP  65

Query  465   DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGL  644
             DQIRKMEES +IRK  +P EL+KLV  L+ EF  E   VE+PQ LK+KI DE+L  L  L
Sbjct  66    DQIRKMEESNQIRKSYKPVELMKLVKGLEGEFSSENLEVELPQHLKQKIIDEVLERLGSL  125

Query  645   DGNANT-------TMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdw  803
             +  +          M+REAVE+WR  KL+E   + +G  S +T+  +EA ML + L+ DW
Sbjct  126   NSRSTNGSHSQGIAMEREAVENWRKEKLEEVKLVSVGGISNSTLSDKEAGMLVKALESDW  185

Query  804   vevleeIGLWIPADVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWG  980
               ++EEIGLWIP +V+N EH+DKP+G E  E EI+ G+ LPPEC  ELHTDYDG+AVRWG
Sbjct  186   AVLVEEIGLWIPVEVVNEEHNDKPDGIEDSEEEILPGRPLPPECKPELHTDYDGSAVRWG  245

Query  981   LTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE  1160
             LTHHK+SA +CC+AC++ AK AK G+KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+E
Sbjct  246   LTHHKDSAADCCQACLDHAKHAKEGEKKCNIWVYCPSEFGCHSPDIYQHKHQECWLKYAE  305

Query  1161  KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             KPKLNF+ +Y E YRN+HP+AP+IVPW+SGV+ 
Sbjct  306   KPKLNFKDRYPEWYRNSHPSAPVIVPWVSGVVG  338



>ref|XP_004242964.1| PREDICTED: uncharacterized protein LOC101263039 [Solanum lycopersicum]
Length=316

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 250/313 (80%), Gaps = 9/313 (3%)
 Frame = +3

Query  327   WCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRK  506
             WCSYKRTTI++CSIN+ V LYVL S     YT P   + +AFRYTPDQ+ KME+S RIRK
Sbjct  12    WCSYKRTTILVCSINIFVALYVLHS-----YTSP---TINAFRYTPDQLTKMEDSNRIRK  63

Query  507   ESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVE  686
             + +P +LI+L++ LK+EFLV+E V+++P  +K+KI+ E+LATL+ ++   N T+QR+ VE
Sbjct  64    QLQPLQLIQLINGLKQEFLVDENVLQLPHKIKQKISHEILATLKRVNARDNATLQRDTVE  123

Query  687   SWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             SWR  KLKEA +++    S +TI PEEA +LA++LDVDW E+ EEIGLWIP  +I++EH 
Sbjct  124   SWRRKKLKEARELVNRKTSNSTIAPEEAGLLAQILDVDWAELSEEIGLWIPVAIIHKEHH  183

Query  867   DKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             +KPEG E  + EIIAG+RLPPECN ELHTDY G AVRWGLTH KESAYECC AC+ QAK 
Sbjct  184   EKPEGEEEFDNEIIAGRRLPPECNVELHTDYGGDAVRWGLTHPKESAYECCMACLNQAKN  243

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
             A   DKKCNIWVYCP+E GCYSPDIYQHK+QECWLKY+EK K +F+ +YSE +R AHPNA
Sbjct  244   AGPNDKKCNIWVYCPSETGCYSPDIYQHKNQECWLKYAEKAKSSFKDRYSETFRKAHPNA  303

Query  1224  PLIVPWMSGVMSV  1262
             P++VPWMSGV+SV
Sbjct  304   PVVVPWMSGVVSV  316



>ref|XP_004291123.1| PREDICTED: uncharacterized protein LOC101308832 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=335

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 245/326 (75%), Gaps = 7/326 (2%)
 Frame = +3

Query  300   GNSNGTRGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIR  476
             G     RGKWC SYK+TT+I+C IN+V+ LYVL+SL+ SLY Y   DS  A  YTPDQIR
Sbjct  9     GIHKAVRGKWCCSYKKTTLIVCCINIVIALYVLRSLYASLYIYSDRDSHLAVEYTPDQIR  68

Query  477   KMEESTRIRKESEPTELIKLVSQlkkeflveekv-vevPQPLKRKITDELLATLRGLDGN  653
             KMEES RIRK +EP ELI+LV QLKKE   E  V VE+P+ LK K+T+E++  L+ L   
Sbjct  69    KMEESVRIRKSAEPLELIRLVKQLKKELSDEHSVGVELPESLKLKLTNEIIDKLKTLPPK  128

Query  654   ANTTMQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGL  830
             AN + QR+  E W   KL++A  ++    +  +TI  EEA ML + L+ D  ++LE+IGL
Sbjct  129   ANVSEQRDFAERWCTEKLEQAKQVVHERGTLNSTISLEEAVMLVKALESDRTQMLEDIGL  188

Query  831   WIPADVINREHDDKPEGA---ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             WIP++V+N EHDDKPEG    EL+ EI+ G+ LPPEC+AELHTDYDGAAVRWGL HHKES
Sbjct  189   WIPSEVVNNEHDDKPEGELGDELD-EILPGRPLPPECHAELHTDYDGAAVRWGLNHHKES  247

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC+ QAKRAK  +KKCN+WVYCPAE GC+SPDIY+H+  ECWLK++E PKLNF+
Sbjct  248   AADCCQACLVQAKRAKPNEKKCNVWVYCPAEDGCHSPDIYEHRLGECWLKFAETPKLNFK  307

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMS  1259
              +Y E+YR +HP+AP++VPW SG++ 
Sbjct  308   DKYPESYRRSHPSAPVLVPWASGIVG  333



>gb|KHN35670.1| hypothetical protein glysoja_037580 [Glycine soja]
Length=355

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 239/318 (75%), Gaps = 8/318 (3%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSYK+ T++IC  N+VV LY L+SL+ SL+ Y  + +++   Y PDQIRKMEES RIRK 
Sbjct  37    CSYKKITLLICLFNIVVALYSLRSLYASLHIYSGSVARNIVVYRPDQIRKMEESNRIRKA  96

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANT-------TM  668
              +P EL+KLV + + EF  E  VVE+P+ LK+KI DE+L  L  L+G++           
Sbjct  97    YKPVELMKLVKEFEGEFSGETVVVELPRHLKQKIIDEVLQRLGSLNGSSKNISHSQVMAK  156

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADV  848
             +REA+E+WR  KL+E    ++   S +TI  EEA ML R L+ DW  + EEIGLWIP +V
Sbjct  157   EREAIENWRKEKLEEVKLAVVRGTSNSTIPHEEAGMLVRALESDWAVLSEEIGLWIPIEV  216

Query  849   INREHDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
              N EH+DKPEGA E+E E++ G+ LPPECN ELHTDYDG AVRWGLTHHK+SA +CC+AC
Sbjct  217   ANEEHNDKPEGASEIEEEVLPGRPLPPECNPELHTDYDGTAVRWGLTHHKDSAADCCQAC  276

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
             ++QAKRAK G+ KCNIWVYCP++ GC+SPDIYQHKHQECWLKY+EKPKLNF+ +Y E YR
Sbjct  277   LDQAKRAKEGENKCNIWVYCPSQFGCHSPDIYQHKHQECWLKYAEKPKLNFKDRYPEWYR  336

Query  1206  NAHPNAPLIVPWMSGVMS  1259
             N+H +AP+IVPW SGV+S
Sbjct  337   NSHLSAPVIVPWASGVVS  354



>ref|XP_003544455.1| PREDICTED: uncharacterized protein LOC100778720 [Glycine max]
Length=330

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 239/318 (75%), Gaps = 8/318 (3%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSYK+ T++IC  N+VV LY L+SL+ SL+ Y  + +++   Y PDQIRKMEES RIRK 
Sbjct  12    CSYKKITLLICLFNIVVALYSLRSLYASLHIYSGSVARNIVVYRPDQIRKMEESNRIRKA  71

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANT-------TM  668
              +P EL+KLV + + EF  E  VVE+P+ LK+KI DE+L  L  L+G++           
Sbjct  72    YKPVELMKLVKEFEGEFSGETVVVELPRHLKQKIIDEVLQRLGSLNGSSKNISHSQVMAK  131

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADV  848
             +REA+E+WR  KL+E    ++   S +TI  EEA ML R L+ DW  + EEIGLWIP +V
Sbjct  132   EREAIENWRKEKLEEVKLAVVRGTSNSTIPHEEAGMLVRALESDWAVLSEEIGLWIPIEV  191

Query  849   INREHDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
              N EH+DKPEGA E+E E++ G+ LPPECN ELHTDYDG AVRWGLTHHK+SA +CC+AC
Sbjct  192   ANEEHNDKPEGASEIEEEVLPGRPLPPECNPELHTDYDGTAVRWGLTHHKDSAADCCQAC  251

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
             ++QAKRAK G+ KCNIWVYCP++ GC+SPDIYQHKHQECWLKY+EKPKLNF+ +Y E YR
Sbjct  252   LDQAKRAKEGENKCNIWVYCPSQFGCHSPDIYQHKHQECWLKYAEKPKLNFKDRYPEWYR  311

Query  1206  NAHPNAPLIVPWMSGVMS  1259
             N+H +AP+IVPW SGV+S
Sbjct  312   NSHLSAPVIVPWASGVVS  329



>ref|XP_010943021.1| PREDICTED: uncharacterized protein LOC105060867 isoform X3 [Elaeis 
guineensis]
Length=327

 Score =   360 bits (924),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 188/328 (57%), Positives = 246/328 (75%), Gaps = 10/328 (3%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP--  464
             A G    G  G+ CS+KR T+ IC +N+VV L++L+SL+ SL      DS S   Y P  
Sbjct  2     ARGAVEIGIGGRCCSFKRITVAICCMNLVVALFLLRSLYISLRL----DSTSGSDYNPSS  57

Query  465   -DQIRKMEESTRIRKESEPTELIKLVSQlkke-flveekvvevPQPLKRKITDELLATLR  638
              DQI+++EES R+RK SEP EL+K+V +L+KE    E++  ++PQPLK+K+ +E+L  L+
Sbjct  58    EDQIKRIEESIRVRKASEPLELVKVVKKLRKEFAREEKRRSKLPQPLKQKLANEILQRLK  117

Query  639   GLDGNANTTMQREAVESWRVAKLKEANDIIIGNP-STATIKPEEARMLARvldvdwvevl  815
              LD NAN T QR AVE WRV KL+EA         S ++I  +EA+ML R    +W  +L
Sbjct  118   DLDNNANMTEQRAAVELWRVEKLEEAKQARYAKSRSNSSILMQEAKMLRRAFGSNWPLLL  177

Query  816   eeIGLWIPADVINREHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHH  992
             E+IGLW+P D+IN E++DKPE   +LE EII G+ LPPEC+AELHTDYDGAAVRWGLTHH
Sbjct  178   EDIGLWLPPDIINTENNDKPENDPDLEEEIIPGRPLPPECHAELHTDYDGAAVRWGLTHH  237

Query  993   KESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKL  1172
             KESA +CC+AC++QAK AK G  KCNIWVYCP+E GCYSPDIY+HKHQECWLK ++KP+L
Sbjct  238   KESAADCCQACLDQAKHAKPGQMKCNIWVYCPSEFGCYSPDIYEHKHQECWLKQAQKPRL  297

Query  1173  NFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             NF+ +YSE+YR+AHPNAP++VPW+SGV+
Sbjct  298   NFKDKYSESYRDAHPNAPVVVPWISGVV  325



>ref|XP_010943019.1| PREDICTED: uncharacterized protein LOC105060867 isoform X1 [Elaeis 
guineensis]
Length=332

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 248/332 (75%), Gaps = 9/332 (3%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYT-----YPYNDSQSAFR  455
             A G    G  G+ CS+KR T+ IC +N+VV L++L+SL+ SL         YN S SA +
Sbjct  2     ARGAVEIGIGGRCCSFKRITVAICCMNLVVALFLLRSLYISLRLDSTSGSDYNPS-SAGK  60

Query  456   YTPDQIRKMEESTRIRKESEPTELIKLVSQlkke-flveekvvevPQPLKRKITDELLAT  632
             +  DQI+++EES R+RK SEP EL+K+V +L+KE    E++  ++PQPLK+K+ +E+L  
Sbjct  61    HAEDQIKRIEESIRVRKASEPLELVKVVKKLRKEFAREEKRRSKLPQPLKQKLANEILQR  120

Query  633   LRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNP-STATIKPEEARMLARvldvdwve  809
             L+ LD NAN T QR AVE WRV KL+EA         S ++I  +EA+ML R    +W  
Sbjct  121   LKDLDNNANMTEQRAAVELWRVEKLEEAKQARYAKSRSNSSILMQEAKMLRRAFGSNWPL  180

Query  810   vleeIGLWIPADVINREHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLT  986
             +LE+IGLW+P D+IN E++DKPE   +LE EII G+ LPPEC+AELHTDYDGAAVRWGLT
Sbjct  181   LLEDIGLWLPPDIINTENNDKPENDPDLEEEIIPGRPLPPECHAELHTDYDGAAVRWGLT  240

Query  987   HHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKP  1166
             HHKESA +CC+AC++QAK AK G  KCNIWVYCP+E GCYSPDIY+HKHQECWLK ++KP
Sbjct  241   HHKESAADCCQACLDQAKHAKPGQMKCNIWVYCPSEFGCYSPDIYEHKHQECWLKQAQKP  300

Query  1167  KLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
             +LNF+ +YSE+YR+AHPNAP++VPW+SGV+  
Sbjct  301   RLNFKDKYSESYRDAHPNAPVVVPWISGVVGA  332



>ref|XP_004499072.1| PREDICTED: uncharacterized protein LOC101510596 isoform X3 [Cicer 
arietinum]
Length=338

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 241/333 (72%), Gaps = 10/333 (3%)
 Frame = +3

Query  288   WAVGGNSNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP  464
             W +   S    GKW CSYK+ TI++C  N+ + LY L+SL+ SLY Y  +  ++   Y P
Sbjct  6     WGIQLQSRSGGGKWICSYKKITILVCLFNIAIALYCLRSLYASLYIYSGSVGRNIVVYKP  65

Query  465   DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGL  644
             DQIRKMEES +IRK  +P EL+KLV  L+ EF  E   VE+PQ LK+KI DE+L  L  L
Sbjct  66    DQIRKMEESNQIRKSYKPVELMKLVKGLEGEFSSENLEVELPQHLKQKIIDEVLERLGSL  125

Query  645   DGNANT-------TMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdw  803
             +  +          M+R AVE+WR  KL+E   + +G  S +T+  +EA ML + L+ DW
Sbjct  126   NSRSTNGSHSQGIAMER-AVENWRKEKLEEVKLVSVGGISNSTLSDKEAGMLVKALESDW  184

Query  804   vevleeIGLWIPADVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWG  980
               ++EEIGLWIP +V+N EH+DKP+G E  E EI+ G+ LPPEC  ELHTDYDG+AVRWG
Sbjct  185   AVLVEEIGLWIPVEVVNEEHNDKPDGIEDSEEEILPGRPLPPECKPELHTDYDGSAVRWG  244

Query  981   LTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE  1160
             LTHHK+SA +CC+AC++ AK AK G+KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+E
Sbjct  245   LTHHKDSAADCCQACLDHAKHAKEGEKKCNIWVYCPSEFGCHSPDIYQHKHQECWLKYAE  304

Query  1161  KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             KPKLNF+ +Y E YRN+HP+AP+IVPW+SGV+ 
Sbjct  305   KPKLNFKDRYPEWYRNSHPSAPVIVPWVSGVVG  337



>ref|XP_008220205.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103320318 
[Prunus mume]
Length=327

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 244/325 (75%), Gaps = 7/325 (2%)
 Frame = +3

Query  294   VGGNSNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             VG      R KW CSYK+TT+I+CSIN+VV LYVL+SL+ SLY Y   DS+    YTPDQ
Sbjct  4     VGEWGFKGRAKWGCSYKKTTLIVCSINIVVALYVLRSLYASLYIYSDRDSRPTLEYTPDQ  63

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDG  650
             IRKMEES RIRK +EP ELI+LV +  K+ L  E VVE+PQPLK KIT+E++  L+ L  
Sbjct  64    IRKMEESVRIRKAAEPVELIRLV-KALKKELSREVVVELPQPLKLKITNEIVERLKTLRP  122

Query  651   NANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIG  827
              AN T QRE VE W   KLKEA  + +  + S +TI  EEA ML + L+ DW  +LE++G
Sbjct  123   KANVTEQREFVERWCKEKLKEAKQLALETDASNSTILHEEAEMLVKALESDWTVLLEDMG  182

Query  828   LWIPADVINREHDDKPEGAELEP--EIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             LWIPA   N EH DKPEG E E   +I+ G+ LPPEC+AE+HTDYDGAAVRWGL HHK+S
Sbjct  183   LWIPAX--NTEHHDKPEGEEEEELDQILPGRPLPPECHAEVHTDYDGAAVRWGLNHHKDS  240

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QAKRAK  +K+CNIWVYCP+E GC+SPDIY+HK  ECWLKY+E PKLNF+
Sbjct  241   AADCCQACLDQAKRAKPNEKRCNIWVYCPSESGCHSPDIYEHKLGECWLKYAEAPKLNFK  300

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVM  1256
              +Y E+YRN HP+APL+VPW SG++
Sbjct  301   DKYPESYRNNHPSAPLVVPWASGIV  325



>ref|XP_010943020.1| PREDICTED: uncharacterized protein LOC105060867 isoform X2 [Elaeis 
guineensis]
Length=331

 Score =   355 bits (910),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 248/332 (75%), Gaps = 10/332 (3%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYT-----YPYNDSQSAFR  455
             A G    G  G+ CS+KR T+ IC +N+VV L++L+SL+ SL         YN S SA +
Sbjct  2     ARGAVEIGIGGRCCSFKRITVAICCMNLVVALFLLRSLYISLRLDSTSGSDYNPS-SAGK  60

Query  456   YTPDQIRKMEESTRIRKESEPTELIKLVSQlkke-flveekvvevPQPLKRKITDELLAT  632
             +  DQI+++EES R+RK SEP EL+K+V +L+KE    E++  ++PQPLK+K+ +E+L  
Sbjct  61    HAEDQIKRIEESIRVRKASEPLELVKVVKKLRKEFAREEKRRSKLPQPLKQKLANEILQR  120

Query  633   LRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNP-STATIKPEEARMLARvldvdwve  809
             L+ LD NAN T QR AVE WRV KL+EA         S ++I  +EA+ML R    +W  
Sbjct  121   LKDLDNNANMTEQR-AVELWRVEKLEEAKQARYAKSRSNSSILMQEAKMLRRAFGSNWPL  179

Query  810   vleeIGLWIPADVINREHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLT  986
             +LE+IGLW+P D+IN E++DKPE   +LE EII G+ LPPEC+AELHTDYDGAAVRWGLT
Sbjct  180   LLEDIGLWLPPDIINTENNDKPENDPDLEEEIIPGRPLPPECHAELHTDYDGAAVRWGLT  239

Query  987   HHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKP  1166
             HHKESA +CC+AC++QAK AK G  KCNIWVYCP+E GCYSPDIY+HKHQECWLK ++KP
Sbjct  240   HHKESAADCCQACLDQAKHAKPGQMKCNIWVYCPSEFGCYSPDIYEHKHQECWLKQAQKP  299

Query  1167  KLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
             +LNF+ +YSE+YR+AHPNAP++VPW+SGV+  
Sbjct  300   RLNFKDKYSESYRDAHPNAPVVVPWISGVVGA  331



>ref|XP_007136669.1| hypothetical protein PHAVU_009G063800g [Phaseolus vulgaris]
 gb|ESW08663.1| hypothetical protein PHAVU_009G063800g [Phaseolus vulgaris]
Length=318

 Score =   354 bits (908),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 239/318 (75%), Gaps = 5/318 (2%)
 Frame = +3

Query  315   TRGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEES  491
              RGKW  SYK+TT+++C  N+ V LYVL+SL+ SLY Y  N S++   Y PDQIRKMEES
Sbjct  2     ARGKWVFSYKKTTLLVCFFNIAVALYVLRSLYASLYIYSGNVSRNVALYNPDQIRKMEES  61

Query  492   TRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNA-NTTM  668
              +IR+E +P ELIK V  L+ EF  E   VE+P+ LK+ I DE+L  LRGL+ ++ +   
Sbjct  62    MQIRREFKPVELIKWVKALEGEFSSETVAVELPKHLKQNIIDEILQRLRGLNSSSTDIAK  121

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADV  848
             +RE VE+WR  KL+E    ++   S +TI  EEA +L R L+ DW    EEIGLWIPA V
Sbjct  122   EREVVENWRKGKLEEVKLALVN--SNSTIPHEEAGILVRALESDWALFCEEIGLWIPAQV  179

Query  849   INREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
              N EHDDKPEG E   E ++ G+ L PEC+AELHTDYDG+AVRWGLTHHK+SA +CC+AC
Sbjct  180   ANEEHDDKPEGEEEFEEEVLPGRPLSPECHAELHTDYDGSAVRWGLTHHKDSAADCCQAC  239

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
             ++ AK AK GDKKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+EKP+LNF+ +Y E YR
Sbjct  240   LDHAKHAKEGDKKCNIWVYCPSEFGCHSPDIYQHKHQECWLKYAEKPRLNFKDKYPEWYR  299

Query  1206  NAHPNAPLIVPWMSGVMS  1259
             N+HP+AP+IVPW+SG+ S
Sbjct  300   NSHPSAPVIVPWVSGITS  317



>emb|CDX68970.1| BnaC01g04830D [Brassica napus]
Length=326

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 243/323 (75%), Gaps = 4/323 (1%)
 Frame = +3

Query  297   GGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQI  473
             GG    T G   SYKR T+++CS N+++ L+VL+ L+ +SL+ YP N  ++A RYT D+I
Sbjct  5     GGEWTVTGGGVVSYKRITLLVCSFNILIALFVLRFLYASSLHFYPNN--RNAVRYTSDEI  62

Query  474   RKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGN  653
             RKMEESTRIR+   P+EL++LV +L+ +    E  VE+   +K K+ DE+L  L+ L+  
Sbjct  63    RKMEESTRIRRSKHPSELVRLVKKLRHDVATSESSVELSPSVKGKLVDEILERLKRLEEK  122

Query  654   ANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIGL  830
             +N T+ REAVE+WR  KLKEA ++I   N   +T+  EEA ML R L+++W  + EEIG 
Sbjct  123   SNVTLVREAVETWRSEKLKEAKELIQEQNGVNSTVIVEEAGMLVRALELEWDALSEEIGF  182

Query  831   WIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYE  1010
             W+PA+V N EHDDKPEG E   EI+AG+ +P  CN ELHTDY GAAVRWGLTHHKESA +
Sbjct  183   WLPAEVHNEEHDDKPEGEEEPEEILAGRPVPGVCNVELHTDYGGAAVRWGLTHHKESAAD  242

Query  1011  CCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQY  1190
             CC+AC++QAKRAK G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK +F+ +Y
Sbjct  243   CCQACLDQAKRAKPGEMRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKRSFKDRY  302

Query  1191  SEAYRNAHPNAPLIVPWMSGVMS  1259
             SEAYRN HP AP IVPW+SGV++
Sbjct  303   SEAYRNNHPKAPTIVPWVSGVVT  325



>gb|KHG12332.1| IgA FC receptor [Gossypium arboreum]
Length=341

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 183/317 (58%), Positives = 231/317 (73%), Gaps = 7/317 (2%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSYKR T+I+CS+N+V+ LYVL SL++SLY Y  N       +T D I++MEES RIR+ 
Sbjct  26    CSYKRITVIVCSVNIVIALYVLHSLYSSLYIYS-NKDHDVVMHTSDHIKQMEESVRIRRA  84

Query  510   SEPTELIKLVSQlkk--eflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAV  683
             SEP EL+KLV +LK            E+PQ +K KITDE+L  LR L  NA+ + Q EAV
Sbjct  85    SEPIELVKLVKRLKHGFSSEESMAEAELPQAVKNKITDEILQRLRSLRPNASVSEQHEAV  144

Query  684   ESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVINRE  860
             E+WR  KLKEA ++ +G     +T+  EEA  L +VL+ +W  + EEIGLWIP ++ N+E
Sbjct  145   ETWRNEKLKEAKNLALGGERLDSTLLREEAGNLVKVLESNWAALSEEIGLWIPNEIKNQE  204

Query  861   HDDKPEGAEL--EPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVE  1031
             H+DKPE  E   +PE I+AG+   PEC  ELHTDYDG  VRWGLTHHKESA +CC+AC++
Sbjct  205   HNDKPEDVEDTDDPEQILAGRPPLPECRTELHTDYDGDCVRWGLTHHKESAADCCQACLD  264

Query  1032  QAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNA  1211
             QAK AK G+KKCNIWVYCP+E GCYSPD Y+HKH ECWLKYSEKP LNF+ +Y E YRN+
Sbjct  265   QAKAAKPGEKKCNIWVYCPSETGCYSPDKYEHKHMECWLKYSEKPSLNFKDRYPEGYRNS  324

Query  1212  HPNAPLIVPWMSGVMSV  1262
             H N P+IVPW+SGV+SV
Sbjct  325   HRNVPVIVPWVSGVISV  341



>gb|AGI78250.1| hypothetical protein [Caragana korshinskii]
Length=338

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 239/333 (72%), Gaps = 10/333 (3%)
 Frame = +3

Query  288   WAVGGNSNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP  464
             W +   S G  GKW CSYK+ TI++C  N+ + LY L+SL+ SLY Y  +  ++   Y P
Sbjct  6     WGIQLQSRGG-GKWVCSYKKITIVVCFFNIAIALYCLRSLYASLYIYSGSVGRNIVVYRP  64

Query  465   DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGL  644
             DQI+KMEES +IRK  +P EL+K V  L+ EF  E   VE+PQ LK+KI DE+L  L  L
Sbjct  65    DQIQKMEESNQIRKSYKPVELMKWVKALEGEFSSENVAVELPQHLKQKIIDEVLQRLGSL  124

Query  645   DGNA-------NTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdw  803
             +  +          M+REA+E+WR  KL+E   +++   S +TI  EEA ML R L+ DW
Sbjct  125   NSKSINGSHSQGIAMEREAIENWRKEKLEEVKLVVVSGTSNSTISQEEAGMLVRALESDW  184

Query  804   vevleeIGLWIPADVINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWG  980
               + EEIGLWIP +V N EH+DKPEG E   E ++ G+ LPPEC  ELHTDYDG AV+WG
Sbjct  185   AVLSEEIGLWIPVEVANEEHNDKPEGIEELEEEVLPGRPLPPECKPELHTDYDGHAVKWG  244

Query  981   LTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE  1160
             LTHHK+SA +CC+AC++ AK AK G+KKCNIWVYCP+E GC+SPDIYQHKHQECWLKY+E
Sbjct  245   LTHHKDSAADCCQACLDHAKHAKEGEKKCNIWVYCPSEFGCHSPDIYQHKHQECWLKYAE  304

Query  1161  KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             KPKLNF+ +Y E YRN+HP+AP+IVPW+SGV++
Sbjct  305   KPKLNFKDRYPEWYRNSHPSAPVIVPWVSGVVA  337



>ref|XP_008805813.1| PREDICTED: uncharacterized protein LOC103718670 isoform X1 [Phoenix 
dactylifera]
Length=332

 Score =   348 bits (892),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 239/333 (72%), Gaps = 15/333 (5%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP--  464
             A G    G+ G+ CS+KR T+ IC +N+VV L++L+  + S       DS S   Y P  
Sbjct  2     ARGAVEIGSAGRCCSFKRITVAICCMNLVVALFLLRYFYTSFRL----DSTSGSDYNPFS  57

Query  465   ------DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvev-PQPLKRKITDEL  623
                   DQI++ EES R+RK SEP EL+K+V +L+KEF  EEK     PQPLK+K+ +E+
Sbjct  58    DGKQTEDQIKRTEESIRVRKASEPLELVKVVKKLRKEFAREEKRRSKLPQPLKQKLANEI  117

Query  624   LATLRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNP-STATIKPEEARMLARvldvd  800
             L  L+ L  NAN T QR AVE WRV KL+E          S ++I  +EA+ML R  + +
Sbjct  118   LQRLKDLGSNANVTEQRAAVELWRVEKLEEVKQARYAKSRSNSSISMQEAKMLRRAFESN  177

Query  801   wvevleeIGLWIPADVINREHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRW  977
             W  +LE+IGLW+P DVIN E++DKPE   +LE EII G+ LPPEC+AELHTDYDG AVRW
Sbjct  178   WPMLLEDIGLWLPPDVINTENNDKPENDQDLEEEIIPGRPLPPECHAELHTDYDGTAVRW  237

Query  978   GLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYS  1157
             GLTHHKESA +CC+AC++QAK AK G  KCNIWVYCP+E GCYSPDIY+HKHQECWLK +
Sbjct  238   GLTHHKESAADCCQACLDQAKHAKPGQMKCNIWVYCPSEFGCYSPDIYEHKHQECWLKQA  297

Query  1158  EKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             ++P+LNF+ +YSE+YR+AHPN P++VPW+SGV+
Sbjct  298   KEPRLNFKDKYSESYRDAHPNTPVVVPWISGVV  330



>ref|XP_009123198.1| PREDICTED: uncharacterized protein LOC103847906 [Brassica rapa]
Length=326

 Score =   347 bits (890),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 240/323 (74%), Gaps = 4/323 (1%)
 Frame = +3

Query  297   GGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQI  473
             GG    T G   SYKR T+++CS N+++ L+VL+ L+ +SL+ YP  +  +A  YT D+I
Sbjct  5     GGEWTVTGGGVVSYKRITLLVCSFNILIALFVLRFLYASSLHFYP--NHHNAVSYTSDEI  62

Query  474   RKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGN  653
             RKMEESTRIR+   P+EL++LV +L+ +    E  VE+   +K K+ DE+L  L+ L+  
Sbjct  63    RKMEESTRIRRSKHPSELVRLVKKLRHDVATSESSVELSPNVKGKLVDEILERLKRLEEK  122

Query  654   ANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIGL  830
             +N T+ REAVE+WR  KLKEA ++I   N   +T+  EEA ML R L+++W  + EEIG 
Sbjct  123   SNVTLVREAVETWRSEKLKEAKELIQEQNGVNSTLIVEEAGMLVRALELEWDALSEEIGF  182

Query  831   WIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYE  1010
             W+PA+V N EHDDKPEG E   EI+AG+ +P  CN ELHTDY GAAVRWGLTHHKESA +
Sbjct  183   WLPAEVHNEEHDDKPEGEEEPEEILAGRPVPAVCNVELHTDYGGAAVRWGLTHHKESAAD  242

Query  1011  CCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQY  1190
             CC+AC++QAKRAK G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK  F+ +Y
Sbjct  243   CCQACLDQAKRAKPGEMRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKRTFKDRY  302

Query  1191  SEAYRNAHPNAPLIVPWMSGVMS  1259
             SEAYRN HP AP IVPW+SGV++
Sbjct  303   SEAYRNNHPKAPTIVPWVSGVVT  325



>ref|XP_010447253.1| PREDICTED: uncharacterized protein LOC104729925 [Camelina sativa]
Length=332

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 233/311 (75%), Gaps = 4/311 (1%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLFNS-LYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             S+KR T+++C  N+++ L+VL+ L++S L+ Y  ND     +YT D+IRKMEES RIR+ 
Sbjct  22    SFKRITLLVCFFNILIALFVLRFLYSSSLHIYSNNDY--VVKYTADEIRKMEESIRIRRS  79

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EPTEL++LV +LK E  V +   E+   +K K+ DE+L  L+ L+  +N T  RE VE 
Sbjct  80    KEPTELVQLVKKLKHEVAVAQSNTELSPNVKHKLVDEILQRLKSLEEQSNVTQLRETVEM  139

Query  690   WRVAKLKEANDIIIG-NPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KLKE  ++I G N   +T+  EEA ML R L+++W  + EEIG W+PA+VIN EHD
Sbjct  140   WRSEKLKEVKELIQGQNGVNSTLVLEEAGMLVRALEMEWDVLSEEIGFWLPAEVINEEHD  199

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKESA +CC+AC++QA+RA
Sbjct  200   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESAADCCQACLDQARRA  259

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK NF+ +YSE YRN HP AP
Sbjct  260   KPGETRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKQNFKDRYSETYRNNHPKAP  319

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  320   SIVPWVSGVVT  330



>ref|XP_003550342.1| PREDICTED: uncharacterized protein LOC100816724 [Glycine max]
Length=336

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 233/318 (73%), Gaps = 8/318 (3%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSYK+ T++IC +N+VV LY L+SL+ SL  Y  + +++   Y PDQIRKMEES RIRK 
Sbjct  18    CSYKKITLLICFLNIVVALYSLRSLYASLSIYSGSVARNIVVYRPDQIRKMEESNRIRKA  77

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM-------  668
              +P EL+KLV + + EF  E  VVE+P+ LK+KI+DE+   L  L+ ++           
Sbjct  78    YKPVELMKLVKEFEGEFSRENVVVELPRHLKQKISDEVSQRLGSLNESSKNIFHPQVMAK  137

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADV  848
             +REA+E+WR  KL+E    ++   S +TI  EEA ML R L+ DW  + EEIGLWIP  V
Sbjct  138   EREAIENWRKEKLEEVKLAVVRGTSNSTIPHEEAGMLVRALESDWDVLSEEIGLWIPIQV  197

Query  849   INREHDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
              N EH+DKPE   E+E E++ G+ L PECN ELHTDYDG AVRWGLTHHK+SA +CC+AC
Sbjct  198   ANEEHNDKPESTTEIEEEVLPGRPLQPECNPELHTDYDGTAVRWGLTHHKDSAADCCQAC  257

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
             ++QAK AK G+ KCNIWVYCP++ GC+SPDIYQHKH+ECWLKY+EK KLNF+ +Y E YR
Sbjct  258   LDQAKHAKEGENKCNIWVYCPSQFGCHSPDIYQHKHRECWLKYAEKSKLNFKDRYPEWYR  317

Query  1206  NAHPNAPLIVPWMSGVMS  1259
             N+HP+AP+IVPW SGV+S
Sbjct  318   NSHPSAPVIVPWASGVVS  335



>ref|XP_008805814.1| PREDICTED: uncharacterized protein LOC103718670 isoform X2 [Phoenix 
dactylifera]
Length=331

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 239/333 (72%), Gaps = 16/333 (5%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP--  464
             A G    G+ G+ CS+KR T+ IC +N+VV L++L+  + S       DS S   Y P  
Sbjct  2     ARGAVEIGSAGRCCSFKRITVAICCMNLVVALFLLRYFYTSFRL----DSTSGSDYNPFS  57

Query  465   ------DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvev-PQPLKRKITDEL  623
                   DQI++ EES R+RK SEP EL+K+V +L+KEF  EEK     PQPLK+K+ +E+
Sbjct  58    DGKQTEDQIKRTEESIRVRKASEPLELVKVVKKLRKEFAREEKRRSKLPQPLKQKLANEI  117

Query  624   LATLRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNP-STATIKPEEARMLARvldvd  800
             L  L+ L  NAN T QR AVE WRV KL+E          S ++I  +EA+ML R  + +
Sbjct  118   LQRLKDLGSNANVTEQR-AVELWRVEKLEEVKQARYAKSRSNSSISMQEAKMLRRAFESN  176

Query  801   wvevleeIGLWIPADVINREHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRW  977
             W  +LE+IGLW+P DVIN E++DKPE   +LE EII G+ LPPEC+AELHTDYDG AVRW
Sbjct  177   WPMLLEDIGLWLPPDVINTENNDKPENDQDLEEEIIPGRPLPPECHAELHTDYDGTAVRW  236

Query  978   GLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYS  1157
             GLTHHKESA +CC+AC++QAK AK G  KCNIWVYCP+E GCYSPDIY+HKHQECWLK +
Sbjct  237   GLTHHKESAADCCQACLDQAKHAKPGQMKCNIWVYCPSEFGCYSPDIYEHKHQECWLKQA  296

Query  1158  EKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             ++P+LNF+ +YSE+YR+AHPN P++VPW+SGV+
Sbjct  297   KEPRLNFKDKYSESYRDAHPNTPVVVPWISGVV  329



>gb|KHN12772.1| hypothetical protein glysoja_008735 [Glycine soja]
Length=337

 Score =   342 bits (878),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 234/319 (73%), Gaps = 9/319 (3%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CSYK+ T++IC +N+VV LY L+SL+ SL  Y  + +++   Y PDQIRKMEES RIRK 
Sbjct  18    CSYKKITLLICFLNIVVALYSLRSLYASLSIYSGSVARNIVVYRPDQIRKMEESNRIRKA  77

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM-------  668
              +P EL+KLV + + EF  E  VVE+P+ LK+KI+DE+   L  L+ ++           
Sbjct  78    YKPVELMKLVKEFEGEFSRENVVVELPRHLKQKISDEVSQRLGSLNESSKNIFHPQVMAK  137

Query  669   QREAVESWRVAKLKEANDIIIGNPSTATIKPEEA-RMLARvldvdwvevleeIGLWIPAD  845
             +REA+E+WR  KL+E    ++   S +TI  EEA RML R L+ DW  + EEIGLWIP  
Sbjct  138   EREAIENWRKEKLEEVKLAVVRGTSNSTIPHEEAGRMLVRALESDWDVLSEEIGLWIPIQ  197

Query  846   VINREHDDKPEGA-ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRA  1022
             V N EH+DKPE   E+E E++ G+ L PECN ELHTDYDG AVRWGLTHHK+SA +CC+A
Sbjct  198   VANEEHNDKPESTTEIEEEVLPGRPLQPECNPELHTDYDGTAVRWGLTHHKDSAADCCQA  257

Query  1023  CVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAY  1202
             C++QAK AK G+ KCNIWVYCP++ GC+SPDIYQHKH+ECWLKY+EK KLNF+ +Y E Y
Sbjct  258   CLDQAKHAKEGENKCNIWVYCPSQFGCHSPDIYQHKHRECWLKYAEKSKLNFKDRYPEWY  317

Query  1203  RNAHPNAPLIVPWMSGVMS  1259
             RN+HP+AP+IVPW SGV+S
Sbjct  318   RNSHPSAPVIVPWASGVVS  336



>ref|XP_002869217.1| hypothetical protein ARALYDRAFT_913084 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45476.1| hypothetical protein ARALYDRAFT_913084 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 232/311 (75%), Gaps = 4/311 (1%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             S+KR T+++C  N+++ L+VL+ L+ +SL+ Y  ND+    +YT D++RKMEES RIR+ 
Sbjct  19    SFKRITLLVCFFNILIALFVLRFLYASSLHIYSNNDN--VVKYTADEVRKMEESIRIRRS  76

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EPT L++LV +LK E    E   E+   +K K+ DE+L  L+  D  +N T  RE VE+
Sbjct  77    KEPTLLVQLVKKLKHEVATAESNTELSPNVKHKLVDEILQRLKRFDQKSNVTQLREVVET  136

Query  690   WRVAKLKEANDIIIG-NPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KL+EA ++I G N   +T+  EEA ML R L+++W  + EEIG W+PA+V N EHD
Sbjct  137   WRSEKLEEAKELIQGQNGVNSTLIVEEAGMLVRALELEWDVLSEEIGFWLPAEVTNEEHD  196

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKESA +CC+AC++QAKRA
Sbjct  197   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESAADCCQACLDQAKRA  256

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             + G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK NF+ +YSE YRN HP AP
Sbjct  257   RPGETRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKQNFKDRYSETYRNNHPKAP  316

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  317   SIVPWVSGVIT  327



>ref|XP_006286258.1| hypothetical protein CARUB_v10007833mg [Capsella rubella]
 gb|EOA19156.1| hypothetical protein CARUB_v10007833mg [Capsella rubella]
Length=330

 Score =   340 bits (872),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 232/311 (75%), Gaps = 4/311 (1%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLFNS-LYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             S+KR T+++C   +++ L+VL+ L++S L+ Y  ND+    +YT D+IRKMEES RIR+ 
Sbjct  20    SFKRITLLVCFFYILIALFVLRFLYSSSLHIYSNNDN--VVKYTADEIRKMEESIRIRRS  77

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EPTEL++LV +LK E    +   E+   +K K+ DE+L  L+ L+  +N T+ RE VE 
Sbjct  78    KEPTELVQLVKKLKHEVAAAQSNTELSPNVKHKLVDEILQRLKTLEEKSNVTLLRETVEM  137

Query  690   WRVAKLKEANDIIIG-NPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KLKE  ++I G N   +T+  EEA ML R L+++W  + EEIG W+PA+V N EHD
Sbjct  138   WRNEKLKEVKELIQGQNGVNSTLILEEAGMLVRALELEWDVLSEEIGFWLPAEVTNEEHD  197

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKESA +CC+AC++QA+RA
Sbjct  198   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESAADCCQACLDQARRA  257

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK NF+ +YSE YRN HP AP
Sbjct  258   KPGETRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKQNFKDRYSETYRNNHPKAP  317

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  318   SIVPWVSGVVT  328



>ref|XP_006412365.1| hypothetical protein EUTSA_v10025691mg [Eutrema salsugineum]
 gb|ESQ53818.1| hypothetical protein EUTSA_v10025691mg [Eutrema salsugineum]
Length=328

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 236/325 (73%), Gaps = 6/325 (2%)
 Frame = +3

Query  297   GGNSNG--TRGKWCSYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPD  467
             GG   G  T G   SYKR T+++C  N+++ L+VL+ L+ +SL+ Y  ND+     YT  
Sbjct  5     GGEWTGGITGGGVLSYKRITLLVCFFNILIALFVLRFLYASSLHIYSNNDN--VVEYTAA  62

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             +IRKMEES RIR+  EP +L+KLV +LK +    E   E+   +K K+ DE+L  L+ L+
Sbjct  63    EIRKMEESIRIRRSKEPAQLVKLVRKLKHDVATAESNTELSPDVKHKLVDEILQRLKILE  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeI  824
               +N T  REAVE+WR  KLKEA ++I   N   +T+  EEA ML R L+++W  + EEI
Sbjct  123   DKSNVTQLREAVETWRTEKLKEAKELIQEQNGVNSTMILEEAGMLVRALELEWDVLSEEI  182

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             G W+PA+V N EHDDKPEG E   EI+AG+ +P  CN ELHTDY GAAVRWGLTHHKESA
Sbjct  183   GFWLPAEVNNEEHDDKPEGEEEPEEILAGRPVPAVCNVELHTDYGGAAVRWGLTHHKESA  242

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QAKRAK G+ +CNIWVYCP+E GCYSPDIY+HKHQECWLKY+EKP+ NF+ 
Sbjct  243   ADCCQACLDQAKRAKPGETRCNIWVYCPSEFGCYSPDIYEHKHQECWLKYAEKPQQNFKD  302

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVMS  1259
             +YSE+YRN HP AP IVPW+SGV++
Sbjct  303   RYSESYRNNHPKAPTIVPWVSGVIT  327



>ref|NP_195064.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36050.1| AT4g33380/F17M5_140 [Arabidopsis thaliana]
 gb|AAM19931.1| AT4g33380/F17M5_140 [Arabidopsis thaliana]
 gb|AEE86217.1| uncharacterized protein AT4G33380 [Arabidopsis thaliana]
Length=328

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 232/311 (75%), Gaps = 4/311 (1%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             S+KR T+++C  N+++ L+VL+ L+ +SL+ Y  ND+    +YT D+IRKMEES RIR+ 
Sbjct  19    SFKRITLLVCFFNILIALFVLRFLYASSLHIYSNNDN--VVKYTADEIRKMEESIRIRRS  76

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EPT +++LV +LK E    E   E+   +K K+ DE+L  L+  +  +N T  RE VE+
Sbjct  77    KEPTLILQLVKKLKHEVSTAESSTELSPNVKHKLVDEILQRLKSFEDKSNVTQLREVVET  136

Query  690   WRVAKLKEANDIIIG-NPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KL+EA ++I G N   +T+  EEA ML R L+++W  + EEIG W+PA+V N EHD
Sbjct  137   WRNEKLEEAKELIQGQNGVNSTLIVEEAGMLVRALELEWDVLSEEIGFWLPAEVTNVEHD  196

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKESA +CC+AC++QAKRA
Sbjct  197   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESAADCCQACLDQAKRA  256

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK NF+ +YSE YRN HP AP
Sbjct  257   KPGETRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKQNFKDRYSETYRNNHPKAP  316

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  317   SIVPWVSGVVT  327



>ref|XP_010437770.1| PREDICTED: uncharacterized protein LOC104721481 [Camelina sativa]
Length=333

 Score =   338 bits (866),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 230/311 (74%), Gaps = 4/311 (1%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLFNS-LYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             S+KR T+++C  N+++ L+VL+ L++S L+ Y  ND     +YT D+IRKMEES RIR+ 
Sbjct  23    SFKRITLLVCFFNILIALFVLRFLYSSSLHIYSNNDY--VVKYTADEIRKMEESIRIRRS  80

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EPTEL++LV +LK E  V +   E+   +K K+ DE+L  L+ L+  +N T  RE VE 
Sbjct  81    KEPTELVQLVKKLKHEVAVAQSNTELSPNVKHKLVDEILQRLKSLEEKSNVTQLRETVEL  140

Query  690   WRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KLKE  ++I   N   +T+  EEA ML R L+++W  + EEIG W+PA+V N EHD
Sbjct  141   WRSEKLKEVKEMIQEQNGVNSTLILEEAGMLVRALEMEWDVLSEEIGFWLPAEVTNEEHD  200

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKESA  CC+AC++QA+RA
Sbjct  201   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESAAHCCQACLDQARRA  260

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK NF+ +YSE YRN HP AP
Sbjct  261   KPGETRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKQNFKDRYSETYRNNHPKAP  320

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  321   SIVPWVSGVVT  331



>ref|XP_010432571.1| PREDICTED: uncharacterized protein LOC104716823 [Camelina sativa]
Length=334

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 230/311 (74%), Gaps = 4/311 (1%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLFNS-LYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             S+KR T+++C  N+++ L+VL+ L++S L+ Y  ND     +YT D+IRKMEES RIR+ 
Sbjct  24    SFKRITLLVCFFNILIALFVLRFLYSSSLHIYSNNDY--VVKYTADEIRKMEESIRIRRS  81

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EPTEL++LV +LK E  V +   E+   +K K+ DE+L  L+  +  +N T  RE VE 
Sbjct  82    KEPTELVQLVKKLKHEVAVAQSNTELSPNVKHKLVDEILQRLKSSEEKSNITQLRETVEM  141

Query  690   WRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KLKE  ++I   N   +T+  EEA ML R L+++W  + EEIG W+PA+V N EHD
Sbjct  142   WRSEKLKEVKELIQEQNGVNSTLVLEEAGMLVRALEMEWDVLSEEIGFWLPAEVTNEEHD  201

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKESA +CC+AC++QA+RA
Sbjct  202   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESAADCCQACLDQARRA  261

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK NF+ +YSE YRN HP AP
Sbjct  262   KPGEMRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKQNFKDRYSETYRNNHPKAP  321

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  322   SIVPWVSGVVT  332



>gb|KFK29951.1| hypothetical protein AALP_AA7G199000 [Arabis alpina]
Length=328

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 233/325 (72%), Gaps = 6/325 (2%)
 Frame = +3

Query  288   WAVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             W  G    G      S+KR T+++C +N+++ L+VL+ L+ S   + Y+++++  +YT D
Sbjct  8     WTGGNTGVGV----LSFKRITLLVCFVNILIALFVLRFLYTS-SLHIYSNNENVVKYTAD  62

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLD  647
             +IRKMEES RIR+  E  EL+ LV +L+ +    E  +E+   +K K+ DE+L  L+ L+
Sbjct  63    EIRKMEESIRIRRSKESIELVTLVKKLRHDVATAESNIELSSNVKHKLVDEILQRLKSLE  122

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeI  824
               +N T  REAVE WR  KLKEA ++I       +TI  EEA ML R L+++W  + EEI
Sbjct  123   EKSNVTQLREAVELWRSEKLKEAKELIQEQSGENSTIILEEAGMLVRALELEWDVLSEEI  182

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             G W+PA+V N EHDDKPEG E   E++AG+ +P  CNAELHTDY GAAVRWGLTHHKESA
Sbjct  183   GFWLPAEVKNEEHDDKPEGEEEPEEVLAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESA  242

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QA RAK G+ KCNIWVYCP+E GC+SPDIY+HKHQECWLKY+E+PK NF+ 
Sbjct  243   ADCCQACLDQANRAKPGETKCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEQPKHNFKD  302

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVMS  1259
             +YSE YRN HP AP IVPW+SGV++
Sbjct  303   RYSETYRNNHPKAPSIVPWVSGVVT  327



>ref|XP_009393662.1| PREDICTED: uncharacterized protein LOC103979296 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=335

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 232/311 (75%), Gaps = 3/311 (1%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CS+KR T++ C +N+V  L VL+S   S + +P         ++ DQ+ ++EES R+R+E
Sbjct  24    CSFKRITVVACCVNLVAALVVLRSFDTSFFLFPSYGFNGNL-FSVDQVERIEESIRVRRE  82

Query  510   SEPTELIKLVSQlkkeflveekv-vevPQPLKRKITDELLATLRGLDGNANTTMQREAVE  686
             +E  EL++ V +L KE   E+K  + +PQ +K+K+ +E+L  L+G + + N T QRE V+
Sbjct  83    AESVELVRAVRKLSKELSREQKRGLNLPQNVKQKLANEILQRLQGDNVDTNVTKQRETVD  142

Query  687   SWRVAKLKEANDIIIGNPST-ATIKPEEARMLARvldvdwvevleeIGLWIPADVINREH  863
              WR+ KL+E   +     +  ++I  +EA+ML RVL+ +W+ +LE IGLWIPADVI+ EH
Sbjct  143   LWRIEKLEEVRRVTTSKSNIDSSISYQEAKMLKRVLESNWLMLLEGIGLWIPADVIHTEH  202

Query  864   DDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             +DKP+  +   EII G+ LPPEC+AELHTDYDGAAVRWGLTHHK+SA +CC+AC++QAK 
Sbjct  203   NDKPKDEQDLEEIIPGRPLPPECHAELHTDYDGAAVRWGLTHHKDSAADCCQACLDQAKH  262

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
              K G+KKCNIWVYCP+E GCYSPDIY+HKHQECWLK +EKP+LNF+ +YS++YR  HPNA
Sbjct  263   PKPGEKKCNIWVYCPSEFGCYSPDIYEHKHQECWLKQAEKPRLNFKDKYSKSYRKKHPNA  322

Query  1224  PLIVPWMSGVM  1256
             P++VPWMSGV+
Sbjct  323   PIVVPWMSGVV  333



>ref|XP_007160839.1| hypothetical protein PHAVU_001G021000g [Phaseolus vulgaris]
 gb|ESW32833.1| hypothetical protein PHAVU_001G021000g [Phaseolus vulgaris]
Length=415

 Score =   335 bits (860),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 233/325 (72%), Gaps = 9/325 (3%)
 Frame = +3

Query  315   TRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEES  491
              RG W CSYK+ T+++C  N+VV LY L+ L+ SLY Y  + +++   Y PDQI+KMEES
Sbjct  91    NRGNWNCSYKKITLLVCFFNIVVALYSLRCLYASLYIYSGSVARNIVVYKPDQIQKMEES  150

Query  492   TRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTT--  665
              RIRK+ +P EL+KLV + + EF  E+ VV++P+ LK+KI DE++  L  L G++     
Sbjct  151   NRIRKDYKPAELMKLVKEFEGEFSREDVVVKLPRHLKQKIIDEVMQKLGSLKGSSINVSH  210

Query  666   -----MQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGL  830
                   +REAVESWR  KL+E    I+   S + I  EEA ML R L  DW  V EEIGL
Sbjct  211   PQVMAKEREAVESWRKQKLEEVKLAIVKGTSNSIIPHEEAGMLLRALGTDWTVVSEEIGL  270

Query  831   WIPADVINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             WIP +V N EH+DKPEG     E ++ G+ LPP+CNAELHTDY G AVRWGLTHHK+SA 
Sbjct  271   WIPFEVGNEEHNDKPEGESEIEEEVLPGRPLPPQCNAELHTDYGGVAVRWGLTHHKDSAA  330

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++ AK AK  +KKCNIWVYCP++ GC+SPDIYQHK+QECWLKY+EKPKLNF+ +
Sbjct  331   DCCQACLDHAKHAKKDEKKCNIWVYCPSQFGCHSPDIYQHKYQECWLKYAEKPKLNFKDK  390

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMSV  1262
             Y E YRN  P+APL+VPW SG++S 
Sbjct  391   YPEWYRNLRPSAPLVVPWASGIVST  415



>ref|XP_009388027.1| PREDICTED: uncharacterized protein LOC103974854 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=325

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 235/311 (76%), Gaps = 8/311 (3%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CS+KR T+++C +N+V  L VL++ + S      +D      ++ DQ+ +++ES R+R++
Sbjct  19    CSFKRITVVVCCVNLVAALLVLRTFYTSFSLVSSSDP-----FSVDQLERIQESIRVRRD  73

Query  510   SEPTELIKLVSQlkkeflv-eekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVE  686
             +EP EL++ V +L+KE L  E++V+++PQP+K+K+ +E+L  L+ +  N N T QREAV 
Sbjct  74    AEPVELVRAVRKLRKELLKDEKRVLKLPQPVKQKLANEILQKLQSVKDN-NVTEQREAVY  132

Query  687   SWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVINREH  863
              WRV KLKE   +     +  ++I  +EA+ML R L  +W  +LE IGLW+PADV++ EH
Sbjct  133   LWRVEKLKEVKRVTSSKSNLNSSIPFQEAKMLKRALASNWQMLLEAIGLWLPADVVHTEH  192

Query  864   DDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             +DKPE  +   EII G+ LPPEC+A+ HTDYDGAAVRWGLTHH+ESA +CC+AC++QAK 
Sbjct  193   NDKPENEQDLEEIIPGRPLPPECHAKTHTDYDGAAVRWGLTHHQESAADCCQACLDQAKN  252

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
             AK G+ KCNIWVYCP+E GCYSPDIY+HKHQECWLK +EKP+LNF+ +YSE+YRN HPNA
Sbjct  253   AKPGEMKCNIWVYCPSEFGCYSPDIYKHKHQECWLKQAEKPRLNFKDEYSESYRNNHPNA  312

Query  1224  PLIVPWMSGVM  1256
             P++VPW+SG++
Sbjct  313   PVVVPWISGIV  323



>ref|NP_001190903.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86218.1| uncharacterized protein AT4G33380 [Arabidopsis thaliana]
Length=326

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 231/311 (74%), Gaps = 6/311 (2%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             S+KR T+++C  N+++ L+VL+ L+ +SL+ Y  ND+    +YT D+IRKMEES RIR+ 
Sbjct  19    SFKRITLLVCFFNILIALFVLRFLYASSLHIYSNNDN--VVKYTADEIRKMEESIRIRRS  76

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EPT +++L  +LK E    E   E+   +K K+ DE+L  L+  +  +N T  RE VE+
Sbjct  77    KEPTLILQL--KLKHEVSTAESSTELSPNVKHKLVDEILQRLKSFEDKSNVTQLREVVET  134

Query  690   WRVAKLKEANDIIIG-NPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR  KL+EA ++I G N   +T+  EEA ML R L+++W  + EEIG W+PA+V N EHD
Sbjct  135   WRNEKLEEAKELIQGQNGVNSTLIVEEAGMLVRALELEWDVLSEEIGFWLPAEVTNVEHD  194

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKESA +CC+AC++QAKRA
Sbjct  195   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKESAADCCQACLDQAKRA  254

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK NF+ +YSE YRN HP AP
Sbjct  255   KPGETRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKQNFKDRYSETYRNNHPKAP  314

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  315   SIVPWVSGVVT  325



>ref|XP_006647945.1| PREDICTED: uncharacterized protein LOC102718147 [Oryza brachyantha]
Length=330

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 228/325 (70%), Gaps = 3/325 (1%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             AV     G   +WCSY+R T+ +C  N+V  L VL+SL +     P    +   +YT +Q
Sbjct  8     AVSFGGRGATARWCSYRRITVAVCLGNLVAALLVLRSLTSFAPAPP--KREEVLQYTEEQ  65

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkk-eflveekvvevPQPLKRKITDELLATLRGLD  647
             IRK EES RIR+E+EP EL++ V  L+K     E++  E+P  LK+KI+ E++  L  L 
Sbjct  66    IRKAEESIRIRREAEPFELVEAVKNLQKIFKRAEKRRKELPLELKQKISYEIVQLLHNLG  125

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIG  827
              N++   QRE+VE WR+ KLK+  +    N +   +  EEAR+L R L  +W  ++++IG
Sbjct  126   DNSSFAQQRESVELWRLEKLKDIKNASTRNSTKLGLSNEEARILKRALQFNWHLLMDDIG  185

Query  828   LWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             LWIP +V + EHDD+PE    + EIIAG  L P+CNAELHTDYDGAAVRWGLTH KESA 
Sbjct  186   LWIPLEVSHTEHDDRPENEPEDEEIIAGPPLAPQCNAELHTDYDGAAVRWGLTHPKESAA  245

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++QAK AK G+ +CNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+ +
Sbjct  246   DCCQACLDQAKNAKPGELRCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFKDK  305

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMSV  1262
             YSE+YRN+HP AP++VPWMSGV+S 
Sbjct  306   YSESYRNSHPTAPVVVPWMSGVISA  330



>emb|CDX75347.1| BnaA01g03550D [Brassica napus]
Length=1134

 Score =   352 bits (902),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 237/319 (74%), Gaps = 4/319 (1%)
 Frame = +3

Query  297   GGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQI  473
             GG    T G   SYKR T+++CS N+++ L+VL+ L+ +SL+ YP  +  +A RYT D+I
Sbjct  5     GGEWTVTGGGVVSYKRITLLVCSFNILIALFVLRFLYASSLHFYP--NHHNAVRYTSDEI  62

Query  474   RKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGN  653
             RKMEESTRIR+   P+EL++LV +L+ +    E  VE+   +K K+ DE+L  L+ L+  
Sbjct  63    RKMEESTRIRRSKHPSELVRLVKKLRHDVATSESSVELSPSVKGKLVDEILERLKRLEEK  122

Query  654   ANTTMQREAVESWRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIGL  830
             +N T+ REAVE+WR  KLKEA ++I   N   +T+  EEA ML R L+++W  + EEIG 
Sbjct  123   SNVTLVREAVETWRSEKLKEAKELIQEQNGVNSTMIVEEAGMLVRALELEWDALSEEIGF  182

Query  831   WIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYE  1010
             W+PA+V N EHDDKPEG E   EI+AG+ +P  CN ELHTDY GAAVRWGLTHHKESA +
Sbjct  183   WLPAEVHNEEHDDKPEGEEEPEEILAGRPVPAVCNVELHTDYGGAAVRWGLTHHKESAAD  242

Query  1011  CCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQY  1190
             CC+AC++QAKRAK G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY+EKPK  F+ +Y
Sbjct  243   CCQACLDQAKRAKPGEMRCNIWVYCPSEFGCFSPDIYEHKHQECWLKYAEKPKRTFKDRY  302

Query  1191  SEAYRNAHPNAPLIVPWMS  1247
             SEAYRN HP AP IVPW+S
Sbjct  303   SEAYRNNHPKAPTIVPWVS  321



>gb|KDO84230.1| hypothetical protein CISIN_1g020080mg [Citrus sinensis]
Length=291

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 222/299 (74%), Gaps = 12/299 (4%)
 Frame = +3

Query  378   VTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKESEPTELIKLVSQlkke  557
             + L +L   F  L T          +YTPDQIR MEES RIR ++EP  L+KLV+ LK+E
Sbjct  1     MLLVILPFFFFQLCT--------VVKYTPDQIRNMEESVRIRSDNEPMALVKLVNGLKQE  52

Query  558   flveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVESWRVAKLKEANDIIIGN  737
             F  +E V E+P+ +K ++ DE+L  L+  D   N + QREAVESWR  KL+EA  + IG 
Sbjct  53    FSRDESVFELPRAVKLRMIDEILRRLQSSDVKGNVSAQREAVESWRREKLEEAKQLSIGR  112

Query  738   PS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHDDKPEGAE---LEPEII  905
                 +TI  EEARML RVL+ DW  + EEIGLWIP ++I++EH DKP+G E   L+ +++
Sbjct  113   QGINSTILQEEARMLVRVLESDWAALSEEIGLWIPTEIIHKEHGDKPKGVEDEDLDEDVL  172

Query  906   AGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYC  1085
              G+  PPEC+AELHTDYDG A+RWGLTHH++SA +CC+AC+EQAKRAK G  KCNIWVYC
Sbjct  173   PGRPPPPECHAELHTDYDGVAIRWGLTHHRDSAADCCQACIEQAKRAKPGQMKCNIWVYC  232

Query  1086  PAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
             PAE GC+SPD Y+HK+QECWLKY+EKPKLNF+ +YSE YRNAHP APL+VPW+SGV+S+
Sbjct  233   PAETGCHSPDKYEHKYQECWLKYAEKPKLNFKDRYSEKYRNAHPAAPLVVPWVSGVVSL  291



>gb|EEC80221.1| hypothetical protein OsI_22145 [Oryza sativa Indica Group]
Length=333

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 234/314 (75%), Gaps = 1/314 (0%)
 Frame = +3

Query  324   KWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIR  503
             +WC+Y+R T+ +C  N+V  L V++SL+++   +     + A +Y+ +QIR +EES RIR
Sbjct  20    RWCTYRRVTVAVCLGNLVAVLLVVRSLYSAPGYFASAPRRVAVKYSEEQIRLVEESIRIR  79

Query  504   KESEPTELIKLVSQlkke-flveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREA  680
             + +   EL++ V +L+K     E++  E+P  LK+K++ E+L  +R L  N+NTT QREA
Sbjct  80    RAAVSVELVEAVKKLEKVFAREEKRRKELPLELKQKVSYEILERMRDLGENSNTTEQREA  139

Query  681   VESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINRE  860
             +ESWR+ KLK+       N S + +  EE+RML R L+++W  ++E+IGLWIP  V + E
Sbjct  140   LESWRLEKLKDIRSASAQNLSMSDLSNEESRMLKRALELNWRMLMEDIGLWIPVSVWHTE  199

Query  861   HDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAK  1040
             HDDKPE    E EIIAG  LPPECNA++HTDY GAAVRWGLTHHKESA +CC+AC++QAK
Sbjct  200   HDDKPENEPEEEEIIAGPPLPPECNAQVHTDYGGAAVRWGLTHHKESAADCCQACLDQAK  259

Query  1041  RAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPN  1220
             RA+ G  KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ PKLNF+ +YSE+YR+AHP+
Sbjct  260   RARPGALKCNIWVYCPSEYGCYSPDKYEHKHQECWLKQADHPKLNFKDRYSESYRDAHPS  319

Query  1221  APLIVPWMSGVMSV  1262
             AP++VPWMSGV++V
Sbjct  320   APVVVPWMSGVITV  333



>ref|NP_001057130.1| Os06g0214100 [Oryza sativa Japonica Group]
 dbj|BAD35304.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD35201.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19044.1| Os06g0214100 [Oryza sativa Japonica Group]
Length=333

 Score =   329 bits (843),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 168/314 (54%), Positives = 234/314 (75%), Gaps = 1/314 (0%)
 Frame = +3

Query  324   KWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIR  503
             +WC+Y+R T+ +C  N+V  L V++SL+++   +     + A +Y+ +QIR +EES RIR
Sbjct  20    RWCTYRRVTVAVCLGNLVAVLLVVRSLYSAPGYFASAPRRVAVKYSEEQIRLVEESIRIR  79

Query  504   KESEPTELIKLVSQlkke-flveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREA  680
             + +   EL++ V +L+K     E++  E+P  LK+K++ E+L  +R L  N+NTT QREA
Sbjct  80    RAAVSVELVEAVKKLEKVFAREEKRRKELPLELKQKVSYEILERMRDLGENSNTTEQREA  139

Query  681   VESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINRE  860
             +ESWR+ KLK+       N S + +  EE+RML R L+++W  ++++IGLWIP  V + E
Sbjct  140   LESWRLEKLKDIRSASAQNLSMSDLSNEESRMLKRALELNWRMLMDDIGLWIPVSVWHTE  199

Query  861   HDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAK  1040
             HDDKPE    E EIIAG  LPPECNA++HTDY GAAVRWGLTHHKESA +CC+AC++QAK
Sbjct  200   HDDKPENEPEEEEIIAGPPLPPECNAQVHTDYGGAAVRWGLTHHKESAADCCQACLDQAK  259

Query  1041  RAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPN  1220
             RA+ G  KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ PKLNF+ +YSE+YR+AHP+
Sbjct  260   RARPGALKCNIWVYCPSEYGCYSPDKYEHKHQECWLKQADHPKLNFKDRYSESYRDAHPS  319

Query  1221  APLIVPWMSGVMSV  1262
             AP++VPWMSGV++V
Sbjct  320   APVVVPWMSGVITV  333



>ref|XP_009393663.1| PREDICTED: uncharacterized protein LOC103979296 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=333

 Score =   327 bits (838),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 231/311 (74%), Gaps = 5/311 (2%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CS+KR T++ C +N+V  L VL+S   S + +P         ++ DQ+ ++EES R+R+E
Sbjct  24    CSFKRITVVACCVNLVAALVVLRSFDTSFFLFPSYGFNGNL-FSVDQVERIEESIRVRRE  82

Query  510   SEPTELIKLVSQlkkeflveekv-vevPQPLKRKITDELLATLRGLDGNANTTMQREAVE  686
             +E  EL++ V +L KE   E+K  + +PQ +K+K+ +E+L  L+G + + N T QR  V+
Sbjct  83    AESVELVRAVRKLSKELSREQKRGLNLPQNVKQKLANEILQRLQGDNVDTNVTKQR--VD  140

Query  687   SWRVAKLKEANDIIIGNPST-ATIKPEEARMLARvldvdwvevleeIGLWIPADVINREH  863
              WR+ KL+E   +     +  ++I  +EA+ML RVL+ +W+ +LE IGLWIPADVI+ EH
Sbjct  141   LWRIEKLEEVRRVTTSKSNIDSSISYQEAKMLKRVLESNWLMLLEGIGLWIPADVIHTEH  200

Query  864   DDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             +DKP+  +   EII G+ LPPEC+AELHTDYDGAAVRWGLTHHK+SA +CC+AC++QAK 
Sbjct  201   NDKPKDEQDLEEIIPGRPLPPECHAELHTDYDGAAVRWGLTHHKDSAADCCQACLDQAKH  260

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
              K G+KKCNIWVYCP+E GCYSPDIY+HKHQECWLK +EKP+LNF+ +YS++YR  HPNA
Sbjct  261   PKPGEKKCNIWVYCPSEFGCYSPDIYEHKHQECWLKQAEKPRLNFKDKYSKSYRKKHPNA  320

Query  1224  PLIVPWMSGVM  1256
             P++VPWMSGV+
Sbjct  321   PIVVPWMSGVV  331



>ref|XP_009388028.1| PREDICTED: uncharacterized protein LOC103974854 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=323

 Score =   323 bits (829),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 233/311 (75%), Gaps = 10/311 (3%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CS+KR T+++C +N+V  L VL++ + S      +D      ++ DQ+ +++ES R+R++
Sbjct  19    CSFKRITVVVCCVNLVAALLVLRTFYTSFSLVSSSDP-----FSVDQLERIQESIRVRRD  73

Query  510   SEPTELIKLVSQlkkeflv-eekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVE  686
             +EP EL++ V +L+KE L  E++V+++PQP+K+K+ +E+L  L+ +  N N T QR  V 
Sbjct  74    AEPVELVRAVRKLRKELLKDEKRVLKLPQPVKQKLANEILQKLQSVKDN-NVTEQR--VY  130

Query  687   SWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVINREH  863
              WRV KLKE   +     +  ++I  +EA+ML R L  +W  +LE IGLW+PADV++ EH
Sbjct  131   LWRVEKLKEVKRVTSSKSNLNSSIPFQEAKMLKRALASNWQMLLEAIGLWLPADVVHTEH  190

Query  864   DDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             +DKPE  +   EII G+ LPPEC+A+ HTDYDGAAVRWGLTHH+ESA +CC+AC++QAK 
Sbjct  191   NDKPENEQDLEEIIPGRPLPPECHAKTHTDYDGAAVRWGLTHHQESAADCCQACLDQAKN  250

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
             AK G+ KCNIWVYCP+E GCYSPDIY+HKHQECWLK +EKP+LNF+ +YSE+YRN HPNA
Sbjct  251   AKPGEMKCNIWVYCPSEFGCYSPDIYKHKHQECWLKQAEKPRLNFKDEYSESYRNNHPNA  310

Query  1224  PLIVPWMSGVM  1256
             P++VPW+SG++
Sbjct  311   PVVVPWISGIV  321



>ref|NP_001048198.1| Os02g0761600 [Oryza sativa Japonica Group]
 dbj|BAD17205.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10112.1| Os02g0761600 [Oryza sativa Japonica Group]
 gb|EAZ24705.1| hypothetical protein OsJ_08476 [Oryza sativa Japonica Group]
 dbj|BAH00039.1| unnamed protein product [Oryza sativa Japonica Group]
Length=330

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 229/324 (71%), Gaps = 5/324 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             + GG +   R  WCSY+R T+ +C  N+V  L VL+SL +   T P    +    YT +Q
Sbjct  10    SFGGRAATAR--WCSYRRITVAVCLGNLVAALLVLRSLTSLAPTPP--KREEVVEYTEEQ  65

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkk-eflveekvvevPQPLKRKITDELLATLRGLD  647
             IRK EES RIR+E+EP EL++ V  L+K     E++  E+P  LK+K++ E++  L  L 
Sbjct  66    IRKAEESIRIRREAEPVELVEAVKNLRKIFRREEKRRKELPLELKQKVSYEIVQLLLDLG  125

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIG  827
              N++   QREAVESWR  KLK+     I N +   +  EEAR L R L  +W  +LE+IG
Sbjct  126   DNSSFAQQREAVESWRFEKLKDIKSASIQNSTKLDLSNEEARTLKRALQFNWHVLLEDIG  185

Query  828   LWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             LWIP++V + EHDDKPE    E EIIAG  LP +CNAELHTDYDGAAVRWGLTH KESA 
Sbjct  186   LWIPSEVSHTEHDDKPENEPEEEEIIAGPPLPSQCNAELHTDYDGAAVRWGLTHPKESAA  245

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++QAK A+ G+ +CNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+ +
Sbjct  246   DCCQACLDQAKNARPGELRCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFKDK  305

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMS  1259
             YSE+YR++HP AP++VPWMSGV+S
Sbjct  306   YSESYRDSHPTAPVVVPWMSGVIS  329



>ref|XP_003570582.1| PREDICTED: uncharacterized protein LOC100838297 isoform X1 [Brachypodium 
distachyon]
Length=328

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 226/324 (70%), Gaps = 7/324 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             + GG +      W SY+R T+ +C  N+V  L VL+SL +S    P        +YT +Q
Sbjct  10    SFGGRATAG---WFSYRRVTVAVCLGNLVAALLVLRSLTSSA---PAPKRVEVVQYTEEQ  63

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvev-PQPLKRKITDELLATLRGLD  647
             IR++EES RIR+E+EP EL++ V +L+K F  EEK  +  P  LK+K++ E++  L  L 
Sbjct  64    IRRVEESIRIRREAEPIELVQAVKKLRKVFAREEKRRKKLPLELKQKVSYEIVWQLHELG  123

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIG  827
              N++   QRE +ESWRV  LK+       N S      EEAR+L R L+ +W  +LE+IG
Sbjct  124   DNSSVIQQREVLESWRVETLKDIKSASTQNSSNLGFSNEEARILKRALEFNWHMLLEDIG  183

Query  828   LWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             LWIP ++ + EHDDKP+    E EIIAG  L P+CNAELH DY GAAV+WGLTHHKESA 
Sbjct  184   LWIPLEISHTEHDDKPDNEPEEEEIIAGPPLDPQCNAELHADYGGAAVKWGLTHHKESAA  243

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++QAK AK G+ KCNIWVYCP+E GCYSPD Y+HKHQECWLK +++PKLNF+ +
Sbjct  244   DCCQACLDQAKNAKPGEMKCNIWVYCPSEFGCYSPDKYEHKHQECWLKQADQPKLNFKDR  303

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMS  1259
             YSE+YR++HP AP++VPWMSGV S
Sbjct  304   YSESYRDSHPRAPVVVPWMSGVTS  327



>gb|EAY87620.1| hypothetical protein OsI_09031 [Oryza sativa Indica Group]
Length=330

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 228/324 (70%), Gaps = 5/324 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             + GG +   R  WCSY+R T+ +C  N+V  L VL+SL +   T P    +    YT +Q
Sbjct  10    SFGGRAATAR--WCSYRRITVAVCLGNLVAALLVLRSLTSLAPTPP--KREEVVEYTEEQ  65

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkk-eflveekvvevPQPLKRKITDELLATLRGLD  647
             IRK EES RIR+E+EP EL++ V  L+K     E++  E+P  LK+K++ E++  L  L 
Sbjct  66    IRKAEESIRIRREAEPVELVEAVKNLRKIFRREEKRRKELPLELKQKVSYEIVQLLLDLG  125

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIG  827
              N++   Q EAVESWR  KLK+     I N +   +  EEAR L R L  +W  +LE+IG
Sbjct  126   DNSSFAQQLEAVESWRFEKLKDIKSASIQNSTKLDLSNEEARTLKRALQFNWHVLLEDIG  185

Query  828   LWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             LWIP++V + EHDDKPE    E EIIAG  LP +CNAELHTDYDGAAVRWGLTH KESA 
Sbjct  186   LWIPSEVSHTEHDDKPENEPEEEEIIAGPPLPSQCNAELHTDYDGAAVRWGLTHPKESAA  245

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++QAK A+ G+ +CNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+ +
Sbjct  246   DCCQACLDQAKNARPGELRCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFKDK  305

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMS  1259
             YSE+YR++HP AP++VPWMSGV+S
Sbjct  306   YSESYRDSHPTAPVVVPWMSGVIS  329



>dbj|BAJ96744.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   319 bits (817),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 221/325 (68%), Gaps = 4/325 (1%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             A       T   W SY+R T+ +C  N+V  L VL+SL +     P        +YT +Q
Sbjct  8     AASFGGRATAAGWFSYRRITVAVCLANLVAALLVLRSLTS---FAPAPKRVEVVQYTEEQ  64

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvev-PQPLKRKITDELLATLRGLD  647
             IR++EES RIR+E+EP EL++ V +L+K F  EEK  +  P  LK +++ EL+  L  L 
Sbjct  65    IRRVEESIRIRREAEPVELVQAVKKLRKVFAREEKRRKELPLELKLRVSYELVGRLNDLG  124

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIG  827
              N +   QREA+ESWRV  LK+A      N S   +  EEAR+L R L+ +W  +LE+IG
Sbjct  125   DNGSAIQQREALESWRVETLKDAKSASTRNSSNLGLSSEEARLLKRGLEFNWHALLEDIG  184

Query  828   LWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             LWI  +V + EHDDKP     E EIIAG  L P+CN ELH DY GAAV+WGLTHHKESA 
Sbjct  185   LWISPEVPHTEHDDKPANEPEEEEIIAGPPLRPQCNTELHADYGGAAVKWGLTHHKESAA  244

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++QA+ AK G+ KCNIWVYCP+E GCYSPD Y+HKHQECWLK +++PKLNF+ +
Sbjct  245   DCCQACLDQARNAKPGELKCNIWVYCPSEFGCYSPDKYEHKHQECWLKQADQPKLNFKDK  304

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMSV  1262
             YSE+YR++HP AP++VPWMSGV S 
Sbjct  305   YSESYRDSHPRAPVVVPWMSGVTSA  329



>ref|XP_004964889.1| PREDICTED: uncharacterized protein LOC101770149 isoform X1 [Setaria 
italica]
 ref|XP_004964890.1| PREDICTED: uncharacterized protein LOC101770149 isoform X2 [Setaria 
italica]
Length=333

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 224/313 (72%), Gaps = 2/313 (1%)
 Frame = +3

Query  327   WCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRK  506
             WC+ +R  + +C  N+V  L V ++L+ +  T+     +   RY+ +Q+R +EES RIR+
Sbjct  22    WCTCRRVAVALCLGNLVAALLVARALY-APGTFASAPKRGEARYSREQMRWVEESIRIRR  80

Query  507   ESEPTELIKLVSQlkkeflveekvvev-PQPLKRKITDELLATLRGLDGNANTTMQREAV  683
              +EP ELI+ V +L++ F+ EEK  +  P  LK+K++ E+L  LR L  N NTT QREAV
Sbjct  81    AAEPAELIEAVEKLRRAFVREEKRRKELPLELKQKVSHEILQRLRDLGENRNTTEQREAV  140

Query  684   ESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREH  863
             ESWRV KLK        N S   +  EE+RML R LD +W  +LE+IGLWIP  V + EH
Sbjct  141   ESWRVEKLKYIRSSSTQNLSNFGLSGEESRMLKRALDFNWRMLLEDIGLWIPPTVHHIEH  200

Query  864   DDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             DDKPE  + E EI+ G  LPPECNAELHTDY G AVRWGLTHHKESA +CC+AC++QAKR
Sbjct  201   DDKPENEQEEEEIVPGPPLPPECNAELHTDYGGTAVRWGLTHHKESAADCCQACIDQAKR  260

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
             AK G  KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ PKLNF+ +YSE YR++HP A
Sbjct  261   AKPGALKCNIWVYCPSEYGCYSPDKYEHKHQECWLKQADHPKLNFKDRYSEPYRDSHPTA  320

Query  1224  PLIVPWMSGVMSV  1262
             P++VPWMSGV+S 
Sbjct  321   PVVVPWMSGVISA  333



>ref|XP_004954004.1| PREDICTED: uncharacterized protein LOC101768836 isoform X1 [Setaria 
italica]
Length=332

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 227/325 (70%), Gaps = 3/325 (1%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYN-DSQSAFRYTPD  467
             AV      T G W SY+R T+ +C  N+V  L VL+SL       P   ++     YT +
Sbjct  8     AVSFGGRATAG-WFSYRRVTVAVCLGNLVAALLVLRSLTAPASFAPTAPNNGGVVPYTEE  66

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveek-vvevPQPLKRKITDELLATLRGL  644
             QI+++EES RIR+E+EP EL++ V +L+K F  EEK   E+P  LK+KI+ +++  L+ L
Sbjct  67    QIKRVEESIRIRREAEPVELVQAVKKLQKVFAREEKWRKELPLVLKQKISYDIVRRLQEL  126

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeI  824
              GN +   QRE VESWR  KLK+       N +   +  +E RML R L+ +W  ++E+I
Sbjct  127   GGNGSLAQQREVVESWRAEKLKDIKSASTQNQTNLDLSSDETRMLKRALEFNWRMLMEDI  186

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             GLWIP +V +  HDDKPE    E EIIAG  L P+CNAELHTDYDGAAVRWGLTHHKESA
Sbjct  187   GLWIPEEVTHTVHDDKPENEPEEEEIIAGPPLSPQCNAELHTDYDGAAVRWGLTHHKESA  246

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QAK AK G+ KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ PKLNF+ 
Sbjct  247   ADCCQACLDQAKNAKPGELKCNIWVYCPSEFGCYSPDKYEHKHQECWLKQADHPKLNFKD  306

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVMS  1259
             +YSE+YR+AHP AP++VPWMSGV+ 
Sbjct  307   KYSESYRDAHPTAPVVVPWMSGVIG  331



>ref|XP_009403092.1| PREDICTED: uncharacterized protein LOC103986723 [Musa acuminata 
subsp. malaccensis]
Length=325

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 235/324 (73%), Gaps = 9/324 (3%)
 Frame = +3

Query  288   WAVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPD  467
             W  GG+      ++CS+KR T+++C +N+V  L VL+S ++S +    +   S   ++ D
Sbjct  8     WGRGGSK-----RFCSFKRITVMVCCVNIVAALLVLRSFYSSFFFASSSRVISD-PFSVD  61

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekv-vevPQPLKRKITDELLATLRGL  644
             Q +++EES +IR+E+EP EL+K V +L KEF  E K  +++P+ LK+K+  E+L +L+ +
Sbjct  62    QTKRIEESIQIRREAEPVELVKAVRKLTKEFSREAKRGLKLPRSLKQKLVYEILHSLQSV  121

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeI  824
             + N N T QR+A E WRV KL+E         S ++I  +EA+ML R L+  W  ++EEI
Sbjct  122   N-NTNVTEQRDAAELWRVEKLEEVKRAT-RTKSNSSIPYQEAKMLKRALESKWPILMEEI  179

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             GLW PADVIN EH+DKPE  +   EII G+ LPPEC+AELHTDYDG AVRWGLTHHKESA
Sbjct  180   GLWTPADVINSEHNDKPENEQDPEEIIPGRPLPPECHAELHTDYDGTAVRWGLTHHKESA  239

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QA RAK G  KCNIWVYCP+E GCYSPDIY+HKHQECWLK + +P++NF+ 
Sbjct  240   ADCCQACLDQANRAKPGQMKCNIWVYCPSEYGCYSPDIYEHKHQECWLKQAVEPRVNFKD  299

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVM  1256
             +YSE+YR  H NAP++VPW+SGV+
Sbjct  300   KYSESYRTDHSNAPVVVPWISGVV  323



>ref|XP_006656766.1| PREDICTED: uncharacterized protein LOC102717445 [Oryza brachyantha]
Length=361

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/326 (53%), Positives = 235/326 (72%), Gaps = 5/326 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQS-AFRYTPD  467
             A+G  S     +WC+Y+R T+ +C  N+V  L VL+SL+++   +     +  A +Y+ +
Sbjct  39    ALGSRSAA---RWCTYRRVTVAVCLGNLVAVLLVLRSLYSAPGHFASPPPRRVAVKYSEE  95

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvve-vPQPLKRKITDELLATLRGL  644
             QIR +EES RIR+ + P EL++ V +L K F  EEK  + +P  LK+K++ E+L  L  L
Sbjct  96    QIRLVEESIRIRRAAVPVELVEAVKKLDKVFAREEKRRKDLPLELKQKVSYEILNRLLDL  155

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeI  824
               N++TT QREA+ESWR  KLK+       N S + +  EE+RML R L+ +W  +LE+ 
Sbjct  156   GENSSTTEQREALESWRAEKLKDIRSASAQNLSISGLSIEESRMLKRALEFNWRMLLEDN  215

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             GLWIP  V + EH+DKPE    E EIIAG  LPPECNA+LHTDY GAAVRWGLTHHKESA
Sbjct  216   GLWIPFIVWHTEHNDKPENEPEEEEIIAGPPLPPECNAQLHTDYGGAAVRWGLTHHKESA  275

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QA+RA+ G  KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ PKLNF+ 
Sbjct  276   ADCCQACLDQARRARPGALKCNIWVYCPSEYGCYSPDKYEHKHQECWLKQADHPKLNFKD  335

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVMSV  1262
             +YSE+YR+AHP+AP++VPWM+GV++V
Sbjct  336   RYSESYRDAHPSAPVVVPWMAGVIAV  361



>ref|XP_010236085.1| PREDICTED: uncharacterized protein LOC100838297 isoform X2 [Brachypodium 
distachyon]
Length=327

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 225/324 (69%), Gaps = 8/324 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQ  470
             + GG +      W SY+R T+ +C  N+V  L VL+SL +S    P        +YT +Q
Sbjct  10    SFGGRATAG---WFSYRRVTVAVCLGNLVAALLVLRSLTSSA---PAPKRVEVVQYTEEQ  63

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvev-PQPLKRKITDELLATLRGLD  647
             IR++EES RIR+E+EP EL++ V +L+K F  EEK  +  P  LK+K++ E++  L  L 
Sbjct  64    IRRVEESIRIRREAEPIELVQAVKKLRKVFAREEKRRKKLPLELKQKVSYEIVWQLHELG  123

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIG  827
              N++   QR  +ESWRV  LK+       N S      EEAR+L R L+ +W  +LE+IG
Sbjct  124   DNSSVIQQR-VLESWRVETLKDIKSASTQNSSNLGFSNEEARILKRALEFNWHMLLEDIG  182

Query  828   LWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             LWIP ++ + EHDDKP+    E EIIAG  L P+CNAELH DY GAAV+WGLTHHKESA 
Sbjct  183   LWIPLEISHTEHDDKPDNEPEEEEIIAGPPLDPQCNAELHADYGGAAVKWGLTHHKESAA  242

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++QAK AK G+ KCNIWVYCP+E GCYSPD Y+HKHQECWLK +++PKLNF+ +
Sbjct  243   DCCQACLDQAKNAKPGEMKCNIWVYCPSEFGCYSPDKYEHKHQECWLKQADQPKLNFKDR  302

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMS  1259
             YSE+YR++HP AP++VPWMSGV S
Sbjct  303   YSESYRDSHPRAPVVVPWMSGVTS  326



>ref|XP_004291122.1| PREDICTED: uncharacterized protein LOC101308832 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 171/291 (59%), Positives = 216/291 (74%), Gaps = 7/291 (2%)
 Frame = +3

Query  300   GNSNGTRGKWC-SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIR  476
             G     RGKWC SYK+TT+I+C IN+V+ LYVL+SL+ SLY Y   DS  A  YTPDQIR
Sbjct  9     GIHKAVRGKWCCSYKKTTLIVCCINIVIALYVLRSLYASLYIYSDRDSHLAVEYTPDQIR  68

Query  477   KMEESTRIRKESEPTELIKLVSQlkkeflveekv-vevPQPLKRKITDELLATLRGLDGN  653
             KMEES RIRK +EP ELI+LV QLKKE   E  V VE+P+ LK K+T+E++  L+ L   
Sbjct  69    KMEESVRIRKSAEPLELIRLVKQLKKELSDEHSVGVELPESLKLKLTNEIIDKLKTLPPK  128

Query  654   ANTTMQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGL  830
             AN + QR+  E W   KL++A  ++    +  +TI  EEA ML + L+ D  ++LE+IGL
Sbjct  129   ANVSEQRDFAERWCTEKLEQAKQVVHERGTLNSTISLEEAVMLVKALESDRTQMLEDIGL  188

Query  831   WIPADVINREHDDKPEGA---ELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             WIP++V+N EHDDKPEG    EL+ EI+ G+ LPPEC+AELHTDYDGAAVRWGL HHKES
Sbjct  189   WIPSEVVNNEHDDKPEGELGDELD-EILPGRPLPPECHAELHTDYDGAAVRWGLNHHKES  247

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKY  1154
             A +CC+AC+ QAKRAK  +KKCN+WVYCPAE GC+SPDIY+H+  ECWLK+
Sbjct  248   AADCCQACLVQAKRAKPNEKKCNVWVYCPAEDGCHSPDIYEHRLGECWLKF  298



>ref|XP_003603021.1| hypothetical protein MTR_3g101480 [Medicago truncatula]
 gb|AES73272.1| plant/F17M5-140 protein [Medicago truncatula]
Length=322

 Score =   313 bits (803),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 221/308 (72%), Gaps = 5/308 (2%)
 Frame = +3

Query  315   TRGKW-CSYKRTTIIICSINV-VVTLYVLQSLFNSLYT-YPYNDSQSAFRYTPDQIRKME  485
              RGK+ CS+  TT+ +C  N+ +V L+V +SL++SL   +    S     Y+PDQI KME
Sbjct  2     ARGKYLCSFNNTTLFLCLFNIAIVALFVFRSLYSSLSIHFAEVSSDVVVSYSPDQIHKME  61

Query  486   ESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNA-NT  662
             ES  IR   +P ELI LV  L+ EFL E   VE+P+ LK+KI DE+L TLR L+ ++ N 
Sbjct  62    ESVHIRMAYKPVELINLVKVLEGEFLRENLAVELPRYLKQKIVDEILHTLRSLNSSSINI  121

Query  663   TMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPA  842
               +RE VESWR  KLKE     +   S +TI  EEA +L R L+ DW  + EE+GLWIPA
Sbjct  122   AKEREVVESWRKEKLKEVKLAHVKGTSNSTIPGEEAGLLVRALESDWDLLCEEVGLWIPA  181

Query  843   DVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCR  1019
              ++N EHDDKPEGAE  + EI+ G+ LPPECNAE HTDYDG AVRWGLTHHK+SA +CC+
Sbjct  182   QIVNEEHDDKPEGAEEFDEEILPGRPLPPECNAEHHTDYDGTAVRWGLTHHKDSAADCCQ  241

Query  1020  ACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEA  1199
             AC++ A+ AK G  KCNIWVYCP E GC+SPDIY+HKH+ECWLKY EKP+LNF+ +Y E+
Sbjct  242   ACLDHARHAKEGVMKCNIWVYCPNEFGCHSPDIYEHKHRECWLKYDEKPQLNFKDKYPES  301

Query  1200  YRNAHPNA  1223
             YRN++P+A
Sbjct  302   YRNSYPSA  309



>gb|AFW85338.1| hypothetical protein ZEAMMB73_547025 [Zea mays]
Length=328

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 222/313 (71%), Gaps = 2/313 (1%)
 Frame = +3

Query  327   WCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRK  506
             WC+ +R  + +C  N+V  L V ++L+ +  ++ +   +   +Y+ +Q+R +EES RIR+
Sbjct  17    WCTCRRAAVALCVANLVAALLVARALY-APGSFAFAPKRGELKYSREQMRWVEESIRIRR  75

Query  507   ESEPTELIKLVSQlkkeflveekvve-vPQPLKRKITDELLATLRGLDGNANTTMQREAV  683
              +EP ELI+ V +L+K F  EEK  + +P  LK+K++ E+L  L  L   +NTT Q+EAV
Sbjct  76    AAEPVELIEAVKKLRKAFTREEKTRKGLPLELKQKVSLEILQRLHDLGEGSNTTEQQEAV  135

Query  684   ESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREH  863
             E+WRV KLK+       N S   +  E++RML R L+ +W  +LE+IGLWIP  + + EH
Sbjct  136   EAWRVGKLKDMRSASSKNLSNFGLSSEDSRMLKRALEFNWQRILEDIGLWIPPTIYHIEH  195

Query  864   DDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             DDKPE    + EII G  LPPECN ELHTDY G AVRWGLTHHKESA +CC+AC++QAKR
Sbjct  196   DDKPENEPEDEEIIPGPPLPPECNTELHTDYGGTAVRWGLTHHKESAADCCQACIDQAKR  255

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
             A+ G  KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ P+LNF+ +Y E YR++HP A
Sbjct  256   ARPGALKCNIWVYCPSEYGCYSPDKYEHKHQECWLKQADHPRLNFKDRYPEPYRDSHPTA  315

Query  1224  PLIVPWMSGVMSV  1262
             P++VPWMSGV++ 
Sbjct  316   PVVVPWMSGVITA  328



>ref|XP_006434802.1| hypothetical protein CICLE_v10001804mg [Citrus clementina]
 gb|ESR48042.1| hypothetical protein CICLE_v10001804mg [Citrus clementina]
Length=265

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 208/265 (78%), Gaps = 4/265 (2%)
 Frame = +3

Query  480   MEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNAN  659
             MEES RIR+++EP  L+KLV+ LK+EF  +E V E+P+ +K ++ DE+L  L+  D   N
Sbjct  1     MEESVRIRRDNEPMALVKLVNGLKQEFSRDESVFELPRAVKLRMIDEILRRLQSSDVKGN  60

Query  660   TTMQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWI  836
              + QREAVESWR  KL+EA  + IG     +TI  EEARML RVL+ DW  + EEIGLWI
Sbjct  61    VSAQREAVESWRREKLEEAKQLSIGRQGINSTILQEEARMLVRVLESDWAALSEEIGLWI  120

Query  837   PADVINREHDDKPEGAE---LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             P ++I++EH DKP+G E   L+ +++ G+  PPEC+AELHTDYDG A+RWGLTHH++SA 
Sbjct  121   PTEIIHKEHGDKPKGVEDEDLDEDVLPGRPPPPECHAELHTDYDGVAIRWGLTHHRDSAA  180

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC+EQAKRAK G  KCNIWVYCPAE GC+SPD Y+HK+QECWLKY+EKPKLNF+ +
Sbjct  181   DCCQACIEQAKRAKPGQMKCNIWVYCPAETGCHSPDKYEHKYQECWLKYAEKPKLNFKDR  240

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMSV  1262
             YSE YRNAHP APL+VPW+SGV+S+
Sbjct  241   YSEKYRNAHPAAPLVVPWVSGVVSL  265



>ref|XP_002454592.1| hypothetical protein SORBIDRAFT_04g034000 [Sorghum bicolor]
 gb|EES07568.1| hypothetical protein SORBIDRAFT_04g034000 [Sorghum bicolor]
Length=332

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 224/326 (69%), Gaps = 5/326 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQ-SAFRYTPD  467
             AV      T G WCSY+R T+ +C  N+V  L VL+SL       P   ++    +YT +
Sbjct  8     AVSFGGRATTG-WCSYRRVTVAVCLGNLVAALLVLRSLTAPASFAPTAPNRVEVVQYTEE  66

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPL--KRKITDELLATLRG  641
             QIR +EES RIR+E+EP EL+  V +L+K+F  EEK      PL  K+K++ +++  L  
Sbjct  67    QIRSVEESIRIRREAEPVELVLAVKKLRKKFAQEEKRRREELPLVLKQKVSYDIVRRLHD  126

Query  642   LDGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevlee  821
             L  N +   QR  VESWRV KLK+       N S   +  +E RML R L+ +W  ++E+
Sbjct  127   LGDNGSLAEQR-VVESWRVEKLKDIKVASTRNQSNLDLSSKETRMLKRALEFNWYMLMED  185

Query  822   IGLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             IGLWIP +V +  HDDKPE    E EI+AG  L P+CNAELHTDYDGAAVRWGLTHHKES
Sbjct  186   IGLWIPEEVKHTVHDDKPENEPEEEEIVAGPPLSPQCNAELHTDYDGAAVRWGLTHHKES  245

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QAK AK G+ KCNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+
Sbjct  246   AADCCQACLDQAKNAKPGELKCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFK  305

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMS  1259
              +YSE YR+AHPNAP++VPWMSGV S
Sbjct  306   DKYSEPYRDAHPNAPVVVPWMSGVTS  331



>ref|XP_004954005.1| PREDICTED: uncharacterized protein LOC101768836 isoform X2 [Setaria 
italica]
Length=331

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 226/325 (70%), Gaps = 4/325 (1%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYN-DSQSAFRYTPD  467
             AV      T G W SY+R T+ +C  N+V  L VL+SL       P   ++     YT +
Sbjct  8     AVSFGGRATAG-WFSYRRVTVAVCLGNLVAALLVLRSLTAPASFAPTAPNNGGVVPYTEE  66

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveek-vvevPQPLKRKITDELLATLRGL  644
             QI+++EES RIR+E+EP EL++ V +L+K F  EEK   E+P  LK+KI+ +++  L+ L
Sbjct  67    QIKRVEESIRIRREAEPVELVQAVKKLQKVFAREEKWRKELPLVLKQKISYDIVRRLQEL  126

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeI  824
              GN +   QR  VESWR  KLK+       N +   +  +E RML R L+ +W  ++E+I
Sbjct  127   GGNGSLAQQR-VVESWRAEKLKDIKSASTQNQTNLDLSSDETRMLKRALEFNWRMLMEDI  185

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             GLWIP +V +  HDDKPE    E EIIAG  L P+CNAELHTDYDGAAVRWGLTHHKESA
Sbjct  186   GLWIPEEVTHTVHDDKPENEPEEEEIIAGPPLSPQCNAELHTDYDGAAVRWGLTHHKESA  245

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QAK AK G+ KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ PKLNF+ 
Sbjct  246   ADCCQACLDQAKNAKPGELKCNIWVYCPSEFGCYSPDKYEHKHQECWLKQADHPKLNFKD  305

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVMS  1259
             +YSE+YR+AHP AP++VPWMSGV+ 
Sbjct  306   KYSESYRDAHPTAPVVVPWMSGVIG  330



>ref|XP_011017224.1| PREDICTED: uncharacterized protein LOC105120641 isoform X2 [Populus 
euphratica]
Length=263

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 210/262 (80%), Gaps = 2/262 (1%)
 Frame = +3

Query  480   MEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNAN  659
             MEES RIR+  EP EL+K+V +LK+EF  EE V+E+P+ +K KITDE+L  LR L+ NAN
Sbjct  1     MEESIRIRRAKEPLELVKIVKELKEEFNREETVIELPKEVKNKITDEILERLRSLNANAN  60

Query  660   TTMQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWI  836
              + QR AVE+WR  KL+E   +       T++I  EEA +L R L+ DW  + E IGLW+
Sbjct  61    ISEQRNAVENWRKEKLQELKMLARETEGLTSSILKEEAGILVRALESDWAVLSENIGLWV  120

Query  837   PADVINREHDDKPEGAELEPE-IIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYEC  1013
             PA+VI++EHDDKPEG E   E ++ G+ LPPEC+AELHTDYDGAAVRWGLTHHKESA +C
Sbjct  121   PAEVIHQEHDDKPEGEEEPEEEVLPGRPLPPECHAELHTDYDGAAVRWGLTHHKESAADC  180

Query  1014  CRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYS  1193
             C+AC++QAK AK G+KKCN WVYCP+E GCYSPDIYQHK+QECWLKY+EKPKLNF+ +YS
Sbjct  181   CQACLDQAKYAKPGEKKCNTWVYCPSETGCYSPDIYQHKNQECWLKYAEKPKLNFKDRYS  240

Query  1194  EAYRNAHPNAPLIVPWMSGVMS  1259
             E+YR++HPNAPLIVPW+SGV+S
Sbjct  241   ESYRDSHPNAPLIVPWVSGVVS  262



>ref|NP_001130057.1| uncharacterized protein LOC100191149 [Zea mays]
 gb|ACF78178.1| unknown [Zea mays]
Length=330

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 223/324 (69%), Gaps = 5/324 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQS-AFRYTPD  467
             AV      T G WCSY+R T+ +C  N+V  L VL+SL       P   ++    +YT +
Sbjct  8     AVSFGRRATTG-WCSYRRVTVAVCIGNLVAVLLVLRSLTAPASFAPTAPNRGEVVQYTEE  66

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekv-vevPQPLKRKITDELLATLRGL  644
             QIR +EES RIR+E+EP EL+  V +L+K+   E K   E+   LK+K+  ++   L  L
Sbjct  67    QIRWVEESIRIRREAEPVELVLAVKKLRKKLAQEVKRREELSLVLKQKVYYDIARGLHEL  126

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeI  824
               N++   QRE VESWRV KLK  N     N S+  +  EE RML + L+ +W  +LE+I
Sbjct  127   GDNSSLAQQREVVESWRVEKLK--NSASTRNQSSLDLSSEETRMLKQALEFNWHMLLEDI  184

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             GLWIP +V +  HDDKPE    E EI+AG  L P+CNAELHTDYDGAAVRWGLTHHKESA
Sbjct  185   GLWIPDEVTHTVHDDKPENEPEEEEIVAGPPLSPQCNAELHTDYDGAAVRWGLTHHKESA  244

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QAK AK G+ KCNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+ 
Sbjct  245   ADCCQACLDQAKNAKPGELKCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFKD  304

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVM  1256
             +YSE YR+AHP AP++VPWMSGV+
Sbjct  305   KYSEPYRDAHPTAPVVVPWMSGVI  328



>ref|XP_006829689.1| hypothetical protein AMTR_s00126p00040820 [Amborella trichopoda]
 gb|ERM97105.1| hypothetical protein AMTR_s00126p00040820 [Amborella trichopoda]
Length=342

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 227/324 (70%), Gaps = 19/324 (6%)
 Frame = +3

Query  288   WAVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYND-----SQSAF  452
             W  GG S       CSYKRT +I+C+IN+   LYVLQSLF+S+Y    +      SQ+A 
Sbjct  11    WGNGGRS------MCSYKRTAMIVCTINIGAALYVLQSLFSSVYIVSTHSNGVPHSQTAT  64

Query  453   RYTPDQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLAT  632
              YT DQI  MEE+ RIR  +EP EL++LV ++ KE   EE V   PQP+K+KI +E+L  
Sbjct  65    TYTKDQINFMEEAIRIRHMAEPRELLRLVMEIDKETSNEEAVNM-PQPMKQKIAEEILHM  123

Query  633   LRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEE-----ARMLARvldv  797
             L+ L GNA  T QREA+E WR  KL+E    I+   S+      E     + M+ RVL+ 
Sbjct  124   LKELKGNA--TEQREALEMWRKEKLEEVKKRIVHRKSSNFTDLTEETETFSEMMTRVLES  181

Query  798   dwvevleeIGLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRW  977
              W+ +LE+IGLW+P +V+N++        ELE EIIAGK  PPEC+AE HTDYDGAAVRW
Sbjct  182   QWIPLLEDIGLWMPFEVLNKDVSKLEAEEELEDEIIAGKPPPPECHAERHTDYDGAAVRW  241

Query  978   GLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYS  1157
             GLTHHKESA +CC+AC++QAKRAK G+KKCNIWVYCP+E GCYSPDIY+HKHQECWLK +
Sbjct  242   GLTHHKESAADCCQACLDQAKRAKPGEKKCNIWVYCPSEAGCYSPDIYEHKHQECWLKQA  301

Query  1158  EKPKLNFQHQYSEAYRNAHPNAPL  1229
             + P+LNF+ +YS +YR+AHP AP+
Sbjct  302   DTPRLNFKDKYSASYRSAHPTAPV  325



>gb|AFW73561.1| hypothetical protein ZEAMMB73_717350 [Zea mays]
Length=330

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 223/324 (69%), Gaps = 5/324 (2%)
 Frame = +3

Query  291   AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQS-AFRYTPD  467
             AV      T G WCSY+R T+ +C  N+V  L VL+SL       P   ++    +YT +
Sbjct  8     AVSFGRRATTG-WCSYRRVTVAVCIGNLVAVLLVLRSLTAPASFAPTAPNRGEVVQYTEE  66

Query  468   QIRKMEESTRIRKESEPTELIKLVSQlkkeflveekv-vevPQPLKRKITDELLATLRGL  644
             QIR +EES RIR+E+EP EL+  V +L+K+   E K   E+   LK+K+  ++   L  L
Sbjct  67    QIRWVEESIRIRREAEPVELVLAVKKLRKKLAQEVKRREELSLVLKQKVYYDIARGLHEL  126

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeI  824
               N++   QRE VESWRV KLK  N     N S+  +  EE RML + L+ +W  +LE+I
Sbjct  127   GDNSSLAQQREVVESWRVEKLK--NIASTRNQSSLDLSSEETRMLKQALEFNWHMLLEDI  184

Query  825   GLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             GLWIP +V +  HDDKPE    E EI+AG  L P+CNAELHTDYDGAAVRWGLTHHKESA
Sbjct  185   GLWIPDEVTHTVHDDKPENEPEEEEIVAGPPLSPQCNAELHTDYDGAAVRWGLTHHKESA  244

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC++QAK AK G+ KCNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+ 
Sbjct  245   ADCCQACLDQAKNAKPGELKCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFKD  304

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVM  1256
             +YSE YR+AHP AP++VPWMSGV+
Sbjct  305   KYSEPYRDAHPTAPVVVPWMSGVI  328



>gb|AFW73562.1| hypothetical protein ZEAMMB73_717350, partial [Zea mays]
Length=350

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 218/312 (70%), Gaps = 4/312 (1%)
 Frame = +3

Query  327   WCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQS-AFRYTPDQIRKMEESTRIR  503
             WCSY+R T+ +C  N+V  L VL+SL       P   ++    +YT +QIR +EES RIR
Sbjct  39    WCSYRRVTVAVCIGNLVAVLLVLRSLTAPASFAPTAPNRGEVVQYTEEQIRWVEESIRIR  98

Query  504   KESEPTELIKLVSQlkkeflveekvvevPQ-PLKRKITDELLATLRGLDGNANTTMQREA  680
             +E+EP EL+  V +L+K+   E K  E     LK+K+  ++   L  L  N++   QRE 
Sbjct  99    REAEPVELVLAVKKLRKKLAQEVKRREELSLVLKQKVYYDIARGLHELGDNSSLAQQREV  158

Query  681   VESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINRE  860
             VESWRV KLK  N     N S+  +  EE RML + L+ +W  +LE+IGLWIP +V +  
Sbjct  159   VESWRVEKLK--NIASTRNQSSLDLSSEETRMLKQALEFNWHMLLEDIGLWIPDEVTHTV  216

Query  861   HDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAK  1040
             HDDKPE    E EI+AG  L P+CNAELHTDYDGAAVRWGLTHHKESA +CC+AC++QAK
Sbjct  217   HDDKPENEPEEEEIVAGPPLSPQCNAELHTDYDGAAVRWGLTHHKESAADCCQACLDQAK  276

Query  1041  RAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPN  1220
              AK G+ KCNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+ +YSE YR+AHP 
Sbjct  277   NAKPGELKCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFKDKYSEPYRDAHPT  336

Query  1221  APLIVPWMSGVM  1256
             AP++VPWMSGV+
Sbjct  337   APVVVPWMSGVI  348



>ref|XP_002436698.1| hypothetical protein SORBIDRAFT_10g007210 [Sorghum bicolor]
 gb|EER88065.1| hypothetical protein SORBIDRAFT_10g007210 [Sorghum bicolor]
Length=328

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 220/313 (70%), Gaps = 2/313 (1%)
 Frame = +3

Query  327   WCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRK  506
             WC+ +R  + +C  N+V  L V ++L+ +  ++ +   +   RY+ +Q+R +EES RIR+
Sbjct  17    WCTCRRVAVALCVGNLVAALLVARALY-APGSFAFAPRRGELRYSREQMRWVEESIRIRR  75

Query  507   ESEPTELIKLVSQlkkeflveekvvev-PQPLKRKITDELLATLRGLDGNANTTMQREAV  683
              +EP ELI+ V +L+K F  EEK     P  LK+K++ E+L  L  L  NANTT QREAV
Sbjct  76    AAEPVELIEAVKKLRKAFAREEKRRRELPLELKQKVSLEILQRLHDLGENANTTEQREAV  135

Query  684   ESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREH  863
             E+WRV KLK        N S  ++  EE+R L R L+ +W  +LE+IGLWIP  + + EH
Sbjct  136   EAWRVGKLKYMRSTSTKNLSNVSLSSEESRRLKRALEFNWQMLLEDIGLWIPPTIYHIEH  195

Query  864   DDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             DDKPE    +  II G  LPPECN ELHTDY G AVRWGLTHHKESA +CC+AC++QAKR
Sbjct  196   DDKPENEPEDEGIIPGPPLPPECNTELHTDYGGTAVRWGLTHHKESAADCCQACIDQAKR  255

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNA  1223
             A+ G  KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ P+LNF+ +YSE YR++HP A
Sbjct  256   ARPGALKCNIWVYCPSEYGCYSPDKYEHKHQECWLKQADHPRLNFKDRYSEPYRDSHPTA  315

Query  1224  PLIVPWMSGVMSV  1262
             P++VPWMSGV++ 
Sbjct  316   PVVVPWMSGVITA  328



>ref|XP_009388029.1| PREDICTED: uncharacterized protein LOC103974854 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=292

 Score =   299 bits (765),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 217/310 (70%), Gaps = 39/310 (13%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             CS+KR T+++C +N+V  L VL++ + S      +D      ++ DQ+ +++ES R+R++
Sbjct  19    CSFKRITVVVCCVNLVAALLVLRTFYTSFSLVSSSDP-----FSVDQLERIQESIRVRRD  73

Query  510   SEPTELIKLVSQlkkeflv-eekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVE  686
             +EP EL++ V +L+KE L  E++V+++PQP+K+K+ +E+L  L+ +  N N T QRE   
Sbjct  74    AEPVELVRAVRKLRKELLKDEKRVLKLPQPVKQKLANEILQKLQSVKDN-NVTEQRE---  129

Query  687   SWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
                                          ML R L  +W  +LE IGLW+PADV++ EH+
Sbjct  130   -----------------------------MLKRALASNWQMLLEAIGLWLPADVVHTEHN  160

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPE  +   EII G+ LPPEC+A+ HTDYDGAAVRWGLTHH+ESA +CC+AC++QAK A
Sbjct  161   DKPENEQDLEEIIPGRPLPPECHAKTHTDYDGAAVRWGLTHHQESAADCCQACLDQAKNA  220

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ KCNIWVYCP+E GCYSPDIY+HKHQECWLK +EKP+LNF+ +YSE+YRN HPNAP
Sbjct  221   KPGEMKCNIWVYCPSEFGCYSPDIYKHKHQECWLKQAEKPRLNFKDEYSESYRNNHPNAP  280

Query  1227  LIVPWMSGVM  1256
             ++VPW+SG++
Sbjct  281   VVVPWISGIV  290



>ref|XP_008393823.1| PREDICTED: uncharacterized protein LOC103455983 isoform X2 [Malus 
domestica]
Length=264

 Score =   296 bits (757),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 200/262 (76%), Gaps = 4/262 (2%)
 Frame = +3

Query  480   MEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNAN  659
             MEES RIRK +EP ELI+LV +  K+ L  E  VE+PQPLK K+T++++  L+ L  NAN
Sbjct  1     MEESVRIRKAAEPVELIRLV-KALKKELYREVAVELPQPLKLKMTNDIIDRLKTLRPNAN  59

Query  660   TTMQREAVESWRVAKLKEANDIIIGN-PSTATIKPEEARMLARvldvdwvevleeIGLWI  836
              T QRE VE W   KLKEA  + +    S +T+  EEA ML + L+ D   +LE++GLWI
Sbjct  60    ITEQREVVERWCKEKLKEAKQLAVETXASNSTVLHEEAEMLVKALESDSTWLLEDLGLWI  119

Query  837   PADVINREHDDKPEG--AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYE  1010
             P ++ N EH DKPEG   EL+ +I+ G+ LPPEC+AE+HTDYDGAAVRWGLTHHK+SA +
Sbjct  120   PPEIRNTEHHDKPEGEEXELDDQILPGRPLPPECHAEVHTDYDGAAVRWGLTHHKDSAAD  179

Query  1011  CCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQY  1190
             CC+AC++QAKRAK  +K+CNIWVYCP+E GC+SPDIY+HK  ECWLKY+E PKLNF+ +Y
Sbjct  180   CCQACLDQAKRAKPNEKRCNIWVYCPSETGCHSPDIYEHKLGECWLKYAETPKLNFKDKY  239

Query  1191  SEAYRNAHPNAPLIVPWMSGVM  1256
              E+YRN HP+APL+VPW SG++
Sbjct  240   PESYRNRHPSAPLVVPWASGIV  261



>emb|CDY45040.1| BnaA08g11790D [Brassica napus]
Length=306

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 217/311 (70%), Gaps = 26/311 (8%)
 Frame = +3

Query  333   SYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             SYKR T+++C IN+++ L+VL+ L+ +SL+ +P +D+    +YT D+IR+MEES RIR+ 
Sbjct  17    SYKRITLLVCLINILIALFVLRFLYASSLHIFPNHDN--GVKYTADEIRRMEESVRIRRS  74

Query  510   SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              EP EL++LV ++K +  + E  VE+   +K K+ DE+L  LR ++  +N T+ REAVE+
Sbjct  75    KEPVELVRLVKKMKHDVAIAESSVELSPNVKGKLIDEILELLRRVEEKSNVTLLREAVET  134

Query  690   WRVAKLKEANDIII-GNPSTATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
             WR+ KLKEA ++I   N   +T+  EEA ML R L+++W  + EEIG W+PA+V N  HD
Sbjct  135   WRIEKLKEAKELIQEQNGVNSTVILEEAGMLVRALELEWDVLSEEIGFWLPAEVNNEVHD  194

Query  867   DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRA  1046
             DKPEG E   EI+AG+ +P  CNAELHTDY GAA                      AK A
Sbjct  195   DKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAA----------------------AKHA  232

Query  1047  KSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAP  1226
             K G+ +CNIWVYCP+E GCYSPDIYQHKHQECWLKY+E+PK NF+ +YSE+YRN HP AP
Sbjct  233   KPGEMRCNIWVYCPSEFGCYSPDIYQHKHQECWLKYAEQPKENFKDRYSESYRNNHPKAP  292

Query  1227  LIVPWMSGVMS  1259
              IVPW+SGV++
Sbjct  293   TIVPWVSGVVT  303



>gb|ACN34596.1| unknown [Zea mays]
Length=265

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 195/265 (74%), Gaps = 1/265 (0%)
 Frame = +3

Query  471   IRKMEESTRIRKESEPTELIKLVSQlkkeflveekvve-vPQPLKRKITDELLATLRGLD  647
             +R +EES RIR+ +EP ELI+ V +L+K F  EEK  + +P  LK+K++ E+L  L  L 
Sbjct  1     MRWVEESIRIRRAAEPVELIEAVKKLRKAFTREEKTRKGLPLELKQKVSLEILQRLHDLG  60

Query  648   GNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIG  827
               +NTT Q+EAVE+WRV KLK+       N S   +  E++RML R L+ +W  +LE+IG
Sbjct  61    EGSNTTEQQEAVEAWRVGKLKDMRSASSKNLSNFGLSSEDSRMLKRALEFNWQRILEDIG  120

Query  828   LWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAY  1007
             LWIP  + + EHDDKPE    + EII G  LPPECN ELHTDY G AVRWGLTHHKESA 
Sbjct  121   LWIPPTIYHIEHDDKPENEPEDEEIIPGPPLPPECNTELHTDYGGTAVRWGLTHHKESAA  180

Query  1008  ECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQ  1187
             +CC+AC++QAKRA+ G  KCNIWVYCP+E GCYSPD Y+HKHQECWLK ++ P+LNF+ +
Sbjct  181   DCCQACIDQAKRARPGALKCNIWVYCPSEYGCYSPDKYEHKHQECWLKQADHPRLNFKDR  240

Query  1188  YSEAYRNAHPNAPLIVPWMSGVMSV  1262
             Y E YR++HP AP++VPWMSGV++ 
Sbjct  241   YPEPYRDSHPTAPVVVPWMSGVITA  265



>emb|CAB38796.1| putative protein [Arabidopsis thaliana]
 emb|CAB80055.1| putative protein [Arabidopsis thaliana]
Length=364

 Score =   289 bits (740),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 206/291 (71%), Gaps = 8/291 (3%)
 Frame = +3

Query  288   WAVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTP  464
             W  G    G      S+KR T+++C  N+++ L+VL+ L+ +SL+ Y  ND+    +YT 
Sbjct  8     WTGGIAGTGV----LSFKRITLLVCFFNILIALFVLRFLYASSLHIYSNNDN--VVKYTA  61

Query  465   DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGL  644
             D+IRKMEES RIR+  EPT +++LV +LK E    E   E+   +K K+ DE+L  L+  
Sbjct  62    DEIRKMEESIRIRRSKEPTLILQLVKKLKHEVSTAESSTELSPNVKHKLVDEILQRLKSF  121

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIG-NPSTATIKPEEARMLARvldvdwvevlee  821
             +  +N T  RE VE+WR  KL+EA ++I G N   +T+  EEA ML R L+++W  + EE
Sbjct  122   EDKSNVTQLREVVETWRNEKLEEAKELIQGQNGVNSTLIVEEAGMLVRALELEWDVLSEE  181

Query  822   IGLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             IG W+PA+V N EHDDKPEG E   EI+AG+ +P  CNAELHTDY GAAVRWGLTHHKES
Sbjct  182   IGFWLPAEVTNVEHDDKPEGEEEPEEILAGRPVPAVCNAELHTDYGGAAVRWGLTHHKES  241

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKY  1154
             A +CC+AC++QAKRAK G+ +CNIWVYCP+E GC+SPDIY+HKHQECWLKY
Sbjct  242   AADCCQACLDQAKRAKPGETRCNIWVYCPSEFGCFSPDIYEHKHQECWLKY  292



>ref|XP_006434801.1| hypothetical protein CICLE_v10001804mg [Citrus clementina]
 gb|ESR48041.1| hypothetical protein CICLE_v10001804mg [Citrus clementina]
 gb|KDO84231.1| hypothetical protein CISIN_1g020080mg [Citrus sinensis]
Length=222

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 175/222 (79%), Gaps = 4/222 (2%)
 Frame = +3

Query  609   ITDELLATLRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNPS-TATIKPEEARMLAR  785
             + DE+L  L+  D   N + QREAVESWR  KL+EA  + IG     +TI  EEARML R
Sbjct  1     MIDEILRRLQSSDVKGNVSAQREAVESWRREKLEEAKQLSIGRQGINSTILQEEARMLVR  60

Query  786   vldvdwvevleeIGLWIPADVINREHDDKPEGAE---LEPEIIAGKRLPPECNAELHTDY  956
             VL+ DW  + EEIGLWIP ++I++EH DKP+G E   L+ +++ G+  PPEC+AELHTDY
Sbjct  61    VLESDWAALSEEIGLWIPTEIIHKEHGDKPKGVEDEDLDEDVLPGRPPPPECHAELHTDY  120

Query  957   DGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQ  1136
             DG A+RWGLTHH++SA +CC+AC+EQAKRAK G  KCNIWVYCPAE GC+SPD Y+HK+Q
Sbjct  121   DGVAIRWGLTHHRDSAADCCQACIEQAKRAKPGQMKCNIWVYCPAETGCHSPDKYEHKYQ  180

Query  1137  ECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
             ECWLKY+EKPKLNF+ +YSE YRNAHP APL+VPW+SGV+S+
Sbjct  181   ECWLKYAEKPKLNFKDRYSEKYRNAHPAAPLVVPWVSGVVSL  222



>ref|XP_006362295.1| PREDICTED: uncharacterized protein LOC102600761 [Solanum tuberosum]
Length=324

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 183/270 (68%), Gaps = 45/270 (17%)
 Frame = +3

Query  588   PQPLKRKITDELLATLRGLDGNANTTMQRE------------------------------  677
             P  +K+KI+DE+LATL+ ++   N T+QR+                              
Sbjct  31    PHQIKQKISDEILATLKRVNARDNATLQRDIQRSRRHLWRLDGDRSSDHPKKSSYMGSIK  90

Query  678   --------------AVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevl  815
                           AVESWR  KLKEA +++    S +TI PEEA +LA++LDVDW E+ 
Sbjct  91    SEGYSRGNPKFSRDAVESWRRKKLKEARELVNRKTSNSTIAPEEAGLLAQILDVDWAELS  150

Query  816   eeIGLWIPADVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHH  992
             EEIGLWIP  +IN EH DKPEG E  + EIIAG+RLPPECN ELHTDY G AVRWGLTH 
Sbjct  151   EEIGLWIPVAIINNEHHDKPEGEEEFDNEIIAGRRLPPECNIELHTDYGGDAVRWGLTHP  210

Query  993   KESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKL  1172
             KESA+ECC AC+ QAK A   DKKCNIWVYCP E GCYSPDIYQHK+QECWLKY+EK K 
Sbjct  211   KESAFECCMACLNQAKNAGPNDKKCNIWVYCPFENGCYSPDIYQHKNQECWLKYAEKAKS  270

Query  1173  NFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
              F+ QYSE++RNAHPNAP++VPWMSGV+S+
Sbjct  271   TFKDQYSESFRNAHPNAPVVVPWMSGVVSI  300



>gb|EMS60795.1| Methionine aminopeptidase 1D, chloroplastic/mitochondrial [Triticum 
urartu]
Length=511

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 201/272 (74%), Gaps = 1/272 (0%)
 Frame = +3

Query  447   AFRYTPDQIRKMEESTRIRKESEPTELIKLVSQlkke-flveekvvevPQPLKRKITDEL  623
               +YT +QIR++EES RIR+E+EP EL++ V +L+K     E++  E+P  LK +++ EL
Sbjct  239   VVQYTEEQIRRVEESIRIRREAEPVELVQAVKKLRKVFAREEKRRKELPLELKLRVSYEL  298

Query  624   LATLRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdw  803
             +  L GL  N +   QREA+ESWRV  LKEA      N S   +  EEAR+L R L+ +W
Sbjct  299   VGRLNGLGDNGSAIQQREALESWRVETLKEAKSASTQNSSNLGLSSEEARLLKRALEFNW  358

Query  804   vevleeIGLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGL  983
               +LE+IGLWI  ++ + EHDDKPE    E EIIAG  L P+CN ELH DY GAAVRWGL
Sbjct  359   HALLEDIGLWISPEIPHTEHDDKPENEPEEEEIIAGPPLHPQCNTELHADYGGAAVRWGL  418

Query  984   THHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEK  1163
             THHKESA +CC+AC++QA+ AK G+ KCNIWVYCP+E GCYSPD Y+HKHQECWLK +++
Sbjct  419   THHKESAADCCQACLDQARNAKLGELKCNIWVYCPSEFGCYSPDKYEHKHQECWLKQADQ  478

Query  1164  PKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
             PKLNF+ +YSE+YR++HP AP++VPWMSGV S
Sbjct  479   PKLNFKDKYSESYRDSHPRAPVVVPWMSGVTS  510



>gb|ADE75719.1| unknown [Picea sitchensis]
Length=331

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 212/318 (67%), Gaps = 14/318 (4%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTY-------PYNDSQSAFRYTPDQIRKMEE  488
             CSYK  T++IC+ N+VV LYVL SL   LY         P ND   A  +  D++++M E
Sbjct  15    CSYKTATMVICAGNLVVALYVLHSLLTPLYIITSSSLAGPAND---AHLFQEDEVKRMRE  71

Query  489   STRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTM  668
             + ++R+ S+P +LI+ V ++++E   E+   +  Q    K+  ELL  L    G+ ++ +
Sbjct  72    ANKVRQASQPVDLIRRVKEIEEESYREDVREKRSQSTTEKLAQELLQRLNEFKGDGDS-I  130

Query  669   QREAVESWRVAKLKEANDIIIGNPST-ATIKPEEARMLARvldvdwvevleeIGLWIPAD  845
             +++A+E WR  KL+E         S  ++++ E+  M+A+VL+ DW  VLEE G  +  +
Sbjct  131   EQQALEEWRKKKLEEVKKREAMKASVNSSMQVEDTEMVAKVLETDWGPVLEEAGFSLSPE  190

Query  846   VINREHDDK--PEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCR  1019
               + +   K   +G E+E  II G+ LP EC+AE HTDYDGAAV+WGL HHKESA +CC+
Sbjct  191   ASSEDSSGKMLEDGPEIEDGIIPGRPLPSECHAEPHTDYDGAAVKWGLMHHKESAADCCQ  250

Query  1020  ACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEA  1199
             AC++QAK AK G+KKCNIWVYCP E GCYSPDIYQHKHQECWLK ++ PKLNF+ +Y+EA
Sbjct  251   ACLDQAKNAKEGEKKCNIWVYCPFEPGCYSPDIYQHKHQECWLKQADHPKLNFKGKYTEA  310

Query  1200  YRNAHPNAPLIVPWMSGV  1253
             YR  HP AP++VPW+SGV
Sbjct  311   YRREHPTAPVVVPWVSGV  328



>emb|CAN63228.1| hypothetical protein VITISV_002667 [Vitis vinifera]
Length=340

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 21/219 (10%)
 Frame = +3

Query  666   MQREAVESWRVAKLKEANDIIIGNPSTATIKPEEAR---------------MLARvldvd  800
             M++EAVESWR  K++E     +     +TI PEEA                ML R L+ +
Sbjct  1     MEQEAVESWRKEKIEE-----VKKSMNSTIPPEEAGIFVFSSXGCVFLVTWMLVRALESN  55

Query  801   wvevleeIGLWIPADVINREHDDKPEG-AELEPEIIAGKRLPPECNAELHTDYDGAAVRW  977
             W  + EEIGLW+P +VI +EHDDKPEG  + +  II G+ +PPEC+AE+HTDYDGAAVRW
Sbjct  56    WAVLFEEIGLWMPTEVIYKEHDDKPEGEXKFDDGIIPGRPVPPECHAEIHTDYDGAAVRW  115

Query  978   GLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYS  1157
             GLTHHK+SA +CC+AC++QA RAK G+KKCNIWVYCP+E GC+SPDIY+HK+ ECWLKY+
Sbjct  116   GLTHHKDSAADCCQACLDQANRAKPGEKKCNIWVYCPSETGCFSPDIYEHKNGECWLKYA  175

Query  1158  EKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV*SGN  1274
             EKP+LNF+ +YSE+YRNAHP+APL VPW+SGV+ +  G+
Sbjct  176   EKPRLNFKDKYSESYRNAHPSAPLFVPWVSGVVQLEMGS  214



>ref|XP_010229900.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104582213 
[Brachypodium distachyon]
Length=316

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 191/296 (65%), Gaps = 13/296 (4%)
 Frame = +3

Query  294   VGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQI  473
             VGG +     +W +Y+R T+ +C  N+V  L VL+ L+ S  +      +   + + +QI
Sbjct  11    VGGRAAA---RWFTYRRATVAVCLANLVAVLLVLRLLYTSPVSVVSARKRVNGKCSDEQI  67

Query  474   RKMEESTRIRKESEPTELIKLVSQ----------lkkeflveekvvevPQPLKRKITDEL  623
             R++ ES RIR+ +EP +L++ +             K   L E++  ++P  LK+K++ ++
Sbjct  68    RRVVESIRIRRAAEPVDLVEAICTILHNSYVRKLQKVSALDEKRREKLPLELKQKVSYDI  127

Query  624   LATLRGLDGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdw  803
             L  LR L  N NTT Q+EA+ SWR+ KLK+       N S   +  +E+RML +  + +W
Sbjct  128   LQKLRDLGENTNTTEQQEAIYSWRIEKLKDIRSPSAQNLSNLVLSSKESRMLKQASEHNW  187

Query  804   vevleeIGLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGL  983
               + E+IGLW P +V + EHDDKP+    E EIIAG  LPPECNAELH+DY GAAVRWGL
Sbjct  188   DMLREDIGLWEPVNVWHTEHDDKPQNEPEEEEIIAGLPLPPECNAELHSDYGGAAVRWGL  247

Query  984   THHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLK  1151
             THHKESA +CC+AC++QAKRAK G  +CNIWVYC +E GCYSPD Y+HKHQEC LK
Sbjct  248   THHKESAADCCQACLDQAKRAKPGALRCNIWVYCSSEYGCYSPDKYEHKHQECXLK  303



>ref|XP_002984798.1| hypothetical protein SELMODRAFT_423965 [Selaginella moellendorffii]
 gb|EFJ14048.1| hypothetical protein SELMODRAFT_423965 [Selaginella moellendorffii]
Length=322

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 182/317 (57%), Gaps = 12/317 (4%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYN---DSQSAFRYTPDQIRKMEESTRI  500
             CSYKR T+I+C  NV    YVL  L +S            +    ++  +  +++E+  I
Sbjct  8     CSYKRATVIVCIFNVAAAFYVLDVLLSSSSRSSSGIPWRRRHVLGFSAQEALRIQEAHEI  67

Query  501   RKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREA  680
             R++ EP ELI  V +++ E   E      P  ++RK   +++  LR +    N T   +A
Sbjct  68    RRKVEPHELIDRVKEIQLESDQESSG---PGAIRRKAAMDIVQRLRDIQSTNNQTAS-QA  123

Query  681   VESWRVAKLKEAN----DIIIGNPSTATIKPEEARMLARvldvdwvevleeIGLWIP-AD  845
             +  WR  +L+ A         G  +T+ +  E A+     L              +P +D
Sbjct  124   LSEWRRKRLEAARAREAKQSAGTNATSDMNQELAQEEVSKLVELGWLHTHTEPPSLPVSD  183

Query  846   VINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRAC  1025
                 E      GAE+E  II G+ +PPEC+AE HTDYDG AVRWGLTHH ESA +CC+AC
Sbjct  184   SDTGEILPTVTGAEVEDGIIPGRIVPPECHAEAHTDYDGVAVRWGLTHHTESAADCCQAC  243

Query  1026  VEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYR  1205
               QAK AK G++KCNIWV+C AE GCYSPDIY+HKHQECWLK +++PKLNF+  Y E YR
Sbjct  244   FNQAKAAKPGERKCNIWVFCAAENGCYSPDIYEHKHQECWLKQADEPKLNFKGHYHEEYR  303

Query  1206  NAHPNAPLIVPWMSGVM  1256
               H NAP++VPW+SGV+
Sbjct  304   QTHQNAPVVVPWVSGVI  320



>gb|ACF88235.1| unknown [Zea mays]
 gb|ACN36665.1| unknown [Zea mays]
Length=163

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  822   IGLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKES  1001
             IGLWIP +V +  HDDKPE    E EI+AG  L P+CNAELHTDYDGAAVRWGLTHHKES
Sbjct  17    IGLWIPDEVTHTVHDDKPENEPEEEEIVAGPPLSPQCNAELHTDYDGAAVRWGLTHHKES  76

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QAK AK G+ KCNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+
Sbjct  77    AADCCQACLDQAKNAKPGELKCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFK  136

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
              +YSE YR+AHP AP++VPWMSGV+  
Sbjct  137   DKYSEPYRDAHPTAPVVVPWMSGVIGA  163



>ref|XP_002985862.1| hypothetical protein SELMODRAFT_234911 [Selaginella moellendorffii]
 gb|EFJ13039.1| hypothetical protein SELMODRAFT_234911 [Selaginella moellendorffii]
Length=329

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/324 (38%), Positives = 175/324 (54%), Gaps = 19/324 (6%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYN---DSQSAFRYTPDQIRKMEESTRI  500
             CSYK+ T+I+C  NV    YVL  L +S            +    ++  +  +++E+  I
Sbjct  8     CSYKKATVIVCIFNVAAAFYVLDVLLSSSSRSSSGIPWRRRHVLGFSAQEALRIQEAHEI  67

Query  501   RKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREA  680
             R++ EP ELI  V +++ E   E      P  ++RK   +++  LR +    N T   +A
Sbjct  68    RRKVEPHELIDRVKEIQLESDQESSG---PGAIRRKAAMDIVQRLRDIQSTNNQTAS-QA  123

Query  681   VESWRVAKLKEAND---------IIIGNPSTATIKPEEARMLARvldvdwvevleeIGLW  833
             +  WR  +L+ A           I        +   E   +              + G  
Sbjct  124   LSEWRRKRLEAARRHEFLTSCSLIFFSILEEVSKLVELGWLHTHTEPPSLPVSDSDTGEI  183

Query  834   IPADV---INREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESA  1004
             +P      + +  + K +       II G+ +PPEC+AE HTDYDG AVRWGLTHH ESA
Sbjct  184   LPTVTGAEVGKSKNRKAKRCRSHDGIIPGRIVPPECHAEAHTDYDGVAVRWGLTHHTESA  243

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              +CC+AC  QAK AK G+ KCN+WV+C AE GCYSPDIY+HKHQECWLK +++PKLNF+ 
Sbjct  244   ADCCQACFNQAKAAKPGEMKCNVWVFCAAENGCYSPDIYEHKHQECWLKQADEPKLNFKG  303

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVM  1256
              Y E YR  H NAP++VPW+SGV+
Sbjct  304   HYHEEYRQTHQNAPVVVPWVSGVI  327



>ref|XP_001774116.1| predicted protein [Physcomitrella patens]
 gb|EDQ61030.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 186/329 (57%), Gaps = 45/329 (14%)
 Frame = +3

Query  330   CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFR-----YTP------DQIR  476
             CS+K+ T++IC+ N+++ + + Q L  S Y    N + S  R     + P      +Q+ 
Sbjct  13    CSFKQATVVICACNLMMVVCISQCLILSYYVPATNLTLSYSRQIDGTFLPTKLDAQEQLN  72

Query  477   KMEESTRIRKESEPTELIKLVS--QlkkeflveekvvevPQPLKRKITDELLATLRGLDG  650
              + ++ + R  ++P +LI+ V   Q +    V     +  Q  + +I+  +         
Sbjct  73    IVRDANQARLAAKPVKLIERVKEIQQEALLQVVAASDKATQNQQTEISKRI---------  123

Query  651   NANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeIGL  830
                T ++ + ++ WR  KLK A             +  EA +L   +     + +     
Sbjct  124   ---TGLRFQGLDKWRREKLKHA-------------QSREAALLKTEMTSQEKDKVPVEED  167

Query  831   WIPADVIN----REHDDK-PEGAELEPE--IIAGKRLPPECNAELHTDYDGAAVRWGLTH  989
              +P +V+N     E   K  +GAE+  E  II G+ +P  C+AE HTDYDG AVRWGLTH
Sbjct  168   VMPDEVVNVLDQSEGSGKVQDGAEIGAEDGIIPGRPVPEICHAEAHTDYDGVAVRWGLTH  227

Query  990   HKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPK  1169
             H ESA +CC AC++QA+ AKSG+K+CN+WV+CPAE GC+SPD+ +HKHQECWLK ++KPK
Sbjct  228   HVESAADCCEACLKQARTAKSGEKRCNVWVFCPAEGGCFSPDVNEHKHQECWLKQADKPK  287

Query  1170  LNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             LNF+  Y E YR  HP AP+IVPW+SG++
Sbjct  288   LNFKGHYDEVYRREHPTAPVIVPWVSGII  316



>ref|XP_001769776.1| predicted protein [Physcomitrella patens]
 gb|EDQ65338.1| predicted protein [Physcomitrella patens]
Length=597

 Score =   214 bits (545),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 174/319 (55%), Gaps = 35/319 (11%)
 Frame = +3

Query  318   RGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQ-----------SAFRYTP  464
             R +W SYKR T I+C+ N++V L +L +    ++    + SQ                + 
Sbjct  249   RLRW-SYKRATFILCTGNLLVALVMLHAALAPVFFVSTSTSQLPRGNGVSAHGVGVTLSK  307

Query  465   DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGL  644
             +++ ++E+S R+R+E  PT LI+ V +++ E   E          ++K+  EL   LR L
Sbjct  308   EELERIEDSNRLRQELLPTPLIERVREIQLEIEEEVNRTAALNIARQKVALELAERLREL  367

Query  645   DGNANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLARvldvdwvevleeI  824
               N+N+   + A+E W+  KLK+ N  +I +   A     E                  +
Sbjct  368   K-NSNSQATQAALEEWKRNKLKKKNISVIASAGDADKVAAE------------------L  408

Query  825   GLWIPADVINREHD----DKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHH  992
             G+ +P D    + D    +     E E + I G+ +PPEC AE HTDY G AVRWGLTHH
Sbjct  409   GVQLPGDGATADLDLVNGESLNFIEHEDDSIPGRPMPPECYAEAHTDYGGVAVRWGLTHH  468

Query  993   KESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKL  1172
               SA +CC+AC++QAK A +G KKCNIWVYCP E GCYSPD+Y H++ ECWLK ++ P L
Sbjct  469   VNSAADCCQACLDQAKNATAGQKKCNIWVYCPKEDGCYSPDVYTHENHECWLKQADDPAL  528

Query  1173  NFQHQYSEAYRNAHPNAPL  1229
             NF+  Y E YR  HP APL
Sbjct  529   NFKGHYDEEYRRRHPKAPL  547



>gb|ADZ13509.1| putative protein B, partial [Populus tremula x Populus alba]
Length=216

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 149/209 (71%), Gaps = 2/209 (1%)
 Frame = +3

Query  330  CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
            CSYKR+T+I+CSIN+VV LYVL+SL+ SLY Y  +D     +YTPDQ+RKMEES RIR+ 
Sbjct  8    CSYKRSTLIVCSINIVVALYVLRSLYASLYLYSNSDFNKVVKYTPDQVRKMEESIRIRRA  67

Query  510  SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
             EP EL+K+V +LK+EF   E V  +P+ +  +ITDE+L  LR L+ NAN + QR+A+ES
Sbjct  68   KEPIELVKIVRELKEEFSRGEMVAGLPKEVMNRITDEILQRLRSLNSNANISEQRDAIES  127

Query  690  WRVAKLKEANDIIIGNPS-TATIKPEEARMLARvldvdwvevleeIGLWIPADVINREHD  866
            WR  KL+E   ++ G     ++I  +EA ML R L+ DW  + E IGLW+PA++I++EH+
Sbjct  128  WRKEKLQEVKQLVHGTGGLNSSILKQEAGMLERALESDWAVLSENIGLWVPAEIIHQEHN  187

Query  867  DK-PEGAELEPEIIAGKRLPPECNAELHT  950
            DK  +  E E E++ G+ L PEC+AELHT
Sbjct  188  DKPEDEEEPEEEVLPGRPLSPECHAELHT  216



>emb|CAN80094.1| hypothetical protein VITISV_010722 [Vitis vinifera]
Length=261

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = +3

Query  774   MLARvldvdwvevleeIGLWIPADVINREHDDKPEGAE-LEPEIIAGKRLPPECNAELHT  950
             ML R L+ +W  + EEIGLW+P +VI +EHDDKPEG E  +  II G+ +PPEC+AE+HT
Sbjct  1     MLVRALESNWAVLFEEIGLWMPTEVIYKEHDDKPEGEEEFDDGIIPGRPVPPECHAEIHT  60

Query  951   DYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHK  1130
             DYDGAAVRWGLTHHK+SA +CC+AC +QA  AK G+KKCNIWVYCP+E GC+SPDIY+HK
Sbjct  61    DYDGAAVRWGLTHHKDSAADCCQACFDQANHAKPGEKKCNIWVYCPSETGCFSPDIYEHK  120

Query  1131  HQECWLKY  1154
             + ECWLKY
Sbjct  121   NGECWLKY  128



>gb|AFW76804.1| hypothetical protein ZEAMMB73_272307 [Zea mays]
Length=382

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 119/197 (60%), Gaps = 31/197 (16%)
 Frame = +3

Query  645   DGNANTTMQREAVESWR---VAKLKEANDIIIGN---PSTATIKPEEARMLARvldvdwv  806
             DGN    MQ    E++    +  L  ++  ++GN       +   E+  ML R L+ +W 
Sbjct  84    DGNDLLEMQAYDPETYNDKVIGALCVSSSEVVGNWCESRVGSNTTEQQGMLKRALEFNWQ  143

Query  807   evleeIGLWIPADVINREHDDKPEGAELEPE----------------------IIAGKRL  920
              +LE+IGLWIP  + + EHDDKPE    EPE                      II G  L
Sbjct  144   MLLEDIGLWIPPTIYHIEHDDKPEN---EPEGYFVYAAYVASIVDYILWVINEIIPGPPL  200

Query  921   PPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKG  1100
             PPECN ELHTDY G AVRWGLTHHKESA +CC+AC++QAK A+ G  KCNIWVYCP+E G
Sbjct  201   PPECNTELHTDYGGTAVRWGLTHHKESAADCCQACIDQAKMARPGALKCNIWVYCPSEYG  260

Query  1101  CYSPDIYQHKHQECWLK  1151
             CYSPD Y+HKHQECWLK
Sbjct  261   CYSPDKYEHKHQECWLK  277



>gb|AFW76803.1| hypothetical protein ZEAMMB73_272307 [Zea mays]
Length=389

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 119/197 (60%), Gaps = 31/197 (16%)
 Frame = +3

Query  645   DGNANTTMQREAVESWR---VAKLKEANDIIIGN---PSTATIKPEEARMLARvldvdwv  806
             DGN    MQ    E++    +  L  ++  ++GN       +   E+  ML R L+ +W 
Sbjct  84    DGNDLLEMQAYDPETYNDKVIGALCVSSSEVVGNWCESRVGSNTTEQQGMLKRALEFNWQ  143

Query  807   evleeIGLWIPADVINREHDDKPEGAELEPE----------------------IIAGKRL  920
              +LE+IGLWIP  + + EHDDKPE    EPE                      II G  L
Sbjct  144   MLLEDIGLWIPPTIYHIEHDDKPEN---EPEGYFVYAAYVASIVDYILWVINEIIPGPPL  200

Query  921   PPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKG  1100
             PPECN ELHTDY G AVRWGLTHHKESA +CC+AC++QAK A+ G  KCNIWVYCP+E G
Sbjct  201   PPECNTELHTDYGGTAVRWGLTHHKESAADCCQACIDQAKMARPGALKCNIWVYCPSEYG  260

Query  1101  CYSPDIYQHKHQECWLK  1151
             CYSPD Y+HKHQECWLK
Sbjct  261   CYSPDKYEHKHQECWLK  277



>ref|NP_001136953.1| uncharacterized protein LOC100217112 [Zea mays]
 gb|ACF82956.1| unknown [Zea mays]
 gb|AFW85337.1| hypothetical protein ZEAMMB73_547025 [Zea mays]
Length=125

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  897   EIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIW  1076
             EII G  LPPECN ELHTDY G AVRWGLTHHKESA +CC+AC++QAKRA+ G  KCNIW
Sbjct  30    EIIPGPPLPPECNTELHTDYGGTAVRWGLTHHKESAADCCQACIDQAKRARPGALKCNIW  89

Query  1077  VYCPAEKGCYSPDIYQHKHQECWLK  1151
             VYCP+E GCYSPD Y+HKHQECWLK
Sbjct  90    VYCPSEYGCYSPDKYEHKHQECWLK  114



>gb|ABR26066.1| unknown [Oryza sativa Indica Group]
Length=87

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  1002  AYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQ  1181
             A +CC+AC++QAK A+ G+ +CNIWVYCP+E GC+SPD Y+HKHQECWLK ++ PKLNF+
Sbjct  1     AADCCQACLDQAKNARPGELRCNIWVYCPSEFGCFSPDKYEHKHQECWLKQADHPKLNFK  60

Query  1182  HQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
              +YSE+YR++HP AP++VPWMSGV+S 
Sbjct  61    DKYSESYRDSHPTAPVVVPWMSGVISA  87



>gb|AEI28159.1| hypothetical protein [Lobularia maritima]
Length=77

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  984   THHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEK  1163
             THHKESA +CC+AC++QAKRAK G+ KCNIWVYCP+E GCYSPDIY+HKHQECWLKY+EK
Sbjct  1     THHKESAADCCQACLDQAKRAKPGEIKCNIWVYCPSEFGCYSPDIYEHKHQECWLKYAEK  60

Query  1164  PKLNFQHQYSEAYRNAH  1214
             PK NF+ +YSE YRN H
Sbjct  61    PKQNFKDRYSETYRNNH  77



>ref|XP_004959369.1| PREDICTED: uncharacterized protein LOC101780882 [Setaria italica]
Length=193

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  933   NAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSP  1112
             NAEL TDY G AVRWGLTHHKESA +CC+AC++QAKR K G  KCNIWVYCP+E GCYSP
Sbjct  112   NAELRTDYGGTAVRWGLTHHKESAADCCQACIDQAKRTKPGALKCNIWVYCPSEYGCYSP  171

Query  1113  DIYQHKHQECWLKY  1154
             D Y+HKHQECWLK+
Sbjct  172   DKYEHKHQECWLKH  185



>gb|ADR78659.1| hypothetical protein [Lepidium sativum]
Length=77

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  987   HHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKP  1166
             HHKESA +CC+AC++QAK  K GD +CNIWVYCP+E GCYSPDIY+H+HQECWLKY+EKP
Sbjct  1     HHKESAADCCQACLDQAKNVKPGDTRCNIWVYCPSEFGCYSPDIYEHRHQECWLKYAEKP  60

Query  1167  KLNFQHQYSEAYRNAHP  1217
             + NF+ +YSE YRN HP
Sbjct  61    RQNFKDRYSETYRNNHP  77



>gb|ADR78661.1| hypothetical protein [Iberis amara]
Length=78

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  996   ESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLN  1175
             ESA +CC+AC++QAKRAK G+ +CNIWVYCP+  GCYSPDIY+HKHQECWLKY+EKP+ N
Sbjct  1     ESAADCCQACLDQAKRAKPGETRCNIWVYCPSVFGCYSPDIYEHKHQECWLKYAEKPQQN  60

Query  1176  FQHQYSEAYRNAHPNAP  1226
             F+ +YSE+YRN HP AP
Sbjct  61    FKDRYSESYRNNHPKAP  77



>gb|AFK49337.1| unknown [Medicago truncatula]
Length=176

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 105/169 (62%), Gaps = 9/169 (5%)
 Frame = +3

Query  288  WAVGGNSNGTRGKW-CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTP  464
            W +   S G  GKW CSYK+ TI++C  N+ + LY L+SL+ SLY Y  + S++   Y P
Sbjct  7    WGIQLQSRGG-GKWVCSYKKITILVCLFNIAIALYCLRSLYASLYIYSGSVSRNIVVYKP  65

Query  465  DQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGL  644
            DQIRKMEES RIR   +P +L+KLV +L+ E  ++   VE+PQ LK+KI DE+L  L  L
Sbjct  66   DQIRKMEESNRIRTSYKPVKLMKLVKELEGEVSIQNTEVELPQHLKQKIIDEVLQRLVSL  125

Query  645  DGNANT-------TMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEA  770
            +  +N         M+R+AVE+WR  KL+E   +  G  S +TI  EEA
Sbjct  126  NSRSNNGSHSQSIAMERDAVENWRKEKLEEVKLVSAGGISNSTISHEEA  174



>ref|XP_001762383.1| predicted protein [Physcomitrella patens]
 gb|EDQ72850.1| predicted protein [Physcomitrella patens]
Length=566

 Score =   135 bits (339),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +3

Query  921   PPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKG  1100
             P +C  EL TD+ G AVRWGLTHH  SA +CC+AC +QA  AKS  +KCN+WV+CP +KG
Sbjct  452   PEKCQPELKTDFGGVAVRWGLTHHVNSAADCCKACSQQAAYAKSSQRKCNVWVFCPEKKG  511

Query  1101  CYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             C SPD Y+HK  ECWLK+++KP+    + YS   RN     P+ V WMSGV+
Sbjct  512   CSSPDGYEHKFGECWLKHADKPR-GIVNDYSLIMRN-KTAPPMPVLWMSGVI  561



>gb|ADR78660.1| hypothetical protein [Matthiola longipetala subsp. bicornis]
Length=72

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  993   KESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKL  1172
             KESA +CC+AC++QAKRAK G+ KCNIWVYCP+E GCYSPDIY+HKHQECWLKY+E+PK 
Sbjct  1     KESAADCCQACLDQAKRAKPGETKCNIWVYCPSEFGCYSPDIYEHKHQECWLKYAEQPKQ  60

Query  1173  NFQHQYSEAYRN  1208
             NF+ +YSE+YRN
Sbjct  61    NFKDRYSESYRN  72



>gb|ACU20810.1| unknown [Glycine max]
Length=182

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 7/159 (4%)
 Frame = +3

Query  330  CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
            CSYK+ T++IC  N+VV LY L+SL+ SL+ Y  + +++   Y PDQIRKMEES RIRK 
Sbjct  12   CSYKKITLLICLFNIVVALYSLRSLYASLHIYSGSVARNIVVYRPDQIRKMEESNRIRKA  71

Query  510  SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNAN-------TTM  668
             +P EL+KLV + + EF  E  VVE+P+ LK+KI DE+L  L  L+G++           
Sbjct  72   YKPVELMKLVKEFEGEFSGETVVVELPRHLKQKIIDEVLQRLGSLNGSSKNISHSQVMAK  131

Query  669  QREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLAR  785
            +REA+E+WR  KL+E    ++   S +TI  EEA ML R
Sbjct  132  EREAIENWRKEKLEEVKLAVVRGTSNSTIPHEEAGMLVR  170



>emb|CDY68861.1| BnaCnng60790D [Brassica napus]
Length=166

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 103/150 (69%), Gaps = 4/150 (3%)
 Frame = +3

Query  327  WCSYKRTTIIICSINVVVTLYVLQSLF-NSLYTYPYNDSQSAFRYTPDQIRKMEESTRIR  503
              SYKR T+++C IN+++ L+VL+ L+ +SL+ +P +D+    +YT D+IR+MEES RIR
Sbjct  15   LLSYKRITLLVCLINILIALFVLRFLYASSLHIFPNHDN--GVKYTADEIRRMEESVRIR  72

Query  504  KESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAV  683
            +  EP EL++LV ++K +  + E  VE+   +K K+ DE+L  LR ++  +N T+ REAV
Sbjct  73   RSKEPVELVRLVKKMKHDVAIAESSVELSPYVKGKLIDEILELLRRVEEKSNVTLLREAV  132

Query  684  ESWRVAKLKEANDIII-GNPSTATIKPEEA  770
            E+WR+ KLKEA ++I   N   +T+  EEA
Sbjct  133  ETWRIDKLKEAKELIQEQNGVNSTVILEEA  162



>ref|XP_001783035.1| predicted protein [Physcomitrella patens]
 gb|EDQ52159.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = +3

Query  921   PPE-CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEK  1097
             PPE C  E HTD+ G AVRWGLT+H  SA ECC+AC+  A  AK G  KCN+WV+CP + 
Sbjct  295   PPEKCYPEPHTDFGGIAVRWGLTYHVNSAGECCKACLLHAAYAKPGQLKCNVWVFCPEKN  354

Query  1098  GCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGV  1253
             GC SPD ++HK  ECWLK +++P+      YS   R+   N+ + V W+SGV
Sbjct  355   GCPSPDGHEHKFGECWLKRADQPR-AVVDDYSLFMRDKSGNS-MPVLWISGV  404



>ref|XP_002505751.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67009.1| predicted protein [Micromonas sp. RCC299]
Length=212

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 67/115 (58%), Gaps = 7/115 (6%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAK---SGDKKCNIWVYCPAEKG  1100
             C+ E   D DG AV WGL H   SA ECC  C  QA+ A+    G + CN WV+CP  + 
Sbjct  97    CHGEASLDIDGPAVVWGLDHLLSSAQECCDRCKAQARGAREKGEGARACNSWVFCPLPE-  155

Query  1101  CYSPDIYQHKHQECWLKYSE---KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             C+SPDI+ H   ECWLK  +    PK+NF+  Y  A+R  H  +P  VPW +GV+
Sbjct  156   CWSPDIWNHTLGECWLKTQDDARNPKINFRGAYPPAFRREHSTSPAHVPWQAGVL  210



>ref|XP_007514565.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14805.1| predicted protein [Bathycoccus prasinos]
Length=217

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C    HTDYDG A  WG  + +  A  CC++C +   +A +    CN+WVYCP E+GC++
Sbjct  75    CFTSEHTDYDGYANVWGNQNKQPDAGRCCQSCKDYVPKAPNY-YPCNVWVYCPKEQGCFA  133

Query  1110  PDIYQHKHQECWLKYSEKP---KLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             P   + K+Q+CWLKY   P    +N + +YS  YR +HP AP +V W +GV+
Sbjct  134   PAAGEFKYQDCWLKYQHDPIHVHVNMKGEYSAEYRISHPTAPEMVDWTAGVV  185



>ref|XP_007216613.1| hypothetical protein PRUPE_ppa027086mg [Prunus persica]
 gb|EMJ17812.1| hypothetical protein PRUPE_ppa027086mg [Prunus persica]
Length=202

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = +3

Query  345  TTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKESEPTE  524
            TT+I+ SIN+VV LYVL+S + SLY Y   DS+    YTP+QI KMEES  IRK +EP E
Sbjct  2    TTLIVSSINIVVALYVLRSQYASLYIYCDRDSRPTLEYTPNQIGKMEESVWIRKAAEPFE  61

Query  525  LIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVESWRVAK  704
            LI+LV +  K+ L  E VVE+ QPLK KIT+E++  L+ L   AN T QR     W   K
Sbjct  62   LIRLV-KALKKELCREVVVELSQPLKLKITNEIVERLKILRPKANVTDQR---GQWCKEK  117

Query  705  LKEANDIII-GNPSTATIKPEEA  770
            LKEA  + I    S + +  EEA
Sbjct  118  LKEAKQLAIETEASNSRVSHEEA  140


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  1011  CCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKY  1154
             C   C++Q KRAK  +K+CNIWVYCP E GC+SPDIY H+  +CWLKY
Sbjct  146   CELVCLDQGKRAKPNEKRCNIWVYCPFESGCHSPDIYGHRLGQCWLKY  193



>gb|KFM24984.1| hypothetical protein F751_1863 [Auxenochlorella protothecoides]
Length=234

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +3

Query  882   AELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSG--  1055
             AEL P  +         + E   DYDG AVRWG+ H + S   C  AC+      +SG  
Sbjct  89    AELGPAAVTASM---RVHIERRADYDGMAVRWGIGHTQPSVEACAHACLTHEPVPQSGHL  145

Query  1056  -DKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE---KPKLNFQHQYSEAYRNAHPNA  1223
              +  CN +V+C AE GC+ PDI++H   +CWLK++E    P++N + + S+  R+ HP+A
Sbjct  146   DELPCNAFVWCAAEGGCWEPDIHKHSFGDCWLKFTEGPAAPEVNMRGELSQRQRSQHPDA  205

Query  1224  PLIVPWMSGVM  1256
             P  V W +G +
Sbjct  206   PTEVQWHAGAV  216



>ref|XP_002499513.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60771.1| predicted protein [Micromonas sp. RCC299]
Length=217

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 4/118 (3%)
 Frame = +3

Query  912   KRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPA  1091
             K++  EC+    TDYDG AV+WG  + +E+   CC +C +  K        CNIWV+CP 
Sbjct  81    KKMSSECHKRDATDYDGYAVKWGSANVQETWEACCESC-KNYKPEAPHFYPCNIWVFCPE  139

Query  1092  EKGCYSPDIYQHKHQECWLKYSE---KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             + GC++P      H +CWLK+ E    P +N +  YS  YR  HP+AP  V W++G +
Sbjct  140   KDGCFAPAAGDFIHGQCWLKFQEDPTNPHVNMRGDYSAEYRKTHPSAPKSVQWVAGSI  197



>ref|XP_002984742.1| hypothetical protein SELMODRAFT_423876 [Selaginella moellendorffii]
 gb|EFJ13992.1| hypothetical protein SELMODRAFT_423876 [Selaginella moellendorffii]
Length=172

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  936   AELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPD  1115
             AE HT+YDG AV WGLTH+ ESA +CC+AC  QAK  K G+    IWV+C AE GC+SPD
Sbjct  87    AEAHTNYDGVAVWWGLTHNTESAADCCQACFNQAKATKLGEVNGKIWVFCAAENGCHSPD  146

Query  1116  IYQ  1124
             IY+
Sbjct  147   IYE  149



>gb|AFW69564.1| hypothetical protein ZEAMMB73_060422 [Zea mays]
Length=174

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 97/165 (59%), Gaps = 3/165 (2%)
 Frame = +3

Query  294  VGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQI  473
            +GG++     +W + +RT + +C  N+V  L V ++L+    ++ +   +   +Y+ +Q+
Sbjct  7    LGGHATSA-ARWFTCRRTAVALCMANLVAALLVARTLYAP-DSFAFAPKRGELKYSREQM  64

Query  474  RKMEESTRIRKESEPTELIKLVSQlkkeflveekvve-vPQPLKRKITDELLATLRGLDG  650
            R +EES RIR  +EP ELI+ V +L+K F  EEK  + +P  L +K++ E+L  L  L  
Sbjct  65   RWVEESIRIRGAAEPVELIEAVKKLRKAFTREEKTRKGLPLELNQKVSLEILQRLHDLGE  124

Query  651  NANTTMQREAVESWRVAKLKEANDIIIGNPSTATIKPEEARMLAR  785
             +NTT Q EA+E+WRV KLK+       N S   +  E++RML R
Sbjct  125  GSNTTEQPEAIEAWRVGKLKDMRSTSFRNLSNFGLSSEDSRMLKR  169



>ref|XP_001421288.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99581.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=225

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 64/124 (52%), Gaps = 18/124 (15%)
 Frame = +3

Query  939   ELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKK---CNIWVYCP---AEKG  1100
             E H  YDG AVRWG+ H  E+A EC   C E   +      +   CN++V+CP    E G
Sbjct  85    EEHASYDGVAVRWGIHHTTETAEECGERCKEHVVKPDGIGAEVLPCNVFVWCPKDVGEGG  144

Query  1101  CYSPDIYQHKHQECWLKYSEKPK------------LNFQHQYSEAYRNAHPNAPLIVPWM  1244
             C+ PD +QH   +CWLK+SE P+              F ++  + +   H NAP +V W 
Sbjct  145   CFEPDAHQHFAGDCWLKFSETPENVEVNQRGANDAPGFVNKDGKTFAERHANAPKLVHWS  204

Query  1245  SGVM  1256
             SGV+
Sbjct  205   SGVL  208



>ref|XP_002985804.1| hypothetical protein SELMODRAFT_424824 [Selaginella moellendorffii]
 gb|EFJ12981.1| hypothetical protein SELMODRAFT_424824 [Selaginella moellendorffii]
Length=172

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  936   AELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPD  1115
             AE  T+YDG AV WGLTH+ ESA +CC+AC  QAK  K G+    IWV+C AE GC+SPD
Sbjct  87    AEARTNYDGVAVWWGLTHNTESAADCCQACFNQAKATKLGEVNGKIWVFCAAENGCHSPD  146

Query  1116  IYQ  1124
             IY+
Sbjct  147   IYE  149



>ref|XP_002952736.1| hypothetical protein VOLCADRAFT_105646 [Volvox carteri f. nagariensis]
 gb|EFJ46289.1| hypothetical protein VOLCADRAFT_105646 [Volvox carteri f. nagariensis]
Length=225

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 18/115 (16%)
 Frame = +3

Query  918   LPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEK  1097
             +P +C  + HTDY G AV WGL H + SA ECC+AC +   +A  G+  CNIWV+C    
Sbjct  112   IPEDCYPQQHTDYAGDAVVWGLGHKRASAAECCQACRDHQLKA-GGNMPCNIWVWCGDPS  170

Query  1098  GCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
             G             CW       ++N Q  +S  +R  H  AP  VPW++GV+ V
Sbjct  171   GI------------CWTM-----EINHQGAFSADFRAVHRTAPEFVPWVAGVVPV  208



>ref|XP_005847820.1| hypothetical protein CHLNCDRAFT_134029 [Chlorella variabilis]
 gb|EFN55718.1| hypothetical protein CHLNCDRAFT_134029 [Chlorella variabilis]
Length=259

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 8/113 (7%)
 Frame = +3

Query  939   ELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKS----GDKKCNIWVYCPAEKGCY  1106
             E H DYDG AV WG+ + K S  EC  AC +   +  S    G+  CN + +C A   C+
Sbjct  130   ERHADYDGLAVGWGIGNTKGSIEECAEACRQHKPKGPSDGPFGNLPCNAFAWC-AFDNCF  188

Query  1107  SPDIYQHKHQECWLKYSE---KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
              PD ++H   +CWLK++E    P++N + + S A +  HP AP  V W +GV+
Sbjct  189   EPDAHKHGKGDCWLKFTEGPASPEVNMRGRLSLAAQKRHPQAPKEVQWHAGVL  241



>emb|CDY46120.1| BnaA03g52480D [Brassica napus]
Length=97

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 19/111 (17%)
 Frame = +3

Query  762   EEARMLARvldvdwvevleeIGLWIPADVINREHDDKPEGAELEPEIIAGKRLPPECNAE  941
             +EA ML R L ++W  + E+I  W+PA+V N E++DKPEG E   EI+AG+ +   CNAE
Sbjct  2     KEAGMLVRALGLEWDVLSEDICFWLPAEVNNEENNDKPEGEEEPEEILAGRPVAAVCNAE  61

Query  942   LHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAE  1094
                                SA +CC+AC+ QA+RAK GD +CNIWVYCP+E
Sbjct  62    -------------------SAVDCCQACLVQAERAKPGDMRCNIWVYCPSE  93



>emb|CEG01776.1| unnamed product [Ostreococcus tauri]
Length=303

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 19/128 (15%)
 Frame = +3

Query  927   ECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKK---CNIWVYCP---  1088
             E   E H  YDG AVRWG+ H  ++A EC   C E   R      +   CN++VYCP   
Sbjct  159   EARVEPHASYDGIAVRWGINHTVKTAEECAERCREHEIRPNGRGAEVLPCNVFVYCPLNV  218

Query  1089  -AEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQY-----------SEAYRNAHPNAPLI  1232
              A++ C+  D ++H   +CWLK+SE P+    +Q             + +   HPNAP +
Sbjct  219   DADR-CFEADAHEHFPGDCWLKFSETPENVEVNQRGANDAPGFVRDGKTFAQRHPNAPNL  277

Query  1233  VPWMSGVM  1256
               W SGV+
Sbjct  278   THWTSGVL  285



>ref|XP_003083314.1| unnamed protein product [Ostreococcus tauri]
Length=211

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 61/127 (48%), Gaps = 17/127 (13%)
 Frame = +3

Query  927   ECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKK---CNIWVYCPAE-  1094
             E   E H  YDG AVRWG+ H  ++A EC   C E   R      +   CN++VYCP   
Sbjct  67    EARVEPHASYDGIAVRWGINHTVKTAEECAERCREHEIRPNGRGAEVLPCNVFVYCPLNV  126

Query  1095  --KGCYSPDIYQHKHQECWLKYSEKPKLNFQHQY-----------SEAYRNAHPNAPLIV  1235
                 C+  D ++H   +CWLK+SE P+    +Q             + +   HPNAP + 
Sbjct  127   DADRCFEADAHEHFPGDCWLKFSETPENVEVNQRGANDAPGFVRDGKTFAQRHPNAPNLT  186

Query  1236  PWMSGVM  1256
              W SGV+
Sbjct  187   HWTSGVL  193



>ref|XP_007513486.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16011.1| predicted protein [Bathycoccus prasinos]
Length=310

 Score = 79.3 bits (194),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 33/137 (24%)
 Frame = +3

Query  945   HTDYDGAAVRWGLTHHKESAYECCRACVEQA-----KRAKSG------------------  1055
             H+ YDG A+ WG+T   ++A ECC AC + A     + A SG                  
Sbjct  152   HSGYDGFALTWGMTFRTKTASECCDACRKHAEICGGEGANSGTMFFNTSFGVRGNCGTAP  211

Query  1056  -DKK--CNIWVYCP----AEKGCYSPDIYQHKHQECWLKYSEKPKLNF---QHQYSEAYR  1205
              +KK  CNIWVYCP     +  C+S DI+ H+  ECWLK    P   F     +Y + + 
Sbjct  212   FEKKLLCNIWVYCPPNEKRDGKCWSGDIHDHEQHECWLKNQADPTKPFAPSSGRYPDKHL  271

Query  1206  NAHPNAPLIVPWMSGVM  1256
               H  +P +V W+SG +
Sbjct  272   QEHKTSPDVVQWLSGAV  288



>ref|XP_002973851.1| hypothetical protein SELMODRAFT_414240 [Selaginella moellendorffii]
 gb|EFJ24806.1| hypothetical protein SELMODRAFT_414240 [Selaginella moellendorffii]
Length=156

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (54%), Gaps = 5/143 (3%)
 Frame = +3

Query  291  AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQS----AFRY  458
            A GGN +G R   CSY+R T++IC++N++  LYVL SL    Y      S +    A +Y
Sbjct  5    AAGGNGSGERSVKCSYRRVTMLICTVNLIAVLYVLHSLLGPRYLSSSLASVARGGHATKY  64

Query  459  TPDQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLR  638
            + ++++K+ ES   RK  EP EL++ V +++ E   +    +     +++  D L   L+
Sbjct  65   SEEELQKIRESLEARKAVEPHELMRRVKEIQDEADSDVSRTKEIGNARQRAADVLAQRLK  124

Query  639  GLDGNANTTMQREAVESWRVAKL  707
             L    N  + ++A+E WR  +L
Sbjct  125  ELK-EVNNQINQQALEEWRKKRL  146



>ref|XP_002983542.1| hypothetical protein SELMODRAFT_445538 [Selaginella moellendorffii]
 gb|EFJ15443.1| hypothetical protein SELMODRAFT_445538 [Selaginella moellendorffii]
Length=156

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (54%), Gaps = 5/143 (3%)
 Frame = +3

Query  291  AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQS----AFRY  458
            A GGN +G R   CSY+R T++IC++N++  LYVL SL    Y      S +    A +Y
Sbjct  5    AAGGNGSGERSVKCSYRRVTMLICTVNLIAVLYVLHSLLGPRYLSSSLASVARGGHATKY  64

Query  459  TPDQIRKMEESTRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLR  638
            + ++++K+ ES   RK  EP EL++ V +++ E   +    +     +++  D L   L+
Sbjct  65   SEEELQKIRESLEARKAVEPHELMRRVKEIQDEADSDVSRTKEIGNARQRAADVLAQRLK  124

Query  639  GLDGNANTTMQREAVESWRVAKL  707
             L    N  + ++A+E WR  +L
Sbjct  125  ELK-EVNNQINQQALEEWRKKRL  146



>ref|XP_002505080.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66338.1| predicted protein [Micromonas sp. RCC299]
Length=231

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 58/123 (47%), Gaps = 17/123 (14%)
 Frame = +3

Query  939   ELHTDYDGAAVRWGLTHHKESAYECCRACVEQ----AKRAKSGDKKCNIWVYCPA--EKG  1100
             E H  YDG AV WG+ H K +A  C  AC              D  CN WV+CP    KG
Sbjct  91    EEHASYDGLAVAWGIGHRKPTAAACAAACRAHKPGPPHHGPFADLPCNAWVWCPVMETKG  150

Query  1101  CYSPDIYQHKHQECWLKYSEKPKLNFQHQY-----------SEAYRNAHPNAPLIVPWMS  1247
             C+ PD + H   +CWLK++E P+    +Q               YR  HP+AP +  W S
Sbjct  151   CFEPDAHTHGPGDCWLKFTETPENVEVNQRGANDAPGTVKDGATYRKRHPDAPRLAHWTS  210

Query  1248  GVM  1256
             GVM
Sbjct  211   GVM  213



>ref|XP_005758211.1| hypothetical protein EMIHUDRAFT_219870 [Emiliania huxleyi CCMP1516]
 gb|EOD05782.1| hypothetical protein EMIHUDRAFT_219870 [Emiliania huxleyi CCMP1516]
Length=256

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 64/152 (42%), Gaps = 41/152 (27%)
 Frame = +3

Query  924   PECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAK--------------RAKSGD-  1058
             P CN   H  + G ++ WG++ H  +A ECC AC   A+              R+  G  
Sbjct  91    PSCNPTPHAGFSGGSLNWGMSFHVGTAQECCDACKAHARVCGAPGAGGRVYLNRSWEGKV  150

Query  1059  -------------------KKCNIWVYCP----AEKGCYSPDIYQHKHQECWLKYS---E  1160
                                + CN++V+CP    A   C+S D++ H   ECWLK     +
Sbjct  151   SAERCAKTMTSNELGTHAAQACNVFVFCPTPPSAGGLCWSNDVWNHSSGECWLKSQAAPQ  210

Query  1161  KPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             +P       Y +AYR  H  AP  V WMSG +
Sbjct  211   RPHAGAFGAYPDAYRKKHRTAPEKVQWMSGAL  242



>ref|XP_005794401.1| hypothetical protein EMIHUDRAFT_194609 [Emiliania huxleyi CCMP1516]
 gb|EOD41972.1| hypothetical protein EMIHUDRAFT_194609 [Emiliania huxleyi CCMP1516]
Length=180

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 61/124 (49%), Gaps = 25/124 (20%)
 Frame = +3

Query  921   PP--ECNAELHTDYDGA-AVRWGL--THHKESAYECCRACVEQAKRAKSGDKKCNIWVYC  1085
             PP  EC  E+H DYDG  A  WGL  + H  +A ECC  C    K        CN WV  
Sbjct  57    PPADECGTEMHADYDGTRAWNWGLDPSQHVATAAECCAKCRAHVK--------CNSWV--  106

Query  1086  PAEKGCYSPDIYQHKHQECWLKYSE---KPKLNFQHQYSEAYRN--AHPNAPLIVPWMSG  1250
                  C++PD ++H   ECW+K       P +N +  Y+  YR    H +AP +V W+SG
Sbjct  107   -----CFAPDAHKHTRGECWMKDQRDPASPSVNMRGAYTSKYRARPGHHHAPPMVHWVSG  161

Query  1251  VMSV  1262
              + +
Sbjct  162   TVRL  165



>ref|XP_007514831.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15071.1| predicted protein [Bathycoccus prasinos]
Length=413

 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 58/124 (47%), Gaps = 18/124 (15%)
 Frame = +3

Query  939   ELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSG---DKKCNIWVYCP-AEKGCY  1106
             E H  YDG AVRWG+ H   +A +C + C E       G   D  CN +V+C  A   C+
Sbjct  272   EKHASYDGLAVRWGIGHKAATAEQCAQKCREHVPGRGGGPFNDLPCNAFVWCDIANDICF  331

Query  1107  SPDIYQHKHQECWLKYSEKPKL--------------NFQHQYSEAYRNAHPNAPLIVPWM  1244
              PD + H   +CWLK++E P+                F ++    Y+  H  AP  V W 
Sbjct  332   EPDAHVHTAGDCWLKFTEVPERVEINQRGANDDPFDGFLNENKLTYKMRHVKAPDKVHWT  391

Query  1245  SGVM  1256
             SGV+
Sbjct  392   SGVL  395



>ref|XP_003060249.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55018.1| predicted protein [Micromonas pusilla CCMP1545]
Length=375

 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 65/151 (43%), Gaps = 46/151 (30%)
 Frame = +3

Query  939   ELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDK----KCNIWVYCPAEK---  1097
             E    YDG AVRWGL H  +SA  C  AC E  +  K+G +     CN + YCP E    
Sbjct  208   EPRASYDGLAVRWGLGHTVQSAEACAEACREH-EPGKAGAEVASLPCNAFAYCPMETPRA  266

Query  1098  ------------------GCYSPDIYQHKHQECWLKYSEKPKL---------------NF  1178
                               GC+ PD ++H   +CWLK++E P+                 F
Sbjct  267   QNLNDTMKPKGGGKGDHGGCFEPDAHEHAPGDCWLKFTEAPEAVEVNQARRRGANAGRGF  326

Query  1179  QHQY-----SEAYRNAHPNAPLIVPWMSGVM  1256
             + +        +YR  HP +P +V W SGV+
Sbjct  327   ERKRPGGGGGVSYRERHPASPKLVDWTSGVL  357



>ref|XP_002946154.1| hypothetical protein VOLCADRAFT_86136 [Volvox carteri f. nagariensis]
 gb|EFJ53149.1| hypothetical protein VOLCADRAFT_86136 [Volvox carteri f. nagariensis]
Length=366

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 53/109 (49%), Gaps = 22/109 (20%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C+ E H++ DG  V+WG  H  E+A ECC AC + A         CN+WV+C    GC S
Sbjct  81    CHTEEHSEIDGRVVKWGADHFTETAGECCAACTKHA--------DCNVWVWCAEPNGCGS  132

Query  1110  PDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
               +    H+ECWLK +    +     YS      HP     +PW +G +
Sbjct  133   GRL----HKECWLKKNTVKNIIDSRGYS------HPG----IPWTAGAL  167



>ref|XP_001421253.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99546.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=196

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 35/118 (30%)
 Frame = +3

Query  939   ELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDI  1118
             E H  YDG AVRWG+ H  E+A EC                  ++      E GC+ PD 
Sbjct  85    EEHASYDGVAVRWGIHHTTETAEEC------------------DV-----GEGGCFEPDA  121

Query  1119  YQHKHQECWLKYSEKPK------------LNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
             +QH   +CWLK+SE P+              F ++  + +   H NAP +V W SGV+
Sbjct  122   HQHFAGDCWLKFSETPENVEVNQRGANDAPGFVNKDGKTFAERHANAPKLVHWSSGVL  179



>ref|XP_005842701.1| hypothetical protein CHLNCDRAFT_136271, partial [Chlorella variabilis]
 gb|EFN50569.1| hypothetical protein CHLNCDRAFT_136271 [Chlorella variabilis]
Length=264

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 55/111 (50%), Gaps = 17/111 (15%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             CN   +TDY G A+ WG +H  ESA ECC+AC +    A +    CNIWVYC  +  C +
Sbjct  125   CNMLNNTDYWGDALVWGHSHKTESAMECCQACTDFKPAADNEQMDCNIWVYCGDKALCGA  184

Query  1110  PDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
                    H+ECWLK+         H Y  A     P+    V W +G+++ 
Sbjct  185   ------HHKECWLKH-------LAHPYGTAPAKEGPD----VGWTTGILAA  218



>ref|XP_001754137.1| predicted protein [Physcomitrella patens]
 gb|EDQ81038.1| predicted protein [Physcomitrella patens]
Length=313

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 69/174 (40%), Gaps = 69/174 (40%)
 Frame = +3

Query  867   DKPE-GAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKR  1043
             D PE GAE    II G+ +P   + E HTDY                    R   +    
Sbjct  163   DGPEIGAE--DGIIPGRPVPEVSHVEAHTDYG-------------------RKSGQPKAM  201

Query  1044  AKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYS----------------------  1157
              KS    C+  +      GC+SPD+Y+HKHQECWLK++                      
Sbjct  202   RKSAMYGCSAQL----RGGCFSPDVYEHKHQECWLKHANNRLVGFVWQICSLIRPSDIFS  257

Query  1158  ---------------------EKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
                                  ++P LNF+  Y E YR  HP AP+ VPW+SG++
Sbjct  258   HLYRSLYDEDLSHFMSFCMQADEPNLNFKVHYDEEYRREHPTAPVTVPWVSGII  311



>ref|XP_005768484.1| hypothetical protein EMIHUDRAFT_211123 [Emiliania huxleyi CCMP1516]
 ref|XP_005790107.1| hypothetical protein EMIHUDRAFT_225258 [Emiliania huxleyi CCMP1516]
 gb|EOD16055.1| hypothetical protein EMIHUDRAFT_211123 [Emiliania huxleyi CCMP1516]
 gb|EOD37678.1| hypothetical protein EMIHUDRAFT_225258 [Emiliania huxleyi CCMP1516]
Length=217

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 65/146 (45%), Gaps = 35/146 (24%)
 Frame = +3

Query  924   PECNAELHTDYDG-AAVRWGLTHHKESAYECCRACVEQAKRAKSGDK-------------  1061
             P C+A  H  Y G  AV WG      SA ECCRAC   A     G+              
Sbjct  23    PTCHARDHAGYAGDRAVVWGANLRLSSAAECCRACQAHAAACGRGNAGAEWWGRACGRAP  82

Query  1062  KCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE----KPKLNFQHQYS------EAYRNA  1211
              CN+W +CP E+ C++ DI+ H+  ECWLK       +PK  F+   +       A R +
Sbjct  83    GCNLWSFCPEEQ-CFAFDIHVHRRGECWLKQQAEAPTRPKDPFEGHAAFPPEMRAAPRRS  141

Query  1212  HPNA----------PLIVPWMSGVMS  1259
              P A          P  VPW+SGV++
Sbjct  142   WPFAVSLAVWPGPMPERVPWISGVLA  167



>ref|XP_005784426.1| hypothetical protein EMIHUDRAFT_99002 [Emiliania huxleyi CCMP1516]
 gb|EOD31997.1| hypothetical protein EMIHUDRAFT_99002 [Emiliania huxleyi CCMP1516]
Length=271

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 68/155 (44%), Gaps = 26/155 (17%)
 Frame = +3

Query  864   DDKPEGAELE-PEIIAGKRLPPECNAELHTDYDGAAVRWGLT--HHKESAYECCRACVEQ  1034
             D   E AE   P    G   P EC  E H+D  G AV WG    H   SA ECC+ C+  
Sbjct  59    DGVCEAAETSCPGDCPGITTPTECGEEPHSDPAGEAVAWGSAPEHRVRSAAECCQRCMAH  118

Query  1035  AKRAKSGDKKCNIWVYCPAEKGCYSPDIYQ-HKHQECWLKYS---EKPKLNFQHQYSEAY  1202
             A  AK+  + CN W +C     C+S D    H H ECWLK+      P    + +YSE++
Sbjct  119   A--AKNTRRPCNSWSFCYLPH-CWSLDNGNTHTHGECWLKWQADVRHPLFGQRGRYSESF  175

Query  1203  RNAH---------PNA-------PLIVPWMSGVMS  1259
             R  +         P+        P  VPW  GV+ 
Sbjct  176   RRKNWDKHLSGRMPDGSKRNLTPPTHVPWTGGVIG  210



>ref|XP_001696577.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
 gb|EDP08554.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
Length=383

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (50%), Gaps = 22/109 (20%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C+ + +++ DG  V+WG  H  E+  +CC AC             CN+WV+C + +GC S
Sbjct  98    CHIKENSEIDGRVVKWGADHFTETPTDCCSACTNH--------PDCNVWVWCASPQGCGS  149

Query  1110  PDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
                   +H+ECWLK +    +      SE Y  AHP     +PW SG +
Sbjct  150   ----GRQHKECWLKKNTVKNI----IDSEGY--AHPG----IPWTSGAL  184



>ref|XP_001690321.1| hypothetical protein CHLREDRAFT_188317 [Chlamydomonas reinhardtii]
 gb|EDP05580.1| predicted protein [Chlamydomonas reinhardtii]
Length=287

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 24/126 (19%)
 Frame = +3

Query  918   LPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEK  1097
             +P +C    H DY G  V WGL H + SA +CC AC E  K+  + +K CN+WV+C    
Sbjct  161   IPEDCYPSKHADYAGDGVVWGLGHKQASAADCCAACKEHQKKFAT-NKPCNVWVWC----  215

Query  1098  GCYSPDIYQHKHQECWLKYSEK----PKL-------NFQHQYSEAYRNAHPNAPLIVPWM  1244
                      H   +CWLK+ EK    P L       N +  ++  +R  H  +P +VPW+
Sbjct  216   --------DHTTGDCWLKHQEKWDNNPDLTTSNLEINHKGAFTAEFRAVHKTSPEMVPWV  267

Query  1245  SGVMSV  1262
             +G++ +
Sbjct  268   AGLVPI  273



>gb|AFW73560.1| hypothetical protein ZEAMMB73_717350, partial [Zea mays]
Length=139

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +3

Query  291  AVGGNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQS-AFRYTPD  467
            AV      T G WCSY+R T+ +C  N+V  L VL+SL       P   ++    +YT +
Sbjct  8    AVSFGRRATTG-WCSYRRVTVAVCIGNLVAVLLVLRSLTAPASFAPTAPNRGEVVQYTEE  66

Query  468  QIRKMEESTRIRKESEPTELIKLV  539
            QIR +EES RIR+E+EP EL+  V
Sbjct  67   QIRWVEESIRIRREAEPVELVLAV  90



>gb|KDD75276.1| hypothetical protein H632_c772p0 [Helicosporidium sp. ATCC 50920]
Length=183

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 60/137 (44%), Gaps = 34/137 (25%)
 Frame = +3

Query  870   KPEGAELEPEII----AGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQA  1037
             KPE  E  P  +     G+  P   + E  +DYDG AV WGL H   +A EC        
Sbjct  55    KPECLEQSPTAVWWNKHGQERPLVIHIEPESDYDGLAVVWGLGHKTATAQECGGI-----  109

Query  1038  KRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE---KPKLNFQHQYSEAYRN  1208
                                  C+ PDI++H   +CWLK++E   +P+LN +    EA + 
Sbjct  110   ---------------------CWEPDIHKHTSHDCWLKFTEGPAQPQLNMRGAIHEAQKK  148

Query  1209  AHP-NAPLIVPWMSGVM  1256
              H    P  VPW+SG +
Sbjct  149   RHGYKTPERVPWVSGAV  165



>ref|XP_002950021.1| hypothetical protein VOLCADRAFT_74454 [Volvox carteri f. nagariensis]
 gb|EFJ49124.1| hypothetical protein VOLCADRAFT_74454 [Volvox carteri f. nagariensis]
Length=634

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 9/79 (11%)
 Frame = +3

Query  921   PPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKG  1100
             P +C+ + H +Y G  + WG  + K SA+ECC +C             CNIWVYC  E+G
Sbjct  96    PDQCHVDEHNEYHGDVLIWGDKNIKASAWECCESCTST--------PGCNIWVYCGREEG  147

Query  1101  CYSPDIYQHKHQECWLKYS  1157
             C S   ++ K  ECWLK++
Sbjct  148   CGSTQPHRPK-GECWLKHN  165



>ref|XP_007512600.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17200.1| predicted protein [Bathycoccus prasinos]
Length=560

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +3

Query  876   EGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKS-  1052
             + A+ +P  + GK    + N  +H ++ G+  +WG  + K SA EC   C+      K+ 
Sbjct  110   KNAKQQPLEVVGKW--GDFNPIVHAEFSGSVSKWGENNFKSSARECHEDCLSMNPDGKAV  167

Query  1053  GDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKL  1172
             GD+ CN+WV+C    GC        K++ CWLK+  +P++
Sbjct  168   GDRACNVWVWCGDANGCLG-----QKYRACWLKHQARPEM  202



>ref|XP_002955379.1| hypothetical protein VOLCADRAFT_106781 [Volvox carteri f. nagariensis]
 gb|EFJ43450.1| hypothetical protein VOLCADRAFT_106781 [Volvox carteri f. nagariensis]
Length=555

 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +3

Query  927   ECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCY  1106
             +C    HT+  G  V WG T+ K SA ECC+AC+    R +  +  CN+WVYC  ++ C 
Sbjct  102   KCFTYEHTELWGDVVAWGTTNKKNSAGECCQACLNH--RPQGDEPDCNVWVYCGNQQLCG  159

Query  1107  SPDIYQHKHQECWLKYSEKPK  1169
             +      ++Q+CWLK+   P+
Sbjct  160   A------QYQQCWLKHLAHPE  174



>ref|XP_002951719.1| hypothetical protein VOLCADRAFT_105231 [Volvox carteri f. nagariensis]
 gb|EFJ47170.1| hypothetical protein VOLCADRAFT_105231 [Volvox carteri f. nagariensis]
Length=378

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 49/111 (44%), Gaps = 17/111 (15%)
 Frame = +3

Query  852   NREHDDKPEGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVE  1031
             +  +D   E A L    +AG     +C+   HT+Y G  V WG  HH  SA ECC AC  
Sbjct  95    SASNDLATEQAALRALSLAGT----QCHVAWHTEYWGDTVVWGSAHHARSAAECCAACSS  150

Query  1032  QAKRAKSG--DK-----KCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEK  1163
                 A  G  DK      CN+WV+C     C         +QECWLK   K
Sbjct  151   HQLAASRGGLDKGPNSTTCNVWVFCGDAARCGP------HYQECWLKSLAK  195



>gb|AEJ54429.1| hypothetical protein [Fagopyrum esculentum subsp. ancestrale]
Length=29

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  954   YDGAAVRWGLTHHKESAYECCRACVEQAK  1040
             Y GAAVRWGLTHHKESA +CC+AC++QAK
Sbjct  1     YGGAAVRWGLTHHKESAADCCQACLDQAK  29



>ref|XP_001703364.1| hypothetical protein CHLREDRAFT_205629 [Chlamydomonas reinhardtii]
 gb|EDP06046.1| hypothetical protein CHLREDRAFT_205629 [Chlamydomonas reinhardtii]
Length=238

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +3

Query  948   TDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKK---CNIWVYCPAEKGCYSPDI  1118
              DYDG AV WG+ + K +  EC   C         G  K   CN + +CP E  C+ PD 
Sbjct  134   ADYDGLAVFWGINNKKANVEECAEHCRSHQPNIVDGPFKKLPCNAFAFCPDEV-CFEPDA  192

Query  1119  YQHKHQECWLKYSEKP  1166
             + H   +CWLK++E P
Sbjct  193   HHHTKGDCWLKFTEGP  208



>ref|XP_001689603.1| predicted protein [Chlamydomonas reinhardtii]
 ref|XP_001689604.1| hypothetical protein CHLREDRAFT_146573 [Chlamydomonas reinhardtii]
 gb|EDP09341.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09342.1| hypothetical protein CHLREDRAFT_146573 [Chlamydomonas reinhardtii]
Length=570

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 52/112 (46%), Gaps = 18/112 (16%)
 Frame = +3

Query  927   ECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCY  1106
             +C    HT+  G  V WG  + K+SA ECC AC+     +   +  CN+WVYC  E  C 
Sbjct  118   KCYTYEHTELWGDVVVWGTLNKKKSAGECCDACLNYQPTSPD-EPGCNVWVYCGDEAKCG  176

Query  1107  SPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMSV  1262
             S      +HQ+CWLK+   P         EA + A        PW SG + V
Sbjct  177   S------QHQQCWLKHLVHP---------EASKPARTGPQ--TPWTSGTIDV  211



>ref|XP_005761972.1| hypothetical protein EMIHUDRAFT_198031 [Emiliania huxleyi CCMP1516]
 gb|EOD09543.1| hypothetical protein EMIHUDRAFT_198031 [Emiliania huxleyi CCMP1516]
Length=301

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 71/160 (44%), Gaps = 43/160 (27%)
 Frame = +3

Query  906   AGKRLPPECNAELHTDYDGA-AVRWGLT---HHKESAYECC-------RACVEQAKRAKS  1052
             +G    P C+A LHTDY G  A  WGL     H +SA ECC       R C +    AK+
Sbjct  80    SGAVADPTCHARLHTDYMGERAPVWGLGKPGFHLQSAAECCAACQAHNRVCGKPGSSAKA  139

Query  1053  -----------GDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSE----KPK------  1169
                         +  CN+WVYCP EK C++ DI+ H   ECWLK       +PK      
Sbjct  140   WWPSRPELRCGNNPGCNVWVYCP-EKQCFAFDIHVHTQGECWLKQQHANITRPKDPHEGH  198

Query  1170  LNFQHQYSEAYRNAHPNA----------PLIVPWMSGVMS  1259
              +F      + R   P A          P  VPW+SGV++
Sbjct  199   TSFPAAMRASPREVWPWAVDKKIWPGGIPEKVPWISGVLA  238



>ref|XP_005758766.1| hypothetical protein EMIHUDRAFT_219177 [Emiliania huxleyi CCMP1516]
 gb|EOD06337.1| hypothetical protein EMIHUDRAFT_219177 [Emiliania huxleyi CCMP1516]
Length=286

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 55/129 (43%), Gaps = 27/129 (21%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C    H+  DG  + WGL+   +SA ECC        R KS  KKCN W +C     C+ 
Sbjct  53    CGEVPHSGRDGRVLTWGLSFRTDSAQECC-------DRCKSHPKKCNSWTFC-GLPVCWG  104

Query  1110  PDI-YQHKHQECWLKY---------SEKPKLNFQHQYSEAYRNAHPN---------APLI  1232
              D  + H + ECWL+          + + +  +  Q+   +R A P          +P  
Sbjct  105   LDTGHNHTYGECWLRRLSGDVQAIDTFRQRGKYTEQWLSQHRKARPGCKRNEPWACSPTH  164

Query  1233  VPWMSGVMS  1259
             VPW SG + 
Sbjct  165   VPWTSGALG  173



>ref|XP_005648355.1| hypothetical protein COCSUDRAFT_47447 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23811.1| hypothetical protein COCSUDRAFT_47447 [Coccomyxa subellipsoidea 
C-169]
Length=546

 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 62/146 (42%), Gaps = 30/146 (21%)
 Frame = +3

Query  858   EHDDKPEGAELEPEIIAGKRLPPE-----------CNAELHTDYDGAAVRWGLTHHKESA  1004
             E   K  GAE +P     + L P            C    +TDY G A+ WG  +  +SA
Sbjct  80    EETRKSSGAESQPRSSRAQMLQPPLSNKKASDRKICKMLPNTDYWGEAIVWGPQNKVDSA  139

Query  1005  YECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQH  1184
              ECC+ C   +  A   D  CN+WV+C  ++ C      +  +++CWLK+   P+     
Sbjct  140   EECCQQCANYSP-ASEDDMDCNVWVWCGDKERC------KGSYRDCWLKHLAHPEA----  188

Query  1185  QYSEAYRNAHPNAPLIVPWMSGVMSV  1262
                      +P     VPW SG+  V
Sbjct  189   --------VNPATGPKVPWTSGLSGV  206



>ref|XP_005845157.1| hypothetical protein CHLNCDRAFT_137318 [Chlorella variabilis]
 gb|EFN53055.1| hypothetical protein CHLNCDRAFT_137318 [Chlorella variabilis]
Length=429

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +3

Query  927   ECNAELHTDYDG-AAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGC  1103
             +C+ E H +YDG   V+WG  ++KESA  CC AC    +    G K+CN+WVYC A  GC
Sbjct  103   QCHTEEHAEYDGETVVQWGDKNYKESAAACCAACQAATQ----GAKRCNVWVYCSAADGC  158

Query  1104  YSPDIYQHKHQECWLKYSE  1160
              +       H+ECWLK+S+
Sbjct  159   GTG----RAHRECWLKHSK  173



>gb|KDD74436.1| cofilin/tropomyosin-type actin-binding protein, partial [Helicosporidium 
sp. ATCC 50920]
Length=492

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 15/83 (18%)
 Frame = +3

Query  930   CNAELHTDYDGA-AVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCY  1106
             C  E + +YDG   V+WG    + SA  CC AC            +C+++VYC +  GC 
Sbjct  175   CRQEPNAEYDGTTVVKWGTNFTQPSAVACCEACRNH--------PRCDLFVYCASATGCG  226

Query  1107  SPDIYQHKHQECWLKYSEKPKLN  1175
             +    +H H ECWLK   +P+LN
Sbjct  227   A----EHAHGECWLK--REPRLN  243



>ref|XP_005790841.1| hypothetical protein EMIHUDRAFT_251799 [Emiliania huxleyi CCMP1516]
 gb|EOD38412.1| hypothetical protein EMIHUDRAFT_251799 [Emiliania huxleyi CCMP1516]
Length=194

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 43/94 (46%), Gaps = 16/94 (17%)
 Frame = +3

Query  894   PEIIAGKRLPPECNAELHTDYDGAAVRWGLT--HHKESAYECCRACVEQAKRAKSGDKKC  1067
             P    G   P EC  E H++  G AV WG    H   SA ECC+ C+  A  AK+  + C
Sbjct  63    PGDCPGITTPTECGEEPHSNPAGEAVAWGSAPEHRVRSAAECCQRCMAHA--AKNTRRPC  120

Query  1068  NIWVYCPAEKGCYSPDIYQ------HKHQECWLK  1151
             N W +      CY P  +       H H ECWLK
Sbjct  121   NSWSF------CYLPHCWSLDNGNTHTHGECWLK  148



>emb|CDO99331.1| unnamed protein product [Coffea canephora]
Length=151

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 72/148 (49%), Gaps = 15/148 (10%)
 Frame = +3

Query  324  KWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIR  503
            +W S+K  TI++C  NV+  L++LQ     L  + +    S+ +     +R ++ES  IR
Sbjct  14   RWLSFKHATIVVCLFNVLTALFLLQGF---LSAFSFGKFSSSHQSNSVLLRHIKESEEIR  70

Query  504  KESEPTELIKLVSQlkkeflveekvvevPQPLKRKIT-----DELLATLRGLDGNANTTM  668
            +   P +LIK V +      +E++    P+ +K+K T      +L++ L  L   ++   
Sbjct  71   RAMIPVDLIKRVKE------IEKEAHAEPEAVKQKDTKQGAASDLVSRLNNLRSYSDAGS  124

Query  669  QREAVESWRVAKLKEANDIIIGNPSTAT  752
             + A+E WR  K++ A    +G   T  
Sbjct  125  LK-ALEEWRKRKMERARQRELGKNGTVV  151



>ref|XP_009387579.1| PREDICTED: uncharacterized protein LOC103974461 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=289

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 46/109 (42%), Gaps = 19/109 (17%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C  + H +  G AV+WG  H   S+ +CCRAC  +A     G   CN WV+C   + C  
Sbjct  66    CRGQEHLELWGPAVKWGADHKFNSSRDCCRAC--KAMCGSVGPCLCNSWVFCGDRERC--  121

Query  1110  PDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
                   +  ECWLK  E   L   H   E            V W SG++
Sbjct  122   ----GERFGECWLKKQEDVLLPALHDLGEK-----------VIWTSGLI  155



>ref|XP_010936108.1| PREDICTED: uncharacterized protein LOC105055808 [Elaeis guineensis]
Length=149

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 43/142 (30%), Positives = 72/142 (51%), Gaps = 10/142 (7%)
 Frame = +3

Query  333  SYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKES  512
            S+K  TI++C +N++  L +LQ          +  S SA +  P Q+R + ES  IR+  
Sbjct  12   SFKNATIVVCFVNLIAALLLLQGFVG----ISHRRSASARQLDPAQLRYILESEEIRRAM  67

Query  513  EPTELIKLVSQlkkeflveekvvevPQPLKRKITD--ELLATLRGLDGNANTTMQREAVE  686
            EP ELIK + ++++E   E +      P +    D  + L  LR ++ +AN+   ++A+E
Sbjct  68   EPVELIKRIKEIEQEAFNEPEAEIQQVPKQTAAVDLSKRLKDLRAMN-DANS---QKALE  123

Query  687  SWRVAKLKEANDIIIGNPSTAT  752
             WR  K++ A    I    T T
Sbjct  124  EWRKRKMERARQREIEKNGTVT  145



>ref|XP_009387578.1| PREDICTED: uncharacterized protein LOC103974461 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=335

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 53/127 (42%), Gaps = 20/127 (16%)
 Frame = +3

Query  876   EGAELEPEIIAGKRLPPECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSG  1055
             +G ELE    AG      C  + H +  G AV+WG  H   S+ +CCRAC  +A     G
Sbjct  49    DGLELE-GTGAGGGDEDCCRGQEHLELWGPAVKWGADHKFNSSRDCCRAC--KAMCGSVG  105

Query  1056  DKKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIV  1235
                CN WV+C   + C        +  ECWLK  E   L   H   E            V
Sbjct  106   PCLCNSWVFCGDRERC------GERFGECWLKKQEDVLLPALHDLGEK-----------V  148

Query  1236  PWMSGVM  1256
              W SG++
Sbjct  149   IWTSGLI  155



>ref|XP_008656621.1| PREDICTED: uncharacterized protein LOC103636039 isoform X2 [Zea 
mays]
Length=106

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  327  WCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRK  506
            WC+ +R T+ +C  N+V TL V ++L+    ++ +   +   +Y+ + +R ++ES  IR+
Sbjct  17   WCTCRRATVALCVANLVATLLVTRALYAP-GSFAFAPKRGELKYSREHMRWVDESIWIRR  75

Query  507  ESEPTELIKLVSQ  545
             +EP ELI+ V +
Sbjct  76   AAEPVELIEAVKK  88



>emb|CEF96636.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain [Ostreococcus 
tauri]
Length=357

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 32/68 (47%), Gaps = 12/68 (18%)
 Frame = +3

Query  948   TDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQH  1127
             T+ DGA VRWG  H    A  CC AC + +         CN+WV+C    GC        
Sbjct  80    TELDGAVVRWGSEHVVADATACCEACSDAS--------GCNVWVWCSDADGCGG----DR  127

Query  1128  KHQECWLK  1151
             K  ECWLK
Sbjct  128   KFGECWLK  135



>ref|XP_005776861.1| hypothetical protein EMIHUDRAFT_238469 [Emiliania huxleyi CCMP1516]
 ref|XP_005778045.1| hypothetical protein EMIHUDRAFT_237378 [Emiliania huxleyi CCMP1516]
 gb|EOD24432.1| hypothetical protein EMIHUDRAFT_238469 [Emiliania huxleyi CCMP1516]
 gb|EOD25616.1| hypothetical protein EMIHUDRAFT_237378 [Emiliania huxleyi CCMP1516]
Length=277

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 67/168 (40%), Gaps = 59/168 (35%)
 Frame = +3

Query  930   CNAELHTDYDG-AAVRWGLT---HHKESAYECCRACVEQAKRAKSGD-------------  1058
             C+A  +T Y G  A+ WGL     H   A ECC AC   A+                   
Sbjct  83    CHARANTGYAGDGALVWGLGKPGFHLAGASECCTACQAHARICGGAGSEGKEWWPAEANG  142

Query  1059  --------------------KKCNIWVYCPAEKGCYSPDIYQHKHQECWLKYS-----EK  1163
                                 + C IW +CP+ + C++ DI+ H+  ECWLK+      E 
Sbjct  143   TASARKHGRRPAMLCGGGQRRACQIWTFCPSPR-CFAFDIHVHEFGECWLKFQAERLPEA  201

Query  1164  PK-LNFQHQ-YSEAYRNA-------------HPNA-PLIVPWMSGVMS  1259
             PK  +F H  Y E  R A              P+A P  VPW+SGV++
Sbjct  202   PKDPHFGHSTYPERMRQAPRRDWPWAVSMDVWPDAMPREVPWVSGVLA  249



>ref|XP_009397926.1| PREDICTED: uncharacterized protein LOC103982663 [Musa acuminata 
subsp. malaccensis]
Length=334

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 19/109 (17%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C  + H +  GAA++WG  H   S+ ECCRAC  ++   + G   CN WV+C   + C  
Sbjct  65    CRGQEHLELWGAAIKWGTDHKFNSSRECCRAC--KSMCGEDGPCLCNSWVFCGDRERC--  120

Query  1110  PDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
                   +  ECWLK  E   L   H   +            V W SG++
Sbjct  121   ----GDRFGECWLKKQEDVLLPALHDSGKK-----------VIWTSGLI  154



>gb|KDD77051.1| hypothetical protein H632_c31p0 [Helicosporidium sp. ATCC 50920]
Length=462

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 33/69 (48%), Gaps = 6/69 (9%)
 Frame = +3

Query  948   TDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQH  1127
             TD  G A+ WG   H  S  ECC AC     +  +   +CN WVYC  +  C +      
Sbjct  37    TDMMGDALVWGSQQHVSSISECCAACAAYRPKNGTAGARCNAWVYCGNKSLCGT------  90

Query  1128  KHQECWLKY  1154
              + ECWLKY
Sbjct  91    SYGECWLKY  99



>ref|XP_003061004.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54654.1| predicted protein [Micromonas pusilla CCMP1545]
Length=3282

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 36/75 (48%), Gaps = 9/75 (12%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C  E   +Y G  +  G     +SA  CC  C             CN +VYC  E GCYS
Sbjct  655   CQIEDAANYKGDPLNDGTELLVDSAEACCNVCHRF--------NGCNSFVYCAGEDGCYS  706

Query  1110  PDIYQHKHQECWLKY  1154
              D Y +KH+ECWLK+
Sbjct  707   -DYYLYKHRECWLKW  720



>ref|XP_005781637.1| hypothetical protein EMIHUDRAFT_421168 [Emiliania huxleyi CCMP1516]
 gb|EOD29208.1| hypothetical protein EMIHUDRAFT_421168 [Emiliania huxleyi CCMP1516]
Length=189

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 52/136 (38%), Gaps = 32/136 (24%)
 Frame = +3

Query  927   ECNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCY  1106
              C  E H+D  G  + +G++H   SA +CC  C       K+  K CN W +C     C+
Sbjct  12    SCGEEPHSDRGGKGLTFGVSHRAASAQDCCDKC-------KAHHKGCNSWTFC-GYPVCF  63

Query  1107  SPDI-YQHKHQECWLKY---SEKPKLNFQHQYSEAYRNAH------------PNA-----  1223
               D  + H   ECWL+       P    + +YS  YR               P       
Sbjct  64    GLDTGWNHTFGECWLRVLPDPAAPVFGQRGEYSMRYRTKMLRTRKACTSIDTPGGLSPGW  123

Query  1224  ---PLIVPWMSGVMSV  1262
                P  VPW SG + V
Sbjct  124   VCPPTHVPWTSGSIGV  139



>ref|XP_002502891.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64149.1| predicted protein [Micromonas sp. RCC299]
Length=3204

 Score = 53.9 bits (128),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 16/110 (15%)
 Frame = +3

Query  930   CNAELHTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYS  1109
             C  E   +Y G  +  G     +S   CC  C E        D +CN +VYC +E GC  
Sbjct  634   CQIEDAANYKGDPLIDGTNLLVDSPEACCAKCAE--------DDRCNSFVYCGSESGC-G  684

Query  1110  PDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVMS  1259
              + Y +KH+ECWLK+  +   +   Q+     N        +PW SG+++
Sbjct  685   GEYYDYKHRECWLKFLAE---DMWTQFPVPAWNRGEG----IPWTSGIVN  727



>ref|XP_007515750.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14629.1| predicted protein [Bathycoccus prasinos]
Length=379

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 56/124 (45%), Gaps = 25/124 (20%)
 Frame = +3

Query  894   PEIIAGKRLPPECNA--ELHTDYDGAAV-RWGLTHHKESAYECCRACVEQAKRAKSGDKK  1064
             P I  G ++  +C    +LH++Y GA V +WG  +   SA ECCRAC      A  G   
Sbjct  91    PRIEDGDKIGGKCGLPYDLHSEYAGAVVGKWGENNILNSADECCRAC-----EATEG---  142

Query  1065  CNIWVYCPAEKGCYSPDIYQHKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWM  1244
             CN +V+C    G  S      K  ECWLK  E P    + + SE          + V W 
Sbjct  143   CNAFVFC----GDRSNGCSGRKFGECWLKKQE-PNSAMRVKMSEG---------MDVRWT  188

Query  1245  SGVM  1256
             SG +
Sbjct  189   SGAL  192



>ref|XP_004954372.1| PREDICTED: uncharacterized protein LOC101773831 isoform X2 [Setaria 
italica]
Length=152

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 69/149 (46%), Gaps = 8/149 (5%)
 Frame = +3

Query  312  GTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEES  491
            GT     SYK  TI +C+ N++V   +L + F+S       D     ++   Q+R + ES
Sbjct  10   GTAASRLSYKNVTIAVCAFNLLVAALLLHNYFSSWTRIAGGD-----QFDSAQLRYIWES  64

Query  492  TRIRKESEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQ  671
              +R+  EP +LI+ V +   E     +     Q  K+    +L   L+ L    + + Q
Sbjct  65   EELRRAMEPVDLIRRVKE--IEQEAYGEHGMATQDPKQTAAVDLSNRLKDLRAGNDGSSQ  122

Query  672  REAVESWRVAKLKEANDIIIGNPSTATIK  758
            + A+E WR  K++ A    I    T+++K
Sbjct  123  K-ALEEWRKRKMERARQRAIEKNGTSSVK  150



>ref|XP_002454780.1| hypothetical protein SORBIDRAFT_04g037190 [Sorghum bicolor]
 gb|EES07756.1| hypothetical protein SORBIDRAFT_04g037190 [Sorghum bicolor]
Length=153

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 7/143 (5%)
 Frame = +3

Query  330  CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             SYK  TI +C+ N++V   +L + F+S       D     R    Q+R + ES  +R+ 
Sbjct  16   LSYKNATIAVCAFNLLVAALLLHNYFSSWTRIAGGD-----RLDSAQLRYIWESEELRRA  70

Query  510  SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
             EP +LI+ V ++++E   E  +     P +    D L   L+ L    + + Q+ A+E 
Sbjct  71   MEPVDLIRRVKEIEQEAYGEHGMATDEDPKQTAAVD-LSKRLKDLRAGNDGSSQK-ALEE  128

Query  690  WRVAKLKEANDIIIGNPSTATIK  758
            WR  K++ A    I    T++ K
Sbjct  129  WRKRKMERARQRAIEKNGTSSAK  151



>emb|CEG00521.1| unnamed product [Ostreococcus tauri]
Length=520

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 44/104 (42%), Gaps = 23/104 (22%)
 Frame = +3

Query  945   HTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQ  1124
             H +  G  V+WG     ESA +C   CV      +  DK C  WV+C    GC       
Sbjct  115   HFEGAGDVVKWGQDFFVESARKCHDECV------RLKDKGCTTWVWCADANGCLG-----  163

Query  1125  HKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
              KH+ CWLK   KP+     Q ++A  N         PW SG +
Sbjct  164   QKHKSCWLKKQAKPQ---SMQGTKAKSN---------PWTSGSI  195



>ref|XP_006854449.1| hypothetical protein AMTR_s00039p00224620 [Amborella trichopoda]
 gb|ERN15916.1| hypothetical protein AMTR_s00039p00224620 [Amborella trichopoda]
Length=158

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 6/129 (5%)
 Frame = +3

Query  330  CSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRKMEESTRIRKE  509
             SY+  T+++C  NVV  + +LQ +F      P N   +  RY   Q+R + ES  IR+ 
Sbjct  23   LSYRNATVLLCFFNVVTIILLLQCMF-----APSNKKFTKNRYESVQLRYIRESEAIRRA  77

Query  510  SEPTELIKLVSQlkkeflveekvvevPQPLKRKITDELLATLRGLDGNANTTMQREAVES  689
              P ELIK V ++++E  ++ + V   +  K+    +L   L+ L    N    ++A++ 
Sbjct  78   MVPLELIKRVKEIQQEPYIQPETVVQRKAPKQNSASDLSKRLKDLQA-LNDANSKKALDE  136

Query  690  WRVAKLKEA  716
            WR  K+  A
Sbjct  137  WRKRKMGRA  145



>ref|XP_003083819.1| UbiE/COQ5 methyltransferase (ISS) [Ostreococcus tauri]
Length=944

 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 45/104 (43%), Gaps = 23/104 (22%)
 Frame = +3

Query  945   HTDYDGAAVRWGLTHHKESAYECCRACVEQAKRAKSGDKKCNIWVYCPAEKGCYSPDIYQ  1124
             H +  G  V+WG     ESA +C   CV    R K  DK C  WV+C    GC       
Sbjct  115   HFEGAGDVVKWGQDFFVESARKCHDECV----RLK--DKGCTTWVWCADANGCLG-----  163

Query  1125  HKHQECWLKYSEKPKLNFQHQYSEAYRNAHPNAPLIVPWMSGVM  1256
              KH+ CWLK   KP+     Q ++A  N         PW SG +
Sbjct  164   QKHKSCWLKKQAKPQ---SMQGTKAKSN---------PWTSGSI  195



>ref|XP_006648112.1| PREDICTED: uncharacterized protein LOC102718148 [Oryza brachyantha]
Length=154

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 70/154 (45%), Gaps = 16/154 (10%)
 Frame = +3

Query  300  GNSNGTRGKWCSYKRTTIIICSINVVVTLYVLQSLFNSLYTYPYNDSQSAFRYTPDQIRK  479
            G ++ +R    SYK  T+ +C+IN++ T  +L++ F+S   +P        R+   Q+R 
Sbjct  9    GGASASR---LSYKSVTVAVCAINLLATALLLRNYFSS---WPR--IAGGHRFDSAQLRY  60

Query  480  MEESTRIRKESEPTELIKLVS---QlkkeflveekvvevPQPLKRKITDELLATLRGLDG  650
            + ES  IR+  EP +LI+ V    Q            +  Q     ++  L     G DG
Sbjct  61   IWESEEIRRAMEPVDLIRRVKEIEQEAYGEHGMSTQEDAKQTAAVDVSKRLQDLRAGNDG  120

Query  651  NANTTMQREAVESWRVAKLKEANDIIIGNPSTAT  752
            ++      +A+E WR  K++ A    I    TA+
Sbjct  121  SSQ-----KALEEWRKRKMERARQRAIEKNGTAS  149



>gb|EMT02411.1| hypothetical protein F775_43189 [Aegilops tauschii]
Length=169

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  456  YTPDQIRKMEESTRIRKESEPTELIKLVSQlkke-flveekvvevPQPLKRKITDELLAT  632
            YT +QIR++EES RIR+E+EP EL++ V +L+K     E++  E+P  LK +++ EL+  
Sbjct  95   YTEEQIRRVEESIRIRREAEPVELVQAVKKLRKVFAREEKRRKELPLELKLRVSYELVGR  154

Query  633  LRGLDGNANTTMQR  674
            L GL  N     QR
Sbjct  155  LNGLGDNGTAIQQR  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4294633319592