BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26163_g1_i1 len=773 path=[4645:0-772]

Length=773
                                                                      Score     E

ref|XP_009617055.1|  PREDICTED: monothiol glutaredoxin-S11-like         152   1e-42   
ref|XP_002268050.1|  PREDICTED: glutaredoxin-C13                        151   3e-42   Vitis vinifera
ref|XP_006389677.1|  glutaredoxin family protein                        150   3e-42   
ref|XP_009621533.1|  PREDICTED: glutaredoxin-C13-like                   150   4e-42   
ref|XP_009758128.1|  PREDICTED: glutaredoxin-C13-like                   150   5e-42   
ref|XP_009797640.1|  PREDICTED: monothiol glutaredoxin-S11-like         150   8e-42   
ref|NP_001275008.1|  glutaredoxin                                       149   1e-41   
ref|XP_006444242.1|  hypothetical protein CICLE_v10023018mg             149   2e-41   
ref|XP_011033601.1|  PREDICTED: glutaredoxin-C13                        148   4e-41   
ref|XP_011009413.1|  PREDICTED: monothiol glutaredoxin-S9-like          147   5e-41   
ref|XP_004240522.1|  PREDICTED: glutaredoxin-C13-like                   147   1e-40   
ref|XP_007050806.1|  Glutaredoxin                                       147   1e-40   
ref|XP_009378906.1|  PREDICTED: monothiol glutaredoxin-S9-like          146   2e-40   
ref|XP_003625870.1|  Glutaredoxin                                       146   2e-40   
emb|CDP03539.1|  unnamed protein product                                146   2e-40   
ref|XP_008386625.1|  PREDICTED: monothiol glutaredoxin-S11              146   3e-40   
ref|XP_004494333.1|  PREDICTED: monothiol glutaredoxin-S11-like         145   3e-40   
ref|XP_010069984.1|  PREDICTED: glutaredoxin-C13-like                   145   4e-40   
ref|XP_010243569.1|  PREDICTED: monothiol glutaredoxin-S11-like         145   5e-40   
gb|KHN03747.1|  Monothiol glutaredoxin-S9                               145   5e-40   
ref|XP_008375847.1|  PREDICTED: monothiol glutaredoxin-S9-like          144   1e-39   
gb|AFC01204.1|  glutaredoxin family protein                             144   2e-39   
gb|EYU40529.1|  hypothetical protein MIMGU_mgv1a015649mg                145   2e-39   
ref|XP_009614874.1|  PREDICTED: glutaredoxin-C13-like                   143   3e-39   
ref|XP_002320361.1|  glutaredoxin family protein                        143   3e-39   Populus trichocarpa [western balsam poplar]
gb|ADV56687.1|  glutaredoxin                                            144   4e-39   
ref|XP_011082492.1|  PREDICTED: monothiol glutaredoxin-S9-like          142   4e-39   
gb|AFK36241.1|  unknown                                                 142   5e-39   
ref|XP_009785800.1|  PREDICTED: glutaredoxin-C13-like                   142   6e-39   
ref|NP_001235478.1|  uncharacterized protein LOC100499748               142   8e-39   
gb|KEH43252.1|  monothiol glutaredoxin-S2 protein                       142   9e-39   
ref|XP_007144558.1|  hypothetical protein PHAVU_007G165900g             142   1e-38   
ref|XP_007163065.1|  hypothetical protein PHAVU_001G203200g             141   1e-38   
gb|KDP28094.1|  hypothetical protein JCGZ_13865                         141   1e-38   
ref|NP_001235876.1|  uncharacterized protein LOC100305984               141   1e-38   
gb|ABK96409.1|  unknown                                                 141   1e-38   Populus trichocarpa x Populus deltoides
gb|KEH43253.1|  monothiol glutaredoxin-S2 protein                       141   2e-38   
ref|NP_001237832.1|  uncharacterized protein LOC100527558               140   2e-38   
ref|XP_007201438.1|  hypothetical protein PRUPE_ppa013777mg             140   3e-38   
ref|XP_008234999.1|  PREDICTED: glutaredoxin-C13-like                   139   8e-38   
gb|AFK47066.1|  unknown                                                 139   2e-37   
ref|XP_010241630.1|  PREDICTED: monothiol glutaredoxin-S11-like         138   3e-37   
gb|KHN46591.1|  Glutaredoxin-C13                                        138   3e-37   
ref|XP_006359428.1|  PREDICTED: monothiol glutaredoxin-S9-like          138   3e-37   
ref|XP_010523992.1|  PREDICTED: glutaredoxin-C14-like                   137   4e-37   
ref|NP_001238158.1|  uncharacterized protein LOC100500442               137   4e-37   
ref|XP_004495992.1|  PREDICTED: monothiol glutaredoxin-S9-like          137   6e-37   
ref|XP_006359429.1|  PREDICTED: monothiol glutaredoxin-S9-like          136   2e-36   
ref|XP_010506828.1|  PREDICTED: glutaredoxin-C13-like                   135   5e-36   
ref|NP_182309.1|  glutaredoxin-C13                                      134   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295295.1|  hypothetical protein CARUB_v10024385mg             134   7e-36   
ref|XP_009142495.1|  PREDICTED: glutaredoxin-C13                        134   1e-35   
ref|XP_006397982.1|  hypothetical protein EUTSA_v10001691mg             134   1e-35   
gb|KFK37539.1|  hypothetical protein AALP_AA4G270200                    133   2e-35   
ref|XP_010545042.1|  PREDICTED: glutaredoxin-C14                        132   3e-35   
ref|XP_009138699.1|  PREDICTED: glutaredoxin-C14-like                   132   4e-35   
emb|CDY55528.1|  BnaA04g29520D                                          132   4e-35   
ref|XP_011079732.1|  PREDICTED: monothiol glutaredoxin-S9-like          132   4e-35   
ref|XP_010518505.1|  PREDICTED: glutaredoxin-C13-like                   132   4e-35   
ref|XP_006402322.1|  hypothetical protein EUTSA_v10006331mg             132   4e-35   
ref|XP_010507838.1|  PREDICTED: glutaredoxin-C13-like                   132   5e-35   
emb|CDY27469.1|  BnaC04g51100D                                          132   5e-35   
emb|CDY23990.1|  BnaC03g17010D                                          132   6e-35   
ref|XP_009132744.1|  PREDICTED: monothiol glutaredoxin-S9-like          132   6e-35   
emb|CDX95739.1|  BnaC03g26200D                                          132   6e-35   
ref|XP_010414255.1|  PREDICTED: monothiol glutaredoxin-S9-like          132   8e-35   
ref|XP_009118476.1|  PREDICTED: monothiol glutaredoxin-S11-like         131   8e-35   
ref|XP_009118202.1|  PREDICTED: glutaredoxin-C13                        132   8e-35   
emb|CDX84825.1|  BnaA03g14050D                                          131   9e-35   
gb|KFK35484.1|  hypothetical protein AALP_AA5G290300                    131   1e-34   
ref|NP_191855.1|  glutaredoxin-C14                                      131   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116964.1|  PREDICTED: glutaredoxin-C14                        131   1e-34   
ref|XP_004247457.1|  PREDICTED: glutaredoxin-C13-like                   131   2e-34   
ref|XP_006410157.1|  hypothetical protein EUTSA_v10017804mg             130   2e-34   
ref|XP_004139878.1|  PREDICTED: monothiol glutaredoxin-S9-like          130   2e-34   
ref|XP_010510342.1|  PREDICTED: monothiol glutaredoxin-S9               130   3e-34   
ref|NP_180612.1|  monothiol glutaredoxin-S9                             130   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522020.1|  PREDICTED: monothiol glutaredoxin-S9               130   4e-34   
gb|EPS63131.1|  glutaredoxin                                            129   4e-34   
ref|XP_010024634.1|  PREDICTED: monothiol glutaredoxin-S10-like         130   4e-34   
ref|XP_006296283.1|  hypothetical protein CARUB_v10025453mg             129   5e-34   
ref|XP_002881118.1|  glutaredoxin family protein                        129   5e-34   
ref|XP_010486752.1|  PREDICTED: monothiol glutaredoxin-S11              129   5e-34   
emb|CDX76678.1|  BnaC08g32640D                                          129   5e-34   
ref|XP_002889620.1|  glutaredoxin family protein                        129   5e-34   
ref|XP_006304582.1|  hypothetical protein CARUB_v10011626mg             129   5e-34   
ref|XP_004309711.1|  PREDICTED: glutaredoxin-C13-like                   129   6e-34   
emb|CDY10229.1|  BnaC05g04720D                                          129   7e-34   
emb|CDY54881.1|  BnaA10g27940D                                          129   8e-34   
ref|XP_009141071.1|  PREDICTED: monothiol glutaredoxin-S9               129   9e-34   
ref|XP_010486713.1|  PREDICTED: monothiol glutaredoxin-S11-like         129   1e-33   
ref|XP_004136055.1|  PREDICTED: monothiol glutaredoxin-S11-like         128   1e-33   
ref|NP_172168.1|  monothiol glutaredoxin-S11                            128   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119027.1|  PREDICTED: monothiol glutaredoxin-S11              127   3e-33   
ref|XP_010666490.1|  PREDICTED: monothiol glutaredoxin-S9-like          127   3e-33   
emb|CDY52638.1|  BnaCnng23060D                                          127   4e-33   
ref|XP_010557174.1|  PREDICTED: monothiol glutaredoxin-S9-like          127   4e-33   
gb|KFK42997.1|  hypothetical protein AALP_AA1G066100                    127   5e-33   
ref|XP_009144292.1|  PREDICTED: monothiol glutaredoxin-S9-like          126   1e-32   
ref|XP_002876697.1|  glutaredoxin family protein                        126   1e-32   
ref|XP_006417875.1|  hypothetical protein EUTSA_v10009180mg             125   1e-32   
emb|CAH59431.1|  glutaredoxin 1                                         125   2e-32   Plantago major [cart-track plant]
ref|XP_009104404.1|  PREDICTED: glutaredoxin-C14-like                   125   2e-32   
emb|CDX97824.1|  BnaC04g41150D                                          125   2e-32   
ref|XP_010038171.1|  PREDICTED: glutaredoxin-C13-like                   125   2e-32   
emb|CAJ38362.1|  glutaredoxin                                           123   2e-31   Plantago major [cart-track plant]
ref|XP_002516882.1|  glutaredoxin, grx, putative                        120   2e-30   Ricinus communis
ref|XP_006342768.1|  PREDICTED: monothiol glutaredoxin-S10-like         119   3e-30   
ref|XP_009382560.1|  PREDICTED: glutaredoxin-C1-like                    119   3e-30   
ref|XP_011016037.1|  PREDICTED: monothiol glutaredoxin-S10              119   3e-30   
ref|XP_010098329.1|  Monothiol glutaredoxin-S10                         119   3e-30   
ref|XP_008674047.1|  PREDICTED: glutaredoxin-C1                         119   5e-30   
ref|XP_006380203.1|  hypothetical protein POPTR_0008s22890g             119   6e-30   
ref|XP_010036905.1|  PREDICTED: monothiol glutaredoxin-S10-like         119   7e-30   
ref|XP_007035504.1|  Glutaredoxin family protein                        119   7e-30   
tpg|DAA43403.1|  TPA: hypothetical protein ZEAMMB73_785146              118   9e-30   
gb|AFK39077.1|  unknown                                                 118   9e-30   
ref|XP_006419643.1|  hypothetical protein CICLE_v10006590mg             118   1e-29   
ref|XP_004229212.1|  PREDICTED: monothiol glutaredoxin-S10              117   2e-29   
ref|XP_010649773.1|  PREDICTED: monothiol glutaredoxin-S10              117   2e-29   
gb|KDP40012.1|  hypothetical protein JCGZ_02010                         117   3e-29   
ref|XP_003593970.1|  Monothiol glutaredoxin-S2                          117   3e-29   
ref|XP_009607405.1|  PREDICTED: monothiol glutaredoxin-S10              117   3e-29   
ref|XP_002455626.1|  hypothetical protein SORBIDRAFT_03g014800          117   3e-29   Sorghum bicolor [broomcorn]
ref|XP_011071467.1|  PREDICTED: monothiol glutaredoxin-S10-like         117   3e-29   
ref|XP_010241641.1|  PREDICTED: monothiol glutaredoxin-S10-like         117   3e-29   
ref|XP_008390723.1|  PREDICTED: monothiol glutaredoxin-S10              117   4e-29   
ref|XP_007225971.1|  hypothetical protein PRUPE_ppa013805mg             117   4e-29   
gb|ACJ83991.1|  unknown                                                 116   5e-29   Medicago truncatula
ref|XP_007138394.1|  hypothetical protein PHAVU_009G205000g             116   5e-29   
ref|XP_007226534.1|  hypothetical protein PRUPE_ppa025150mg             116   6e-29   
gb|EYU45572.1|  hypothetical protein MIMGU_mgv1a023883mg                116   6e-29   
emb|CDO98900.1|  unnamed protein product                                116   7e-29   
ref|XP_008353233.1|  PREDICTED: monothiol glutaredoxin-S10-like         116   7e-29   
ref|XP_004486045.1|  PREDICTED: monothiol glutaredoxin-S2-like          116   8e-29   
ref|XP_008223118.1|  PREDICTED: monothiol glutaredoxin-S2               116   8e-29   
ref|XP_003546092.1|  PREDICTED: monothiol glutaredoxin-S2-like          115   9e-29   
ref|XP_004494334.1|  PREDICTED: glutaredoxin-C11-like                   115   1e-28   
ref|XP_010243570.1|  PREDICTED: glutaredoxin-C11-like                   115   1e-28   
ref|NP_001043047.1|  Os01g0368900                                       115   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008353232.1|  PREDICTED: monothiol glutaredoxin-S2-like          115   2e-28   
ref|XP_004968750.1|  PREDICTED: glutaredoxin-C1-like                    115   2e-28   
ref|XP_008651112.1|  PREDICTED: glutaredoxin-C1-like                    117   2e-28   
ref|XP_009369121.1|  PREDICTED: monothiol glutaredoxin-S2-like          114   2e-28   
ref|XP_004296803.1|  PREDICTED: monothiol glutaredoxin-S10-like         114   2e-28   
ref|XP_008390722.1|  PREDICTED: monothiol glutaredoxin-S2               114   4e-28   
ref|XP_004486046.1|  PREDICTED: monothiol glutaredoxin-S10-like         114   4e-28   
ref|XP_009369117.1|  PREDICTED: monothiol glutaredoxin-S10-like         114   5e-28   
ref|XP_003529587.1|  PREDICTED: monothiol glutaredoxin-S10-like         114   5e-28   
ref|XP_008796225.1|  PREDICTED: glutaredoxin-C1-like                    114   6e-28   
ref|XP_011071468.1|  PREDICTED: monothiol glutaredoxin-S10-like         113   7e-28   
ref|XP_010243566.1|  PREDICTED: monothiol glutaredoxin-S2-like          113   8e-28   
ref|XP_003567688.1|  PREDICTED: glutaredoxin-C1                         113   8e-28   
ref|XP_009411702.1|  PREDICTED: glutaredoxin-C1-like                    113   1e-27   
ref|XP_004296804.1|  PREDICTED: monothiol glutaredoxin-S2-like          113   1e-27   
ref|XP_008802104.1|  PREDICTED: glutaredoxin-C1-like                    112   1e-27   
ref|XP_011033600.1|  PREDICTED: glutaredoxin-C11                        112   1e-27   
ref|XP_004296808.1|  PREDICTED: monothiol glutaredoxin-S2-like          112   1e-27   
ref|XP_003593973.1|  Monothiol glutaredoxin-S4                          112   2e-27   
gb|AFK43054.1|  unknown                                                 112   2e-27   
ref|XP_007147879.1|  hypothetical protein PHAVU_006G162600g             114   2e-27   
ref|XP_006594493.1|  PREDICTED: monothiol glutaredoxin-S10-like         112   2e-27   
emb|CDO98899.1|  unnamed protein product                                112   2e-27   
ref|XP_006406267.1|  hypothetical protein EUTSA_v10021819mg             112   2e-27   
ref|XP_004296805.1|  PREDICTED: monothiol glutaredoxin-S2-like          112   2e-27   
ref|XP_003546093.1|  PREDICTED: monothiol glutaredoxin-S10-like         112   2e-27   
ref|XP_010243568.1|  PREDICTED: monothiol glutaredoxin-S10-like         112   2e-27   
gb|KFK39456.1|  hypothetical protein AALP_AA3G247200                    112   2e-27   
ref|XP_009352227.1|  PREDICTED: monothiol glutaredoxin-S2               112   2e-27   
gb|KHN47302.1|  Monothiol glutaredoxin-S4                               112   3e-27   
ref|XP_004968749.1|  PREDICTED: glutaredoxin-C1-like                    112   3e-27   
ref|XP_007035505.1|  Thioredoxin superfamily protein                    112   3e-27   
ref|XP_010904788.1|  PREDICTED: glutaredoxin-C1-like                    112   3e-27   
ref|XP_002885441.1|  electron carrier/ protein disulfide oxidored...    112   3e-27   
ref|XP_007154237.1|  hypothetical protein PHAVU_003G101900g             111   3e-27   
ref|XP_006299130.1|  hypothetical protein CARUB_v10015272mg             111   3e-27   
dbj|BAJ89491.1|  predicted protein                                      111   4e-27   
ref|XP_010241681.1|  PREDICTED: monothiol glutaredoxin-S2-like          111   4e-27   
gb|KFK39447.1|  hypothetical protein AALP_AA3G246300                    111   4e-27   
ref|XP_009135750.1|  PREDICTED: monothiol glutaredoxin-S10              111   5e-27   
ref|NP_001078198.1|  monothiol glutaredoxin-S10                         111   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EMT12568.1|  Glutaredoxin-C1                                         111   5e-27   
gb|ABK28101.1|  unknown                                                 111   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006594494.1|  PREDICTED: monothiol glutaredoxin-S2-like          112   6e-27   
ref|XP_004296807.1|  PREDICTED: monothiol glutaredoxin-S2-like          110   7e-27   
ref|XP_006644173.1|  PREDICTED: glutaredoxin-C1-like                    110   8e-27   
ref|XP_010524509.1|  PREDICTED: monothiol glutaredoxin-S4               110   8e-27   
ref|XP_004296806.1|  PREDICTED: monothiol glutaredoxin-S2-like          110   9e-27   
ref|XP_006406268.1|  hypothetical protein EUTSA_v10021818mg             110   9e-27   
ref|XP_010098332.1|  Monothiol glutaredoxin-S2                          110   1e-26   
ref|XP_010466387.1|  PREDICTED: monothiol glutaredoxin-S10-like         110   1e-26   
ref|XP_007147880.1|  hypothetical protein PHAVU_006G162700g             110   1e-26   
ref|XP_010243565.1|  PREDICTED: monothiol glutaredoxin-S2               110   1e-26   
ref|XP_002275384.1|  PREDICTED: monothiol glutaredoxin-S2               110   1e-26   Vitis vinifera
ref|XP_007050807.1|  Thioredoxin superfamily protein                    110   2e-26   
ref|XP_002320360.1|  glutaredoxin family protein                        110   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_002455625.1|  hypothetical protein SORBIDRAFT_03g014790          110   2e-26   Sorghum bicolor [broomcorn]
emb|CDY32430.1|  BnaC03g42140D                                          109   2e-26   
ref|XP_006419644.1|  hypothetical protein CICLE_v10006286mg             109   2e-26   
ref|XP_009135749.1|  PREDICTED: monothiol glutaredoxin-S10-like         109   3e-26   
ref|XP_002873906.1|  glutaredoxin family protein                        109   3e-26   
gb|KDP28095.1|  hypothetical protein JCGZ_13866                         108   4e-26   
gb|EYU43910.1|  hypothetical protein MIMGU_mgv1a020927mg                108   5e-26   
ref|XP_004296809.1|  PREDICTED: monothiol glutaredoxin-S2-like          108   6e-26   
gb|EMT12569.1|  Glutaredoxin-C1                                         108   7e-26   
gb|EYU34223.1|  hypothetical protein MIMGU_mgv1a023043mg                108   7e-26   
emb|CDP03538.1|  unnamed protein product                                108   7e-26   
ref|XP_004495991.1|  PREDICTED: glutaredoxin-C11-like                   108   8e-26   
ref|XP_004309686.1|  PREDICTED: glutaredoxin-C11-like                   108   8e-26   
gb|KFK22959.1|  hypothetical protein AALP_AAs50914U000200               108   9e-26   
ref|XP_009419009.1|  PREDICTED: putative glutaredoxin-C14               108   9e-26   
ref|XP_006284819.1|  hypothetical protein CARUB_v10006098mg             107   1e-25   
ref|XP_009109577.1|  PREDICTED: monothiol glutaredoxin-S10-like         107   1e-25   
ref|XP_008804595.1|  PREDICTED: glutaredoxin-C1                         110   1e-25   
ref|XP_009414476.1|  PREDICTED: putative glutaredoxin-C14               107   1e-25   
ref|XP_006389678.1|  glutaredoxin family protein                        107   1e-25   
ref|XP_003521537.1|  PREDICTED: glutaredoxin-C11-like                   107   1e-25   
gb|ACJ85884.1|  unknown                                                 107   1e-25   Medicago truncatula
ref|XP_011071466.1|  PREDICTED: monothiol glutaredoxin-S5-like          107   1e-25   
ref|XP_008799330.1|  PREDICTED: glutaredoxin-C1-like                    107   2e-25   
ref|XP_009383750.1|  PREDICTED: putative glutaredoxin-C14               107   2e-25   
ref|XP_006342767.1|  PREDICTED: monothiol glutaredoxin-S3-like          107   2e-25   
ref|XP_007154238.1|  hypothetical protein PHAVU_003G102000g             107   2e-25   
ref|XP_008791106.1|  PREDICTED: glutaredoxin-C1-like                    107   2e-25   
ref|NP_001275534.1|  monothiol glutaredoxin-S10-like                    107   2e-25   
ref|XP_002315567.1|  glutaredoxin family protein                        107   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_003577277.1|  PREDICTED: glutaredoxin-C10                        107   2e-25   
ref|XP_009629061.1|  PREDICTED: monothiol glutaredoxin-S2               107   2e-25   
gb|KDP40011.1|  hypothetical protein JCGZ_02009                         107   2e-25   
ref|XP_011009412.1|  PREDICTED: glutaredoxin-C11-like                   107   2e-25   
ref|XP_011090919.1|  PREDICTED: monothiol glutaredoxin-S4-like          107   2e-25   
ref|XP_002520675.1|  glutaredoxin, grx, putative                        107   2e-25   Ricinus communis
ref|XP_006444243.1|  hypothetical protein CICLE_v10023999mg             107   2e-25   
ref|XP_006584039.1|  PREDICTED: monothiol glutaredoxin-S2-like          107   2e-25   
ref|XP_006284820.1|  hypothetical protein CARUB_v10006099mg             107   3e-25   
ref|XP_007163066.1|  hypothetical protein PHAVU_001G203300g             107   3e-25   
ref|XP_004247456.1|  PREDICTED: glutaredoxin-C11                        106   3e-25   
gb|AAS47604.1|  At4g15670                                               107   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EMS62879.1|  Glutaredoxin-C1                                         106   3e-25   
ref|XP_009399249.1|  PREDICTED: glutaredoxin-C1-like                    106   4e-25   
ref|XP_003550174.1|  PREDICTED: monothiol glutaredoxin-S2-like          106   4e-25   
ref|XP_006380199.1|  glutaredoxin family protein                        106   4e-25   
emb|CDY13904.1|  BnaC09g39220D                                          106   4e-25   
ref|XP_006284821.1|  hypothetical protein CARUB_v10006100mg             106   4e-25   
ref|XP_010434937.1|  PREDICTED: monothiol glutaredoxin-S7               106   4e-25   
ref|XP_004229211.1|  PREDICTED: monothiol glutaredoxin-S3               106   5e-25   
ref|XP_004134195.1|  PREDICTED: monothiol glutaredoxin-S2-like          105   5e-25   
ref|XP_002863057.1|  glutaredoxin family protein                        105   6e-25   
ref|NP_193302.1|  monothiol glutaredoxin-S7                             105   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378908.1|  PREDICTED: glutaredoxin-C11-like                   105   6e-25   
gb|KFK24503.1|  hypothetical protein AALP_AAs55560U000300               105   6e-25   
ref|XP_004304538.1|  PREDICTED: glutaredoxin-C7-like                    106   6e-25   
ref|XP_010449913.1|  PREDICTED: monothiol glutaredoxin-S7-like          105   6e-25   
ref|NP_193303.1|  monothiol glutaredoxin-S4                             105   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EMT12570.1|  Glutaredoxin-C1                                         105   7e-25   
gb|EPS63130.1|  hypothetical protein M569_11657                         105   7e-25   
ref|XP_010434935.1|  PREDICTED: monothiol glutaredoxin-S7-like          105   7e-25   
ref|XP_006414472.1|  hypothetical protein EUTSA_v10027374mg             105   7e-25   
ref|XP_010434933.1|  PREDICTED: monothiol glutaredoxin-S5-like          105   7e-25   
ref|XP_008779419.1|  PREDICTED: glutaredoxin-C1-like                    106   7e-25   
ref|XP_010434934.1|  PREDICTED: monothiol glutaredoxin-S4               105   8e-25   
ref|XP_008775588.1|  PREDICTED: glutaredoxin-C1-like                    106   8e-25   
ref|XP_002870221.1|  glutaredoxin family protein                        105   8e-25   
ref|XP_011082491.1|  PREDICTED: glutaredoxin-C11-like                   105   9e-25   
gb|EYU43911.1|  hypothetical protein MIMGU_mgv1a016894mg                105   9e-25   
ref|XP_008386623.1|  PREDICTED: glutaredoxin-C11-like                   105   1e-24   
gb|EMT22951.1|  Glutaredoxin-C1                                         105   1e-24   
ref|XP_002267962.1|  PREDICTED: glutaredoxin-C11                        105   1e-24   Vitis vinifera
ref|XP_002870222.1|  glutaredoxin family protein                        105   1e-24   
ref|XP_008386624.1|  PREDICTED: glutaredoxin-C11-like                   105   1e-24   
ref|XP_007201440.1|  hypothetical protein PRUPE_ppa013797mg             105   1e-24   
ref|XP_011005540.1|  PREDICTED: monothiol glutaredoxin-S2-like          105   1e-24   
ref|XP_010449912.1|  PREDICTED: monothiol glutaredoxin-S7-like          105   1e-24   
ref|NP_182308.1|  putative glutaredoxin-C12                             105   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458480.1|  PREDICTED: monothiol glutaredoxin-S10              105   1e-24   
ref|XP_008674046.1|  PREDICTED: glutaredoxin-C1-like                    105   1e-24   
gb|KHN33129.1|  Monothiol glutaredoxin-S4                               104   1e-24   
ref|XP_008375845.1|  PREDICTED: glutaredoxin-C11-like                   105   1e-24   
ref|XP_009146837.1|  PREDICTED: monothiol glutaredoxin-S4-like          105   1e-24   
ref|NP_001238068.1|  uncharacterized protein LOC100305876               105   1e-24   
ref|XP_010024635.1|  PREDICTED: monothiol glutaredoxin-S2-like          105   1e-24   
ref|XP_006380202.1|  hypothetical protein POPTR_0008s22870g             104   1e-24   
ref|NP_001274383.1|  monothiol glutaredoxin-S2-like                     104   1e-24   
ref|XP_010666488.1|  PREDICTED: glutaredoxin-C11-like                   104   1e-24   
ref|XP_009384168.1|  PREDICTED: putative glutaredoxin-C14               104   2e-24   
emb|CDX70828.1|  BnaC03g09120D                                          104   2e-24   
ref|XP_009146815.1|  PREDICTED: monothiol glutaredoxin-S4               104   2e-24   
ref|XP_006414476.1|  hypothetical protein EUTSA_v10026878mg             104   2e-24   
gb|EMS62279.1|  Glutaredoxin-C1                                         104   2e-24   
ref|XP_009759599.1|  PREDICTED: monothiol glutaredoxin-S2-like          104   2e-24   
ref|XP_010440264.1|  PREDICTED: monothiol glutaredoxin-S4-like          104   2e-24   
ref|XP_010454112.1|  PREDICTED: monothiol glutaredoxin-S2-like          104   2e-24   
ref|XP_006575104.1|  PREDICTED: glutaredoxin-C11-like                   104   2e-24   
ref|XP_006844586.1|  hypothetical protein AMTR_s00016p00206670          104   2e-24   
ref|XP_002870217.1|  glutaredoxin family protein                        104   2e-24   
ref|NP_193301.1|  monothiol glutaredoxin-S8                             104   2e-24   
gb|KFK26098.1|  hypothetical protein AALP_AA8G202600                    104   2e-24   
ref|XP_010241661.1|  PREDICTED: monothiol glutaredoxin-S2-like          104   2e-24   
ref|XP_004508301.1|  PREDICTED: monothiol glutaredoxin-S2-like          104   2e-24   
ref|XP_002516883.1|  glutaredoxin, grx, putative                        103   3e-24   
ref|XP_009131678.1|  PREDICTED: monothiol glutaredoxin-S2               103   3e-24   
ref|XP_010545041.1|  PREDICTED: glutaredoxin-C11                        103   3e-24   
ref|XP_009120959.1|  PREDICTED: monothiol glutaredoxin-S2               103   3e-24   
ref|XP_010558476.1|  PREDICTED: monothiol glutaredoxin-S2               103   3e-24   
ref|XP_010272731.1|  PREDICTED: monothiol glutaredoxin-S2-like          103   3e-24   
emb|CDY54296.1|  BnaC01g41950D                                          103   3e-24   
ref|XP_009146804.1|  PREDICTED: monothiol glutaredoxin-S4-like          103   3e-24   
ref|XP_011013421.1|  PREDICTED: monothiol glutaredoxin-S2-like          103   3e-24   
gb|KHN46590.1|  Glutaredoxin-C11                                        103   4e-24   
ref|XP_006286199.1|  hypothetical protein CARUB_v10007765mg             103   4e-24   
ref|XP_004160199.1|  PREDICTED: LOW QUALITY PROTEIN: monothiol gl...    103   4e-24   
gb|KFK43354.1|  hypothetical protein AALP_AA1G115200                    103   4e-24   
ref|XP_008375846.1|  PREDICTED: glutaredoxin-C11-like                   103   4e-24   
gb|EMT22949.1|  Glutaredoxin-C1                                         103   4e-24   
ref|XP_006400409.1|  hypothetical protein EUTSA_v10015538mg             103   4e-24   
gb|AGX01496.1|  glutaredoxin                                            103   4e-24   
ref|XP_006346725.1|  PREDICTED: monothiol glutaredoxin-S2-like          103   4e-24   
ref|NP_197361.1|  monothiol glutaredoxin-S2                             103   4e-24   
ref|XP_006663084.1|  PREDICTED: glutaredoxin-C10-like                   103   4e-24   
ref|XP_006359427.1|  PREDICTED: glutaredoxin-C11-like                   103   4e-24   
ref|XP_004236715.1|  PREDICTED: monothiol glutaredoxin-S1-like          103   5e-24   
ref|XP_004136054.1|  PREDICTED: glutaredoxin-C11-like                   103   5e-24   
gb|KFK24502.1|  hypothetical protein AALP_AAs55560U000200               103   5e-24   
dbj|BAJ86342.1|  predicted protein                                      103   5e-24   
gb|EPS64180.1|  hypothetical protein M569_10600                         103   5e-24   
ref|XP_004150812.1|  PREDICTED: monothiol glutaredoxin-S10-like         103   6e-24   
ref|XP_008670904.1|  PREDICTED: putative glutaredoxin-C14               103   6e-24   
ref|XP_011079731.1|  PREDICTED: glutaredoxin-C11                        103   6e-24   
ref|XP_007144557.1|  hypothetical protein PHAVU_007G165800g             104   6e-24   
ref|XP_004171791.1|  PREDICTED: glutaredoxin-C1-like                    103   7e-24   
emb|CDY54294.1|  BnaC01g41930D                                          103   7e-24   
ref|XP_004138799.1|  PREDICTED: glutaredoxin-C1-like                    103   7e-24   
emb|CDY02610.1|  BnaC02g08250D                                          102   7e-24   
ref|XP_010038172.1|  PREDICTED: glutaredoxin-C11-like                   102   7e-24   
gb|AHM25912.1|  glutaredoxin 2                                          103   7e-24   
ref|XP_009136708.1|  PREDICTED: monothiol glutaredoxin-S4-like          102   7e-24   
ref|XP_008799336.1|  PREDICTED: glutaredoxin-C1-like                    103   8e-24   
gb|EYU45573.1|  hypothetical protein MIMGU_mgv1a019538mg                102   8e-24   
ref|XP_004962841.1|  PREDICTED: putative glutaredoxin-C14-like          102   9e-24   
ref|XP_010420636.1|  PREDICTED: monothiol glutaredoxin-S2               102   9e-24   
ref|XP_006288956.1|  hypothetical protein CARUB_v10002321mg             102   9e-24   
ref|XP_008450140.1|  PREDICTED: glutaredoxin-C1-like                    103   9e-24   
ref|XP_004148005.1|  PREDICTED: glutaredoxin-C1-like                    103   1e-23   
ref|NP_193305.1|  monothiol glutaredoxin-S3                             102   1e-23   
ref|XP_010112749.1|  hypothetical protein L484_020479                   102   1e-23   
ref|XP_006830226.1|  hypothetical protein AMTR_s00130p00050470          102   1e-23   
gb|KFK43355.1|  hypothetical protein AALP_AA1G115300                    102   1e-23   
emb|CDM85466.1|  unnamed protein product                                102   1e-23   
ref|XP_010449907.1|  PREDICTED: monothiol glutaredoxin-S5-like          102   1e-23   
ref|XP_007139286.1|  hypothetical protein PHAVU_008G016400g             103   1e-23   
emb|CDP12908.1|  unnamed protein product                                102   1e-23   
ref|XP_006414471.1|  hypothetical protein EUTSA_v10026652mg             102   1e-23   
ref|XP_010492876.1|  PREDICTED: monothiol glutaredoxin-S2-like          102   1e-23   
ref|XP_010434931.1|  PREDICTED: monothiol glutaredoxin-S3               102   1e-23   
ref|XP_006346723.1|  PREDICTED: monothiol glutaredoxin-S1-like          102   1e-23   
ref|XP_006284824.1|  hypothetical protein CARUB_v10006103mg             102   2e-23   
ref|XP_006356697.1|  PREDICTED: monothiol glutaredoxin-S3-like          102   2e-23   
ref|XP_008441305.1|  PREDICTED: glutaredoxin-C1-like                    102   2e-23   
ref|XP_010249120.1|  PREDICTED: glutaredoxin-C1-like                    102   2e-23   
ref|XP_010666489.1|  PREDICTED: glutaredoxin-C11-like                   102   2e-23   
gb|AFK45164.1|  unknown                                                 102   2e-23   
gb|EMS46251.1|  Putative glutaredoxin-C14                               102   2e-23   
ref|XP_004236714.1|  PREDICTED: monothiol glutaredoxin-S1-like          101   2e-23   
ref|XP_010440263.1|  PREDICTED: monothiol glutaredoxin-S3-like          101   2e-23   
ref|XP_007043882.1|  Thioredoxin superfamily protein                    102   2e-23   
ref|XP_008674577.1|  PREDICTED: putative glutaredoxin-C2                102   2e-23   
ref|XP_002870219.1|  glutaredoxin family protein                        101   3e-23   
ref|XP_003575739.1|  PREDICTED: putative glutaredoxin-C14               101   3e-23   
ref|XP_009615101.1|  PREDICTED: glutaredoxin-C11-like                   101   3e-23   
ref|XP_009378907.1|  PREDICTED: glutaredoxin-C11-like                   101   3e-23   
ref|XP_006664080.1|  PREDICTED: putative glutaredoxin-C14-like          101   3e-23   
ref|XP_004236721.1|  PREDICTED: monothiol glutaredoxin-S1-like          101   3e-23   
ref|XP_010445383.1|  PREDICTED: monothiol glutaredoxin-S7-like          101   3e-23   
gb|KCW61086.1|  hypothetical protein EUGRSUZ_H03860                     103   3e-23   
ref|XP_006402323.1|  hypothetical protein EUTSA_v10006329mg             101   3e-23   
ref|XP_009126270.1|  PREDICTED: monothiol glutaredoxin-S2-like          101   3e-23   
ref|XP_004310231.1|  PREDICTED: glutaredoxin-C1-like                    102   3e-23   
ref|XP_009762083.1|  PREDICTED: glutaredoxin-C11-like                   101   3e-23   
gb|KDP41803.1|  hypothetical protein JCGZ_26821                         102   3e-23   
ref|XP_009612544.1|  PREDICTED: monothiol glutaredoxin-S1-like          101   3e-23   
ref|XP_009779593.1|  PREDICTED: monothiol glutaredoxin-S1-like          101   3e-23   
gb|EPS64181.1|  glutaredoxin                                            101   3e-23   
gb|EPS67459.1|  hypothetical protein M569_07317                         101   3e-23   
ref|XP_009336451.1|  PREDICTED: glutaredoxin-C1-like                    102   3e-23   
gb|EMT19730.1|  Putative glutaredoxin-C14                               101   3e-23   
ref|XP_006346724.1|  PREDICTED: monothiol glutaredoxin-S2-like          101   4e-23   
ref|XP_006284817.1|  hypothetical protein CARUB_v10006105mg             101   4e-23   
ref|XP_009146825.1|  PREDICTED: monothiol glutaredoxin-S4-like          100   4e-23   
ref|XP_006346726.1|  PREDICTED: monothiol glutaredoxin-S2-like          100   4e-23   
ref|XP_007031936.1|  Thioredoxin superfamily protein                    101   4e-23   
ref|XP_007216287.1|  hypothetical protein PRUPE_ppa020474mg             101   4e-23   
ref|XP_006855454.1|  hypothetical protein AMTR_s00057p00176460          100   4e-23   
ref|XP_010273480.1|  PREDICTED: monothiol glutaredoxin-S2-like          100   4e-23   
emb|CAN67225.1|  hypothetical protein VITISV_043905                     100   4e-23   
ref|XP_004962842.1|  PREDICTED: putative glutaredoxin-C14-like          100   4e-23   
ref|XP_008389917.1|  PREDICTED: glutaredoxin-C1-like                    101   4e-23   
ref|XP_004236717.1|  PREDICTED: monothiol glutaredoxin-S1-like          100   4e-23   
ref|NP_193304.1|  monothiol glutaredoxin-S5                             100   5e-23   
ref|XP_002456905.1|  hypothetical protein SORBIDRAFT_03g045210          100   5e-23   
ref|XP_006284827.1|  hypothetical protein CARUB_v10006107mg             100   5e-23   
emb|CDY68328.1|  BnaAnng26900D                                          100   5e-23   
ref|XP_009346791.1|  PREDICTED: glutaredoxin-C1                         101   6e-23   
ref|XP_010449909.1|  PREDICTED: monothiol glutaredoxin-S3-like          100   6e-23   
ref|XP_004239526.1|  PREDICTED: glutaredoxin-C1                         101   6e-23   
ref|NP_001066942.2|  Os12g0538600                                       100   6e-23   
ref|XP_009138702.1|  PREDICTED: glutaredoxin-C11                        100   7e-23   
ref|XP_010434932.1|  PREDICTED: monothiol glutaredoxin-S3-like          100   7e-23   
ref|XP_002870218.1|  glutaredoxin family protein                        100   7e-23   
ref|XP_003575732.1|  PREDICTED: putative glutaredoxin-C14               100   7e-23   
ref|XP_008341254.1|  PREDICTED: glutaredoxin-C5-like                    100   8e-23   
ref|XP_003625872.1|  Glutaredoxin                                       100   8e-23   
ref|XP_006363784.1|  PREDICTED: glutaredoxin-C5-like                    100   8e-23   
gb|EMT00625.1|  hypothetical protein F775_42757                         100   8e-23   
ref|XP_010904787.1|  PREDICTED: putative glutaredoxin-C14               100   8e-23   
ref|XP_006363780.1|  PREDICTED: glutaredoxin-C5-like                    100   8e-23   
ref|XP_010449908.1|  PREDICTED: monothiol glutaredoxin-S3-like          100   9e-23   
gb|KFK35470.1|  hypothetical protein AALP_AA5G288300                    100   9e-23   
ref|XP_009624458.1|  PREDICTED: monothiol glutaredoxin-S6-like          100   9e-23   
ref|NP_191854.1|  glutaredoxin-C11                                      100   9e-23   
ref|XP_010250605.1|  PREDICTED: glutaredoxin-C1-like                    100   9e-23   
emb|CDY53023.1|  BnaC04g00070D                                          100   1e-22   
ref|XP_009381963.1|  PREDICTED: putative glutaredoxin-C14               100   1e-22   
ref|XP_008222218.1|  PREDICTED: glutaredoxin-C1-like                    100   1e-22   
ref|XP_008347995.1|  PREDICTED: glutaredoxin-C5-like                    100   1e-22   
ref|XP_007227610.1|  hypothetical protein PRUPE_ppa021177mg             100   1e-22   
ref|XP_002300130.1|  glutaredoxin family protein                        100   1e-22   
ref|XP_009800086.1|  PREDICTED: monothiol glutaredoxin-S1-like        99.8    1e-22   
ref|XP_002272852.1|  PREDICTED: glutaredoxin-C1                         100   1e-22   
ref|XP_009773169.1|  PREDICTED: monothiol glutaredoxin-S1-like        99.8    1e-22   
gb|KHN27195.1|  Glutaredoxin-C1                                         100   1e-22   
ref|XP_004236716.1|  PREDICTED: monothiol glutaredoxin-S1-like        99.8    1e-22   
ref|XP_009631350.1|  PREDICTED: monothiol glutaredoxin-S3-like        99.8    1e-22   
ref|XP_004236719.1|  PREDICTED: monothiol glutaredoxin-S1-like        99.8    1e-22   
emb|CDY25124.1|  BnaC06g18660D                                        99.8    1e-22   
ref|XP_011086843.1|  PREDICTED: glutaredoxin-C5-like                    100   1e-22   
ref|XP_004228854.1|  PREDICTED: glutaredoxin-C1-like                    100   1e-22   
ref|XP_004236718.1|  PREDICTED: monothiol glutaredoxin-S1-like        99.8    1e-22   
ref|XP_009116963.1|  PREDICTED: glutaredoxin-C11-like                 99.8    1e-22   
gb|EPS67026.1|  hypothetical protein M569_07752                       99.8    1e-22   
ref|NP_001066943.1|  Os12g0538700                                     99.8    1e-22   
gb|KDO63867.1|  hypothetical protein CISIN_1g033109mg                   100   1e-22   
ref|XP_002264542.2|  PREDICTED: glutaredoxin-C1-like                    100   1e-22   
gb|KCW61087.1|  hypothetical protein EUGRSUZ_H03861                   99.8    2e-22   
ref|XP_010548927.1|  PREDICTED: monothiol glutaredoxin-S5-like        99.4    2e-22   
ref|XP_006284826.1|  hypothetical protein CARUB_v10006106mg           99.4    2e-22   
ref|XP_006447012.1|  hypothetical protein CICLE_v10017534mg             100   2e-22   
ref|XP_010931999.1|  PREDICTED: glutaredoxin-C1                       99.4    2e-22   
ref|XP_009773168.1|  PREDICTED: monothiol glutaredoxin-S2-like        99.4    2e-22   
ref|XP_003548512.1|  PREDICTED: glutaredoxin-C5-like                    100   2e-22   
ref|XP_009605617.1|  PREDICTED: monothiol glutaredoxin-S2-like        99.4    2e-22   
ref|XP_004236720.1|  PREDICTED: monothiol glutaredoxin-S1-like        99.4    2e-22   
ref|XP_004241071.1|  PREDICTED: monothiol glutaredoxin-S4-like        99.0    2e-22   
ref|XP_006574874.1|  PREDICTED: glutaredoxin-C3-like                    100   2e-22   
ref|XP_009107850.1|  PREDICTED: monothiol glutaredoxin-S4-like        99.0    2e-22   
gb|EAY81715.1|  hypothetical protein OsI_36889                        99.4    2e-22   
gb|EAY83390.1|  hypothetical protein OsI_38605                        99.0    2e-22   
gb|EYU43914.1|  hypothetical protein MIMGU_mgv1a016876mg              99.0    2e-22   
gb|KFK24501.1|  hypothetical protein AALP_AAs55560U000100             98.6    2e-22   
ref|XP_011045755.1|  PREDICTED: glutaredoxin-C1                       99.4    2e-22   
emb|CDM86171.1|  unnamed protein product                              99.0    3e-22   
ref|XP_008662619.1|  PREDICTED: glutaredoxin-C15-like                 99.0    3e-22   
gb|KFK24504.1|  hypothetical protein AALP_AAs55560U000400             98.6    3e-22   
ref|XP_003625871.1|  Glutaredoxin                                     99.0    3e-22   
ref|XP_010024636.1|  PREDICTED: monothiol glutaredoxin-S4-like        99.0    3e-22   
gb|EYU43913.1|  hypothetical protein MIMGU_mgv1a026737mg              98.6    3e-22   
ref|XP_010468903.1|  PREDICTED: glutaredoxin-C11-like                 98.6    3e-22   
ref|XP_007161691.1|  hypothetical protein PHAVU_001G090300g           99.4    3e-22   
ref|XP_009386287.1|  PREDICTED: glutaredoxin-C1-like                  98.6    3e-22   
ref|XP_009761795.1|  PREDICTED: monothiol glutaredoxin-S6-like        98.6    3e-22   
ref|XP_009592444.1|  PREDICTED: glutaredoxin-C5-like                  99.4    3e-22   
ref|XP_004140545.1|  PREDICTED: glutaredoxin-C3-like                  98.6    4e-22   
ref|XP_009408234.1|  PREDICTED: putative glutaredoxin-C14             98.2    4e-22   
ref|XP_003575736.1|  PREDICTED: putative glutaredoxin-C14             98.2    4e-22   
ref|XP_009621532.1|  PREDICTED: glutaredoxin-C11-like                 98.2    4e-22   
ref|XP_009758132.1|  PREDICTED: glutaredoxin-C11-like                 98.2    4e-22   
ref|XP_003609600.1|  Monothiol glutaredoxin-S2                        98.2    4e-22   
gb|AFK35832.1|  unknown                                               99.0    4e-22   
tpg|DAA42401.1|  TPA: hypothetical protein ZEAMMB73_785246            98.2    4e-22   
ref|XP_006359084.1|  PREDICTED: glutaredoxin-C5-like                  99.0    5e-22   
ref|XP_008665182.1|  PREDICTED: putative glutaredoxin-C14             98.2    5e-22   
ref|XP_009591194.1|  PREDICTED: monothiol glutaredoxin-S1-like        98.2    5e-22   
ref|XP_009757079.1|  PREDICTED: monothiol glutaredoxin-S1-like        97.8    5e-22   
ref|XP_009624459.1|  PREDICTED: monothiol glutaredoxin-S6-like        97.8    5e-22   
ref|XP_008459889.1|  PREDICTED: glutaredoxin-C1-like                  98.6    5e-22   
ref|XP_002442255.1|  hypothetical protein SORBIDRAFT_08g017100        98.2    5e-22   
gb|AGX01499.1|  glutaredoxin                                          98.6    6e-22   
ref|XP_002299331.2|  hypothetical protein POPTR_0001s13440g           98.6    6e-22   
ref|XP_002963851.1|  hypothetical protein SELMODRAFT_80143            97.8    6e-22   
ref|XP_009344217.1|  PREDICTED: glutaredoxin-C5-like                  98.6    6e-22   
ref|XP_004962840.1|  PREDICTED: glutaredoxin-C15-like                 97.8    6e-22   
ref|XP_009142497.1|  PREDICTED: putative glutaredoxin-C12             97.8    6e-22   
ref|NP_001068390.1|  Os11g0655900                                     97.8    6e-22   
ref|XP_003536267.1|  PREDICTED: monothiol glutaredoxin-S6-like        97.8    6e-22   
ref|XP_003553278.1|  PREDICTED: glutaredoxin-C3-like                  98.6    6e-22   
ref|XP_004962839.1|  PREDICTED: putative glutaredoxin-C14-like        97.8    6e-22   
gb|EYU46715.1|  hypothetical protein MIMGU_mgv1a020763mg              97.8    7e-22   
ref|XP_009624461.1|  PREDICTED: monothiol glutaredoxin-S1-like        97.8    7e-22   
ref|XP_009761867.1|  PREDICTED: monothiol glutaredoxin-S6-like        97.8    7e-22   
emb|CDP12910.1|  unnamed protein product                              97.8    7e-22   
ref|XP_006663086.1|  PREDICTED: glutaredoxin-C13-like                 97.8    7e-22   



>ref|XP_009617055.1| PREDICTED: monothiol glutaredoxin-S11-like [Nicotiana tomentosiformis]
Length=101

 Score =   152 bits (383),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQ-ELGVKPHVYDIDTDHQDGKDMERALAR  332
            MDKV+ LA +HGVVIFSK+TCCLCYAV+IL Q +LGV P+V++ID D  +GK+ME+AL R
Sbjct  1    MDKVRRLATEHGVVIFSKSTCCLCYAVTILFQDQLGVSPYVHEIDHD-PEGKEMEKALLR  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSS  458
            +GCN+SVPAVFIGG L+GSTNEVMSLHL GSLI +LKPYM +
Sbjct  60   MGCNASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPYMPN  101



>ref|XP_002268050.1| PREDICTED: glutaredoxin-C13 [Vitis vinifera]
Length=102

 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIFSK++CCLCYAV+IL QELGV P V++ID D  DG++ME+AL RL
Sbjct  1    MDKVTRLASEKGVVIFSKSSCCLCYAVNILFQELGVTPTVHEIDQD-PDGREMEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GCN+ VPAVFIGG L+GSTNEVMS HLSGSLI +LKPY  +++
Sbjct  60   GCNAPVPAVFIGGKLVGSTNEVMSRHLSGSLIPLLKPYQQTLS  102



>ref|XP_006389677.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP48591.1| glutaredoxin family protein [Populus trichocarpa]
Length=99

 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIFSK++CCLCYAV IL QE+GV P VY+ID D  +G++ME+AL RL
Sbjct  1    MDKVMGLASEKGVVIFSKSSCCLCYAVKILFQEIGVDPLVYEIDQD-PEGREMEKALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ VPAVFIGG L+GSTNEVMSLHLSGSLI MLKPY
Sbjct  60   GCNAPVPAVFIGGKLMGSTNEVMSLHLSGSLIPMLKPY  97



>ref|XP_009621533.1| PREDICTED: glutaredoxin-C13-like [Nicotiana tomentosiformis]
Length=100

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV+ +A++HGVVIFSK+TCCLCYAV+IL ++LGV P+V+++D D  +GKDME+AL R+
Sbjct  1    MDKVQRMASEHGVVIFSKSTCCLCYAVTILFRDLGVDPYVHELDHD-SEGKDMEKALMRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GCN+SVPAVFI G L+GSTNEVMSLHL GSLI +LKPY+
Sbjct  60   GCNASVPAVFIAGKLVGSTNEVMSLHLKGSLIQLLKPYL  98



>ref|XP_009758128.1| PREDICTED: glutaredoxin-C13-like [Nicotiana sylvestris]
Length=100

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV+ +A+++GVVIFSK+TCCLCYAV+IL ++LGV P+V+++D D  +GKDME+AL R+
Sbjct  1    MDKVQRMASEYGVVIFSKSTCCLCYAVTILFRDLGVDPYVHELDHD-SEGKDMEKALMRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GCN+SVPAVFIGG L+GSTNEVMSLHL GSLI +LKPY+
Sbjct  60   GCNASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPYL  98



>ref|XP_009797640.1| PREDICTED: monothiol glutaredoxin-S11-like [Nicotiana sylvestris]
Length=101

 Score =   150 bits (378),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQ-ELGVKPHVYDIDTDHQDGKDMERALAR  332
            MDKV+ LA +HGVVIFSK+TCCLCYAV+IL Q +LGV P+V++ID D  +GK+ME+AL R
Sbjct  1    MDKVRRLATEHGVVIFSKSTCCLCYAVTILFQDQLGVSPYVHEIDHD-PEGKEMEKALLR  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSS  458
            + CN+SVPAVFIGG L+GSTNEVMSLHL GSLI +LKPYM +
Sbjct  60   MSCNASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPYMPN  101



>ref|NP_001275008.1| glutaredoxin [Solanum tuberosum]
 gb|ABU96708.1| glutaredoxin [Solanum tuberosum]
Length=101

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = +3

Query  159  DKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARLG  338
            DKV+ ++++HGV+IFSK+TCCLCYAV+IL ++LGV P+V+++D D  DGKDME+AL R+G
Sbjct  3    DKVQRMSSEHGVMIFSKSTCCLCYAVTILFRDLGVDPYVHELDHD-SDGKDMEKALMRMG  61

Query  339  CNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            CN+SVPAVFIGG L+GSTNEVMSLHL GSLI +LKPY+
Sbjct  62   CNASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPYL  99



>ref|XP_006444242.1| hypothetical protein CICLE_v10023018mg [Citrus clementina]
 ref|XP_006479882.1| PREDICTED: monothiol glutaredoxin-S9-like [Citrus sinensis]
 gb|ESR57482.1| hypothetical protein CICLE_v10023018mg [Citrus clementina]
 gb|KDO87381.1| hypothetical protein CISIN_1g034205mg [Citrus sinensis]
Length=101

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIFSK++CCLCYAV+IL QELGV P VY+ID D  +GK+ME+AL R+
Sbjct  1    MDKVTRLASEKGVVIFSKSSCCLCYAVNILFQELGVHPMVYEIDQD-PEGKEMEKALMRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ VPAVFI G L+GSTNEVMSLHLSG+LI +LKPY
Sbjct  60   GCNAPVPAVFISGQLVGSTNEVMSLHLSGNLIPLLKPY  97



>ref|XP_011033601.1| PREDICTED: glutaredoxin-C13 [Populus euphratica]
Length=101

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  +A++HGVVIF+K+TCCLCYAV IL QE+GV P V++ID D  +G++MERAL R+
Sbjct  1    MDKVSRMASEHGVVIFTKSTCCLCYAVKILFQEIGVDPLVHEIDLD-AEGREMERALKRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC++ VPAVF+GG L+GSTNEVMSLHLSGSL  MLKPY S
Sbjct  60   GCSAPVPAVFVGGKLLGSTNEVMSLHLSGSLNQMLKPYQS  99



>ref|XP_011009413.1| PREDICTED: monothiol glutaredoxin-S9-like [Populus euphratica]
Length=99

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++  VVIFSK++CCLCYAV IL QE+GV P VY+ID D + G++ME+AL RL
Sbjct  1    MDKVMGLASEKAVVIFSKSSCCLCYAVKILFQEIGVDPLVYEIDQDAE-GREMEKALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ +PAVFIGG L+GSTNEVMSLHLSGSLI MLKPY
Sbjct  60   GCNAPLPAVFIGGKLMGSTNEVMSLHLSGSLIPMLKPY  97



>ref|XP_004240522.1| PREDICTED: glutaredoxin-C13-like [Solanum lycopersicum]
Length=101

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = +3

Query  159  DKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARLG  338
            DKV+ ++++HGV+IFSK+TCCLCYAV+IL ++LGV P+V+++D D  +GKDME+AL R+G
Sbjct  3    DKVQRMSSEHGVMIFSKSTCCLCYAVTILFRDLGVDPYVHELDHD-SEGKDMEKALVRMG  61

Query  339  CNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            CN SVPAVFIGG L+GSTNEVMSLHL GSLI +LKPY+
Sbjct  62   CNVSVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPYL  99



>ref|XP_007050806.1| Glutaredoxin [Theobroma cacao]
 gb|EOX94963.1| Glutaredoxin [Theobroma cacao]
Length=100

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVV+FSK++CCLCYAV IL QELGV P V++ID D  +G+DME+AL RL
Sbjct  1    MDKVMRLASEKGVVLFSKSSCCLCYAVKILFQELGVSPVVHEIDQD-PEGRDMEKALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ VPAVFIGG L+GSTNEVMSLHLSG LI +LKPY
Sbjct  60   GCNAPVPAVFIGGKLVGSTNEVMSLHLSGGLIPLLKPY  97



>ref|XP_009378906.1| PREDICTED: monothiol glutaredoxin-S9-like [Pyrus x bretschneideri]
Length=98

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIFSK++CCLCYAV+IL QE+GV P VY+ID D  +G++ME+AL R+
Sbjct  1    MDKVMRLASEKGVVIFSKSSCCLCYAVNILFQEIGVSPVVYEIDQD-PEGREMEKALTRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC + VPAVFIGGNLIGSTNEVMSLHL G LI  LKPY
Sbjct  60   GCTAPVPAVFIGGNLIGSTNEVMSLHLKGQLIPKLKPY  97



>ref|XP_003625870.1| Glutaredoxin [Medicago truncatula]
 gb|AES82088.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=102

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIF+K++CCLCYAV+IL QELG++P V++ID D  +G++ME+AL RL
Sbjct  1    MDKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGIRPMVHEIDQD-PEGREMEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC + VPAVFIGG L+GSTNE+MSLHLSGSL  ++KPY S  N
Sbjct  60   GCTAPVPAVFIGGQLMGSTNEIMSLHLSGSLTQLIKPYQSRSN  102



>emb|CDP03539.1| unnamed protein product [Coffea canephora]
Length=101

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA+++G+VIFSK+TCCLCYAV+IL  ELGV P++++ID D  DGK++E+AL R+
Sbjct  1    MDKVLRLASENGLVIFSKSTCCLCYAVNILFHELGVTPYIHEIDHD-PDGKEIEKALMRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSS  458
            GCN+ +PAVFIGG L+GSTNEVMSLHLSGSL+ +L+PY  S
Sbjct  60   GCNAPIPAVFIGGKLVGSTNEVMSLHLSGSLLPLLRPYQPS  100



>ref|XP_008386625.1| PREDICTED: monothiol glutaredoxin-S11 [Malus domestica]
Length=101

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA+++GVVIFSK++CCLCYAV+IL QE+GV P V++ID D  +G++ME+AL RL
Sbjct  1    MDKVMRLASENGVVIFSKSSCCLCYAVNILFQEIGVSPVVHEIDQD-PEGREMEKALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC + VPAVFIGGNLIGSTNEVMSLHL G LI  LKPY
Sbjct  60   GCTAPVPAVFIGGNLIGSTNEVMSLHLKGQLIPQLKPY  97



>ref|XP_004494333.1| PREDICTED: monothiol glutaredoxin-S11-like [Cicer arietinum]
Length=102

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA++ GVVIF+K++CCLCYAV+IL QELG++P V++ID D  +G+DME+AL RL
Sbjct  1    MEKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGIRPMVHEIDQD-PEGRDMEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC + VPAVFIGG L+GSTNE+MSLHLSGSL  +LKPY  S++
Sbjct  60   GCTAPVPAVFIGGKLMGSTNEIMSLHLSGSLTQLLKPYHQSLS  102



>ref|XP_010069984.1| PREDICTED: glutaredoxin-C13-like [Eucalyptus grandis]
 gb|KCW58534.1| hypothetical protein EUGRSUZ_H01202 [Eucalyptus grandis]
Length=104

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKVK  A++ GVVIFSK++CCLCY V+IL ++LGV+P VY+ID D  + +++E+AL RL
Sbjct  1    MDKVKRCASEQGVVIFSKSSCCLCYTVTILFRDLGVQPRVYEIDRDP-ECREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GCN+ VPAVFIGG L+GSTNEVMSLHLSGSLI M++PY +
Sbjct  60   GCNAPVPAVFIGGQLVGSTNEVMSLHLSGSLIPMIRPYQA  99



>ref|XP_010243569.1| PREDICTED: monothiol glutaredoxin-S11-like [Nelumbo nucifera]
Length=101

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LAA+ GVVIFSK++CC+CYAV IL  ELGV P V++ID D  +GK+MERAL RL
Sbjct  1    MEKVMRLAAEKGVVIFSKSSCCMCYAVKILFHELGVNPIVHEIDQD-PEGKEMERALCRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GCN+ VPAVFIGG L+GSTNEVMSLHL GSLI +L+PY +
Sbjct  60   GCNAPVPAVFIGGKLVGSTNEVMSLHLGGSLIPLLRPYQT  99



>gb|KHN03747.1| Monothiol glutaredoxin-S9 [Glycine soja]
Length=101

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKVK LA + GVV+F+K++CCLCYAV+IL QELGV P V++ID D  +GK++E+A+ RL
Sbjct  1    MDKVKRLATEKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKD-PEGKEIEKAITRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC + VPAVFIGGNL+GSTNEVMSLHLSGSL  +LKPY +
Sbjct  60   GCPTPVPAVFIGGNLVGSTNEVMSLHLSGSLTQLLKPYRA  99



>ref|XP_008375847.1| PREDICTED: monothiol glutaredoxin-S9-like [Malus domestica]
Length=99

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIFSK++CCLCYAV IL QE+GV P V++ID D  +G++ME+AL R+
Sbjct  1    MDKVMRLASEKGVVIFSKSSCCLCYAVKILFQEIGVSPVVHEIDQD-PEGREMEKALTRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC + VPAVFIGGNLIGSTNEVMSLHL G LI  LKPY
Sbjct  60   GCTAPVPAVFIGGNLIGSTNEVMSLHLKGQLIPKLKPY  97



>gb|AFC01204.1| glutaredoxin family protein [Ammopiptanthus mongolicus]
Length=102

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIF+K++CCLCYAV+IL QELGV P V++ID D  +G++ME+AL+RL
Sbjct  1    MDKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGVSPVVHEIDQD-PEGREMEKALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC + VPAVFIGG L+GSTNEVMSLHLSGSL  +LKPY
Sbjct  60   GCTAPVPAVFIGGKLMGSTNEVMSLHLSGSLTQLLKPY  97



>gb|EYU40529.1| hypothetical protein MIMGU_mgv1a015649mg [Erythranthe guttata]
Length=150

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  150  DRMDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALA  329
              M+KV  LA+++G++IFSK+TCCLCYAV +L +ELG  P +Y+ID D  +GKD+E+AL 
Sbjct  46   QEMEKVVKLASENGILIFSKSTCCLCYAVQMLFKELGANPSIYEIDHDPAEGKDIEKALM  105

Query  330  RLGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            R+GC+  +PAVF+ G L+GSTNEVMSLHLSGSLI +LKPY  +M+
Sbjct  106  RMGCSGPLPAVFVSGKLVGSTNEVMSLHLSGSLIPLLKPYQPNMS  150



>ref|XP_009614874.1| PREDICTED: glutaredoxin-C13-like [Nicotiana tomentosiformis]
Length=100

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV+ LA+++GV+IFSK+TCCLCYAVSIL +ELGV  +V+++D D  DGK+M+++L ++
Sbjct  1    MEKVQKLASENGVMIFSKSTCCLCYAVSILFRELGVNAYVHELDHD-SDGKEMDKSLIKM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GCN SVPAVFIGG LIGSTNE+MSLHL GSL+ +LKPYM
Sbjct  60   GCNPSVPAVFIGGKLIGSTNEIMSLHLKGSLLQLLKPYM  98



>ref|XP_002320361.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE98676.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIF K+TCCLCYAV IL QE+GV P V++ID D  +G++ME+AL R+
Sbjct  1    MDKVLRLASEQGVVIFIKSTCCLCYAVKILFQEIGVDPLVHEIDQD-PEGREMEKALTRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSS  458
            GC++ VPAVF+GG L+GSTNEVMSLHLSGSL  MLKPY S 
Sbjct  60   GCSAPVPAVFVGGKLLGSTNEVMSLHLSGSLNQMLKPYQSQ  100



>gb|ADV56687.1| glutaredoxin [Phaseolus vulgaris]
Length=145

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  123  LIKEVVVPADRMDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQD  302
            L ++V+    RMDKVK LA+++GVVIF+K++CCLCYAV+IL +ELGVKP +++ID D  +
Sbjct  38   LEEQVLDQCIRMDKVKRLASENGVVIFTKSSCCLCYAVNILFEELGVKPQLHEIDHD-PE  96

Query  303  GKDMERALARLGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            G++ME+AL RLGCN+ VPAVFIGG LIGSTNE+MSLHL GSL  +LK +
Sbjct  97   GREMEKALLRLGCNAPVPAVFIGGKLIGSTNEIMSLHLRGSLTPLLKTH  145



>ref|XP_011082492.1| PREDICTED: monothiol glutaredoxin-S9-like [Sesamum indicum]
Length=102

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+K+  LA+++G++IFSK+TCCLCYAV IL QEL V P V++ID D  +GK++E+AL R+
Sbjct  1    MEKIVKLASENGILIFSKSTCCLCYAVQILFQELRVHPRVHEIDHD-PEGKEIEKALMRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC+  VPAVFIGG L+GSTNEVMSLHLSGSLI +LKPY +S++
Sbjct  60   GCSGPVPAVFIGGKLVGSTNEVMSLHLSGSLIPLLKPYQASLS  102



>gb|AFK36241.1| unknown [Lotus japonicus]
Length=99

 Score =   142 bits (359),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIF+K++CCLCYAV+IL QE+GV+P V++ID D  +G++ME+AL RL
Sbjct  1    MDKVMRLASEKGVVIFTKSSCCLCYAVNILFQEIGVRPVVHEIDQD-PEGREMEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC   VPAVFIGG L+GSTNE+MSLHLSGSL  +LKPY S
Sbjct  60   GCPVPVPAVFIGGKLMGSTNEIMSLHLSGSLTQLLKPYQS  99



>ref|XP_009785800.1| PREDICTED: glutaredoxin-C13-like [Nicotiana sylvestris]
Length=100

 Score =   142 bits (358),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV+ LA+++GV+IFSK+TCCLCYAVSIL +ELGV  +V+++D D  DGK+M+++L ++
Sbjct  1    MEKVQKLASENGVMIFSKSTCCLCYAVSILFRELGVNAYVHELDHD-SDGKEMDKSLIKM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GCN SVPAVFIGG LIGSTNE+MSLHL GSLI +L PYM
Sbjct  60   GCNPSVPAVFIGGKLIGSTNEIMSLHLKGSLIQLLNPYM  98



>ref|NP_001235478.1| uncharacterized protein LOC100499748 [Glycine max]
 ref|XP_006603650.1| PREDICTED: uncharacterized protein LOC100499748 isoform X1 [Glycine 
max]
 gb|ACU13470.1| unknown [Glycine max]
 gb|KHN43545.1| Glutaredoxin-C13 [Glycine soja]
Length=101

 Score =   142 bits (357),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIF+K++CCLCYAV+IL QELGV P V++ID D  +G++ME+AL RL
Sbjct  1    MDKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGVNPVVHEIDHD-PEGREMEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC + VPAVFIGG L GSTNE+MSLHLSGSL  MLKPY +
Sbjct  60   GCTAPVPAVFIGGKLRGSTNEIMSLHLSGSLTQMLKPYQA  99



>gb|KEH43252.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=99

 Score =   142 bits (357),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA + GVVIF+K++CCLCYAV+IL QE+GV P V++ID D  +GK+ME+A+ +L
Sbjct  1    MEKVMRLATEKGVVIFTKSSCCLCYAVNILFQEIGVFPVVHEIDKD-PEGKEMEKAITKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ VPAVFIGG L+GSTNEVMSLHLSGSL+ +L+PY
Sbjct  60   GCNAPVPAVFIGGRLVGSTNEVMSLHLSGSLVPLLRPY  97



>ref|XP_007144558.1| hypothetical protein PHAVU_007G165900g [Phaseolus vulgaris]
 gb|ESW16552.1| hypothetical protein PHAVU_007G165900g [Phaseolus vulgaris]
Length=101

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA   GVV+F+K++CCLCYAV+IL +ELGV P V++ID D  +GK+ME+AL RL
Sbjct  1    MEKVIRLATDKGVVVFTKSSCCLCYAVNILFRELGVNPVVHEIDKD-PEGKEMEKALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC + VPAVFIGG L+GSTNEVMSLHLSGSL  MLKPY S
Sbjct  60   GCPAPVPAVFIGGTLVGSTNEVMSLHLSGSLTKMLKPYRS  99



>ref|XP_007163065.1| hypothetical protein PHAVU_001G203200g [Phaseolus vulgaris]
 gb|ESW35059.1| hypothetical protein PHAVU_001G203200g [Phaseolus vulgaris]
Length=97

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKVK LA+++GVVIF+K++CCLCYAV+IL +ELGVKP +++ID D  +G++ME+AL RL
Sbjct  1    MDKVKRLASENGVVIFTKSSCCLCYAVNILFEELGVKPQLHEIDHD-PEGREMEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ VPAVFIGG LIGSTNE+MSLHL GSL  +LK +
Sbjct  60   GCNAPVPAVFIGGKLIGSTNEIMSLHLRGSLTPLLKTH  97



>gb|KDP28094.1| hypothetical protein JCGZ_13865 [Jatropha curcas]
Length=101

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA++ GVVIFSK++CC+CYAV IL Q +GV P VY+ID D  +G++MERAL R+
Sbjct  1    MEKVMGLASEKGVVIFSKSSCCMCYAVKILFQGIGVDPLVYEIDQD-PEGREMERALLRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC++ VPAVFIGG L+GSTNE+MSLHLSG+L+ MLKPY +
Sbjct  60   GCSAPVPAVFIGGKLMGSTNEIMSLHLSGNLVQMLKPYQT  99



>ref|NP_001235876.1| uncharacterized protein LOC100305984 [Glycine max]
 ref|XP_006576146.1| PREDICTED: uncharacterized protein LOC100305984 isoform X1 [Glycine 
max]
 gb|ACU13941.1| unknown [Glycine max]
 gb|KHN28230.1| Glutaredoxin-C13 [Glycine soja]
Length=101

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIF+K++CCLCYAV+IL QELGV P V++ID D  +G++ME+AL R 
Sbjct  1    MDKVTRLASEKGVVIFTKSSCCLCYAVNILFQELGVNPVVHEIDHD-PEGREMEKALLRQ  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC + VPAVFIGG L+GSTNE+MSLHLSGSL  MLKPY +
Sbjct  60   GCTAPVPAVFIGGKLMGSTNEIMSLHLSGSLTQMLKPYQA  99



>gb|ABK96409.1| unknown [Populus trichocarpa x Populus deltoides]
Length=101

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  L ++ GVVIF K+TCCLCYAV IL QE+GV P V++ID D  +G++ME+AL R+
Sbjct  1    MDKVLRLTSEQGVVIFIKSTCCLCYAVKILFQEIGVDPLVHEIDQD-PEGREMEKALTRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSS  458
            GC++ VPAVF+GG L+GSTNEVMSLHLSGSL  MLKPY S 
Sbjct  60   GCSAPVPAVFVGGKLLGSTNEVMSLHLSGSLNQMLKPYQSQ  100



>gb|KEH43253.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=99

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA + GVV+F+K++CCLCYAV+IL QE+GV P +++ID D  +GK+ME+A+ +L
Sbjct  1    MEKVMRLATEKGVVVFTKSSCCLCYAVNILFQEIGVYPVIHEIDKD-PEGKEMEKAITKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ VPAVFIGG L+GSTNEVMSLHLSGSL+ +L+PY
Sbjct  60   GCNAPVPAVFIGGRLVGSTNEVMSLHLSGSLVPLLRPY  97



>ref|NP_001237832.1| uncharacterized protein LOC100527558 [Glycine max]
 gb|ACU16655.1| unknown [Glycine max]
Length=101

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA + GVV+F+K++CCLCYAV+IL QELGV P V++ID D  +GK++E+A+ RL
Sbjct  1    MDKVTRLATEKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKD-PEGKEIEKAITRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC + VPAVFIGG L+GSTNEVMSLHLSGSL  +LKPY +
Sbjct  60   GCPTPVPAVFIGGKLVGSTNEVMSLHLSGSLTQLLKPYRA  99



>ref|XP_007201438.1| hypothetical protein PRUPE_ppa013777mg [Prunus persica]
 gb|EMJ02637.1| hypothetical protein PRUPE_ppa013777mg [Prunus persica]
Length=103

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIFSK++CCLCYAV+IL QE+GV P V++ID D  DG++ME+AL RL
Sbjct  1    MDKVMRLASEKGVVIFSKSSCCLCYAVNILFQEIGVSPVVHEIDQD-PDGREMEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC + VPAVFIGG L+GSTNEVMSLHL G LI  LKP+
Sbjct  60   GCTAPVPAVFIGGTLVGSTNEVMSLHLKGQLIPKLKPH  97



>ref|XP_008234999.1| PREDICTED: glutaredoxin-C13-like [Prunus mume]
Length=103

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA++ GVVIFSK++CCLCYAV+IL QE+GV P V++ID D  DG++ME+A+ RL
Sbjct  1    MDKVMRLASEKGVVIFSKSSCCLCYAVNILFQEIGVSPVVHEIDQD-PDGREMEKAILRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC + VPAVFIGG L+GSTNEVMSLHL G LI  LKP+
Sbjct  60   GCTAPVPAVFIGGTLVGSTNEVMSLHLKGQLIPKLKPH  97



>gb|AFK47066.1| unknown [Lotus japonicus]
Length=104

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  +A++ GVVIF+K++CC+CYAV IL  ELGV P VY+ID D  +GK+MERA+ R+
Sbjct  1    MEKVLRMASEKGVVIFTKSSCCMCYAVKILFHELGVIPVVYEIDKD-PEGKEMERAITRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSS  458
            GC + VPAVFI G L+GSTNEV+SLHLSGSL  +LKPY+ S
Sbjct  60   GCTAPVPAVFIAGKLVGSTNEVLSLHLSGSLNPLLKPYIRS  100



>ref|XP_010241630.1| PREDICTED: monothiol glutaredoxin-S11-like [Nelumbo nucifera]
Length=101

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  +A++ GVVIFS+++CC+CYAV IL  ELGV P V+++D D ++ K+MERAL+R+
Sbjct  1    MEKVMRVASEKGVVIFSRSSCCMCYAVKILFHELGVNPMVHELDQDPEE-KEMERALSRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GCN+ VPAVFIGG L+GSTNEVMSLHLSGSL+ ++K Y +
Sbjct  60   GCNAPVPAVFIGGKLVGSTNEVMSLHLSGSLVPLIKSYQT  99



>gb|KHN46591.1| Glutaredoxin-C13 [Glycine soja]
Length=101

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA   GVV+F+K++CCLCYAV+IL QELGV P V++ID D  +GK+ME+A+ RL
Sbjct  1    MEKVMRLATDKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKD-PEGKEMEKAITRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            G  + VPAVFIGG L+GSTNEVMSLHLSGSLI +LKPY
Sbjct  60   GSPTPVPAVFIGGKLVGSTNEVMSLHLSGSLIQLLKPY  97



>ref|XP_006359428.1| PREDICTED: monothiol glutaredoxin-S9-like [Solanum tuberosum]
Length=106

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV+ +  +HGVVIFSK+TCCL YAVSIL Q+LGV P+V +ID +  DGK+ME+AL R+
Sbjct  1    MEKVQRMTREHGVVIFSKSTCCLSYAVSILFQDLGVIPYVCEIDHE-SDGKEMEKALIRM  59

Query  336  GCNSS--VPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            G NSS   PA+FIGG L+GSTNEVMSLHL GSLI ++KPYMS++ 
Sbjct  60   GVNSSFMFPAIFIGGLLVGSTNEVMSLHLQGSLIKLIKPYMSNLK  104



>ref|XP_010523992.1| PREDICTED: glutaredoxin-C14-like [Tarenaya hassleriana]
Length=102

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  +A++ GVVIFSK++CCLCYAV IL ++L V+P ++DID D  D +++E+AL RL
Sbjct  1    MDKVMRMASEKGVVIFSKSSCCLCYAVQILFRDLRVQPTIHDIDND-PDFREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC+++VPAVF+ G L+GSTNEVMSLHLSGSL+ ++KPY S  N
Sbjct  60   GCSTAVPAVFVSGKLVGSTNEVMSLHLSGSLLPLIKPYQSVHN  102



>ref|NP_001238158.1| uncharacterized protein LOC100500442 [Glycine max]
 gb|ACU15529.1| unknown [Glycine max]
Length=101

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA + GVV+F+K++CCLCYAV+IL QELGV P V++ID D  +GK+ME+A+ RL
Sbjct  1    MEKVMRLATEKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKD-PEGKEMEKAITRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            G  + VPAVFIGG L+GSTNEVMSLHLSGSL  +LKPY
Sbjct  60   GSPTPVPAVFIGGKLVGSTNEVMSLHLSGSLTQLLKPY  97



>ref|XP_004495992.1| PREDICTED: monothiol glutaredoxin-S9-like [Cicer arietinum]
Length=99

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA + GVVIF+K++CC+CYAV+IL +ELGV P V++ID D  +GK+ME+A+ +L
Sbjct  1    MEKVMRLATEKGVVIFTKSSCCMCYAVNILFRELGVFPVVHEIDKD-PEGKEMEKAITKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GCN+ VPAVFIGG L+GSTNEVMSLHLSGSL  +++P+
Sbjct  60   GCNAPVPAVFIGGKLVGSTNEVMSLHLSGSLTPLIRPF  97



>ref|XP_006359429.1| PREDICTED: monothiol glutaredoxin-S9-like [Solanum tuberosum]
Length=106

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV+ +  +HGVVIFSK+TCCL YAVSIL Q+LGV P+V +ID +  DGK+ME+AL R+
Sbjct  1    MEKVQRMTREHGVVIFSKSTCCLSYAVSILFQDLGVIPYVCEIDHE-SDGKEMEKALIRM  59

Query  336  GCNSS--VPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            G NSS   PAVFIGG L+GSTNEVMSLHL GSLI ++KPY+S + 
Sbjct  60   GVNSSFMFPAVFIGGLLVGSTNEVMSLHLQGSLIKLIKPYISGLK  104



>ref|XP_010506828.1| PREDICTED: glutaredoxin-C13-like [Camelina sativa]
Length=102

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-TDCREIEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>ref|NP_182309.1| glutaredoxin-C13 [Arabidopsis thaliana]
 ref|XP_002863058.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002880329.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010497805.1| PREDICTED: glutaredoxin-C13 [Camelina sativa]
 sp|O82255.1|GRC13_ARATH RecName: Full=Glutaredoxin-C13; Short=AtGrxC13; AltName: Full=Protein 
ROXY 9 [Arabidopsis thaliana]
 gb|AAC63642.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM15127.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM63279.1| putative glutaredoxin [Arabidopsis thaliana]
 dbj|BAD94488.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|ABE02400.1| At2g47880 [Arabidopsis thaliana]
 gb|ACO50414.1| glutaredoxin [Arabidopsis thaliana]
 gb|EFH39317.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56588.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10904.1| glutaredoxin-C13 [Arabidopsis thaliana]
Length=102

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>ref|XP_006295295.1| hypothetical protein CARUB_v10024385mg [Capsella rubella]
 gb|EOA28193.1| hypothetical protein CARUB_v10024385mg [Capsella rubella]
Length=102

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDRVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG LIGSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLIGSTNEVMSLHLSGSLVPLIKPYQS  99



>ref|XP_009142495.1| PREDICTED: glutaredoxin-C13 [Brassica rapa]
 emb|CDY53024.1| BnaC04g00060D [Brassica napus]
 emb|CDX80139.1| BnaA05g00170D [Brassica napus]
Length=102

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVI +K++CCLCYAV IL ++L V+P V++IDTD  D +++E+AL R+
Sbjct  1    MDKVMRMSSERGVVIITKSSCCLCYAVQILFRDLRVQPTVHEIDTD-PDCREIEKALLRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>ref|XP_006397982.1| hypothetical protein EUTSA_v10001691mg [Eutrema salsugineum]
 gb|ESQ39435.1| hypothetical protein EUTSA_v10001691mg [Eutrema salsugineum]
Length=102

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL R+
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALLRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>gb|KFK37539.1| hypothetical protein AALP_AA4G270200 [Arabis alpina]
Length=102

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++I+ D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIEND-PDCREIEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>ref|XP_010545042.1| PREDICTED: glutaredoxin-C14 [Tarenaya hassleriana]
Length=102

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFSKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC ++VPAVF+ G L+GSTNEVMSLHLSGSL+ ++KP+ S  N
Sbjct  60   GCPTAVPAVFVSGKLVGSTNEVMSLHLSGSLLPLIKPFQSVHN  102



>ref|XP_009138699.1| PREDICTED: glutaredoxin-C14-like [Brassica rapa]
 emb|CDY68061.1| BnaCnng57420D [Brassica napus]
 emb|CDX89162.1| BnaA04g00240D [Brassica napus]
Length=102

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K +CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKDSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC ++VPAVF+ G L+GSTNEVMSLHLSGSL+ ++KPY S  N
Sbjct  60   GCTNAVPAVFVSGKLVGSTNEVMSLHLSGSLVPLIKPYQSFHN  102



>emb|CDY55528.1| BnaA04g29520D [Brassica napus]
Length=105

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E AL R+
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIETALLRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>ref|XP_011079732.1| PREDICTED: monothiol glutaredoxin-S9-like [Sesamum indicum]
Length=104

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+K+  LA+++G++I SK++CCLCYAV +L Q+LGV P +Y+ID D ++ K++E+AL R+
Sbjct  1    MEKIVKLASENGILIMSKSSCCLCYAVQMLFQDLGVHPLIYEIDHDPEE-KEIEKALVRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC+  VPAVFIGG L+GSTNEVMSLHLSGSLI ++ PY +  N
Sbjct  60   GCSGPVPAVFIGGKLVGSTNEVMSLHLSGSLIPLITPYQALSN  102



>ref|XP_010518505.1| PREDICTED: glutaredoxin-C13-like [Camelina sativa]
Length=102

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEV SLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVTSLHLSGSLVPLIKPYQS  99



>ref|XP_006402322.1| hypothetical protein EUTSA_v10006331mg [Eutrema salsugineum]
 gb|ESQ43775.1| hypothetical protein EUTSA_v10006331mg [Eutrema salsugineum]
Length=102

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K +CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKNSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC ++VPAVF+ G L+GSTNEVMSLHLSGSL+ ++KPY S  N
Sbjct  60   GCANAVPAVFVSGKLVGSTNEVMSLHLSGSLVPLIKPYQSFHN  102



>ref|XP_010507838.1| PREDICTED: glutaredoxin-C13-like [Camelina sativa]
Length=102

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ G VIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGEVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>emb|CDY27469.1| BnaC04g51100D [Brassica napus]
Length=105

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCY V IL ++L V+P +++ID D  D +++E+AL R+
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYTVQILFRDLRVQPTIHEIDND-PDCREIEKALLRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>emb|CDY23990.1| BnaC03g17010D [Brassica napus]
Length=102

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P V++ID D  D +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKD-PDCREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG L+GSTNEVMS+HLSGSL+ ++KP+ +S+
Sbjct  60   GCSTPVPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQASL  101



>ref|XP_009132744.1| PREDICTED: monothiol glutaredoxin-S9-like [Brassica rapa]
Length=102

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P V++ID D  D +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKD-LDCREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG L+GSTNEVMS+HLSGSL+ ++KP+ +S+
Sbjct  60   GCSTPVPAIFVGGKLVGSTNEVMSMHLSGSLVSLVKPFQASL  101



>emb|CDX95739.1| BnaC03g26200D [Brassica napus]
Length=102

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL + L V+P +++IDTD  D +++E+AL R+
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRNLRVQPTIHEIDTD-PDCREIEKALLRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++ PAVFIGG L+GST+EVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAFPAVFIGGKLVGSTSEVMSLHLSGSLVPLIKPYQS  99



>ref|XP_010414255.1| PREDICTED: monothiol glutaredoxin-S9-like [Camelina sativa]
Length=102

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +D+E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKD-PECRDIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG LIGSTNEVMSLHLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQANL  101



>ref|XP_009118476.1| PREDICTED: monothiol glutaredoxin-S11-like [Brassica rapa]
 emb|CDY09953.1| BnaC08g44980D [Brassica napus]
 emb|CDY06230.1| BnaA09g49730D [Brassica napus]
Length=99

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  L+++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + ++ME+AL RL
Sbjct  1    MDKVMRLSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKD-PECREMEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYI  98



>ref|XP_009118202.1| PREDICTED: glutaredoxin-C13 [Brassica rapa]
Length=105

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV I+ ++L V+P +++ID D  D +++E AL R+
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQIMFRDLRVQPTIHEIDND-PDCREIETALLRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            GC+++VPAVF+GG L+GSTNEVMSLHLSGSL+ ++KPY S
Sbjct  60   GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQS  99



>emb|CDX84825.1| BnaA03g14050D [Brassica napus]
Length=102

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P V++ID D  D +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKD-LDCREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG L+GSTNEVMS+HLSGSL+ ++KP+ +S+
Sbjct  60   GCSTPVPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQASL  101



>gb|KFK35484.1| hypothetical protein AALP_AA5G290300 [Arabis alpina]
Length=102

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++ + GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSTEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC ++VPAVF+ G L+GSTN+VMSLHLSGSL+ ++KPY S  N
Sbjct  60   GCANAVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQSFPN  102



>ref|NP_191855.1| glutaredoxin-C14 [Arabidopsis thaliana]
 ref|XP_006292102.1| hypothetical protein CARUB_v10018297mg [Capsella rubella]
 ref|XP_010512694.1| PREDICTED: glutaredoxin-C14 [Camelina sativa]
 ref|XP_010413216.1| PREDICTED: glutaredoxin-C14 [Camelina sativa]
 ref|XP_010468902.1| PREDICTED: glutaredoxin-C14 [Camelina sativa]
 sp|Q9LYC5.1|GRC14_ARATH RecName: Full=Glutaredoxin-C14; Short=AtGrxC14; AltName: Full=Protein 
ROXY 8 [Arabidopsis thaliana]
 emb|CAB87741.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|ABD57487.1| At3g62960 [Arabidopsis thaliana]
 gb|ACO50413.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE80417.1| glutaredoxin-C14 [Arabidopsis thaliana]
 gb|EOA25000.1| hypothetical protein CARUB_v10018297mg [Capsella rubella]
Length=102

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC ++VPAVF+ G L+GSTN+VMSLHLSGSL+ ++KPY S  N
Sbjct  60   GCANAVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQSFHN  102



>ref|XP_009116964.1| PREDICTED: glutaredoxin-C14 [Brassica rapa]
 emb|CDY11466.1| BnaA09g40320D [Brassica napus]
Length=102

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K +CCLCYAV +L ++L V+P V++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKNSCCLCYAVQVLFRDLRVQPKVHEIDND-PDCREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC ++VPAVF+ G L+GSTN+VMSLHLSGSL+ ++KPY S  N
Sbjct  60   GCANAVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQSFHN  102



>ref|XP_004247457.1| PREDICTED: glutaredoxin-C13-like [Solanum lycopersicum]
Length=106

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV+ +A  HGVVIFSK+TCCL YAVS+L ++LGV P+V  ID +  DGK+ME+AL R+
Sbjct  1    MDKVQRMARDHGVVIFSKSTCCLSYAVSVLFKDLGVVPYVCQIDHE-PDGKEMEKALIRM  59

Query  336  GCNSS--VPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMS  455
            G NSS   PAVFIGG+L+GSTNEVMSLHL GSL  +++PY+S
Sbjct  60   GVNSSFLFPAVFIGGSLLGSTNEVMSLHLQGSLNQLIQPYIS  101



>ref|XP_006410157.1| hypothetical protein EUTSA_v10017804mg [Eutrema salsugineum]
 gb|ESQ51610.1| hypothetical protein EUTSA_v10017804mg [Eutrema salsugineum]
Length=102

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P V++ID D  D +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKD-PDCREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG L+GSTNEVMS+HLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQANL  101



>ref|XP_004139878.1| PREDICTED: monothiol glutaredoxin-S9-like [Cucumis sativus]
 ref|XP_004159058.1| PREDICTED: monothiol glutaredoxin-S9-like [Cucumis sativus]
 ref|XP_008447177.1| PREDICTED: glutaredoxin-C13-like [Cucumis melo]
 gb|KGN44219.1| hypothetical protein Csa_7G230940 [Cucumis sativus]
Length=105

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LAA++ V+I SK++CCLCYAVS+L+++LGV P VY++D D + G+DME+AL RL
Sbjct  1    MEKVNRLAAENEVLIISKSSCCLCYAVSVLLRDLGVSPMVYELDQDPE-GRDMEKALVRL  59

Query  336  -GCNS-SVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
             GCN+  VPAVFI G+L+GSTNE+MSLHLSG L  MLKPY
Sbjct  60   QGCNTPPVPAVFIAGDLVGSTNELMSLHLSGDLNRMLKPY  99



>ref|XP_010510342.1| PREDICTED: monothiol glutaredoxin-S9 [Camelina sativa]
 ref|XP_010469842.1| PREDICTED: monothiol glutaredoxin-S9 [Camelina sativa]
Length=102

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG LIGSTNEVMSLHLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQANL  101



>ref|NP_180612.1| monothiol glutaredoxin-S9 [Arabidopsis thaliana]
 sp|O04341.1|GRXS9_ARATH RecName: Full=Monothiol glutaredoxin-S9; Short=AtGrxS9; AltName: 
Full=Protein ROXY 7 [Arabidopsis thaliana]
 gb|AAB63083.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM65461.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM83235.1| At2g30540/T6B20.11 [Arabidopsis thaliana]
 gb|AAN46782.1| At2g30540/T6B20.11 [Arabidopsis thaliana]
 gb|ACO50412.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEC08405.1| monothiol glutaredoxin-S9 [Arabidopsis thaliana]
Length=102

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CC+ YAV +L Q+LGV P V++ID D  + +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG LIGSTNEVMSLHLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQANL  101



>ref|XP_010522020.1| PREDICTED: monothiol glutaredoxin-S9 [Tarenaya hassleriana]
Length=102

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID +  D +++E+AL R+
Sbjct  1    MDKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKE-PDCREIEKALMRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPAVFI G LIGSTNEVMSLHLSGSL+ ++KPY +++
Sbjct  60   GCSTPVPAVFISGKLIGSTNEVMSLHLSGSLVPLVKPYQANL  101



>gb|EPS63131.1| glutaredoxin, partial [Genlisea aurea]
Length=98

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+K+  LA+++G++I SK+TCCLCYAV +L +EL V P V++ID D  +GK+ME+AL R+
Sbjct  1    MEKISKLASENGILILSKSTCCLCYAVQMLFKELRVHPIVHEIDHD-PEGKEMEKALVRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC+  VPAVFIGG L+GSTNEVMS+HLSG+L+ +L PY
Sbjct  60   GCSGPVPAVFIGGKLVGSTNEVMSMHLSGALLPLLGPY  97



>ref|XP_010024634.1| PREDICTED: monothiol glutaredoxin-S10-like [Eucalyptus grandis]
Length=102

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK+TCC+C+AV  L  ELGV P +Y++D D + GK+MERALARL
Sbjct  1    MDRVAKLASQKAVVIFSKSTCCMCHAVKSLFYELGVSPAIYELDEDSR-GKEMERALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG  +GS N VM+ HLSGSL  MLK
Sbjct  60   GCSPAVPAVFIGGKFVGSANTVMTYHLSGSLKRMLK  95



>ref|XP_006296283.1| hypothetical protein CARUB_v10025453mg [Capsella rubella]
 gb|EOA29181.1| hypothetical protein CARUB_v10025453mg [Capsella rubella]
Length=102

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKD-VECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG LIGSTNEVMSLHLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQANL  101



>ref|XP_002881118.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57377.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  +++  GVVIFSK++CCL YAV +L Q+LGV P V++ID D  + +++E+AL RL
Sbjct  1    MDKVVRMSSDKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG LIGSTNEVMSLHLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQANL  101



>ref|XP_010486752.1| PREDICTED: monothiol glutaredoxin-S11 [Camelina sativa]
 ref|XP_010475433.1| PREDICTED: monothiol glutaredoxin-S11 [Camelina sativa]
 ref|XP_010475434.1| PREDICTED: monothiol glutaredoxin-S11 [Camelina sativa]
Length=99

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVMRMSSERGVVIFSKSSCCLSYAVQVLFQDLGVNPKIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>emb|CDX76678.1| BnaC08g32640D [Brassica napus]
Length=102

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K +CCLCYAV +L ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKNSCCLCYAVQVLFRDLRVQPKIHEIDND-PDCREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC ++VPAVF+ G L+GSTN+VMSLHLSGSL+ ++KPY +  N
Sbjct  60   GCANAVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQAFHN  102



>ref|XP_002889620.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65879.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=99

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVNPKIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>ref|XP_006304582.1| hypothetical protein CARUB_v10011626mg [Capsella rubella]
 gb|EOA37480.1| hypothetical protein CARUB_v10011626mg [Capsella rubella]
Length=99

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>ref|XP_004309711.1| PREDICTED: glutaredoxin-C13-like [Fragaria vesca subsp. vesca]
Length=102

 Score =   129 bits (325),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA+ + VVIFSK++CCLCYAV+IL QE+GV+  V +ID D  DG++ME+ L R+
Sbjct  1    MDKVIRLASANDVVIFSKSSCCLCYAVNILFQEIGVRASVNEIDND-PDGREMEKCLMRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC SSVPAVFIGG LIGSTNEVMSLHL G LI  LK Y
Sbjct  60   GC-SSVPAVFIGGQLIGSTNEVMSLHLKGQLIPKLKAY  96



>emb|CDY10229.1| BnaC05g04720D [Brassica napus]
Length=99

 Score =   129 bits (324),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + ++ME+AL +L
Sbjct  1    MDKVLRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKD-PECREMEKALMKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>emb|CDY54881.1| BnaA10g27940D [Brassica napus]
Length=99

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVLRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>ref|XP_009141071.1| PREDICTED: monothiol glutaredoxin-S9 [Brassica rapa]
 emb|CDY29666.1| BnaA04g17610D [Brassica napus]
Length=102

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CC+ YAV +L Q+LGV P V++ID D  D +++E+A+ RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKD-PDCREIEKAIMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG L+GSTNEVMS+HLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQANL  101



>ref|XP_010486713.1| PREDICTED: monothiol glutaredoxin-S11-like [Camelina sativa]
 ref|XP_010457833.1| PREDICTED: monothiol glutaredoxin-S11-like [Camelina sativa]
 ref|XP_010497824.1| PREDICTED: monothiol glutaredoxin-S11-like [Camelina sativa]
Length=99

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVMRMSSERGVVIFSKSSCCLSYAVQVLFQDLGVIPKIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>ref|XP_004136055.1| PREDICTED: monothiol glutaredoxin-S11-like [Cucumis sativus]
 ref|XP_004160535.1| PREDICTED: monothiol glutaredoxin-S11-like [Cucumis sativus]
 ref|XP_008451631.1| PREDICTED: monothiol glutaredoxin-S11 [Cucumis melo]
 gb|KGN44888.1| hypothetical protein Csa_7G394080 [Cucumis sativus]
Length=103

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKVK L A+  VVIFSK++CCL YAV+IL  ELGV P VY+ID D  D +++E+AL RL
Sbjct  1    MDKVKRLVAERSVVIFSKSSCCLSYAVNILFGELGVNPLVYEIDQD-PDYREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN+ VPAVFIGG L+GSTNE+MS HLSG L  ML
Sbjct  60   GCNAPVPAVFIGGKLVGSTNEIMSHHLSGDLTKML  94



>ref|NP_172168.1| monothiol glutaredoxin-S11 [Arabidopsis thaliana]
 sp|Q9M9Y9.1|GRS11_ARATH RecName: Full=Monothiol glutaredoxin-S11; Short=AtGrxS11; AltName: 
Full=Protein ROXY 6 [Arabidopsis thaliana]
 gb|AAF63150.1|AC011001_20 Similar to glutaredoxin [Arabidopsis thaliana]
 gb|AAL62358.1| glutaredoxin, putative [Arabidopsis thaliana]
 gb|AAM47933.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM61604.1| glutaredoxin, putative [Arabidopsis thaliana]
 gb|ACO50411.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE28043.1| monothiol glutaredoxin-S11 [Arabidopsis thaliana]
Length=99

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLSYAVQVLFQDLGVNPKIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>ref|XP_009119027.1| PREDICTED: monothiol glutaredoxin-S11 [Brassica rapa]
Length=99

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL +L
Sbjct  1    MDKVLRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKD-PECREIEKALMKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>ref|XP_010666490.1| PREDICTED: monothiol glutaredoxin-S9-like [Beta vulgaris subsp. 
vulgaris]
Length=103

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 82/98 (84%), Gaps = 3/98 (3%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  + +++GVVIFSK++CCLCY+V+IL QELGV P +Y+ID D  +GK++E+A+ ++
Sbjct  1    MDKVIRVVSENGVVIFSKSSCCLCYSVNILFQELGVTPFIYEIDKD-SEGKEIEKAIMKI  59

Query  336  GCNSSV--PAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN+ V  PAVFIGG L+GSTNE+MSLHL G+L+ M+K
Sbjct  60   GCNTHVPLPAVFIGGKLMGSTNEIMSLHLRGALVPMVK  97



>emb|CDY52638.1| BnaCnng23060D [Brassica napus]
Length=102

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CC+ YAV +L Q+LGV P V++ID D  D +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKD-PDCREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+ G L+GSTNEVMS+HLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVDGKLVGSTNEVMSMHLSGSLVPLVKPFQANL  101



>ref|XP_010557174.1| PREDICTED: monothiol glutaredoxin-S9-like [Tarenaya hassleriana]
Length=99

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CCL YAV +L Q++GV P V++IDTD  D +++E+AL R+
Sbjct  1    MDKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDIGVHPTVHEIDTD-PDCREIEKALMRI  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC++ VPAVFIGG LIGSTNEVMSLHL GSL+ ++K
Sbjct  60   GCSTPVPAVFIGGKLIGSTNEVMSLHLRGSLVPLVK  95



>gb|KFK42997.1| hypothetical protein AALP_AA1G066100 [Arabis alpina]
Length=99

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLSYAVQVLFQDLGVIPKIHEIDKD-PECREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYI  98



>ref|XP_009144292.1| PREDICTED: monothiol glutaredoxin-S9-like [Brassica rapa]
 emb|CDY10745.1| BnaA05g11910D [Brassica napus]
Length=102

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  +++  GVVIFSK++CC+ YAV +L Q+LGV P V++ID D  D +++E+AL RL
Sbjct  1    MDKVVRMSSDKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKD-PDCREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+ G L+GSTNEVMS+HLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVDGKLVGSTNEVMSMHLSGSLVPLVKPFQANL  101



>ref|XP_002876697.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52956.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=96

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIF+K++CCLCYAV IL ++L V+P +++ID D  D +++E+AL RL
Sbjct  1    MDKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDND-PDCREIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKP  446
            GC ++VPAVF+ G L+GSTN+VMSLHLSGSL+ ++KP
Sbjct  60   GCANAVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKP  96



>ref|XP_006417875.1| hypothetical protein EUTSA_v10009180mg [Eutrema salsugineum]
 gb|ESQ36228.1| hypothetical protein EUTSA_v10009180mg [Eutrema salsugineum]
Length=99

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  ++++  VVIFSK++CCL YAV +L Q+LGV P +++ID D  + +++E+AL RL
Sbjct  1    MDRVMRMSSEKRVVIFSKSSCCLSYAVQVLFQDLGVNPKIHEIDKD-PECREIEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYM  452
            GC+  VPAVFIGG L+GSTNEVMS+HLS SL+ ++KPY+
Sbjct  60   GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYL  98



>emb|CAH59431.1| glutaredoxin 1 [Plantago major]
Length=105

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  + +++GVVIFSK++CCL YAV +L QEL     +Y+ID    DGK++E+AL RL
Sbjct  1    MDKVMKIKSENGVVIFSKSSCCLSYAVQMLFQELRANAFIYEID-HSPDGKEVEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            G +  +PAVFIGG L+GSTNEVMSLHLSGSLI +LKP  ++++
Sbjct  60   GSSGPIPAVFIGGKLVGSTNEVMSLHLSGSLIPLLKPTQANLS  102



>ref|XP_009104404.1| PREDICTED: glutaredoxin-C14-like [Brassica rapa]
Length=102

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  +++  GVVIF+K +CCLCYAV IL ++L V+P +++ID D  D  ++E+AL RL
Sbjct  1    MDKVMRMSSGKGVVIFTKNSCCLCYAVQILFRDLRVQPTIHEIDND-PDCLEIEKALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPY  449
            GC ++VPAVF+ G L+GSTNEVMSLHLSGSL+ ++KPY
Sbjct  60   GCPNAVPAVFVSGKLVGSTNEVMSLHLSGSLVPLIKPY  97



>emb|CDX97824.1| BnaC04g41150D [Brassica napus]
Length=102

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  ++++ GVVIFSK++CC+ YAV +L Q+LGV P V++ID D  D +++E+AL RL
Sbjct  1    MDKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKD-PDCREIEKALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSM  461
            GC++ VPA+F+GG L+GST E MS+HLSGSL+ ++KP+ +++
Sbjct  60   GCSTPVPAIFVGGKLMGSTTEAMSMHLSGSLVPLVKPFQANL  101



>ref|XP_010038171.1| PREDICTED: glutaredoxin-C13-like [Eucalyptus grandis]
 gb|KCW49985.1| hypothetical protein EUGRSUZ_K03441 [Eucalyptus grandis]
Length=106

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  LA++ GVVIFSK+TCCLCY VSIL ++LGV+P V++ID D  +G +MER LARL
Sbjct  1    MEKVTRLASEKGVVIFSKSTCCLCYTVSILFRDLGVQPEVHEIDQD-PEGLEMERYLARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLH  413
            GC   VPAVFIGGNL+GSTNEVMSLH
Sbjct  60   GCTGPVPAVFIGGNLVGSTNEVMSLH  85



>emb|CAJ38362.1| glutaredoxin [Plantago major]
Length=102

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  +A+++G+VIFSK+TCCL Y V +L Q+LG  P ++D+D D  +GK++E+AL R+
Sbjct  1    MEKVLQMASENGIVIFSKSTCCLSYTVQMLFQQLGTHPCIHDLDHD-PEGKEVEKALMRM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLKPYMSSMN  464
            GC   VPAVFI GNL+GSTNEVMSLHLSG+L+ ML  + + ++
Sbjct  60   GCGGPVPAVFIDGNLVGSTNEVMSLHLSGTLLPMLGAHRAKLH  102



>ref|XP_002516882.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF45496.1| glutaredoxin, grx, putative [Ricinus communis]
Length=102

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+C+A+  L  E GV P +Y++D D + G +ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDSR-GTEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N +M+LHL+GSL  +LK
Sbjct  60   GCNPSVPAVFIGGKFVGSANTIMTLHLNGSLKKLLK  95



>ref|XP_006342768.1| PREDICTED: monothiol glutaredoxin-S10-like [Solanum tuberosum]
Length=102

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  +A+Q  VVIFSK++CC+C+A+  L  E GV P +Y++D D  +G+DMER+L RL
Sbjct  1    MDRVVKIASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYELDED-MNGRDMERSLLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG  +GS N VM+LH++GSL  MLK
Sbjct  60   GCSPAVPAVFIGGRFVGSANTVMTLHINGSLKKMLK  95



>ref|XP_009382560.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
Length=103

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD+V  LA+Q  VV+FS ++CC+C+ +  L  ELGV P ++++D D  +GKDMERALAR 
Sbjct  1    MDRVMRLASQRAVVVFSLSSCCMCHTIKRLFCELGVNPGIHELDED-PNGKDMERALARM  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LGCNS VPAVFIGGNL+G T++VMSLHL G L+ +L+
Sbjct  60   LGCNSPVPAVFIGGNLVGPTDKVMSLHLGGKLVPLLR  96



>ref|XP_011016037.1| PREDICTED: monothiol glutaredoxin-S10 [Populus euphratica]
Length=102

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+C+A+  L  E GV P +Y++D D + GK+ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDSR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +G+ N VM+L L+GSL  +LK
Sbjct  60   GCNPSVPAVFIGGKFVGTANTVMTLQLNGSLKKLLK  95



>ref|XP_010098329.1| Monothiol glutaredoxin-S10 [Morus notabilis]
 gb|EXB74833.1| Monothiol glutaredoxin-S10 [Morus notabilis]
Length=102

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+ +A+  L  E GV P VY+ID D + GK+ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAVYEIDEDSR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGGN +GS N +M+L L+GSL  +LK
Sbjct  60   GCNPAVPAVFIGGNFVGSANTIMTLQLNGSLKKLLK  95



>ref|XP_008674047.1| PREDICTED: glutaredoxin-C1 [Zea mays]
 tpg|DAA54578.1| TPA: hypothetical protein ZEAMMB73_315594 [Zea mays]
Length=103

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFS ++CC+C+ V+ L +ELGV P V ++D D + GK+ME+ALARL
Sbjct  1    MDRVTKLASQRAVVIFSTSSCCMCHTVTRLFRELGVNPTVVELDEDPR-GKEMEKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVFIGG L+GST++VMSLHLSG+L+ +L+
Sbjct  60   LGRNPAVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLR  96



>ref|XP_006380203.1| hypothetical protein POPTR_0008s22890g [Populus trichocarpa]
 gb|ERP58000.1| hypothetical protein POPTR_0008s22890g [Populus trichocarpa]
Length=102

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+C+A+  L  + GV P +Y++D D + GK+ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIYELDEDSR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N VM+L L+GSL  +LK
Sbjct  60   GCNPSVPAVFIGGKFVGSANTVMTLQLNGSLKKLLK  95



>ref|XP_010036905.1| PREDICTED: monothiol glutaredoxin-S10-like [Eucalyptus grandis]
 gb|KCW84426.1| hypothetical protein EUGRSUZ_B01274 [Eucalyptus grandis]
Length=102

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA+Q  VVIFSK++CC+C+A+  L  + GV P ++++D D + G++MERAL RL
Sbjct  1    MDKVARLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIHELDEDPR-GREMERALIRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG  +GS N VM+L L+GSL  MLK
Sbjct  60   GCNPAVPAVFIGGKFVGSANAVMTLQLNGSLKKMLK  95



>ref|XP_007035504.1| Glutaredoxin family protein [Theobroma cacao]
 gb|EOY06430.1| Glutaredoxin family protein [Theobroma cacao]
Length=102

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+C+A+  L  E GV P +Y++D D + GK+ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDAR-GKEMEWALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN  VPAVFIGG  +GS N +M+L L+GSL  +LK
Sbjct  60   GCNPPVPAVFIGGKFVGSANTIMTLQLNGSLKNLLK  95



>tpg|DAA43403.1| TPA: hypothetical protein ZEAMMB73_785146 [Zea mays]
Length=104

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD+V  LA+Q  VVIFS ++CC+C+ V+ L +ELGV P V ++D D   GK+ME+ALAR 
Sbjct  1    MDRVTKLASQRAVVIFSASSCCMCHTVTRLFRELGVNPTVVELDEDPSWGKEMEKALARL  60

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG + +VPAVFIGG L+GST++VMSLHLSG+L  ML+
Sbjct  61   LGRSPAVPAVFIGGRLVGSTDKVMSLHLSGNLDTMLR  97



>gb|AFK39077.1| unknown [Lotus japonicus]
Length=102

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V +LA++  VVIFSK+TCC+C+ +  L  + GV P V++ID +   G+D+E+AL+RL
Sbjct  1    MDRVTTLASERSVVIFSKSTCCMCHTIITLFSDFGVNPTVHEID-EMPRGRDIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG L+G  NEVMSLHL+ SLI ML+
Sbjct  60   GCSPAVPAVFIGGELVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_006419643.1| hypothetical protein CICLE_v10006590mg [Citrus clementina]
 ref|XP_006489133.1| PREDICTED: monothiol glutaredoxin-S10-like [Citrus sinensis]
 gb|ESR32883.1| hypothetical protein CICLE_v10006590mg [Citrus clementina]
 gb|KDO75112.1| hypothetical protein CISIN_1g034165mg [Citrus sinensis]
Length=102

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+C+A+  L  + GV P +Y++D D + GK+ME AL RL
Sbjct  1    MDRVGRLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIYELDEDAR-GKEMEWALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N VM+L L+GSL  +LK
Sbjct  60   GCNPSVPAVFIGGKFVGSANTVMTLQLNGSLKKLLK  95



>ref|XP_004229212.1| PREDICTED: monothiol glutaredoxin-S10 [Solanum lycopersicum]
Length=102

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  +A+Q  VVIFSK++CC+C+A+  L  E GV P +Y++D D  +G+DMER+L RL
Sbjct  1    MERVVKVASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPLIYELDED-MNGRDMERSLLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG  +GS N VM+LH++GSL  MLK
Sbjct  60   GCSPAVPAVFIGGRFVGSANTVMTLHINGSLKKMLK  95



>ref|XP_010649773.1| PREDICTED: monothiol glutaredoxin-S10 [Vitis vinifera]
 emb|CBI26101.3| unnamed protein product [Vitis vinifera]
Length=102

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+ +A+  L  E GV P ++++D D + GK+ME AL RL
Sbjct  1    MDRVGKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIHELDEDSR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N VM+LHL+GSL  MLK
Sbjct  60   GCNPSVPAVFIGGKFVGSANTVMTLHLNGSLKKMLK  95



>gb|KDP40012.1| hypothetical protein JCGZ_02010 [Jatropha curcas]
Length=102

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA Q  VVIFSK++CC+C+A+  L  E  V P +Y++D D + GK+ME AL RL
Sbjct  1    MDRVAKLAGQKAVVIFSKSSCCMCHAIKRLFYEQAVSPAIYELDEDSR-GKEMECALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N VM+LHL+GSL  +L+
Sbjct  60   GCNPSVPAVFIGGKFVGSANTVMTLHLNGSLKKLLR  95



>ref|XP_003593970.1| Monothiol glutaredoxin-S2 [Medicago truncatula]
 gb|AES64221.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=102

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA++  VVIFSK++CC+C+ +  L  + GV P V+++D +   G+D+E+AL RL
Sbjct  1    MERVTQLASERSVVIFSKSSCCMCHTIKTLFSDFGVNPEVHELD-EMSGGRDIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG L+G  NEVMSLHL+ SLI ML+
Sbjct  60   GCNPSVPAVFIGGELVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_009607405.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana tomentosiformis]
 ref|XP_009782550.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana sylvestris]
Length=102

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  +A+Q  VVIFSK++CC+C+A+  L  E GV P +Y++D D  +G++MER+L RL
Sbjct  1    MDRVVKVASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYELDED-INGREMERSLLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG  +GS N VM+LH++GSL  MLK
Sbjct  60   GCSPAVPAVFIGGRFVGSANTVMTLHINGSLKKMLK  95



>ref|XP_002455626.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
 gb|EES00746.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
Length=103

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFS ++CC+C+ V+ L +ELGV P V ++D D + GK+M++ALARL
Sbjct  1    MDRVTKLASQRAVVIFSTSSCCMCHTVTRLFRELGVNPTVVELDQDPR-GKEMDKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVFIGG L+GST+ VMSLHLSG+L+ +L+
Sbjct  60   LGRNPAVPAVFIGGRLVGSTDRVMSLHLSGNLVPLLR  96



>ref|XP_011071467.1| PREDICTED: monothiol glutaredoxin-S10-like [Sesamum indicum]
Length=102

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  LA+Q  VVIFSK+TCC+C+A+  L  E GV P VY+ID +  +G++ ERAL RL
Sbjct  1    METVMKLASQKAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYEID-EQPNGRETERALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG  +GS N +++LHL GSL  MLK
Sbjct  60   GCSPTVPAVFIGGKFVGSANNILTLHLDGSLKKMLK  95



>ref|XP_010241641.1| PREDICTED: monothiol glutaredoxin-S10-like [Nelumbo nucifera]
Length=102

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD +  LA+Q+  VIFSK++CC+ +A   L  ELGV P ++++D D++ G+DME AL RL
Sbjct  1    MDMITKLASQNAAVIFSKSSCCMSHATKRLFYELGVSPAIHELDQDYR-GRDMELALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VP VFIGG  +GST +VMSLHL GSL+ MLK
Sbjct  60   GCNPAVPTVFIGGKFVGSTQKVMSLHLDGSLVPMLK  95



>ref|XP_008390723.1| PREDICTED: monothiol glutaredoxin-S10 [Malus domestica]
 ref|XP_009352226.1| PREDICTED: monothiol glutaredoxin-S10-like [Pyrus x bretschneideri]
Length=102

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+ +A+  L  E GV P +Y++D + + GK+ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESR-GKEMEWALIRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  SVPAVFIGG L+GS N VM+LHL+GSL  +LK
Sbjct  60   GCQPSVPAVFIGGKLVGSANTVMTLHLNGSLKKLLK  95



>ref|XP_007225971.1| hypothetical protein PRUPE_ppa013805mg [Prunus persica]
 gb|EMJ27170.1| hypothetical protein PRUPE_ppa013805mg [Prunus persica]
Length=102

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  +A++  VVIFSK++CC+C+++  L  + GV P VY++D + Q GK++E+AL+RL
Sbjct  1    MEVVTKMASERPVVIFSKSSCCMCHSIKTLFSDFGVNPAVYELD-EMQRGKEIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG  +G  NEVM+LHL  SLI MLK
Sbjct  60   GCNPTVPAVFIGGEFVGGANEVMNLHLQRSLIPMLK  95



>gb|ACJ83991.1| unknown [Medicago truncatula]
 gb|AFK46546.1| unknown [Medicago truncatula]
Length=102

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA++  VVIFSK++CC+C+ +  L  + GV P V+++D +   G+D E+AL RL
Sbjct  1    MERVTQLASERSVVIFSKSSCCMCHTIKTLFSDFGVNPEVHELD-EMSGGRDTEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG L+G  NEVMSLHL+ SLI ML+
Sbjct  60   GCNPSVPAVFIGGELVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_007138394.1| hypothetical protein PHAVU_009G205000g [Phaseolus vulgaris]
 gb|ESW10388.1| hypothetical protein PHAVU_009G205000g [Phaseolus vulgaris]
Length=101

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +3

Query  174  LAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARLGCNSSV  353
            LA ++GVVIF+K++CCLCYAV+IL QELGVKP V+ ID D  +G++ME+AL RLGCN+ V
Sbjct  4    LANENGVVIFTKSSCCLCYAVNILFQELGVKPLVHGIDHD-PEGREMEKALLRLGCNAPV  62

Query  354  PAVFIGGNLIGSTNEVMSLHL  416
            PAVFIGG LIGSTNE+MS  L
Sbjct  63   PAVFIGGKLIGSTNEIMSHRL  83



>ref|XP_007226534.1| hypothetical protein PRUPE_ppa025150mg [Prunus persica]
 ref|XP_008223117.1| PREDICTED: monothiol glutaredoxin-S10 [Prunus mume]
 gb|EMJ27733.1| hypothetical protein PRUPE_ppa025150mg [Prunus persica]
Length=102

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+ +A+  L  E GV P +Y++D + + GK+ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESR-GKEMEWALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  SVPAVFIGG  +GS N VM+LHL+GSL  +LK
Sbjct  60   GCQPSVPAVFIGGKFVGSANAVMTLHLNGSLKKLLK  95



>gb|EYU45572.1| hypothetical protein MIMGU_mgv1a023883mg [Erythranthe guttata]
Length=102

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  LAAQ  VVIFSK+TCC+C+A+  L  E GV P VY++D +  +GK+MERAL RL
Sbjct  1    MECVVKLAAQKAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYELD-EQINGKEMERALIRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  +VPAVF+GG  IGS N+V++LHL GSL   LK
Sbjct  60   GCTPTVPAVFVGGKFIGSANDVLTLHLDGSLKKKLK  95



>emb|CDO98900.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD++  LA+Q  VVIFSK++CC+C+A+  L  E GV P + ++D + + G++ME AL RL
Sbjct  1    MDRIAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMILELDEESR-GQEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N VM+LH++GSL  MLK
Sbjct  60   GCNPSVPAVFIGGKFVGSANTVMTLHVNGSLKKMLK  95



>ref|XP_008353233.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
 ref|XP_008361968.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
Length=102

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q+ VVIFSK++CC+ +AV  L  E GV P +Y++D + + GK+ME AL RL
Sbjct  1    MDRVTKLASQNAVVIFSKSSCCMSHAVKRLFYEQGVSPEIYELDEESR-GKEMECALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  SVPAVFIGG  +GS N VM+LHL+GSL  +LK
Sbjct  60   GCQPSVPAVFIGGKFVGSANTVMTLHLNGSLKKLLK  95



>ref|XP_004486045.1| PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum]
Length=102

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA++  VVIFSK++CC+C+ +  L+ + GV P V+++D +   G+D+E+AL RL
Sbjct  1    MERVTELASERSVVIFSKSSCCMCHTIKTLLSDFGVNPEVHELD-EINGGRDIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +G  NEVMSLHL+ SLI ML+
Sbjct  60   GCNPSVPAVFIGGEFVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_008223118.1| PREDICTED: monothiol glutaredoxin-S2 [Prunus mume]
Length=102

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  +A++  VVIFSK++CC+C+++  L  + GV P VY++D + Q G+++E+AL+RL
Sbjct  1    MEVVTKMASERPVVIFSKSSCCMCHSIKTLFSDFGVNPAVYELD-EMQRGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG+ +G  NEVM+LHL  SLI MLK
Sbjct  60   GCNPTVPAVFIGGDFVGGANEVMNLHLQRSLIPMLK  95



>ref|XP_003546092.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
Length=102

 Score =   115 bits (289),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  +A++  VVIFS+++CC+C+ +  L  + GV P+V+++D +   GKD+E+AL+RL
Sbjct  1    MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELD-EIPRGKDIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFIGG L+G  NEVMSLHL+ SLI ML+
Sbjct  60   GCSPSVPAVFIGGELVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_004494334.1| PREDICTED: glutaredoxin-C11-like [Cicer arietinum]
Length=103

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+VK LA++   VIF+K++CC+C+++  L  ELG  P VY++D D   G++ME AL  L
Sbjct  1    MDRVKDLASKKAAVIFTKSSCCMCHSIKQLFYELGASPAVYELDNDSSYGREMEWALKGL  60

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG  +GS+ +V+SLH+ GSL  ML
Sbjct  61   GCNPSVPAVFIGGKFVGSSKDVISLHVDGSLKQML  95



>ref|XP_010243570.1| PREDICTED: glutaredoxin-C11-like [Nelumbo nucifera]
Length=102

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA++  VVIFSK++CC+C+A+  L  +LGV P +Y++D +   G++MERAL  L
Sbjct  1    MDIVMKLASKKAVVIFSKSSCCMCHAIKTLFYDLGVSPAIYELD-EEAKGREMERALQSL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            G N SVPAVFIGG L+ ST+ +MSLHL GSL+ MLK
Sbjct  60   GLNPSVPAVFIGGRLVNSTSTIMSLHLCGSLVPMLK  95



>ref|NP_001043047.1| Os01g0368900 [Oryza sativa Japonica Group]
 sp|Q7G8Y5.1|GRXC1_ORYSJ RecName: Full=Glutaredoxin-C1 [Oryza sativa Japonica Group]
 gb|AAK53837.1|AC011806_14 Putative glutaredoxin [Oryza sativa]
 dbj|BAB64731.1| glutaredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAB64761.1| P0560B06.28 [Oryza sativa Japonica Group]
 dbj|BAD88356.1| glutaredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAD89485.1| putative glutaredoxin 1 [Oryza sativa Japonica Group]
 dbj|BAF04961.1| Os01g0368900 [Oryza sativa Japonica Group]
 gb|EAY74062.1| hypothetical protein OsI_01950 [Oryza sativa Indica Group]
 gb|EAZ11913.1| hypothetical protein OsJ_01785 [Oryza sativa Japonica Group]
Length=103

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LAAQ  VVIFS ++CC+C+ V+ L  ELGV P V ++D D + GK+ME+ALARL
Sbjct  1    MDRVNRLAAQRAVVIFSMSSCCMCHTVTRLFCELGVNPTVVELDEDPR-GKEMEKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G + +VPAVFIGG L+GST++VMSLHLSG+L+ +L+
Sbjct  60   LGRSPAVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLR  96



>ref|XP_008353232.1| PREDICTED: monothiol glutaredoxin-S2-like [Malus domestica]
 ref|XP_008361967.1| PREDICTED: monothiol glutaredoxin-S2-like [Malus domestica]
Length=102

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V ++A++  VVIFSK++CC+ +++  L+ + GV P VY++D   Q G+++E+AL+RL
Sbjct  1    MDAVTNMASERPVVIFSKSSCCMSHSIKTLLCDFGVNPAVYELD-QMQRGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG L+G  NEVMSLHL  SLI MLK
Sbjct  60   GCNPTVPAVFIGGELVGGANEVMSLHLKRSLIPMLK  95



>ref|XP_004968750.1| PREDICTED: glutaredoxin-C1-like [Setaria italica]
Length=103

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD+V  LA+Q  VVIFS ++CC+C+ V+ L +ELGV P V ++D D + GK+ME+ALAR 
Sbjct  1    MDRVTKLASQRAVVIFSMSSCCMCHTVTRLFRELGVNPTVVELDEDPR-GKEMEKALARL  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG + +VPAVFIGG L GST++VMSLHLSG+L+ +L+
Sbjct  60   LGRSPAVPAVFIGGRLAGSTDKVMSLHLSGNLVPLLR  96



>ref|XP_008651112.1| PREDICTED: glutaredoxin-C1-like [Zea mays]
Length=197

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD+V  LA+Q  VVIFS ++CC+C+ V+ L +ELGV P V ++D D   GK+ME+ALAR 
Sbjct  94   MDRVTKLASQRAVVIFSASSCCMCHTVTRLFRELGVNPTVVELDEDPSWGKEMEKALARL  153

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG + +VPAVFIGG L+GST++VMSLHLSG+L  ML+
Sbjct  154  LGRSPAVPAVFIGGRLVGSTDKVMSLHLSGNLDTMLR  190



>ref|XP_009369121.1| PREDICTED: monothiol glutaredoxin-S2-like [Pyrus x bretschneideri]
 ref|XP_009339842.1| PREDICTED: monothiol glutaredoxin-S2-like [Pyrus x bretschneideri]
Length=102

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V ++A++  VVIFSK++CC+ + +  L+ + GV P VY++D   Q G+++E+AL+RL
Sbjct  1    MDAVTNMASERPVVIFSKSSCCMSHTIKTLLCDFGVNPAVYELD-QMQRGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG L+G  NEVMSLHL  SLI MLK
Sbjct  60   GCNPTVPAVFIGGELVGGANEVMSLHLRRSLIPMLK  95



>ref|XP_004296803.1| PREDICTED: monothiol glutaredoxin-S10-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++CC+ +A+  L  E GV P +Y++D + + GK+ME AL RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  SVPAVFIGG  +GS N VM+LHL+G+L  +LK
Sbjct  60   GCQPSVPAVFIGGKFVGSANTVMTLHLNGTLKKLLK  95



>ref|XP_008390722.1| PREDICTED: monothiol glutaredoxin-S2 [Malus domestica]
Length=102

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  +A++  VVIFSK++CC+ +++  L+ + GV P VY++D + Q G+++E+AL+RL
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLCDFGVNPAVYELD-EMQRGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG L+G  NEVMSLHL  SLI MLK
Sbjct  60   GCNPTVPAVFIGGELVGGANEVMSLHLKRSLIPMLK  95



>ref|XP_004486046.1| PREDICTED: monothiol glutaredoxin-S10-like [Cicer arietinum]
Length=102

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++C + +A+  L  E GV P +Y++D D + GK+ME AL RL
Sbjct  1    MDRVSKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDKR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N +M+LHL+GSL  ML+
Sbjct  60   GCNPSVPAVFIGGKFVGSANIIMTLHLNGSLKKMLR  95



>ref|XP_009369117.1| PREDICTED: monothiol glutaredoxin-S10-like [Pyrus x bretschneideri]
 ref|XP_009339846.1| PREDICTED: monothiol glutaredoxin-S10-like [Pyrus x bretschneideri]
Length=102

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V +LA+Q+ +VIFSK++CC+ +AV  L  E GV P +Y++D + + GK+ME AL RL
Sbjct  1    MDRVTNLASQNAIVIFSKSSCCMSHAVKRLFYEQGVSPAIYELDEESR-GKEMECALTRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  SVPAVFIGG  +GS N VM+LHL+GSL  +LK
Sbjct  60   GCQPSVPAVFIGGKCVGSANTVMTLHLNGSLKKLLK  95



>ref|XP_003529587.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN02996.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++C +C+A+  L  ELGV P +Y++D + + GK++E  L RL
Sbjct  1    MDRVAKLASQKAVVIFSKSSCGMCHAIKRLFYELGVGPTIYEVDEESR-GKEIEWCLMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +G+ N VM+LHL+GSL  ML+
Sbjct  60   GCNPSVPAVFIGGKFVGAPNTVMTLHLNGSLKKMLR  95



>ref|XP_008796225.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=103

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD++  LA+Q  VVIFS ++CC+C+ V  L  +LGV P ++++D D + GKDMERALA+ 
Sbjct  1    MDRINRLASQKAVVIFSLSSCCMCHTVKTLFSDLGVSPAIHELDEDPK-GKDMERALAKM  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG +  VPAVFIGGNL+G T+++MSLHLSG L+ +L+
Sbjct  60   LGRSPPVPAVFIGGNLVGPTDKIMSLHLSGKLVPLLR  96



>ref|XP_011071468.1| PREDICTED: monothiol glutaredoxin-S10-like [Sesamum indicum]
Length=102

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  + +Q  VVIFSK++CC+C+A+  L  E GV P V++ID D + GKD+E AL +L
Sbjct  1    MDRVAKIVSQKAVVIFSKSSCCMCHAIKRLFYEQGVSPLVHEIDEDSR-GKDIEWALTKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG L+GS N VM+L L+GSL  MLK
Sbjct  60   GCSPAVPAVFIGGKLVGSANTVMTLQLNGSLKKMLK  95



>ref|XP_010243566.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=102

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA+Q  VVIFSK++CC+C+ +  L  + GV P VY++D D + G+++E+AL RL
Sbjct  1    MERVMKLASQRAVVIFSKSSCCICHTIKTLFSDFGVSPTVYELDEDPR-GRELEKALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG L+G   EVM+  L GSL  +LK
Sbjct  60   GCNPSVPAVFIGGKLVGGAKEVMTRQLDGSLKELLK  95



>ref|XP_003567688.1| PREDICTED: glutaredoxin-C1 [Brachypodium distachyon]
Length=103

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA Q  VVIFS ++CC+C++V  L +ELGV P V ++D D + GK+M++AL RL
Sbjct  1    MDRVTKLAGQRAVVIFSMSSCCMCHSVMRLFRELGVNPTVVELDEDPR-GKEMDKALVRL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVFIGG L+GST++VMSLHLSG+L+ +L+
Sbjct  60   LGRNPAVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLR  96



>ref|XP_009411702.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
Length=103

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD+V+ LA+Q  VV+FS ++CC+C+ +  L  ELGV P V+++D D + GKDMERALA  
Sbjct  1    MDRVRRLASQRAVVVFSLSSCCMCHTIKRLFCELGVNPAVHELDEDPK-GKDMERALANM  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG +  VPAVFIGGNL+G T+EVM+LHL G L+ +L+
Sbjct  60   LGRSPPVPAVFIGGNLVGPTDEVMALHLGGKLVPLLR  96



>ref|XP_004296804.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  + ++  VVIFSK++CC+ Y++  L+ + GV P VY++D + Q G+++E+AL RL
Sbjct  1    MEAVTKMVSERPVVIFSKSSCCISYSIKTLLSDFGVNPAVYELD-EMQRGREIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFIGG  +G  NE+MSLHL  SLI MLK
Sbjct  60   GCSPSVPAVFIGGEFVGGANEIMSLHLKRSLIPMLK  95



>ref|XP_008802104.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=103

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFS ++CC+C+ +     ELGV P ++++D D + GKDMERALA++
Sbjct  1    MDRVNKLASQKAVVIFSLSSCCMCHTIKRFFSELGVNPTIHELDEDPK-GKDMERALAKM  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N  VPAVFIGG+L+G T+++MSLHLSG L+ +L+
Sbjct  60   VGRNPPVPAVFIGGSLVGPTDKIMSLHLSGKLVPLLR  96



>ref|XP_011033600.1| PREDICTED: glutaredoxin-C11 [Populus euphratica]
Length=102

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV+ LA+++  VIF+K++CC+C+++  L  ELG  P ++++D +  +GK+MERAL  L
Sbjct  1    MDKVRDLASRNAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDRE-ANGKEMERALRGL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN +VPAVFIGG  +GS  +V+SLHL GSL  ML
Sbjct  60   GCNPTVPAVFIGGKWVGSAKDVLSLHLDGSLKQML  94



>ref|XP_004296808.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  +A++  VVIFSK++CC+ +++  L+ + GV P VY++D + Q G+++E+AL RL
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELD-EMQRGREIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFIGG  +G  NEVMSLHL  SLI MLK
Sbjct  60   GCSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLK  95



>ref|XP_003593973.1| Monothiol glutaredoxin-S4 [Medicago truncatula]
 gb|AES64224.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=102

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD++  LA+Q  VVIFSK++C + +A+  L  E GV P +Y++D D + G++ME AL RL
Sbjct  1    MDRISKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDKR-GREMEWALIRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N +M+LHL+GSL  ML+
Sbjct  60   GCNPSVPAVFIGGKFVGSANIIMTLHLNGSLKKMLR  95



>gb|AFK43054.1| unknown [Lotus japonicus]
Length=102

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++C + +A+  L  E GV P +Y++D + + GK+ME AL RL
Sbjct  1    MDRVSKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEELR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +GS N V++LHLSGSL  ML+
Sbjct  60   GCNPSVPAVFIGGKFVGSANTVITLHLSGSLKRMLR  95



>ref|XP_007147879.1| hypothetical protein PHAVU_006G162600g [Phaseolus vulgaris]
 gb|ESW19873.1| hypothetical protein PHAVU_006G162600g [Phaseolus vulgaris]
Length=147

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+++  LA+Q  VVIFSK++C + +A+  L  E GV P +Y++D D + GK+ME AL RL
Sbjct  46   MERITKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDIR-GKEMEWALMRL  104

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVF+GGN +GS N VM+LHL+GSL  ML+
Sbjct  105  GCNPSVPAVFVGGNFVGSANTVMTLHLNGSLKKMLR  140



>ref|XP_006594493.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN47301.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+++  LA+Q  VVIFSK++C + +A+  L  E GV P +Y++D D + GK+ME AL RL
Sbjct  1    MERITKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDTR-GKEMEWALMRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVF+GG  +GS N VM+LHL+GSL  ML+
Sbjct  60   GCNPSVPAVFVGGKFVGSANTVMTLHLNGSLKKMLR  95



>emb|CDO98899.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD +  LA+Q  VVIFSK++CC+C+A+  L  E GV P +Y+ID    +G ++E AL RL
Sbjct  1    MDSIVKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYEID-QISNGTEIEWALIRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGGN +GS + VM+L ++GSL  MLK
Sbjct  60   GCNPSVPAVFIGGNFVGSASTVMTLQINGSLKKMLK  95



>ref|XP_006406267.1| hypothetical protein EUTSA_v10021819mg [Eutrema salsugineum]
 gb|ESQ47720.1| hypothetical protein EUTSA_v10021819mg [Eutrema salsugineum]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V +LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVATLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+  VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPPVPAVFVGGKFVGTANTVMTLHLNGSLKRLLK  95



>ref|XP_004296805.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  +A++  VVIFSK++CC+ +++  L+ + GV P VY++D  H+ G+++E+AL RL
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELDEMHR-GREIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFIGG  +G  NEVMSLHL  SLI MLK
Sbjct  60   GCSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLK  95



>ref|XP_003546093.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN33128.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+++  LA+Q  VVIFSK++C + +A+  L  E GV P +Y++D D + GK+ME AL RL
Sbjct  1    MERITKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDTR-GKEMEWALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVF+GG  +GS N VM+LHL+GSL  ML+
Sbjct  60   GCNPSVPAVFVGGKFVGSANTVMTLHLNGSLKKMLR  95



>ref|XP_010243568.1| PREDICTED: monothiol glutaredoxin-S10-like [Nelumbo nucifera]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q   V+FSK++CC+ + +     ELGV P ++++D +++ G++ME AL +L
Sbjct  1    MDRVTKLASQSAAVVFSKSSCCMSHVIKRFFYELGVNPAIHELDEEYR-GREMEMALLKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG  IGST +VM+LH++GSLI +LK
Sbjct  60   GCNPAVPAVFIGGKFIGSTQKVMALHINGSLIPLLK  95



>gb|KFK39456.1| hypothetical protein AALP_AA3G247200 [Arabis alpina]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIIEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGTANTVMTLHLNGSLKKLLK  95



>ref|XP_009352227.1| PREDICTED: monothiol glutaredoxin-S2 [Pyrus x bretschneideri]
Length=102

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  +A++  VVIFSK++CC+ +++  L+ + GV P VY++D + Q G+++E+AL+RL
Sbjct  1    MEAVTKMASERPVVIFSKSSCCISHSIKTLLCDFGVNPAVYELD-EMQRGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN +VPAVFIGG L+G  NEVMSLHL  SLI ML
Sbjct  60   GCNPTVPAVFIGGELVGGANEVMSLHLKRSLIPML  94



>gb|KHN47302.1| Monothiol glutaredoxin-S4 [Glycine soja]
Length=102

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  +A++  VVIFS+++CC+C+ +  L  + GV P+V+++D +   G D+E+AL+RL
Sbjct  1    MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELD-EIPRGNDIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVP VFIGG L+G  NEVMSLHL+ SLI ML+
Sbjct  60   GCSPSVPVVFIGGELVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_004968749.1| PREDICTED: glutaredoxin-C1-like [Setaria italica]
Length=103

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LAAQ  VVIFS ++CC+C+ V+ L +ELGV   V ++D D + G +ME+ALARL
Sbjct  1    MDRVTRLAAQRAVVIFSTSSCCMCHTVTQLFRELGVNATVVELDEDPR-GNEMEKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G ++ VPAVFIGG L+GST++VMSLHLSG+L+ +L+
Sbjct  60   LGRSTGVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLR  96



>ref|XP_007035505.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOY06431.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=102

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA++  VVIFSK++CC+C+ +  L  + GV P V+++D +   G+++E+AL+RL
Sbjct  1    MERVTKLASEKPVVIFSKSSCCMCHTIKTLFYDFGVNPAVHELD-EIARGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVF+GG L+G  NEVMSLHL+ SLI ML+
Sbjct  60   GCSPSVPAVFVGGELVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_010904788.1| PREDICTED: glutaredoxin-C1-like [Elaeis guineensis]
Length=103

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD+V SLA+Q  VVIFSK++CC+C+ V  L  ELGV P VY++D + + G++ME+AL + 
Sbjct  1    MDRVMSLASQRAVVIFSKSSCCMCHTVKRLFCELGVNPAVYELD-EVRGGREMEKALVQL  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG +  +PAVFIGGNLIGST+ VMSLHL G+L+ +L+
Sbjct  60   LGRSPPLPAVFIGGNLIGSTDRVMSLHLGGNLVSLLR  96



>ref|XP_002885441.1| electron carrier/ protein disulfide oxidoreductase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61700.1| electron carrier/ protein disulfide oxidoreductase [Arabidopsis 
lyrata subsp. lyrata]
Length=102

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGTANTVMTLHLNGSLKMLLK  95



>ref|XP_007154237.1| hypothetical protein PHAVU_003G101900g [Phaseolus vulgaris]
 gb|ESW26231.1| hypothetical protein PHAVU_003G101900g [Phaseolus vulgaris]
Length=102

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFSK++C +C+A+  L  ELGV P +Y++D +   GK++E  L +L
Sbjct  1    MDRVAKLASQKAVVIFSKSSCGMCHAIKRLFYELGVAPAIYEVD-EVSRGKEIEWCLMKL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN SVPAVFIGG  +G+ N VM+LHL+GSL  ML+
Sbjct  60   GCNPSVPAVFIGGKFVGAANTVMTLHLNGSLKKMLR  95



>ref|XP_006299130.1| hypothetical protein CARUB_v10015272mg [Capsella rubella]
 ref|XP_010510226.1| PREDICTED: monothiol glutaredoxin-S10 [Camelina sativa]
 gb|EOA32028.1| hypothetical protein CARUB_v10015272mg [Capsella rubella]
Length=102

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGTANTVMTLHLNGSLKMLLK  95



>dbj|BAJ89491.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=103

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA Q  VVIFS ++CC+C+ V+ L ++LG  P   D+D D + GK+ME+ALARL
Sbjct  1    MEQVTKLAGQRAVVIFSMSSCCMCHTVTRLFRDLGANPAEVDLDEDPR-GKEMEKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVFIGG L+GST++VMSLHLSG L+ +L+
Sbjct  60   LGRNPAVPAVFIGGRLVGSTDKVMSLHLSGKLVPLLR  96



>ref|XP_010241681.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=103

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV  L +Q  VVIFSK++CC+C+ +  L  +LGV P VY++D D Q GK++E+AL RL
Sbjct  1    MEKVMKLVSQKPVVIFSKSSCCMCHTIKTLFCDLGVNPAVYELDEDPQ-GKEIEKALLRL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             GCN +VPAVF+GGNL+G  NEVM+  L+GSL   LK
Sbjct  60   LGCNPAVPAVFVGGNLVGGANEVMTRQLNGSLKTQLK  96



>gb|KFK39447.1| hypothetical protein AALP_AA3G246300 [Arabis alpina]
Length=102

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GK++E ALARL
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPEIIEIDQDMY-GKEIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGTANTVMTLHLNGSLKKLLK  95



>ref|XP_009135750.1| PREDICTED: monothiol glutaredoxin-S10 [Brassica rapa]
 emb|CDY48891.1| BnaA03g36300D [Brassica napus]
 emb|CDY32431.1| BnaC03g42150D [Brassica napus]
Length=102

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V +LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID +   GKD+E ALARL
Sbjct  1    MDVVATLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQNMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGTANTVMTLHLNGSLKRLLK  95



>ref|NP_001078198.1| monothiol glutaredoxin-S10 [Arabidopsis thaliana]
 sp|Q9LIF1.1|GRS10_ARATH RecName: Full=Monothiol glutaredoxin-S10; Short=AtGrxS10; AltName: 
Full=Protein ROXY 3 [Arabidopsis thaliana]
 dbj|BAB03058.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|ABF59441.1| unknown protein [Arabidopsis thaliana]
 gb|ACO50408.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE76510.1| monothiol glutaredoxin-S10 [Arabidopsis thaliana]
Length=102

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGTANTVMTLHLNGSLKILLK  95



>gb|EMT12568.1| Glutaredoxin-C1 [Aegilops tauschii]
Length=103

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA Q  VVIFS ++CC+C+ V+ L ++LG  P   D+D D + GK+ME+ALARL
Sbjct  1    MEQVTKLAGQRAVVIFSMSSCCMCHTVARLFRDLGANPAEVDLDEDPR-GKEMEKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVFIGG L+GST++VMSLHLSG L+ +L+
Sbjct  60   LGRNPAVPAVFIGGRLVGSTDKVMSLHLSGKLVPLLR  96



>gb|ABK28101.1| unknown [Arabidopsis thaliana]
Length=103

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G+ N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGTANTVMTLHLNGSLKILLK  95



>ref|XP_006594494.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
Length=154

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  +A++  VVIFS+++CC+C+ +  L  + GV P+V+++D +   G D+E+AL+RL
Sbjct  53   MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELD-EIPRGNDIEQALSRL  111

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVP VFIGG L+G  NEVMSLHL+ SLI ML+
Sbjct  112  GCSPSVPVVFIGGELVGGANEVMSLHLNRSLIPMLR  147



>ref|XP_004296807.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  +A++  VVIFSK++CC+ +++  L+ + GV P VY++D + Q G+++E+ L RL
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELD-EMQRGREIEQVLLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFIGG  +G  NEVMSLHL  SLI MLK
Sbjct  60   GCSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLK  95



>ref|XP_006644173.1| PREDICTED: glutaredoxin-C1-like [Oryza brachyantha]
Length=103

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LAAQ  VV+FS ++CC+C+ V+ L+ ELGV P V ++D D + GK+ME+ALARL
Sbjct  1    MERVNKLAAQRAVVMFSMSSCCMCHTVTRLLCELGVNPTVVELDEDPR-GKEMEKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G + +VPAVF GG L+GST++VMSLHLSG+L+ +L+
Sbjct  60   LGRSPAVPAVFTGGGLVGSTDKVMSLHLSGNLVPLLR  96



>ref|XP_010524509.1| PREDICTED: monothiol glutaredoxin-S4 [Tarenaya hassleriana]
Length=102

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+K++ + ++  VVIFSK +CC+ + +  L  + GV P VY++D +  +G++MERALA+L
Sbjct  1    MEKLQKMVSEKPVVIFSKNSCCMSHTIKTLFYDFGVNPTVYELD-EIDNGREMERALAQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG L+G  N+VMSLHL+ SLI MLK
Sbjct  60   GCSPTVPAVFVGGQLVGGANQVMSLHLNRSLIPMLK  95



>ref|XP_004296806.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  + ++  VVIFSK++CC+ +++  L+ + GV P VY++D + Q G+++E+AL RL
Sbjct  1    MEAVTKMVSERPVVIFSKSSCCISHSIKTLLSDFGVNPAVYELD-EMQRGREIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFIGG  +G  NEVMSLHL  SLI MLK
Sbjct  60   GCSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLK  95



>ref|XP_006406268.1| hypothetical protein EUTSA_v10021818mg [Eutrema salsugineum]
 gb|ESQ47721.1| hypothetical protein EUTSA_v10021818mg [Eutrema salsugineum]
Length=102

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVARLASQSAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+  VPAVF+GG  +G+ N VM+LHL GSL  +LK
Sbjct  60   GCSPPVPAVFVGGKFVGTANTVMTLHLDGSLKRLLK  95



>ref|XP_010098332.1| Monothiol glutaredoxin-S2 [Morus notabilis]
 gb|EXB74836.1| Monothiol glutaredoxin-S2 [Morus notabilis]
Length=102

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  + ++  VVIFS++TCC+C+ +  L  + GV P VY++D + + G+++E+AL+ L
Sbjct  1    MERVTKMVSEKPVVIFSRSTCCMCHTIKTLFCDFGVNPAVYELDEEPR-GREIEQALSML  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG L+G  NEVMSLHL  SLI MLK
Sbjct  60   GCSPTVPAVFIGGELVGGANEVMSLHLKRSLIPMLK  95



>ref|XP_010466387.1| PREDICTED: monothiol glutaredoxin-S10-like [Camelina sativa]
 ref|XP_010488159.1| PREDICTED: monothiol glutaredoxin-S10-like [Camelina sativa]
Length=102

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID D   GKD+E ALARL
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMY-GKDIEWALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVF+GG  +G  N VM+LHL+GSL  +LK
Sbjct  60   GCSPTVPAVFVGGKFVGMANTVMTLHLNGSLKMLLK  95



>ref|XP_007147880.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris]
 gb|ESW19874.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris]
Length=102

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  +A++  VVIFS+++CC+C+ +  L  + GV P+V+++D +   G+D+E+AL+RL
Sbjct  1    MDRVVQMASERPVVIFSRSSCCMCHTIKTLFNDFGVNPNVHELD-EIPRGRDIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG L+G  +EVMSLHL+ +LI  L
Sbjct  60   GCNPSVPAVFIGGELVGGASEVMSLHLNRTLIPRL  94



>ref|XP_010243565.1| PREDICTED: monothiol glutaredoxin-S2 [Nelumbo nucifera]
Length=102

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V SLA+Q  VVIFSK++CC+C+ +  LI + G  P VY++D D + G+++ERAL RL
Sbjct  1    MERVTSLASQSPVVIFSKSSCCMCHTIKTLISDYGASPTVYELDLDPR-GREIERALVRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GC  SVPAVFIGG L+G  NEVM+  L  SL  +L
Sbjct  60   GCKPSVPAVFIGGRLVGGANEVMTRQLDRSLKELL  94



>ref|XP_002275384.1| PREDICTED: monothiol glutaredoxin-S2 [Vitis vinifera]
 emb|CBI26100.3| unnamed protein product [Vitis vinifera]
Length=103

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +3

Query  165  VKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARLGCN  344
            V  LA++  VVIFSK++CC+C+ +  L  + GV P V+++D +   G+++E+ALARLGCN
Sbjct  5    VARLASERPVVIFSKSSCCMCHTIKTLFSDFGVNPAVHELD-EMPRGREIEQALARLGCN  63

Query  345  SSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             +VP VFIGG  +G TNE+M+LHL+ SLI MLK
Sbjct  64   PTVPTVFIGGERVGGTNEIMTLHLNRSLIPMLK  96



>ref|XP_007050807.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOX94964.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=102

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV+ LA++   VIF+K++CC+CY++  L  ELG  P ++++D D   G+DME AL  L
Sbjct  1    MDKVRDLASKKAAVIFTKSSCCMCYSIKTLFYELGASPAIHELDHD-PSGRDMEWALRGL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GC+ SVPAVFIGG  +GS  +V+SLH+ GSL  ML
Sbjct  60   GCDPSVPAVFIGGRFVGSAKDVISLHVDGSLKQML  94



>ref|XP_002320360.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE98675.1| glutaredoxin family protein [Populus trichocarpa]
Length=102

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV+ LA+++  VIF+K++CC+C+++  L  ELG  P ++++D +  +GK+ME AL  L
Sbjct  1    MDKVRDLASRNAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDRE-ANGKEMEWALRGL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN +VPAVFIGG  +GS  +V+SLHL GSL  ML
Sbjct  60   GCNPTVPAVFIGGKWVGSAKDVLSLHLDGSLKQML  94



>ref|XP_002455625.1| hypothetical protein SORBIDRAFT_03g014790 [Sorghum bicolor]
 gb|EES00745.1| hypothetical protein SORBIDRAFT_03g014790 [Sorghum bicolor]
Length=103

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MD+V  LA+Q  VVIFS +TCC+C+ V+ L +ELGV   V ++D + + GK+ME+ LAR 
Sbjct  1    MDQVTRLASQRAVVIFSTSTCCMCHTVTQLFRELGVNTMVVELDKEPR-GKEMEKGLARL  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG ++ VPAVFIGG L+GST++VMSLHLSG+L+ +L+
Sbjct  60   LGRSAGVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLR  96



>emb|CDY32430.1| BnaC03g42140D [Brassica napus]
Length=102

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID  +  GKD+ERALARL
Sbjct  1    MDVVARLASQSAVVIFSKSTCCMSHAIKCLFYEQGVSPAIVEID-QYMYGKDIERALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+  VP VFIGG L+G+   VM+LHL GSL  +LK
Sbjct  60   GCSPQVPVVFIGGKLVGTATTVMTLHLDGSLKRLLK  95



>ref|XP_006419644.1| hypothetical protein CICLE_v10006286mg [Citrus clementina]
 ref|XP_006489134.1| PREDICTED: monothiol glutaredoxin-S2-like [Citrus sinensis]
 gb|ESR32884.1| hypothetical protein CICLE_v10006286mg [Citrus clementina]
 gb|KDO75111.1| hypothetical protein CISIN_1g034075mg [Citrus sinensis]
Length=104

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  +A++  VVIFSK++CC+C+++  L  + GV P VY++D +   G+++E+ L RL
Sbjct  3    MERVAKMASERPVVIFSKSSCCICHSIKTLFCDFGVNPAVYELD-EMPGGRELEQDLQRL  61

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG L+G  N+VMSLHL+ SLI MLK
Sbjct  62   GCSPAVPAVFIGGELVGGANQVMSLHLNRSLIPMLK  97



>ref|XP_009135749.1| PREDICTED: monothiol glutaredoxin-S10-like [Brassica rapa]
 emb|CDY48890.1| BnaA03g36290D [Brassica napus]
Length=102

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID  +  GKD+ERALARL
Sbjct  1    MDVVARLASQSAVVIFSKSTCCMSHAIKCLFYEQGVSPAIVEID-QYMYGKDIERALARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+  VP VFIGG LIG+   VM+LHL G+L  +LK
Sbjct  60   GCSPQVPVVFIGGKLIGTATTVMTLHLDGTLKRLLK  95



>ref|XP_002873906.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50165.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD +  +  +  VVI+SK++CC+ + +  L+ + G  P VY++D +   G+D+ERAL RL
Sbjct  1    MDMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELD-ELPRGRDIERALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG L+G  NEVMSLHL+GSLI MLK
Sbjct  60   GCSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLK  95



>gb|KDP28095.1| hypothetical protein JCGZ_13866 [Jatropha curcas]
Length=102

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V+ LA+    VIF+K++CC+C+++  L  ELG  P ++++D D  +G++ME AL  L
Sbjct  1    MDRVRDLASTRAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDRD-ANGREMEWALRGL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG  +GS  +V+SLHL GSL  ML
Sbjct  60   GCNPSVPAVFIGGKYVGSAKDVLSLHLDGSLKQML  94



>gb|EYU43910.1| hypothetical protein MIMGU_mgv1a020927mg [Erythranthe guttata]
Length=103

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+C+A+  L  E GV P VY++D +  +G++MERAL RL
Sbjct  1    MDCVLKLASQRAVVIFSKSTCCMCHAIKRLFYEQGVSPTVYELD-ELVNGREMERALVRL  59

Query  336  GCN-SSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+  ++PAVF+GG L+GS+  V++LH+ GSL  MLK
Sbjct  60   GCSGPTLPAVFVGGKLVGSSKNVLTLHIDGSLKKMLK  96



>ref|XP_004296809.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V  LA++  VVIFSK++CC+ Y +  L  + GV P V+++D + Q GK++E+AL RL
Sbjct  1    MEVVTKLASERPVVIFSKSSCCMSYTIKTLFCDFGVNPAVHELD-EMQRGKEIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             C+ SVPAVFIGG  +G  NEVMSLHL  SLI MLK
Sbjct  60   RCSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLK  95



>gb|EMT12569.1| Glutaredoxin-C1 [Aegilops tauschii]
Length=103

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA Q  VVIF  ++CC+C+ V+ L+++LG  P V ++D D   GK+ME+ALARL
Sbjct  1    MEQVTKLAGQRAVVIFGMSSCCMCHTVTTLLRDLGANPTVVELDEDPW-GKEMEKALARL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVFIGG L+G T++VMSLHLSG L+ +L+
Sbjct  60   LGRNPAVPAVFIGGRLVGCTDKVMSLHLSGKLVPLLR  96



>gb|EYU34223.1| hypothetical protein MIMGU_mgv1a023043mg [Erythranthe guttata]
Length=103

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q+ VVIFSK+TCC+C+A+  L  E GV P VY++D +  +G+++ERAL RL
Sbjct  1    MDCVLKLASQNAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYELD-ELLNGREIERALVRL  59

Query  336  GCN-SSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+  ++PAVFIGG L+GST  +++LH++GSL  MLK
Sbjct  60   GCSGPTLPAVFIGGKLVGSTKNLLTLHINGSLEKMLK  96



>emb|CDP03538.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD ++ LA++   VIF+K++CC+C+++  L  ELG  P V+++D D   G++MERAL  L
Sbjct  1    MDTIRDLASKKAAVIFTKSSCCMCHSIKALFYELGASPAVHELDHD-ASGREMERALRSL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN +VPAVFIGG  +GS  +V+SLH+ GSL  ML
Sbjct  60   GCNPAVPAVFIGGEFVGSAKDVISLHVDGSLKQML  94



>ref|XP_004495991.1| PREDICTED: glutaredoxin-C11-like [Cicer arietinum]
Length=102

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+VK LA++   VIF+K++C +C++++ L  ELG  P V+++D D   G++MERAL  L
Sbjct  1    MDRVKDLASKKAAVIFTKSSCYMCHSITQLFYELGASPAVHELDNDVY-GREMERALRSL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG  +GS+ +V+SLH+ GSL  ML
Sbjct  60   GCNPSVPAVFIGGKFVGSSKDVISLHVDGSLKQML  94



>ref|XP_004309686.1| PREDICTED: glutaredoxin-C11-like [Fragaria vesca subsp. vesca]
Length=102

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ V+ LA +   VIF+K++CC+C++V  L  ELG  P +++ID  + +G+DME AL +L
Sbjct  1    MESVRELATEKAAVIFTKSSCCICHSVKSLFYELGASPAIHEIDR-YSNGRDMESALRQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN S PAVFIGG  +GS+ +++SLH+ GSL  MLK
Sbjct  60   GCNPSFPAVFIGGKYVGSSKDIISLHVDGSLKQMLK  95



>gb|KFK22959.1| hypothetical protein AALP_AAs50914U000200 [Arabis alpina]
Length=102

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+KV+ + ++  VVIFSK +CC+ + +  L  + GV P +Y++D +   GKD+E+ALA+L
Sbjct  1    MEKVQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELD-EITRGKDIEQALAQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VP VFIGG LIG  N+VMSLHL+ SLI MLK
Sbjct  60   GCSPTVPVVFIGGQLIGGANQVMSLHLNRSLIPMLK  95



>ref|XP_009419009.1| PREDICTED: putative glutaredoxin-C14 [Musa acuminata subsp. malaccensis]
Length=103

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MDKV  LA+Q  VVIFS+++CC CY+V  L  ELGV   V+++D D + G +ME+AL + 
Sbjct  1    MDKVTKLASQRAVVIFSRSSCCFCYSVKSLFHELGVNAAVHELDEDPR-GAEMEKALVKL  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG  S VPAVFIGG L+GST+ +M+LHL G+L+ +L+
Sbjct  60   LGRKSPVPAVFIGGKLVGSTDRIMTLHLGGNLVPLLR  96



>ref|XP_006284819.1| hypothetical protein CARUB_v10006098mg [Capsella rubella]
 gb|EOA17717.1| hypothetical protein CARUB_v10006098mg [Capsella rubella]
Length=102

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDK++ + ++  VVIFSK +CC+ + +  L  +LGV P +Y++D  ++ GK++E+ALA+L
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEINR-GKEIEQALAQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VP VFIGG L+G  N+VMSLHL+ SLI MLK
Sbjct  60   GCSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLK  95



>ref|XP_009109577.1| PREDICTED: monothiol glutaredoxin-S10-like [Brassica rapa]
 emb|CDY37292.1| BnaA01g25120D [Brassica napus]
 emb|CDY19270.1| BnaC01g32100D [Brassica napus]
Length=102

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD V  LA+Q  VVIFSK+TCC+ +A+  L  E GV P + +ID +   GKD+E +LARL
Sbjct  1    MDVVARLASQSAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQEMY-GKDIEWSLARL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+  VPAVF+GG  +G+ N VM+LHL GSL  +LK
Sbjct  60   GCSPPVPAVFVGGKFVGTANTVMTLHLDGSLKRLLK  95



>ref|XP_008804595.1| PREDICTED: glutaredoxin-C1 [Phoenix dactylifera]
Length=191

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERAL-AR  332
            MD V  LA+Q  VVIFSK++CCLC+ +  L  ELGV P VY++D D + GK+MERAL   
Sbjct  1    MDMVLKLASQRAVVIFSKSSCCLCHTIKRLFLELGVNPAVYELDEDSR-GKEMERALIIL  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG +  VPAVFIGG L+GST+ +MSLHL G L+ +L+
Sbjct  60   LGRSPPVPAVFIGGKLVGSTDRIMSLHLGGQLVPLLR  96



>ref|XP_009414476.1| PREDICTED: putative glutaredoxin-C14 [Musa acuminata subsp. malaccensis]
Length=103

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            MDKV  LA+Q  VV+FS++ CC CY+V  L  ELGV   V+++D D   G +ME+ALAR 
Sbjct  1    MDKVMKLASQRAVVVFSRSNCCFCYSVKSLFHELGVSAAVHELDED-PSGPEMEKALARL  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LG    VPAVFIGG L+GST ++M+LHL G L+ +L+
Sbjct  60   LGRKPPVPAVFIGGQLVGSTEKIMTLHLGGDLVPLLR  96



>ref|XP_006389678.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP48592.1| glutaredoxin family protein [Populus trichocarpa]
Length=102

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V+ LA+++  VIF+K++CC+C+++  L  ELG  P ++++D +  +G++ME AL  L
Sbjct  1    MDQVRDLASKNAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDRE-ANGREMEWALRGL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN +VPAVFIGG  +GS  +V+SLHL GSL  ML
Sbjct  60   GCNPTVPAVFIGGKWVGSAKDVLSLHLDGSLKQML  94



>ref|XP_003521537.1| PREDICTED: glutaredoxin-C11-like [Glycine max]
 ref|XP_006604701.1| PREDICTED: glutaredoxin-C11-like [Glycine max]
 gb|KHN28229.1| Glutaredoxin-C11 [Glycine soja]
 gb|KHN43544.1| Glutaredoxin-C11 [Glycine soja]
Length=102

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+VK LA++   VIF+K++CC+C+++  L  ELG  P V+++D D   GK+ME AL  +
Sbjct  1    MDRVKDLASKKAAVIFTKSSCCMCHSIKQLFYELGASPAVHELDNDSY-GKEMEWALRGM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG  +GS+ +V+SLH+ GSL  +L
Sbjct  60   GCNPSVPAVFIGGKFVGSSKDVISLHVDGSLKQLL  94



>gb|ACJ85884.1| unknown [Medicago truncatula]
 gb|AFK35919.1| unknown [Medicago truncatula]
 gb|KEH43251.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=102

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+VK LA++   VIF+K++C +C++++ L  ELG  P V+++D +   G++MERAL  L
Sbjct  1    MDRVKDLASKKAAVIFTKSSCYMCHSITQLFYELGASPAVHELDNEPY-GREMERALRSL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG  +GS+ +V+SLH+ GSL  ML
Sbjct  60   GCNPSVPAVFIGGKFVGSSKDVISLHVDGSLKQML  94



>ref|XP_011071466.1| PREDICTED: monothiol glutaredoxin-S5-like [Sesamum indicum]
Length=102

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ +  + + + VVIFSKT+CC+ + +  L  + GV P VY++D   + G+++E+AL+RL
Sbjct  1    MEGISDMVSNNPVVIFSKTSCCISHTIRSLFSDFGVNPTVYELDGVAR-GREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG  +G  NEVMSLHLSGSL  ML+
Sbjct  60   GCNPTVPAVFIGGEFVGGANEVMSLHLSGSLKPMLR  95



>ref|XP_008799330.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=103

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VV+FS +TCC+C+ V  L  ELGV P V+++D D + GK+ME ALA+L
Sbjct  1    MDRVMRLASQRAVVVFSLSTCCMCHTVKRLFCELGVNPSVHEVDEDPR-GKEMEMALAKL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G +  VP VFIGG LIGST++VMSLHL G L+ +L+
Sbjct  60   MGRSPPVPVVFIGGKLIGSTDKVMSLHLGGKLVPLLR  96



>ref|XP_009383750.1| PREDICTED: putative glutaredoxin-C14 [Musa acuminata subsp. malaccensis]
Length=103

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDKV  LA+Q  VVIFS ++CC+C+ V  L  +LGV   VY++D D + G++ME+ALA+L
Sbjct  1    MDKVMKLASQKAVVIFSLSSCCMCHTVKSLFHDLGVNAAVYELDEDPR-GREMEKALAKL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G NS VPAVFIGG  +GST+ +MSLHL G L+ +L+
Sbjct  60   VGRNSPVPAVFIGGKPVGSTDRIMSLHLGGKLVPLLR  96



>ref|XP_006342767.1| PREDICTED: monothiol glutaredoxin-S3-like [Solanum tuberosum]
Length=102

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  + A+  VVIFSK +CC+ + +  L  +LGV P V+++D + Q G+++E AL+RL
Sbjct  1    MERVSRMVAEKPVVIFSKNSCCMSHTIKSLFCDLGVHPSVHELD-EMQRGREIEAALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG L+G  NEVMSLHL  SL  MLK
Sbjct  60   GCNPTVPAVFIGGELVGGENEVMSLHLQRSLKPMLK  95



>ref|XP_007154238.1| hypothetical protein PHAVU_003G102000g [Phaseolus vulgaris]
 gb|ESW26232.1| hypothetical protein PHAVU_003G102000g [Phaseolus vulgaris]
Length=102

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  + ++  VVIFSK++CC+ +++  L  + GV P V+++D +   G+D+E+AL+RL
Sbjct  1    MDRVTKMVSERPVVIFSKSSCCMSHSIKTLFCDFGVNPSVHELD-EIPRGRDIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFI G L+G  NEVM+LHL+ SLI MLK
Sbjct  60   GCSPSVPAVFIAGELVGGANEVMTLHLNRSLIPMLK  95



>ref|XP_008791106.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
 ref|XP_010929596.1| PREDICTED: glutaredoxin-C1-like [Elaeis guineensis]
Length=128

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 75/102 (74%), Gaps = 5/102 (5%)
 Frame = +3

Query  150  DRMDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALA  329
            D +++V+ LAA+  VVIFS +TCC+C+AV  L + +GV P VY++D D + GKDMERALA
Sbjct  21   DPLERVERLAAESAVVIFSVSTCCMCHAVKRLFRGMGVSPTVYELDEDPR-GKDMERALA  79

Query  330  RL----GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            RL    G   +VP VFIGG L+G+ + VM+ H++G+L+ +LK
Sbjct  80   RLLGAAGGPPAVPVVFIGGKLVGAMDRVMASHINGTLVPLLK  121



>ref|NP_001275534.1| monothiol glutaredoxin-S10-like [Cucumis sativus]
 ref|XP_004170038.1| PREDICTED: monothiol glutaredoxin-S10-like [Cucumis sativus]
 ref|XP_008438822.1| PREDICTED: monothiol glutaredoxin-S10-like [Cucumis melo]
 gb|AGX01497.1| glutaredoxin [Cucumis sativus]
 gb|KGN57081.1| Glutaredoxin [Cucumis sativus]
Length=102

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+++  +A+Q  VVIFSK++CC+ +A+  L  + GV P VY++D D + GK++E AL RL
Sbjct  1    MERIAKVASQKAVVIFSKSSCCMSHAIKRLFYDQGVSPAVYELDEDSR-GKEIEWALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG  +GS N +++LHL+G L  +LK
Sbjct  60   GCNPAVPAVFIGGRFVGSANAIITLHLNGCLNKLLK  95



>ref|XP_002315567.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEF01738.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA++  VVIFSKTTCC+C+ +  L  + GV P V+++D +   G+++E+AL R 
Sbjct  1    MERVTKLASERPVVIFSKTTCCMCHTIKTLFCDFGVNPAVHELD-EMPRGREIEQALTRA  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  ++PAVFIGG ++G  NEVMSLHLS SLI MLK
Sbjct  60   GC-PTLPAVFIGGEIVGGANEVMSLHLSRSLIPMLK  94



>ref|XP_003577277.1| PREDICTED: glutaredoxin-C10 [Brachypodium distachyon]
Length=105

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V +LA++  VV+F+ + C +C  V+ L++ELGV   V+++D D Q G++MER LAR 
Sbjct  1    MDQVATLASERAVVVFTTSRCSMCPVVTSLLRELGVNAAVHELDKDPQ-GREMERELARR  59

Query  336  ---GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
               G  S VPAVFIGGNL+G TN VM+LHL+G L+ MLK
Sbjct  60   LGRGSTSVVPAVFIGGNLVGGTNRVMALHLAGQLVPMLK  98



>ref|XP_009629061.1| PREDICTED: monothiol glutaredoxin-S2 [Nicotiana tomentosiformis]
 ref|XP_009763279.1| PREDICTED: monothiol glutaredoxin-S2-like [Nicotiana sylvestris]
Length=103

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  + A+  VVIFSK++CC+ + +  L  +LGV P V+++D   + G+++E AL+RL
Sbjct  1    MERVSRMVAEKPVVIFSKSSCCMSHTIKSLFCDLGVHPAVHELDEMQRGGREIEAALSRL  60

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG L+G  +EVMSLHL  SL  MLK
Sbjct  61   GCNPTVPAVFIGGELVGGESEVMSLHLQRSLKPMLK  96



>gb|KDP40011.1| hypothetical protein JCGZ_02009 [Jatropha curcas]
Length=101

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LAAQ  VVIFS++TCC+C+A+  L+ + GV P V+++D +   G+++E+AL+RL
Sbjct  1    MERVTQLAAQRPVVIFSRSTCCMCHAIKTLLSDFGVNPAVHELD-EIARGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            G + ++PAVFIGG L+G  NEVM+LHL+ SLI ML
Sbjct  60   G-SPTLPAVFIGGELVGGANEVMALHLNRSLIPML  93



>ref|XP_011009412.1| PREDICTED: glutaredoxin-C11-like [Populus euphratica]
Length=102

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+++  VIF+K++CC+CY++  L  ELG  P ++++D +  +G++ME AL  L
Sbjct  1    MDQVTDLASKNAAVIFTKSSCCMCYSIKTLFYELGASPAIHELDRE-ANGREMEWALRGL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN  VPAVFIGG  +GS  +V+SLHL GSL  ML
Sbjct  60   GCNPIVPAVFIGGKWVGSAKDVLSLHLDGSLKQML  94



>ref|XP_011090919.1| PREDICTED: monothiol glutaredoxin-S4-like [Sesamum indicum]
Length=102

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  + ++  VVIFSKT CC+ + +  L  + GV P VY++D +   G+++E+AL+RL
Sbjct  1    MDRVSKMVSEKPVVIFSKTQCCMSHTIRSLFCDFGVNPTVYELD-EISRGREIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG  +G  NE+MSLHL  SL  MLK
Sbjct  60   GCNPTVPAVFIGGEFVGGANEIMSLHLKRSLKPMLK  95



>ref|XP_002520675.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF41637.1| glutaredoxin, grx, putative [Ricinus communis]
Length=102

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V+ LA+    VIF+K++CC+C+++  L  ELG  P ++++D D  +G++ME AL  L
Sbjct  1    MDRVRDLASTRAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDRD-ANGREMEWALRGL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GC+ SVPAVFIGG  +GS  +V+SLHL GSL  ML
Sbjct  60   GCSPSVPAVFIGGKYVGSAKDVLSLHLDGSLKQML  94



>ref|XP_006444243.1| hypothetical protein CICLE_v10023999mg [Citrus clementina]
 ref|XP_006479883.1| PREDICTED: glutaredoxin-C11-like [Citrus sinensis]
 gb|ESR57483.1| hypothetical protein CICLE_v10023999mg [Citrus clementina]
 gb|KDO87380.1| hypothetical protein CISIN_1g037937mg [Citrus sinensis]
Length=102

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V+ LA++   VIF+K++CC+C+++  L  ELG  P ++++D D  +G+++E AL  L
Sbjct  1    MDRVRDLASKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDQD-ANGREIEWALRAL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG  +GS  +V+SLH+ GSL  ML
Sbjct  60   GCNPSVPAVFIGGRYVGSAKDVISLHVDGSLKQML  94



>ref|XP_006584039.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
 gb|KHN02995.1| Monothiol glutaredoxin-S2 [Glycine soja]
Length=102

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  + ++  VVIFSK++CC+ + +  L  + GV P V+++D +   G+D+E+AL+RL
Sbjct  1    MERVTKMVSERPVVIFSKSSCCMSHTIKTLFCDFGVNPAVHELD-EIPRGRDIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFI G+LIG  NEVMSLHL+ SLI MLK
Sbjct  60   GCSPSVPAVFIAGDLIGGANEVMSLHLNRSLIPMLK  95



>ref|XP_006284820.1| hypothetical protein CARUB_v10006099mg [Capsella rubella]
 gb|EOA17718.1| hypothetical protein CARUB_v10006099mg [Capsella rubella]
Length=102

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+K++ + ++  VVIFSK +CC+ + +  L  +LGV P +Y++D +   GK++E+ALA+L
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDLGVNPTIYELD-EITRGKEIEQALAQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG L+G  N+VMSLHL+ SL+ MLK
Sbjct  60   GCSPTVPAVFIGGQLVGGANQVMSLHLNRSLLPMLK  95



>ref|XP_007163066.1| hypothetical protein PHAVU_001G203300g [Phaseolus vulgaris]
 gb|ADV56688.1| glutaredoxin [Phaseolus vulgaris]
 gb|ESW35060.1| hypothetical protein PHAVU_001G203300g [Phaseolus vulgaris]
Length=102

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+VK LA++   VIF+K++CC+C+++  L  ELG  P V+++D D   G++ME AL  +
Sbjct  1    MDRVKDLASKKAAVIFTKSSCCMCHSIKQLFYELGASPAVHELDNDSY-GREMEWALRGM  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN SVPAVFIGG  +GS+ +V+SLH+ GSL  +L
Sbjct  60   GCNPSVPAVFIGGKFVGSSKDVISLHVDGSLKQLL  94



>ref|XP_004247456.1| PREDICTED: glutaredoxin-C11 [Solanum lycopersicum]
Length=102

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDK++ L+++   VIF+K++CC+C+++  L  ELG  P ++++D D + G +M  AL  L
Sbjct  1    MDKIRDLSSKRAAVIFTKSSCCMCHSIKALFYELGASPAIHELDQDSR-GNEMALALRSL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGML  440
            GCN  VPA+FIGGN IGST +V+SLH++GSL  ML
Sbjct  60   GCNPCVPAIFIGGNFIGSTKDVISLHVNGSLKQML  94



>gb|AAS47604.1| At4g15670 [Arabidopsis thaliana]
 gb|AAS76724.1| At4g15670 [Arabidopsis thaliana]
Length=125

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +3

Query  153  RMDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR  332
            +M+K++ + ++  +VIFSK +CC+ + +  L  +LGV P +Y++D +   GK++E+ALA+
Sbjct  23   KMEKLQKMTSEKSLVIFSKNSCCMSHTIKTLFLDLGVNPTIYELD-EINRGKEIEQALAQ  81

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            LGC+ +VP VFIGG L+G  N+VMSLHL+ SLI MLK
Sbjct  82   LGCSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLK  118



>gb|EMS62879.1| Glutaredoxin-C1 [Triticum urartu]
Length=103

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  LA Q  VVIF  ++CC+C+ V+ L+++LGV P V ++D D + GK+ME+AL RL
Sbjct  1    MEQVTKLAGQRAVVIFGTSSCCMCHTVTSLLRDLGVNPMVVELDEDPR-GKEMEKALVRL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVFIGG L+G T++VMSLHL G L+ +L+
Sbjct  60   LGRNPAVPAVFIGGRLVGCTDKVMSLHLGGKLVPLLR  96



>ref|XP_009399249.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
 gb|ABF69994.1| glutaredoxin family protein [Musa acuminata]
Length=103

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  LA+Q  VVIFS ++CC+C+ +  L  ELGV P VY++D D + G++ME+AL +L
Sbjct  1    MDRVMKLASQKAVVIFSLSSCCMCHTIKRLFCELGVNPAVYELDEDPR-GREMEKALVKL  59

Query  336  -GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N SVP VFIGG L+GST+ +M+LHL G L  +L+
Sbjct  60   LGRNPSVPVVFIGGKLVGSTDRIMALHLGGKLTPLLR  96



>ref|XP_003550174.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
 gb|KHN03384.1| Monothiol glutaredoxin-S2 [Glycine soja]
Length=102

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  + ++  VVIFSK++CC+ + +  L+ + GV P V+++D +   G+D+E+AL+RL
Sbjct  1    MERVTKMVSERPVVIFSKSSCCMSHTIKTLLCDFGVNPAVHELD-EIPRGRDIEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ SVPAVFI G L+G  NEVMSLHL+ SLI MLK
Sbjct  60   GCSPSVPAVFISGELVGGANEVMSLHLNRSLIPMLK  95



>ref|XP_006380199.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP57996.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V +LA++  VVIFSK+TCC+C+ +  L  E GV   V+++D +   G+++E+AL+R 
Sbjct  1    MERVTNLASERPVVIFSKSTCCMCHTIKTLFNEFGVNVAVHELD-EMPRGREIEQALSRF  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC  ++PAVFIGG L+G  NEVMSLHL+ SLI MLK
Sbjct  60   GC-PTLPAVFIGGELVGGANEVMSLHLNRSLIPMLK  94



>emb|CDY13904.1| BnaC09g39220D [Brassica napus]
Length=102

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ VK +  +  VVI+SK+ CC+ + V  L+ + G  P VY++D +   G+++E+AL RL
Sbjct  1    MEMVKRMVLERPVVIYSKSLCCMSHTVKTLLCDFGANPAVYELD-EVSRGREIEQALLRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VPAVFIGG L+G  NEVMSLHL+GSLI MLK
Sbjct  60   GCSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLK  95



>ref|XP_006284821.1| hypothetical protein CARUB_v10006100mg [Capsella rubella]
 gb|EOA17719.1| hypothetical protein CARUB_v10006100mg [Capsella rubella]
Length=102

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MDK++ + ++  VVIFSK +CC+ + V  L  + GV P +Y++D  ++ GK++E+ALA+L
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTVKTLFIDFGVNPTIYELDEINR-GKEIEQALAQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VP VFIGG L+G  N+VMSLHL+ SL+ MLK
Sbjct  60   GCSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLK  95



>ref|XP_010434937.1| PREDICTED: monothiol glutaredoxin-S7 [Camelina sativa]
 ref|XP_010445385.1| PREDICTED: monothiol glutaredoxin-S7 [Camelina sativa]
Length=102

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+K++ + ++  VVIFSK TCC+ + +  L  +LGV P +Y++D  ++  KD+E+ALA+L
Sbjct  1    MEKLQKMISEKSVVIFSKNTCCMSHTIKTLFLDLGVNPTIYELDEINR-AKDIEQALAQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VP VFIGG L+G  N+VMSLHL+ SLI ML+
Sbjct  60   GCSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLQ  95



>ref|XP_004229211.1| PREDICTED: monothiol glutaredoxin-S3 [Solanum lycopersicum]
Length=102

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M++V  + ++  VVIFSK +CC+ + +  L  +LGV P V+++D + Q G+++E AL+RL
Sbjct  1    MERVSRMVSEKPVVIFSKNSCCMSHTIKSLFCDLGVHPSVHELD-EMQRGREIEAALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN +VPAVFIGG L+G  NEVMSLHL  SL  MLK
Sbjct  60   GCNPTVPAVFIGGELVGGENEVMSLHLQRSLKPMLK  95



>ref|XP_004134195.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus]
 ref|XP_004170037.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus]
 ref|XP_008438823.1| PREDICTED: monothiol glutaredoxin-S2 [Cucumis melo]
 gb|KGN57082.1| hypothetical protein Csa_3G152090 [Cucumis sativus]
Length=102

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            MD+V  L ++  VVIFSK+TCC+ + V  L+   GV P V+++D   + G+++E+AL+RL
Sbjct  1    MDRVTRLISERPVVIFSKSTCCMSHTVMRLLSGFGVNPAVHELDQISR-GREVEQALSRL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            G N +VPAVFIGG L+G  NEVMSLHL+ SLI ML+
Sbjct  60   GFNPTVPAVFIGGELVGGANEVMSLHLNRSLIPMLR  95



>ref|XP_002863057.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002880328.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39316.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56587.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=103

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALAR-  332
            M++V+ LA++   VIF+K++CC+C+++  L  ELG  P ++++D D Q G+DMERAL R 
Sbjct  1    MERVRDLASKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPQ-GRDMERALFRV  59

Query  333  LGCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
             G N +VPAVF+GG  +GS  +V+S H+ GSL  MLK
Sbjct  60   FGSNPAVPAVFVGGRYVGSAKDVISFHVDGSLKQMLK  96



>ref|NP_193302.1| monothiol glutaredoxin-S7 [Arabidopsis thaliana]
 sp|Q6NLU2.2|GRXS7_ARATH RecName: Full=Monothiol glutaredoxin-S7; Short=AtGrxS7; AltName: 
Full=Protein ROXY 14 [Arabidopsis thaliana]
 emb|CAB10345.1| glutaredoxin [Arabidopsis thaliana]
 emb|CAB78609.1| glutaredoxin [Arabidopsis thaliana]
 gb|ACO50419.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE83634.1| monothiol glutaredoxin-S7 [Arabidopsis thaliana]
Length=102

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+K++ + ++  +VIFSK +CC+ + +  L  +LGV P +Y++D  ++ GK++E+ALA+L
Sbjct  1    MEKLQKMTSEKSLVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEINR-GKEIEQALAQL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GC+ +VP VFIGG L+G  N+VMSLHL+ SLI MLK
Sbjct  60   GCSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLK  95



>ref|XP_009378908.1| PREDICTED: glutaredoxin-C11-like [Pyrus x bretschneideri]
Length=102

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  156  MDKVKSLAAQHGVVIFSKTTCCLCYAVSILIQELGVKPHVYDIDTDHQDGKDMERALARL  335
            M+ VK LA++   VIF+K++CC+C++V  L  ELG  P ++++D  + +G+DME AL  L
Sbjct  1    METVKQLASEKAAVIFTKSSCCICHSVKTLFYELGASPAIHELDR-YANGRDMEWALRNL  59

Query  336  GCNSSVPAVFIGGNLIGSTNEVMSLHLSGSLIGMLK  443
            GCN ++PAVFIGG  +GS+ +++S H+ GSL  MLK
Sbjct  60   GCNPALPAVFIGGKYVGSSKDIISYHVDGSLKQMLK  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1396864856436