BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26135_g1_i1 len=3478 path=[1:0-3477]

Length=3478
                                                                      Score     E

emb|CDO96982.1|  unnamed protein product                               1070   0.0      
ref|XP_009617683.1|  PREDICTED: arginine decarboxylase                 1068   0.0      
ref|XP_009804627.1|  PREDICTED: arginine decarboxylase                 1060   0.0      
emb|CAB64599.1|  arginine decarboxylase 1                              1059   0.0      Datura stramonium [common thornapple]
ref|XP_009592123.1|  PREDICTED: arginine decarboxylase-like            1058   0.0      
gb|AAF42970.1|AF127239_1  arginine decarboxylase 1                     1057   0.0      Nicotiana tabacum [American tobacco]
gb|AAQ14851.1|AF321137_1  arginine decarboxylase                       1056   0.0      Nicotiana tabacum [American tobacco]
gb|AAF42972.1|AF127241_1  arginine decarboxylase 2                     1054   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009779129.1|  PREDICTED: arginine decarboxylase-like            1053   0.0      
ref|XP_011088497.1|  PREDICTED: arginine decarboxylase                 1049   0.0      
dbj|BAD06581.1|  arginine decarboxylase                                1049   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006360614.1|  PREDICTED: arginine decarboxylase 2-like          1048   0.0      
ref|NP_001234064.1|  arginine decarboxylase                            1042   0.0      
ref|XP_006359602.1|  PREDICTED: arginine decarboxylase-like            1040   0.0      
gb|AFN26936.1|  arginine decarboxylase                                 1023   0.0      
ref|XP_010091194.1|  Arginine decarboxylase                            1021   0.0      
ref|XP_010066227.1|  PREDICTED: arginine decarboxylase-like            1020   0.0      
gb|AEW69809.1|  Hop-interacting protein THI107                         1015   0.0      
ref|XP_002269030.1|  PREDICTED: arginine decarboxylase                 1014   0.0      Vitis vinifera
ref|XP_004290299.1|  PREDICTED: arginine decarboxylase-like            1004   0.0      
ref|XP_008358425.1|  PREDICTED: arginine decarboxylase-like            1001   0.0      
gb|EYU37871.1|  hypothetical protein MIMGU_mgv1a002100mg                999   0.0      
ref|XP_007200307.1|  hypothetical protein PRUPE_ppa002034mg             995   0.0      
ref|XP_004507509.1|  PREDICTED: arginine decarboxylase-like             992   0.0      
ref|XP_009378454.1|  PREDICTED: arginine decarboxylase-like             992   0.0      
ref|XP_006487299.1|  PREDICTED: arginine decarboxylase-like             991   0.0      
dbj|BAE71301.1|  putative arginine decarboxylase                        990   0.0      Trifolium pratense [peavine clover]
ref|XP_006423501.1|  hypothetical protein CICLE_v10027873mg             990   0.0      
ref|XP_004306445.1|  PREDICTED: arginine decarboxylase-like             989   0.0      
dbj|BAE71251.1|  putative arginine decarboxylase                        988   0.0      Trifolium pratense [peavine clover]
ref|XP_010271459.1|  PREDICTED: arginine decarboxylase-like             987   0.0      
gb|KDO41479.1|  hypothetical protein CISIN_1g004438mg                   986   0.0      
gb|ACP56699.1|  arginine decarboxylase                                  984   0.0      Lithospermum erythrorhizon
ref|XP_008236828.1|  PREDICTED: arginine decarboxylase                  979   0.0      
ref|XP_011092858.1|  PREDICTED: arginine decarboxylase-like             978   0.0      
gb|ACC43927.1|  arginine decarboxylase                                  977   0.0      Malus hupehensis
dbj|BAD74163.1|  arginine decarboxylase                                 977   0.0      Malus domestica [apple tree]
ref|XP_010526909.1|  PREDICTED: arginine decarboxylase 2-like           974   0.0      
gb|AEZ01223.1|  arginine decarboxylase                                  973   0.0      
ref|XP_008461023.1|  PREDICTED: arginine decarboxylase                  970   0.0      
ref|XP_007042018.1|  Arginine decarboxylase                             970   0.0      
ref|XP_002306141.1|  arginine decarboxylase family protein              969   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010263903.1|  PREDICTED: arginine decarboxylase-like             969   0.0      
sp|Q43075.1|SPE1_PEA  RecName: Full=Arginine decarboxylase; Short...    968   0.0      Pisum sativum [garden pea]
gb|AEE99192.1|  arginine decarboxylase                                  968   0.0      
gb|KDP27633.1|  hypothetical protein JCGZ_19638                         966   0.0      
ref|XP_004150135.1|  PREDICTED: arginine decarboxylase-like             957   0.0      
gb|AAP36992.2|  arginine decarboxylase                                  949   0.0      Cucumis sativus [cucumbers]
ref|XP_011037225.1|  PREDICTED: arginine decarboxylase                  946   0.0      
ref|XP_010516630.1|  PREDICTED: arginine decarboxylase 1-like           946   0.0      
ref|XP_010489221.1|  PREDICTED: arginine decarboxylase 1-like iso...    946   0.0      
ref|XP_002513004.1|  arginine decarboxylase, putative                   944   0.0      Ricinus communis
gb|AES89273.2|  arginine decarboxylase                                  942   0.0      
ref|NP_195197.1|  arginine decarboxylase 2                              942   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAA65585.1|  arginine decarboxylase                                 942   0.0      Vitis vinifera
ref|XP_010467377.1|  PREDICTED: arginine decarboxylase 1                941   0.0      
gb|AEQ02349.1|  arginine decarboxylase                                  941   0.0      
ref|XP_010548847.1|  PREDICTED: arginine decarboxylase 2-like           939   0.0      
gb|AAN31828.1|  putative arginine decarboxylase SPE2                    939   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAA25685.1|  arginine decarboxylase                                 938   0.0      Nicotiana sylvestris
ref|XP_002867107.1|  hypothetical protein ARALYDRAFT_491183             937   0.0      
ref|XP_006297087.1|  hypothetical protein CARUB_v10013090mg             937   0.0      
gb|AAL09792.1|  AT4g34710/T4L20_290                                     936   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530808.1|  PREDICTED: arginine decarboxylase 2-like           933   0.0      
ref|XP_010432382.1|  PREDICTED: arginine decarboxylase 2                932   0.0      
ref|XP_010437573.1|  PREDICTED: arginine decarboxylase 2-like           932   0.0      
ref|XP_007135913.1|  hypothetical protein PHAVU_009G002500g             929   0.0      
gb|AAF26434.1|  arginine decarboxylase                                  928   0.0      Brassica juncea [brown mustard]
gb|KFK40065.1|  hypothetical protein AALP_AA3G325600                    926   0.0      
ref|NP_179243.1|  arginine decarboxylase 1                              926   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAB60880.1|  arginine decarboxylase                                  925   0.0      Dianthus caryophyllus [carnation]
ref|XP_002886234.1|  hypothetical protein ARALYDRAFT_900320             924   0.0      
gb|AAB09723.1|  arginine decarboxylase                                  923   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003522832.1|  PREDICTED: arginine decarboxylase-like             923   0.0      
ref|XP_006283215.1|  hypothetical protein CARUB_v10004246mg             920   0.0      
ref|XP_010447040.1|  PREDICTED: arginine decarboxylase 2 isoform X2     920   0.0      
ref|XP_010447039.1|  PREDICTED: arginine decarboxylase 2 isoform X1     919   0.0      
sp|O82475.1|SPE1_BRAJU  RecName: Full=Arginine decarboxylase; Sho...    919   0.0      Brassica juncea [brown mustard]
gb|AAR08422.1|  arginine decarboxylase 1                                919   0.0      Pringlea antiscorbutica
gb|EPS61793.1|  arginine decarboxylase                                  919   0.0      
gb|AAR08423.1|  arginine decarboxylase 2                                918   0.0      Pringlea antiscorbutica
gb|AHJ38851.1|  arginine decarboxylase                                  916   0.0      
ref|XP_006409427.1|  hypothetical protein EUTSA_v10022578mg             916   0.0      
emb|CDY45328.1|  BnaA03g53010D                                          913   0.0      
ref|XP_009138322.1|  PREDICTED: arginine decarboxylase 2-like           912   0.0      
ref|XP_006412194.1|  hypothetical protein EUTSA_v10024529mg             911   0.0      
ref|XP_010447041.1|  PREDICTED: arginine decarboxylase 2 isoform X3     910   0.0      
ref|XP_010690749.1|  PREDICTED: arginine decarboxylase                  909   0.0      
dbj|BAJ34222.1|  unnamed protein product                                909   0.0      
emb|CDX72498.1|  BnaC07g45200D                                          909   0.0      
gb|KFK30109.1|  hypothetical protein AALP_AA7G217900                    906   0.0      
gb|KHG07349.1|  Arginine decarboxylase                                  906   0.0      
gb|KDO41478.1|  hypothetical protein CISIN_1g004438mg                   899   0.0      
sp|Q96412.1|SPE1_DIACA  RecName: Full=Arginine decarboxylase; Sho...    895   0.0      Dianthus caryophyllus [carnation]
gb|AAF26435.1|  arginine decarboxylase                                  887   0.0      Brassica juncea [brown mustard]
emb|CAN65288.1|  hypothetical protein VITISV_008959                     885   0.0      Vitis vinifera
ref|NP_001238359.1|  arginine decarboxylase                             878   0.0      
ref|XP_009418323.1|  PREDICTED: arginine decarboxylase-like             874   0.0      
ref|XP_008787396.1|  PREDICTED: arginine decarboxylase-like             872   0.0      
ref|XP_009420802.1|  PREDICTED: arginine decarboxylase-like             870   0.0      
ref|XP_010908989.1|  PREDICTED: LOW QUALITY PROTEIN: arginine dec...    869   0.0      
ref|XP_009393201.1|  PREDICTED: arginine decarboxylase-like             866   0.0      
ref|XP_008777956.1|  PREDICTED: arginine decarboxylase-like             866   0.0      
emb|CDX76301.1|  BnaA08g10990D                                          858   0.0      
ref|XP_010690748.1|  PREDICTED: arginine decarboxylase-like             853   0.0      
emb|CDY17482.1|  BnaC03g65810D                                          850   0.0      
gb|AAR84411.2|  arginine decarboxylase                                  840   0.0      Daucus carota [carrots]
ref|XP_010919152.1|  PREDICTED: arginine decarboxylase-like             844   0.0      
ref|XP_009383023.1|  PREDICTED: arginine decarboxylase-like             843   0.0      
gb|ACX56223.1|  arginine decarboxylase                                  828   0.0      Humulus lupulus [common hop]
ref|XP_008805579.1|  PREDICTED: arginine decarboxylase-like             830   0.0      
gb|EYU40397.1|  hypothetical protein MIMGU_mgv1a020386mg                828   0.0      
ref|NP_001234649.1|  arginine decarboxylase                             822   0.0      
emb|CDX69081.1|  BnaC01g03720D                                          828   0.0      
ref|NP_001056695.1|  Os06g0131300                                       830   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABY47890.1|  arginine decarboxylase                                  829   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659338.1|  PREDICTED: arginine decarboxylase 1                825   0.0      
emb|CDX75456.1|  BnaA01g02460D                                          821   0.0      
dbj|BAJ94285.1|  predicted protein                                      821   0.0      
ref|XP_004964433.1|  PREDICTED: arginine decarboxylase 1-like           820   0.0      
ref|XP_003557137.1|  PREDICTED: arginine decarboxylase 1                820   0.0      
ref|XP_002437758.1|  hypothetical protein SORBIDRAFT_10g002070          819   0.0      Sorghum bicolor [broomcorn]
emb|CAE02645.1|  arginine decarboxylase                                 810   0.0      Lotus japonicus
ref|XP_006854857.1|  hypothetical protein AMTR_s00182p00026140          812   0.0      
emb|CDX75457.1|  BnaA01g02450D                                          810   0.0      
gb|ABX80379.1|  arginine decarboxylase                                  806   0.0      
gb|ADK91572.1|  arginine decarboxylase                                  797   0.0      
ref|XP_007034347.1|  Arginine decarboxylase                             788   0.0      
gb|EAZ35714.1|  hypothetical protein OsJ_20004                          756   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656600.1|  PREDICTED: LOW QUALITY PROTEIN: arginine dec...    755   0.0      
gb|AAX56880.1|  putative arginine decarboxylase                         723   0.0      Solanum habrochaites
gb|ADV29041.1|  arginine decarboxylase                                  720   0.0      
gb|AEO52825.1|  putative arginine decarboxylase                         719   0.0      
gb|AAX56858.1|  putative arginine decarboxylase                         719   0.0      Solanum peruvianum [Peruvian tomato]
gb|ABW21795.1|  putative arginine decarboxylase                         719   0.0      Solanum peruvianum [Peruvian tomato]
gb|AEO52752.1|  putative arginine decarboxylase                         719   0.0      
gb|ABW21820.1|  putative arginine decarboxylase                         719   0.0      Solanum peruvianum [Peruvian tomato]
gb|ADV29091.1|  arginine decarboxylase                                  719   0.0      
gb|AAX56878.1|  putative arginine decarboxylase                         719   0.0      Solanum habrochaites
gb|AAX56874.1|  putative arginine decarboxylase                         718   0.0      Solanum habrochaites
gb|ADV29087.1|  arginine decarboxylase                                  718   0.0      
gb|AAX56857.1|  putative arginine decarboxylase                         718   0.0      Solanum peruvianum [Peruvian tomato]
gb|AEO52751.1|  putative arginine decarboxylase                         718   0.0      
gb|ADV29032.1|  arginine decarboxylase                                  718   0.0      
gb|AEO52823.1|  putative arginine decarboxylase                         718   0.0      
gb|ADV29042.1|  arginine decarboxylase                                  717   0.0      
gb|AAX56864.1|  putative arginine decarboxylase                         717   0.0      Solanum chilense
gb|AAX56854.1|  putative arginine decarboxylase                         717   0.0      Solanum peruvianum [Peruvian tomato]
gb|ABW21835.1|  putative arginine decarboxylase                         717   0.0      Solanum chilense
gb|ABW21818.1|  putative arginine decarboxylase                         717   0.0      Solanum peruvianum [Peruvian tomato]
gb|AEO52831.1|  putative arginine decarboxylase                         717   0.0      
gb|ABW21853.1|  putative arginine decarboxylase                         717   0.0      Solanum chilense
gb|ABW21826.1|  putative arginine decarboxylase                         717   0.0      Solanum peruvianum [Peruvian tomato]
gb|ABW21847.1|  putative arginine decarboxylase                         717   0.0      Solanum chilense
gb|AEO52754.1|  putative arginine decarboxylase                         717   0.0      
gb|AAZ85223.1|  arginine decarboxylase                                  717   0.0      Solanum pimpinellifolium [currant tomato]
gb|ABW21831.1|  putative arginine decarboxylase                         717   0.0      Solanum chilense
gb|ABW21846.1|  putative arginine decarboxylase                         717   0.0      Solanum chilense
gb|AEO52753.1|  putative arginine decarboxylase                         717   0.0      
gb|ABW21845.1|  putative arginine decarboxylase                         717   0.0      Solanum chilense
gb|AAX56863.1|  putative arginine decarboxylase                         716   0.0      Solanum peruvianum [Peruvian tomato]
gb|ABW21861.1|  putative arginine decarboxylase                         716   0.0      Solanum chilense
gb|AAZ85211.1|  arginine decarboxylase                                  716   0.0      Solanum chmielewskii
gb|ADV29106.1|  arginine decarboxylase                                  716   0.0      
gb|ABW21854.1|  putative arginine decarboxylase                         716   0.0      Solanum chilense
gb|AAX56859.1|  putative arginine decarboxylase                         716   0.0      Solanum peruvianum [Peruvian tomato]
gb|ADV29076.1|  arginine decarboxylase                                  716   0.0      
gb|ABW21836.1|  putative arginine decarboxylase                         716   0.0      Solanum chilense
gb|AAX56855.1|  putative arginine decarboxylase                         716   0.0      Solanum peruvianum [Peruvian tomato]
gb|AEO52821.1|  putative arginine decarboxylase                         716   0.0      
gb|AAZ85221.1|  arginine decarboxylase                                  716   0.0      Solanum pimpinellifolium [currant tomato]
gb|AAX56876.1|  putative arginine decarboxylase                         716   0.0      Solanum habrochaites
gb|ABW21844.1|  putative arginine decarboxylase                         716   0.0      Solanum chilense
gb|ADV29018.1|  arginine decarboxylase                                  716   0.0      
gb|ABW21855.1|  putative arginine decarboxylase                         716   0.0      Solanum chilense
gb|ADV29037.1|  arginine decarboxylase                                  716   0.0      
gb|AEO52748.1|  putative arginine decarboxylase                         716   0.0      
gb|ADV29057.1|  arginine decarboxylase                                  716   0.0      
gb|AEO52829.1|  putative arginine decarboxylase                         715   0.0      
gb|AAX56856.1|  putative arginine decarboxylase                         713   0.0      Solanum peruvianum [Peruvian tomato]
gb|ADV29095.1|  arginine decarboxylase                                  712   0.0      
gb|AEO52826.1|  putative arginine decarboxylase                         712   0.0      
gb|AAZ85210.1|  arginine decarboxylase                                  707   0.0      Solanum ochranthum
gb|ADQ37299.1|  putative arginine decarboxylase                         704   0.0      
dbj|BAJ89348.1|  predicted protein                                      676   0.0      
gb|AAN77734.1|  arginine decarboxylase                                  655   0.0      Capsicum annuum
dbj|BAD97829.1|  arginine decarboxylase                                 639   0.0      Prunus persica
gb|AAC68512.1|  arginine decarboxylase                                  634   0.0      Carica papaya [mamon]
gb|AAC68510.1|  arginine decarboxylase                                  626   0.0      Aethionema grandiflorum
gb|AAC68526.1|  arginine decarboxylase                                  625   0.0      Barbarea vulgaris [upland cress]
gb|AAC68535.1|  arginine decarboxylase                                  625   0.0      Nasturtium officinale [watercress]
gb|AAC68519.1|  arginine decarboxylase                                  625   0.0      Arabidopsis arenosa
gb|AAC68514.1|  arginine decarboxylase                                  624   0.0      Boechera stricta
gb|AAC68522.1|  arginine decarboxylase                                  623   0.0      Thlaspi arvense
gb|AAC68524.1|  arginine decarboxylase                                  622   0.0      Nasturtium officinale [watercress]
gb|AAC68533.1|  arginine decarboxylase                                  622   0.0      Thlaspi arvense
gb|AAC68529.1|  arginine decarboxylase                                  621   0.0      Capsella bursa-pastoris
gb|AAC68523.1|  arginine decarboxylase                                  621   0.0      Eutrema salsugineum [saltwater cress]
gb|AAQ14538.1|AF306451_1  arginine decarboxylase                        627   0.0      Pinus sylvestris [Scotch pine]
gb|AAC68530.1|  arginine decarboxylase                                  620   0.0      Arabidopsis arenosa
gb|AAC68520.1|  arginine decarboxylase                                  620   0.0      Sisymbrium altissimum [tall rocket]
gb|AAC68525.1|  arginine decarboxylase                                  620   0.0      Boechera stricta
gb|AAC68515.1|  arginine decarboxylase                                  618   0.0      Barbarea vulgaris [upland cress]
gb|AAC68513.1|  arginine decarboxylase                                  617   0.0      Polanisia dodecandra
gb|AAC68518.1|  arginine decarboxylase                                  615   0.0      Capsella bursa-pastoris
gb|AAC68532.1|  arginine decarboxylase                                  607   0.0      Stanleya pinnata
gb|AAC68516.1|  arginine decarboxylase                                  607   0.0      Brassica nigra
gb|AAC68531.1|  arginine decarboxylase                                  606   0.0      Sisymbrium altissimum [tall rocket]
gb|AAC68528.1|  arginine decarboxylase                                  602   0.0      Brassica oleracea
gb|AAC68527.1|  arginine decarboxylase                                  598   0.0      Brassica nigra
ref|XP_001760311.1|  predicted protein                                  602   0.0      
sp|O81160.1|SPE2_THECC  RecName: Full=Arginine decarboxylase; Sho...    590   0.0      Theobroma cacao [chocolate]
ref|XP_001754665.1|  predicted protein                                  590   0.0      
ref|XP_003607076.1|  Arginine decarboxylase                             560   0.0      
dbj|BAE72686.1|  arginine decarboxylase                                 556   0.0      Vitis vinifera
gb|AAV87173.1|  arginine decarboxylase                                  549   0.0      Phaseolus vulgaris [French bean]
gb|ADN93178.1|  arginine decarboxylase 2                                541   1e-178   
gb|ADN93156.1|  arginine decarboxylase 2                                540   2e-178   
gb|ADN93163.1|  arginine decarboxylase 2                                540   3e-178   
gb|ADN93159.1|  arginine decarboxylase 2                                540   3e-178   
gb|ADN93141.1|  arginine decarboxylase 1                                538   1e-177   
gb|ADN93168.1|  arginine decarboxylase 2                                537   2e-177   
gb|ADN93183.1|  arginine decarboxylase 2                                537   3e-177   
gb|ADN93181.1|  arginine decarboxylase 2                                535   1e-176   
gb|ADN93164.1|  arginine decarboxylase 2                                535   1e-176   
gb|ADN93153.1|  arginine decarboxylase 1                                535   1e-176   
gb|ADN93165.1|  arginine decarboxylase 2                                535   1e-176   
gb|ADN93128.1|  arginine decarboxylase 1                                535   2e-176   
gb|ADN93166.1|  arginine decarboxylase 2                                535   2e-176   
gb|ADN93120.1|  arginine decarboxylase 1                                535   2e-176   
gb|ADN93124.1|  arginine decarboxylase 1                                534   3e-176   
gb|ADN93121.1|  arginine decarboxylase 1                                534   3e-176   
gb|ADN93160.1|  arginine decarboxylase 2                                534   4e-176   
gb|ADN93147.1|  arginine decarboxylase 1                                534   4e-176   
gb|ADN93116.1|  arginine decarboxylase 1                                533   6e-176   
gb|ADN93158.1|  arginine decarboxylase 2                                533   7e-176   
gb|ADN93184.1|  arginine decarboxylase 2                                533   1e-175   
gb|ADN93180.1|  arginine decarboxylase 2                                533   1e-175   
gb|ADN93129.1|  arginine decarboxylase 1                                533   1e-175   
gb|ADN93177.1|  arginine decarboxylase 2                                533   1e-175   
gb|ADN93169.1|  arginine decarboxylase 2                                533   1e-175   
gb|ADN93195.1|  arginine decarboxylase 2                                532   3e-175   
gb|ADN93167.1|  arginine decarboxylase 2                                532   3e-175   
gb|ADN93117.1|  arginine decarboxylase 1                                531   3e-175   
gb|ADN93144.1|  arginine decarboxylase 1                                532   3e-175   
gb|ADN93182.1|  arginine decarboxylase 2                                532   3e-175   
gb|ADN93134.1|  arginine decarboxylase 1                                531   3e-175   
gb|ADN93161.1|  arginine decarboxylase 2                                531   3e-175   
gb|ADN93162.1|  arginine decarboxylase 2                                531   4e-175   
gb|ADN93179.1|  arginine decarboxylase 2                                531   4e-175   
gb|ADN93135.1|  arginine decarboxylase 1                                531   5e-175   
gb|ADN93127.1|  arginine decarboxylase 1                                531   7e-175   
gb|ADN93122.1|  arginine decarboxylase 1                                531   7e-175   
gb|ADN93139.1|  arginine decarboxylase 1                                530   9e-175   
gb|ADN93171.1|  arginine decarboxylase 2                                530   9e-175   
gb|ADN93155.1|  arginine decarboxylase 1                                530   9e-175   
gb|ADN93130.1|  arginine decarboxylase 1                                530   2e-174   
gb|ADN93152.1|  arginine decarboxylase 1                                530   2e-174   
gb|ADN93185.1|  arginine decarboxylase 2                                529   2e-174   
gb|ADN93196.1|  arginine decarboxylase 2                                529   3e-174   
gb|ADN93172.1|  arginine decarboxylase 2                                529   3e-174   
gb|ADN93154.1|  arginine decarboxylase 1                                529   4e-174   
gb|ADN93173.1|  arginine decarboxylase 2                                528   6e-174   
gb|ADN93123.1|  arginine decarboxylase 1                                528   6e-174   
gb|ADN93136.1|  arginine decarboxylase 1                                528   6e-174   
gb|ADN93145.1|  arginine decarboxylase 1                                528   1e-173   
gb|ADN93140.1|  arginine decarboxylase 1                                527   1e-173   
gb|ADN93137.1|  arginine decarboxylase 1                                527   2e-173   
gb|ADN93146.1|  arginine decarboxylase 1                                526   3e-173   
gb|ADN93194.1|  arginine decarboxylase 2                                526   6e-173   
gb|ADN93191.1|  arginine decarboxylase 2                                525   1e-172   
gb|ADN93132.1|  arginine decarboxylase 1                                525   1e-172   
gb|ADN93190.1|  arginine decarboxylase 2                                525   1e-172   
gb|ADN93131.1|  arginine decarboxylase 1                                524   2e-172   
gb|ADN93186.1|  arginine decarboxylase 2                                524   2e-172   
gb|ADN93193.1|  arginine decarboxylase 2                                524   3e-172   
gb|ADN93138.1|  arginine decarboxylase 1                                523   5e-172   
gb|ADN93133.1|  arginine decarboxylase 1                                523   5e-172   
gb|ADN93192.1|  arginine decarboxylase 2                                523   6e-172   
gb|ADN93170.1|  arginine decarboxylase 2                                523   8e-172   
gb|ADN93188.1|  arginine decarboxylase 2                                522   1e-171   
gb|ADN93119.1|  arginine decarboxylase 1                                522   1e-171   
gb|ADN93150.1|  arginine decarboxylase 1                                521   2e-171   
gb|ADN93125.1|  arginine decarboxylase 1                                521   3e-171   
gb|ADN93126.1|  arginine decarboxylase 1                                521   5e-171   
gb|ADN93197.1|  arginine decarboxylase 2                                521   6e-171   
gb|ADN93175.1|  arginine decarboxylase 2                                520   1e-170   
gb|ADN93174.1|  arginine decarboxylase 2                                519   2e-170   
gb|ADN93187.1|  arginine decarboxylase 2                                518   4e-170   
gb|ADN93143.1|  arginine decarboxylase 1                                518   4e-170   
gb|ADN93151.1|  arginine decarboxylase 1                                514   1e-168   
gb|ADN93142.1|  arginine decarboxylase 1                                514   1e-168   
gb|ADN93189.1|  arginine decarboxylase 2                                513   3e-168   
ref|XP_002960107.1|  hypothetical protein SELMODRAFT_70229              523   3e-168   
gb|ADN93148.1|  arginine decarboxylase 1                                513   3e-168   
ref|XP_002983909.1|  hypothetical protein SELMODRAFT_41652              523   5e-168   
gb|ADN93201.1|  arginine decarboxylase 2                                510   4e-167   
gb|ADN93202.1|  arginine decarboxylase 2                                509   9e-167   
ref|XP_004953197.1|  PREDICTED: arginine decarboxylase 2-like iso...    520   9e-167   
gb|ADN93200.1|  arginine decarboxylase 2                                509   9e-167   
gb|ADN93204.1|  arginine decarboxylase 2                                509   1e-166   
gb|ADN93203.1|  arginine decarboxylase 2                                509   1e-166   
ref|XP_006664927.1|  PREDICTED: arginine decarboxylase 2-like           518   4e-166   
gb|ADN93176.1|  arginine decarboxylase 2                                507   7e-166   
gb|ADN93149.1|  arginine decarboxylase 1                                503   4e-164   
gb|ADN93198.1|  arginine decarboxylase 2                                500   4e-163   
ref|NP_001052018.1|  Os04g0107600                                       506   1e-161   
gb|ADN93118.1|  arginine decarboxylase 1                                493   3e-160   
gb|ADN93199.1|  arginine decarboxylase 2                                491   1e-159   
gb|ACN65507.1|  arginine decarboxylase 2                                500   4e-159   
ref|NP_001132198.1|  uncharacterized protein LOC100193626               497   8e-158   
ref|XP_008676571.1|  PREDICTED: uncharacterized protein LOC100193...    495   3e-157   
gb|ACG41098.1|  arginine decarboxylase                                  495   3e-157   
gb|EMT32269.1|  Arginine decarboxylase                                  491   6e-156   
emb|CDX69082.1|  BnaC01g03710D                                          481   3e-155   
sp|P22220.1|SPE1_AVESA  RecName: Full=Arginine decarboxylase; Sho...    476   2e-150   
gb|EMT30234.1|  Arginine decarboxylase                                  477   3e-150   
emb|CDM81060.1|  unnamed protein product                                467   3e-146   
ref|WP_015173045.1|  arginine decarboxylase                             464   3e-145   
ref|WP_006632294.1|  arginine decarboxylase                             463   1e-144   
ref|WP_013321319.1|  arginine decarboxylase                             463   3e-144   
ref|WP_036031230.1|  arginine decarboxylase                             461   4e-144   
ref|WP_015174165.1|  arginine decarboxylase                             461   5e-144   
ref|WP_015203800.1|  arginine decarboxylase                             461   1e-143   
ref|WP_038027935.1|  arginine decarboxylase                             457   1e-142   
ref|WP_006530895.1|  arginine decarboxylase                             457   1e-142   
ref|WP_026798224.1|  arginine decarboxylase                             457   2e-142   
ref|WP_026798522.1|  MULTISPECIES: arginine decarboxylase               457   2e-142   
ref|WP_015080122.1|  arginine decarboxylase                             457   3e-142   
ref|WP_037221130.1|  arginine decarboxylase                             454   1e-141   
ref|WP_014276307.1|  arginine decarboxylase                             455   1e-141   
ref|WP_016864895.1|  arginine decarboxylase                             455   1e-141   
ref|WP_015117080.1|  arginine decarboxylase                             455   1e-141   
ref|WP_017297983.1|  hypothetical protein                               455   2e-141   
ref|XP_002967438.1|  hypothetical protein SELMODRAFT_144682             451   2e-141   
ref|WP_015955997.1|  arginine decarboxylase                             455   2e-141   
ref|WP_012307419.1|  arginine decarboxylase                             454   2e-141   
ref|WP_030006364.1|  arginine decarboxylase                             454   2e-141   
ref|WP_015193578.1|  arginine decarboxylase                             454   3e-141   
ref|WP_011365438.1|  arginine decarboxylase                             453   3e-141   
ref|WP_006195391.1|  arginine decarboxylase                             454   3e-141   
ref|WP_011377840.1|  arginine decarboxylase                             453   3e-141   
ref|WP_006617556.1|  arginine decarboxylase                             453   4e-141   
ref|WP_023067105.1|  arginine decarboxylase                             454   4e-141   
ref|WP_006623438.1|  MULTISPECIES: arginine decarboxylase               453   5e-141   
ref|WP_015162244.1|  arginine decarboxylase, biosynthetic               454   6e-141   
ref|WP_038083834.1|  arginine decarboxylase                             453   6e-141   
ref|WP_006514050.1|  arginine decarboxylase                             453   8e-141   
ref|WP_027401367.1|  arginine decarboxylase                             453   8e-141   
ref|WP_026733175.1|  arginine decarboxylase                             453   9e-141   
ref|WP_009756872.1|  MULTISPECIES: arginine decarboxylase               453   1e-140   
ref|WP_007354569.1|  MULTISPECIES: arginine decarboxylase               452   1e-140   
ref|WP_015196793.1|  arginine decarboxylase                             453   1e-140   
ref|WP_026148731.1|  arginine decarboxylase                             452   1e-140   
ref|WP_015113142.1|  arginine decarboxylase                             453   1e-140   
ref|WP_013190966.1|  arginine decarboxylase                             452   1e-140   
ref|WP_015186856.1|  arginine decarboxylase                             453   1e-140   
gb|EMT22731.1|  Arginine decarboxylase                                  448   2e-140   
ref|WP_035985996.1|  arginine decarboxylase                             452   2e-140   
ref|WP_016951012.1|  arginine decarboxylase                             452   2e-140   
ref|WP_024124847.1|  biosynthetic arginine decarboxylase SpeA           451   2e-140   
ref|WP_026087383.1|  arginine decarboxylase                             452   2e-140   
ref|WP_019507534.1|  hypothetical protein                               451   2e-140   
ref|WP_008232395.1|  Biosynthetic arginine decarboxylase                452   3e-140   
ref|WP_026720045.1|  arginine decarboxylase                             452   3e-140   
ref|WP_036008011.1|  arginine decarboxylase                             451   3e-140   
ref|WP_018400797.1|  hypothetical protein                               452   3e-140   
ref|WP_035156408.1|  arginine decarboxylase                             451   4e-140   
ref|WP_011242822.1|  arginine decarboxylase                             451   4e-140   
ref|WP_017653456.1|  arginine decarboxylase                             451   5e-140   
ref|WP_008224738.1|  Biosynthetic arginine decarboxylase                451   5e-140   
ref|WP_012629302.1|  arginine decarboxylase                             450   6e-140   
ref|WP_017313429.1|  arginine decarboxylase                             451   7e-140   
ref|WP_017740660.1|  arginine decarboxylase                             451   7e-140   
ref|WP_015145472.1|  arginine decarboxylase                             451   8e-140   
ref|WP_017319376.1|  arginine decarboxylase                             450   9e-140   
ref|WP_039729954.1|  arginine decarboxylase                             449   9e-140   
ref|WP_019492395.1|  arginine decarboxylase                             451   9e-140   
ref|WP_011162955.1|  arginine decarboxylase                             450   1e-139   
ref|WP_017305259.1|  hypothetical protein                               450   1e-139   
ref|WP_009783174.1|  arginine decarboxylase                             450   1e-139   
ref|WP_015139581.1|  arginine decarboxylase                             450   1e-139   
ref|WP_015219594.1|  arginine decarboxylase                             449   1e-139   
ref|WP_012412497.1|  arginine decarboxylase                             450   2e-139   
ref|WP_039201384.1|  arginine decarboxylase                             449   2e-139   
ref|WP_028953070.1|  arginine decarboxylase                             448   2e-139   
ref|WP_011320145.1|  arginine decarboxylase                             449   3e-139   
ref|WP_017322815.1|  arginine decarboxylase                             449   4e-139   
ref|WP_006278638.1|  arginine decarboxylase                             449   4e-139   
ref|WP_010997551.1|  arginine decarboxylase                             449   4e-139   
ref|WP_016859713.1|  arginine decarboxylase                             449   4e-139   
ref|WP_017295955.1|  hypothetical protein                               447   5e-139   
ref|WP_017660250.1|  hypothetical protein                               447   6e-139   
ref|WP_036615631.1|  arginine decarboxylase                             446   1e-138   
ref|WP_015089548.1|  arginine decarboxylase                             446   2e-138   
gb|EKQ70123.1|  arginine decarboxylase                                  447   2e-138   
ref|WP_006509027.1|  arginine decarboxylase                             446   2e-138   
ref|WP_009625829.1|  arginine decarboxylase                             446   2e-138   
ref|WP_010475925.1|  arginine decarboxylase                             447   3e-138   
ref|WP_028090180.1|  arginine decarboxylase                             446   3e-138   
ref|WP_015148278.1|  arginine decarboxylase                             446   4e-138   
gb|EMS56348.1|  Arginine decarboxylase 1                                437   4e-138   
ref|WP_023075986.1|  arginine decarboxylase                             446   5e-138   
ref|WP_011936790.1|  arginine decarboxylase                             445   5e-138   
ref|WP_011057644.1|  arginine decarboxylase                             444   7e-138   
ref|WP_011360910.1|  arginine decarboxylase                             444   9e-138   
ref|WP_039716235.1|  arginine decarboxylase                             444   1e-137   
ref|WP_015154993.1|  arginine decarboxylase                             444   2e-137   
ref|WP_015123687.1|  arginine decarboxylase                             444   2e-137   
ref|WP_038450681.1|  arginine decarboxylase                             443   2e-137   
ref|WP_028082266.1|  arginine decarboxylase                             444   2e-137   
ref|WP_012162198.1|  arginine decarboxylase                             444   3e-137   
ref|WP_015215011.1|  arginine decarboxylase                             443   4e-137   
ref|WP_024969595.1|  arginine decarboxylase                             444   4e-137   
dbj|GAL93717.1|  biosynthetic arginine decarboxylase                    444   4e-137   
ref|WP_027843730.1|  arginine decarboxylase                             443   8e-137   
ref|WP_016515834.1|  Biosynthetic arginine decarboxylase                442   1e-136   
ref|WP_002751897.1|  arginine decarboxylase                             442   1e-136   
ref|WP_017713676.1|  hypothetical protein                               441   1e-136   
ref|WP_004162551.1|  arginine decarboxylase                             442   1e-136   
ref|WP_029633046.1|  arginine decarboxylase [                           442   1e-136   
ref|WP_017716493.1|  arginine decarboxylase                             442   1e-136   
ref|WP_002736001.1|  arginine decarboxylase                             442   1e-136   
ref|WP_002760593.1|  arginine decarboxylase                             442   1e-136   
ref|WP_015132399.1|  arginine decarboxylase                             440   2e-136   
ref|WP_011129212.1|  arginine decarboxylase                             440   3e-136   
ref|WP_008200077.1|  arginine decarboxylase                             441   3e-136   
ref|WP_009634485.1|  arginine decarboxylase                             441   3e-136   
ref|WP_002777779.1|  arginine decarboxylase                             441   4e-136   
gb|AHF64905.1|  arginine decarboxylase                                  439   5e-136   
ref|WP_004160800.1|  Biosynthetic arginine decarboxylase 1              441   5e-136   
ref|WP_038552398.1|  arginine decarboxylase                             439   5e-136   
ref|WP_029626029.1|  arginine decarboxylase                             439   5e-136   
ref|WP_039754047.1|  arginine decarboxylase                             440   6e-136   
ref|WP_038547365.1|  arginine decarboxylase                             439   7e-136   
ref|WP_004162057.1|  arginine decarboxylase                             440   8e-136   
ref|WP_004161381.1|  arginine decarboxylase                             440   8e-136   
ref|WP_002764563.1|  arginine decarboxylase                             440   9e-136   
ref|WP_012267232.1|  arginine decarboxylase                             440   1e-135   
ref|XP_002960274.1|  hypothetical protein SELMODRAFT_139552             438   1e-135   
ref|WP_011429050.1|  arginine decarboxylase                             438   1e-135   
ref|WP_004268904.1|  arginine decarboxylase                             439   2e-135   
gb|AHI04766.1|  arginine decarboxylase                                  437   2e-135   
ref|WP_002748085.1|  arginine decarboxylase                             438   6e-135   
gb|KHD89007.1|  arginine decarboxylase                                  436   6e-135   
ref|WP_011610890.1|  arginine decarboxylase                             438   7e-135   
ref|WP_015209194.1|  arginine decarboxylase                             438   8e-135   
gb|AII46407.1|  arginine decarboxylase                                  436   2e-134   
ref|WP_036535149.1|  arginine decarboxylase                             435   2e-134   
ref|WP_006173201.1|  arginine decarboxylase                             435   3e-134   
ref|WP_011434320.1|  arginine decarboxylase                             434   3e-134   
ref|WP_006101594.1|  arginine decarboxylase                             436   4e-134   
ref|XP_005646448.1|  arginine decarboxylase                             437   5e-134   
ref|WP_015183452.1|  arginine decarboxylase                             435   2e-133   
ref|WP_023173367.1|  arginine decarboxylase                             432   2e-133   
ref|WP_015231057.1|  arginine decarboxylase                             432   3e-133   
ref|WP_015222723.1|  arginine decarboxylase                             432   3e-133   
ref|WP_006455908.1|  arginine decarboxylase                             433   4e-133   
ref|WP_010305504.1|  arginine decarboxylase                             432   4e-133   
ref|WP_015168708.1|  arginine decarboxylase                             432   5e-133   
ref|WP_035798599.1|  arginine decarboxylase                             431   5e-133   
ref|WP_015110264.1|  arginine decarboxylase                             432   6e-133   
ref|WP_019502934.1|  hypothetical protein                               431   7e-133   
gb|EAZ92702.1|  arginine decarboxylase                                  432   7e-133   
ref|WP_015227084.1|  arginine decarboxylase                             431   2e-132   
emb|CBI37982.3|  unnamed protein product                                423   2e-132   
ref|WP_007101275.1|  arginine decarboxylase                             430   3e-132   
gb|AIB06721.1|  arginine decarboxylase-like protein                     412   2e-131   
gb|EAU75144.1|  arginine decarboxylase                                  427   2e-131   
ref|WP_015783768.1|  arginine decarboxylase                             427   6e-131   
ref|WP_015129243.1|  arginine decarboxylase                             426   1e-130   
ref|WP_008186202.1|  arginine decarboxylase                             427   1e-130   
ref|WP_012594974.1|  arginine decarboxylase                             426   2e-130   
ref|WP_011934275.1|  arginine decarboxylase                             424   2e-130   
ref|WP_010874165.1|  arginine decarboxylase                             426   3e-130   
ref|WP_015470938.1|  arginine decarboxylase                             423   1e-129   
ref|WP_011144058.1|  arginine decarboxylase                             421   6e-129   
gb|EHA61904.1|  Biosynthetic arginine decarboxylase                     421   9e-129   
gb|AIE72691.1|  Biosynthetic arginine decarboxylase                     421   1e-128   
ref|WP_038014335.1|  arginine decarboxylase                             419   4e-128   
ref|WP_038024471.1|  arginine decarboxylase                             418   4e-128   
ref|WP_025923797.1|  arginine decarboxylase                             418   5e-128   
ref|WP_025941129.1|  arginine decarboxylase                             418   6e-128   
ref|WP_025958672.1|  arginine decarboxylase                             418   6e-128   
ref|WP_025893735.1|  arginine decarboxylase                             418   7e-128   
ref|WP_025945556.1|  arginine decarboxylase                             418   8e-128   
ref|WP_006042868.1|  arginine decarboxylase                             417   1e-127   
ref|WP_025975678.1|  arginine decarboxylase                             417   1e-127   
ref|WP_011620634.1|  arginine decarboxylase                             417   1e-127   
ref|YP_002049017.1|  arginine decarboxylase                             417   1e-127   
ref|WP_025905757.1|  arginine decarboxylase                             417   2e-127   
ref|WP_025887346.1|  MULTISPECIES: arginine decarboxylase               417   2e-127   
ref|WP_025940355.1|  arginine decarboxylase                             417   2e-127   
ref|WP_025890219.1|  arginine decarboxylase                             417   2e-127   
ref|WP_025932247.1|  MULTISPECIES: arginine decarboxylase               417   2e-127   
ref|WP_025943853.1|  MULTISPECIES: arginine decarboxylase               417   2e-127   
gb|AIQ94087.1|  Biosynthetic arginine decarboxylase                     417   3e-127   
ref|WP_025947101.1|  MULTISPECIES: arginine decarboxylase               416   3e-127   
ref|WP_025974386.1|  arginine decarboxylase                             416   3e-127   
ref|WP_035833631.1|  arginine decarboxylase                             417   4e-127   



>emb|CDO96982.1| unnamed protein product [Coffea canephora]
Length=729

 Score =  1070 bits (2766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/721 (80%), Positives = 635/721 (88%), Gaps = 18/721 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEA----LVSSDA--PLPTNAVPPTASVDHSHWSPSMSAALYRIDGWG  2664
             GY FA D SLPAP A    L SS A  P PTNA   +A+ D  HWSP++SAALY++DGWG
Sbjct  17    GYVFARDSSLPAPAADSVFLPSSAAGVPSPTNA---SATADVCHWSPALSAALYKVDGWG  73

Query  2663  DPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLK  2484
              PYFTVN SG+IS+RP+G+ TLSHQEIDLLKVVK+ASDPK  GGLGLQLPLIVRFPDVLK
Sbjct  74    APYFTVNCSGNISIRPYGTDTLSHQEIDLLKVVKRASDPKSSGGLGLQLPLIVRFPDVLK  133

Query  2483  NRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEL  2304
             NRLESLQSAF++AV+SQGY + YQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPEL
Sbjct  134   NRLESLQSAFDYAVQSQGYEARYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPEL  193

Query  2303  LLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKM  2124
             LLAMSCLCKGSPDALL+CNGFKD EYISLAL ARKL LNTVIVLEQEEEVDL+IDIS+K+
Sbjct  194   LLAMSCLCKGSPDALLVCNGFKDVEYISLALLARKLCLNTVIVLEQEEEVDLVIDISKKI  253

Query  2123  AVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHI  1944
              VRPVIG+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL+ S  +DCLQLLHFHI
Sbjct  254   GVRPVIGVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLELSGFLDCLQLLHFHI  313

Query  1943  GSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTL  1764
             GSQIPSTALLADGVGEAAQIYCELVRLGACMKVIDIGGGLGIDYDGSKSA+S++SV YTL
Sbjct  314   GSQIPSTALLADGVGEAAQIYCELVRLGACMKVIDIGGGLGIDYDGSKSANSDISVAYTL  373

Query  1763  QEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGL  1584
             QEYASAVVQAVRFVCDR GV HPV+CSESGRAIVSHHSILIFEAVS+SS +  Q+ + G 
Sbjct  374   QEYASAVVQAVRFVCDRNGVKHPVLCSESGRAIVSHHSILIFEAVSASSYETPQVSSVGQ  433

Query  1583  QSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDG  1404
             Q FVE L ++ RADY+NL +AA+RGEYD+CVLYADQLKQ+C++QFKEGSL IEQLAAVDG
Sbjct  434   QYFVERLTEEGRADYRNLYSAAVRGEYDSCVLYADQLKQKCIEQFKEGSLGIEQLAAVDG  493

Query  1403  ICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLT  1224
             +C+ VSKA+GA +PV TY+VNLS+FTSIPDFWA GQLFPIVPIHRLD++PG RGILSDLT
Sbjct  494   LCEFVSKAVGASEPVRTYHVNLSIFTSIPDFWAIGQLFPIVPIHRLDDKPGMRGILSDLT  553

Query  1223  CDSDGKIDKFVGGESSLPLHEL---GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVR  1053
             CDSDGKIDKF+GGESSLPLHEL   GG+GG Y+LGMFLGGAYEEALGGFHNLFGGPSVVR
Sbjct  554   CDSDGKIDKFIGGESSLPLHELEGIGGSGGGYFLGMFLGGAYEEALGGFHNLFGGPSVVR  613

Query  1052  VSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafasl  873
             VSQSDGPHSF+VT A PG SC DVLRVMQHEPELMFETLKHRAEEF+H+ED  GMA  SL
Sbjct  614   VSQSDGPHSFAVTCAVPGLSCGDVLRVMQHEPELMFETLKHRAEEFVHEEDGDGMAHVSL  673

Query  872   asslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWS-YCI  696
             AS LA  FHNMPYLV  S+CCLTA     SGYYY +D S    I +S+ GEDE W+ YC+
Sbjct  674   ASGLARYFHNMPYLVAPSSCCLTA----NSGYYYCDDESFGAAI-ESAAGEDEQWTAYCV  728

Query  695   A  693
             A
Sbjct  729   A  729



>ref|XP_009617683.1| PREDICTED: arginine decarboxylase [Nicotiana tomentosiformis]
Length=720

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/716 (80%), Positives = 624/716 (87%), Gaps = 17/716 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAF+ D SLPAPE          T+ VPPT S   SHWSP +S+ALY +DGWG PYF+V
Sbjct  17    GYAFSRDSSLPAPEFF--------TSGVPPTNSAAGSHWSPDLSSALYGVDGWGAPYFSV  68

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NS+GDISVRPHG+ TL HQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESL
Sbjct  69    NSNGDISVRPHGTDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESL  128

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+ AV SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC
Sbjct  129   QSAFDLAVHSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  188

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LC+GS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDISRKMAVRPVI
Sbjct  189   LCRGSAEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISRKMAVRPVI  248

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPS
Sbjct  249   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPS  308

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCEL+RLGA MK ID GGGLGIDYDG+KS DS+VSVGY +QEYAS 
Sbjct  309   TALLADGVGEAAQIYCELIRLGAGMKFIDTGGGLGIDYDGTKSCDSDVSVGYGIQEYAST  368

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA--VSSSSDKLLQLPNPGLQSFV  1572
             VVQAV++VCDRKGV HPVICSESGRAIVSHHSILIFEA   SS+      L + GLQS  
Sbjct  369   VVQAVQYVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASSTHVSSSHLSSGGLQSMA  428

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             E+L +DA ADY+NLSAAA+RGEY+TCVLY+DQLKQRCVDQFKEGSL IE LAAVD ICD 
Sbjct  429   ETLNEDALADYRNLSAAAVRGEYETCVLYSDQLKQRCVDQFKEGSLGIEHLAAVDSICDF  488

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             VSKA+GA DP+ TY+VNLS+FTSIPDFWAFGQLFPIVPIHRLDE+P  RGILSDLTCDSD
Sbjct  489   VSKAMGAADPIRTYHVNLSIFTSIPDFWAFGQLFPIVPIHRLDEKPAVRGILSDLTCDSD  548

Query  1211  GKIDKFVGGESSLPLHELG--GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             GK+DKF+GGESSLPLHELG  G+GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSD
Sbjct  549   GKVDKFIGGESSLPLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVVQSD  608

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla  858
               HSF++TR+ PGPSCADVLR MQHEPELMFETLKHRAEEFL  E++ G+A ASLASSLA
Sbjct  609   SAHSFAMTRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEEDKGLAIASLASSLA  668

Query  857   nsFHNMPYLVVGSTCCLTAATTPGSGY-YYGNDVSAANPIADSSPGEDEHWSYCIA  693
              SFHNMPYLV  ++CC TA T    GY YY +D +A    ADS+ GEDE WSYC A
Sbjct  669   QSFHNMPYLVAPASCCFTAVTANNGGYNYYYSDENA----ADSATGEDEIWSYCTA  720



>ref|XP_009804627.1| PREDICTED: arginine decarboxylase [Nicotiana sylvestris]
Length=721

 Score =  1060 bits (2741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/715 (80%), Positives = 620/715 (87%), Gaps = 17/715 (2%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVN  2643
             YAF+ D SLPAPE   S         VPPT S   SHWSP +S+ALY +DGWG PYF+VN
Sbjct  19    YAFSRDSSLPAPEFFAS--------GVPPTNSAAASHWSPDLSSALYGVDGWGAPYFSVN  70

Query  2642  SSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQ  2463
             S+GDISVRPHG+ TL HQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESLQ
Sbjct  71    SNGDISVRPHGTDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESLQ  130

Query  2462  SAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCL  2283
             SAF+ AV SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSCL
Sbjct  131   SAFDLAVHSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSCL  190

Query  2282  CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIG  2103
             CKGS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDIS KMAVRPVIG
Sbjct  191   CKGSAEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISHKMAVRPVIG  250

Query  2102  LRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPST  1923
             LRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPST
Sbjct  251   LRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPST  310

Query  1922  ALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAV  1743
              LLADGVGEAAQIYCELVRLGA MK IDIGGGLGIDYDG+KS DS+VSVGY +QEYASAV
Sbjct  311   GLLADGVGEAAQIYCELVRLGAGMKFIDIGGGLGIDYDGTKSCDSDVSVGYGIQEYASAV  370

Query  1742  VQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA--VSSSSDKLLQLPNPGLQSFVE  1569
             VQAV++VCDRKGV HPVICSESGRAIVSHHSILIFEA   SS+      L + GLQS  E
Sbjct  371   VQAVQYVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASSTHVSSSHLSSGGLQSMAE  430

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
             +L +DA ADY+NLSAAA+RGEY+TCVLY+DQLKQRCV+QFKEGSL IE LAAVD ICD V
Sbjct  431   TLNEDALADYRNLSAAAVRGEYETCVLYSDQLKQRCVEQFKEGSLGIEHLAAVDSICDFV  490

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKA+GA DPV TY+VNLS+FTSIPDFWAFGQLFPIVPIHRLDE+P  RGILSDLTCDSDG
Sbjct  491   SKAMGAADPVRTYHVNLSIFTSIPDFWAFGQLFPIVPIHRLDEKPAVRGILSDLTCDSDG  550

Query  1208  KIDKFVGGESSLPLHELG--GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDG  1035
             K+DKF+GGESSLPLHELG  G+GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSD 
Sbjct  551   KVDKFIGGESSLPLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVVQSDS  610

Query  1034  PHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslan  855
              HSF++TR+ PGPSCADVLR MQHEPELMFETLKHRAEEFL  ED+ G+A  SLASS+A 
Sbjct  611   AHSFAMTRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEDDKGLAVESLASSVAQ  670

Query  854   sFHNMPYLVVGSTCCLTAATTPGSGY-YYGNDVSAANPIADSSPGEDEHWSYCIA  693
             SFHNMPYLV  S+C  TAAT    GY YY +D +A    ADS+ GEDE WSYC A
Sbjct  671   SFHNMPYLVAPSSCRFTAATDNNGGYNYYYSDENA----ADSATGEDEIWSYCTA  721



>emb|CAB64599.1| arginine decarboxylase 1 [Datura stramonium]
Length=724

 Score =  1059 bits (2738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/715 (80%), Positives = 619/715 (87%), Gaps = 11/715 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAF+WD SLPAPE   SS  P  TN     A    SHWSP +S+ALYR+DGWG PYF++
Sbjct  17    GYAFSWDSSLPAPE-FFSSGVPPSTNET--AAHTAGSHWSPDLSSALYRVDGWGAPYFSI  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISVRPHG+ TL HQEIDLLKV KKASDPK LGGLGLQLPL+VRFPDVLKNRLESL
Sbjct  74    NSSGDISVRPHGTDTLPHQEIDLLKVGKKASDPKHLGGLGLQLPLVVRFPDVLKNRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+ AV SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS +RFGLEAGSKPELLLAMSC
Sbjct  134   QSAFDMAVHSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSPYRFGLEAGSKPELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L KGS DALL+CNGFKD EYISLAL ARKLLLNTVIVLEQEEE+DL+IDISRKMAVRPVI
Sbjct  194   LSKGSADALLVCNGFKDTEYISLALVARKLLLNTVIVLEQEEELDLVIDISRKMAVRPVI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL ES M+DCLQLLHFHIGSQIPS
Sbjct  254   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDESGMLDCLQLLHFHIGSQIPS  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEA QIY EL RLGA MK IDIGGGLGIDYDG+KS+DS+VSVGY ++EYASA
Sbjct  314   TDLLADGVGEATQIYSELARLGAGMKFIDIGGGLGIDYDGTKSSDSDVSVGYGIEEYASA  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLL-QLPNPGLQSFVE  1569
             VVQAV++VCDRKGV HPVICSESGRAIVSHHSILI EAVS+S+     QL + GLQS  E
Sbjct  374   VVQAVQYVCDRKGVKHPVICSESGRAIVSHHSILILEAVSASTGHASPQLSSGGLQSLAE  433

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
             +L +DARADY+NLSAAA+RGEYDTC+LY+DQLKQRCV+QFKEGSL IEQLAAVD ICDLV
Sbjct  434   TLNEDARADYRNLSAAAVRGEYDTCLLYSDQLKQRCVEQFKEGSLDIEQLAAVDSICDLV  493

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKAIG  DP+ TY+VNLSVFTSIPDFWAFGQLFPIVPIHRLDE+P  RGILSDLTCDSDG
Sbjct  494   SKAIGVADPIRTYHVNLSVFTSIPDFWAFGQLFPIVPIHRLDEKPVMRGILSDLTCDSDG  553

Query  1208  KIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             K+DKF+GGESSLPLHELG +GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRV QSD PH
Sbjct  554   KVDKFIGGESSLPLHELGSDGGRYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQSDSPH  613

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRA---EEFLHDEDNGGMafaslassla  858
             SF+VTR+ PGPSCADVLR MQ EPELMFETLKHRA    E    E++  M+FASL SSLA
Sbjct  614   SFAVTRSVPGPSCADVLRAMQFEPELMFETLKHRAEEYLEQEEKEEDKSMSFASLTSSLA  673

Query  857   nsFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
              SFHNMPYLV  S+CC TAAT    GYYY ++  A    AD + GED+ WSYC A
Sbjct  674   QSFHNMPYLVAPSSCCFTAATGNNGGYYYYSEDKA----ADCATGEDDIWSYCTA  724



>ref|XP_009592123.1| PREDICTED: arginine decarboxylase-like [Nicotiana tomentosiformis]
Length=730

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/719 (79%), Positives = 629/719 (87%), Gaps = 13/719 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY+F WD SLPAPE   S    +P +      +   +HWSP+ S+ALY IDGWG PYFTV
Sbjct  17    GYSFLWDSSLPAPEIFPSG---VPLSTNTAATTTTTTHWSPAHSSALYSIDGWGAPYFTV  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISV+PHG+ TL HQEIDLLKVVKKASDPK  GGLGLQ PL+VRFPD+LKNRLESL
Sbjct  74    NSSGDISVKPHGTETLPHQEIDLLKVVKKASDPKNSGGLGLQFPLVVRFPDILKNRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF++AV+SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  134   QSAFDYAVQSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKGS + LL+CNGFKDA+YISLAL ARKL+LNTVIVLEQEEE+DL+IDISRKMAVRP+I
Sbjct  194   LCKGSREGLLVCNGFKDADYISLALVARKLMLNTVIVLEQEEELDLVIDISRKMAVRPLI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPS
Sbjct  254   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPS  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCELVRLGA MK ID GGGLGIDYDG+KS DS+ SVGY LQEYAS 
Sbjct  314   TALLADGVGEAAQIYCELVRLGAGMKYIDCGGGLGIDYDGTKSCDSDCSVGYGLQEYAST  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVSS++ +  +L +  LQSFVE 
Sbjct  374   VVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVDLQSFVEK  433

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L DDARADY+NLSAAAIRGEYDTCVLYADQLKQRCV+QFK+G+L IEQLAAVDGICD VS
Sbjct  434   LNDDARADYRNLSAAAIRGEYDTCVLYADQLKQRCVEQFKDGNLDIEQLAAVDGICDFVS  493

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA DPV TY+VNLS+FTSIPDFWA  QLFPIVPIH+LDERPG RGILSDLTCDSDGK
Sbjct  494   KAIGASDPVRTYHVNLSIFTSIPDFWAIDQLFPIVPIHKLDERPGVRGILSDLTCDSDGK  553

Query  1205  IDKFVGGESSLPLHEL----GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             IDKF+GGESSLPLHEL    GG+GG+YYLGMFLGGAYEEALGG HNLFGGPSV+RVSQSD
Sbjct  554   IDKFIGGESSLPLHELGSNGGGDGGKYYLGMFLGGAYEEALGGLHNLFGGPSVLRVSQSD  613

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDED----NGGMafasla  870
              PHSF+VT A PGPSCADVLR MQHEPELMFETLKHRAEEF+H++D    + G+AFASLA
Sbjct  614   SPHSFAVTCAVPGPSCADVLRAMQHEPELMFETLKHRAEEFVHNDDEQEEDKGLAFASLA  673

Query  869   sslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             SSLA SF+NMPYLV  S+CCLTAA     GYYY ND +     A+S+  E+E W YC+A
Sbjct  674   SSLAQSFNNMPYLVTNSSCCLTAANN--GGYYYCNDENIVGVGAESAAAEEELWPYCVA  730



>gb|AAF42970.1|AF127239_1 arginine decarboxylase 1 [Nicotiana tabacum]
 gb|AAF42971.1|AF127240_1 arginine decarboxylase 1 [Nicotiana tabacum]
Length=720

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/716 (79%), Positives = 622/716 (87%), Gaps = 17/716 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAF+ D SLPAPE          T+ VPPT S   S  SP +S+ALY +DGWG PYF+V
Sbjct  17    GYAFSRDSSLPAPEFF--------TSGVPPTNSAAGSIGSPDLSSALYGVDGWGAPYFSV  68

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NS+GDISVRPHG+ TL HQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESL
Sbjct  69    NSNGDISVRPHGTDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESL  128

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+ AV SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC
Sbjct  129   QSAFDLAVHSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  188

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LC+GS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDISRKMAVRPVI
Sbjct  189   LCRGSAEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISRKMAVRPVI  248

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPS
Sbjct  249   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPS  308

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCEL+RLGA MK ID GGGLGIDYDG+KS DS+VSVGY +QEYAS 
Sbjct  309   TALLADGVGEAAQIYCELIRLGAGMKFIDTGGGLGIDYDGTKSCDSDVSVGYGIQEYAST  368

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAV--SSSSDKLLQLPNPGLQSFV  1572
             VVQAV++VCDRKGV HPVICSESGRAIVSHHSILIFEAV  SS S     L + GLQS  
Sbjct  369   VVQAVQYVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASSHSCSSSHLSSGGLQSMA  428

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             E+L +DA ADY+NLSAAA+RGEY+TCVLY+DQLKQRCVDQFKEGSL IE LAAVD ICD 
Sbjct  429   ETLNEDALADYRNLSAAAVRGEYETCVLYSDQLKQRCVDQFKEGSLGIEHLAAVDSICDF  488

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             VSKA+GA DP+ TY+VNLS+FTSIPDFWAFGQLFPIVPIHRLDE+P  RGILSDLTCDSD
Sbjct  489   VSKAMGAADPIRTYHVNLSIFTSIPDFWAFGQLFPIVPIHRLDEKPAVRGILSDLTCDSD  548

Query  1211  GKIDKFVGGESSLPLHELG--GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             GK+DKF+GGESSL LHELG  G+GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSD
Sbjct  549   GKVDKFIGGESSLQLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVVQSD  608

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla  858
               HSF+++R+ PGPSCADVLR MQHEPELMFETLKHRAEEFL  E++ G+A ASLASSLA
Sbjct  609   SAHSFAMSRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEEDKGLAIASLASSLA  668

Query  857   nsFHNMPYLVVGSTCCLTAATTPGSGY-YYGNDVSAANPIADSSPGEDEHWSYCIA  693
              SFHNMPYLV  ++CC TA T    GY YY +D +A    ADS+ GEDE WSYC A
Sbjct  669   QSFHNMPYLVAPASCCFTAVTANNGGYNYYYSDENA----ADSATGEDEIWSYCTA  720



>gb|AAQ14851.1|AF321137_1 arginine decarboxylase [Nicotiana tabacum]
Length=721

 Score =  1056 bits (2731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/715 (80%), Positives = 619/715 (87%), Gaps = 17/715 (2%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVN  2643
             YAF+ D SLPAPE   S         VPPT S   SHWSP +S+ALY +DGWG PYF+VN
Sbjct  19    YAFSRDSSLPAPEFFAS--------GVPPTNSAAASHWSPDLSSALYGVDGWGAPYFSVN  70

Query  2642  SSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQ  2463
             S+GDISVRPHG+ TL HQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESLQ
Sbjct  71    SNGDISVRPHGTDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESLQ  130

Query  2462  SAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCL  2283
             SAF+ AV SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSCL
Sbjct  131   SAFDLAVHSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSCL  190

Query  2282  CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIG  2103
             CKGS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDIS KMAVRPVIG
Sbjct  191   CKGSAEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISHKMAVRPVIG  250

Query  2102  LRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPST  1923
             LRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPST
Sbjct  251   LRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPST  310

Query  1922  ALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAV  1743
              LLADGVGEAAQIYCELVRLGA MK IDIGGGLGIDYDG+KS DS+VSVGY +QEYASAV
Sbjct  311   GLLADGVGEAAQIYCELVRLGAGMKFIDIGGGLGIDYDGTKSCDSDVSVGYGIQEYASAV  370

Query  1742  VQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA--VSSSSDKLLQLPNPGLQSFVE  1569
             VQAV++V DRKGV HPVICSESGRAIVSHHSILIFEA   SS+      L + GLQS  E
Sbjct  371   VQAVQYVGDRKGVKHPVICSESGRAIVSHHSILIFEAVSASSTHVSSSHLSSGGLQSMAE  430

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
             +L +DA ADY+NLSAAA+RGEY+TCVLY+DQLKQRCV+QFKEGSL IE LAAVD ICD V
Sbjct  431   TLNEDALADYRNLSAAAVRGEYETCVLYSDQLKQRCVEQFKEGSLGIEHLAAVDSICDFV  490

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKA+GA DPV TY+VNLS+FTSIPDFWAFGQLFPIVPIHRLDE+P  RGILSDLTCDSDG
Sbjct  491   SKAMGAADPVRTYHVNLSIFTSIPDFWAFGQLFPIVPIHRLDEKPAVRGILSDLTCDSDG  550

Query  1208  KIDKFVGGESSLPLHELG--GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDG  1035
             K+DKF+GGESSLPLHELG  G+GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSD 
Sbjct  551   KVDKFIGGESSLPLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVVQSDS  610

Query  1034  PHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslan  855
              HSF++TR+ PGPSCADVLR MQHEPELMFETLKHRAEEFL  ED+ G+A  SLASS+A 
Sbjct  611   AHSFAMTRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEDDKGLAVESLASSVAQ  670

Query  854   sFHNMPYLVVGSTCCLTAATTPGSGY-YYGNDVSAANPIADSSPGEDEHWSYCIA  693
             SFHNMPYLV  S+C  TAAT    GY YY +D +A    ADS+ GEDE WSYC A
Sbjct  671   SFHNMPYLVAPSSCRFTAATDNNGGYNYYYSDENA----ADSATGEDEIWSYCTA  721



>gb|AAF42972.1|AF127241_1 arginine decarboxylase 2 [Nicotiana tabacum]
Length=721

 Score =  1054 bits (2726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/715 (80%), Positives = 619/715 (87%), Gaps = 17/715 (2%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVN  2643
             YAF+ D SLPAPE   S         VPPT S   S  SP +S+ALY +DGWG PYF+VN
Sbjct  19    YAFSRDSSLPAPEFFAS--------GVPPTNSAAASIGSPDLSSALYGVDGWGAPYFSVN  70

Query  2642  SSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQ  2463
             S+GDISVRPHG+ TL HQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESLQ
Sbjct  71    SNGDISVRPHGTDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESLQ  130

Query  2462  SAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCL  2283
             SAF+ AV SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSCL
Sbjct  131   SAFDLAVHSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSCL  190

Query  2282  CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIG  2103
             CKGS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDIS KMAVRPVIG
Sbjct  191   CKGSAEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISHKMAVRPVIG  250

Query  2102  LRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPST  1923
             LRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPST
Sbjct  251   LRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPST  310

Query  1922  ALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAV  1743
              LLADGVGEAAQIYCELVRLGA MK IDIGGGLGIDYDG+KS DS+VSVGY +QEYASAV
Sbjct  311   GLLADGVGEAAQIYCELVRLGAGMKFIDIGGGLGIDYDGTKSCDSDVSVGYGIQEYASAV  370

Query  1742  VQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAV--SSSSDKLLQLPNPGLQSFVE  1569
             VQAV++VCDRKGV HPVICSESGRAIVSHHSILIFEAV  SS S     L + GLQS  E
Sbjct  371   VQAVQYVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASSHSCSSSHLSSGGLQSMAE  430

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
             +L +DA ADY+NLSAAA+RGEY+TCVLY+DQLKQRCVDQFKEGSL IE LAAVD ICD V
Sbjct  431   TLNEDALADYRNLSAAAVRGEYETCVLYSDQLKQRCVDQFKEGSLGIEHLAAVDSICDFV  490

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKA+GA DPV TY+VNLS+FTSIPDFWAFGQLFPIVPIHRLDE+P  RGILSDLTCDSDG
Sbjct  491   SKAMGAADPVRTYHVNLSIFTSIPDFWAFGQLFPIVPIHRLDEKPAVRGILSDLTCDSDG  550

Query  1208  KIDKFVGGESSLPLHELG--GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDG  1035
             K+DKF+GGESSLPLHELG  G+GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSD 
Sbjct  551   KVDKFIGGESSLPLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVVQSDS  610

Query  1034  PHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslan  855
              HSF++TR+ PGPSCADVLR MQHEPELMFETLKHRAEEFL  ED+ G+A  SLASS+A 
Sbjct  611   AHSFAMTRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEDDKGLAVESLASSVAQ  670

Query  854   sFHNMPYLVVGSTCCLTAATTPGSGY-YYGNDVSAANPIADSSPGEDEHWSYCIA  693
             SFHNMPYLV  S+C  TAAT    GY YY +D +A    ADS+ GEDE WSYC A
Sbjct  671   SFHNMPYLVAPSSCRFTAATDNNGGYNYYYSDENA----ADSATGEDEIWSYCTA  721



>ref|XP_009779129.1| PREDICTED: arginine decarboxylase-like [Nicotiana sylvestris]
Length=733

 Score =  1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/721 (79%), Positives = 629/721 (87%), Gaps = 14/721 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY+F WD SLPAPE   S    +P +     A+   +HWSP+ S+ALY IDGWG PYFTV
Sbjct  17    GYSFLWDSSLPAPEIFPSG---VPPSTNTAVATTTTTHWSPAHSSALYSIDGWGAPYFTV  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISV+PHG+ TL HQEIDLLKVVKKASDPK LGGLGLQ PL+VRFPD+LKNRLESL
Sbjct  74    NSSGDISVKPHGTDTLPHQEIDLLKVVKKASDPKNLGGLGLQFPLVVRFPDILKNRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QS F++AV+SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  134   QSVFDYAVQSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKGS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDIS+KMAVRPVI
Sbjct  194   LCKGSHEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISKKMAVRPVI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPS
Sbjct  254   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPS  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCELVRLGA MK ID GGGLGIDYDG+KS DS+ SVGY LQEYAS 
Sbjct  314   TALLADGVGEAAQIYCELVRLGAGMKYIDCGGGLGIDYDGTKSCDSDCSVGYGLQEYAST  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVSS++ +  +L +  LQSFVE 
Sbjct  374   VVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVDLQSFVEK  433

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L DDARADY+NLSAAAIRGEYDTCVLYADQLKQRCV+QFK+G L IEQLAAVDGICD VS
Sbjct  434   LNDDARADYRNLSAAAIRGEYDTCVLYADQLKQRCVEQFKDGDLDIEQLAAVDGICDFVS  493

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA DPV TY+VNLS+FTS+PDFWA  QLFPIVPIH+LDERP  RGILSDLTCDSDGK
Sbjct  494   KAIGASDPVRTYHVNLSIFTSVPDFWAIDQLFPIVPIHKLDERPVVRGILSDLTCDSDGK  553

Query  1205  IDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQ  1044
             IDKF+GGESSLPLHEL      GG+GG+YYLGMFLGGAYEEALGG HNLFGGPSV+RVSQ
Sbjct  554   IDKFIGGESSLPLHELGSNGGGGGDGGKYYLGMFLGGAYEEALGGLHNLFGGPSVLRVSQ  613

Query  1043  SDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDED----NGGMafas  876
             SD PHSF+VT A PGPSCADVLR MQHEPELMFETLKHRAEEF+H++D    + G+AFAS
Sbjct  614   SDSPHSFAVTCAVPGPSCADVLRAMQHEPELMFETLKHRAEEFVHNDDEQEEDKGLAFAS  673

Query  875   lasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCI  696
             LASSLA SF+NMPYLV  S+CCLTAA   G GYYY ND +     A+S+  E+E W YC+
Sbjct  674   LASSLAQSFNNMPYLVTNSSCCLTAAANNG-GYYYCNDENIVGVGAESAAAEEELWPYCV  732

Query  695   A  693
             A
Sbjct  733   A  733



>ref|XP_011088497.1| PREDICTED: arginine decarboxylase [Sesamum indicum]
Length=717

 Score =  1049 bits (2712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/717 (77%), Positives = 614/717 (86%), Gaps = 25/717 (3%)
 Frame = -3

Query  2822  YAFA-WDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             YAFA WD +LPAP          PTN   P+ +     WSP+ S+ LYR+DGWG PYFTV
Sbjct  19    YAFAGWDSTLPAPP---------PTNTAVPSPA-----WSPAHSSLLYRVDGWGAPYFTV  64

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N +G++SVRP+G  TLSHQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESL
Sbjct  65    NCNGNVSVRPYGVNTLSHQEIDLLKVVKKASDPKDSGGLGLQLPLVVRFPDVLKNRLESL  124

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QS+F+FA++SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  125   QSSFDFAIQSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSC  184

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LC GSP+ALL+CNGFKD EYISLAL ARKL LNTVIVLEQEEE+D++I++SRK+ VRPVI
Sbjct  185   LCNGSPEALLVCNGFKDVEYISLALVARKLHLNTVIVLEQEEELDIVINVSRKLGVRPVI  244

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKLQ+ EM+DCLQLLHFHIGSQIPS
Sbjct  245   GVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLQQYEMLDCLQLLHFHIGSQIPS  304

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCELVRLGACM+VIDIGGGLGIDYDGSKS DS++SV Y+LQEYASA
Sbjct  305   TALLADGVGEAAQIYCELVRLGACMRVIDIGGGLGIDYDGSKSQDSDISVAYSLQEYASA  364

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV+AVR VCDRKGV HPVICSESGRAIVSHHSIL+FEAVS+SS    Q+   GLQ FVE 
Sbjct  365   VVEAVRLVCDRKGVKHPVICSESGRAIVSHHSILVFEAVSTSSHDSPQVSALGLQYFVEL  424

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L D+A ADY+NLSAAAI G+YDTC+LYA+QLKQRC++QFKEGSL +EQLAAVDG+C+LV 
Sbjct  425   LTDEALADYRNLSAAAIHGDYDTCLLYAEQLKQRCIEQFKEGSLGMEQLAAVDGLCELVL  484

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIG  DPV TY+VNLS+FTSIPDFW  GQLFPI+PIHRLDE+PG RGILSDLTCDSDGK
Sbjct  485   KAIGVSDPVRTYHVNLSIFTSIPDFWGIGQLFPIIPIHRLDEKPGVRGILSDLTCDSDGK  544

Query  1205  IDKFVGGESSLPLHELGGNGG------RYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQ  1044
             IDKF+GGESSLPLHEL GNGG       YYLGMFLGGAYEEALGG HNLFGGPSVVRVSQ
Sbjct  545   IDKFIGGESSLPLHELEGNGGVNGDCPAYYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQ  604

Query  1043  SDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslass  864
             SDGPHSF+VTRA PGPSC DVLRVMQHEPELMF+TLKHR EEF    D+GG +  +L + 
Sbjct  605   SDGPHSFAVTRAVPGPSCGDVLRVMQHEPELMFQTLKHRVEEF---ADDGGSSILALTNG  661

Query  863   lansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             LA  F+NMPYL   ++C LTAA    +GYYY ND S A    DS   E+E WSYC+A
Sbjct  662   LACCFNNMPYLAAAASCSLTAAAAGNNGYYYCNDESFAAS-GDSVGAEEEQWSYCVA  717



>dbj|BAD06581.1| arginine decarboxylase [Nicotiana tabacum]
Length=733

 Score =  1049 bits (2712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/721 (79%), Positives = 628/721 (87%), Gaps = 14/721 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY+F  D SLPAPE   S    +P +     A+   +HWSP+ S+ALY IDGWG PYFTV
Sbjct  17    GYSFLGDSSLPAPEIFPSG---VPPSTNTAVATTTTTHWSPAHSSALYSIDGWGAPYFTV  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISV+PHG+ TL HQEIDLLKVVKKASDPK LGGLGLQ PL+VRFPD+LKNRLESL
Sbjct  74    NSSGDISVKPHGTDTLPHQEIDLLKVVKKASDPKNLGGLGLQFPLVVRFPDILKNRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QS F++AV+SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  134   QSVFDYAVQSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKGS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDIS+KMAVRPVI
Sbjct  194   LCKGSHEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISKKMAVRPVI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPS
Sbjct  254   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPS  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCELVRLGA MK ID GGGLGIDYDG+KS DS+ SVGY LQEYAS 
Sbjct  314   TALLADGVGEAAQIYCELVRLGAGMKYIDCGGGLGIDYDGTKSCDSDCSVGYGLQEYAST  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVSS++ +  +L +  LQSFVE 
Sbjct  374   VVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVDLQSFVEK  433

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L DDARADY+NLSAAAIRGEYDTCVLYADQLKQRCV+QFK+G L IEQLAAVDGICD VS
Sbjct  434   LNDDARADYRNLSAAAIRGEYDTCVLYADQLKQRCVEQFKDGDLDIEQLAAVDGICDFVS  493

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA DPV TY+VNLS+FTS+PDFWA  QLFPIVPIH+LDERP  RGILSDLTCDSDGK
Sbjct  494   KAIGASDPVRTYHVNLSIFTSVPDFWAIDQLFPIVPIHKLDERPVVRGILSDLTCDSDGK  553

Query  1205  IDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQ  1044
             IDKF+GGESSLPLHEL      GG+GG+YYLGMFLGGAYEEALGG HNLFGGPSV+RVSQ
Sbjct  554   IDKFIGGESSLPLHELGSNGGGGGDGGKYYLGMFLGGAYEEALGGLHNLFGGPSVLRVSQ  613

Query  1043  SDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDED----NGGMafas  876
             SD PHSF+VT A PGPSCADVLR MQHEPELMFETLKHRAEEF+H++D    + G+AFAS
Sbjct  614   SDSPHSFAVTCAVPGPSCADVLRAMQHEPELMFETLKHRAEEFVHNDDEQEEDKGLAFAS  673

Query  875   lasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCI  696
             LASSLA SF+NMPYLV  S+CCLTAA   G GYYY ND +     A+S+  E+E W YC+
Sbjct  674   LASSLAQSFNNMPYLVTNSSCCLTAAANNG-GYYYCNDENIVGVGAESAAAEEELWPYCV  732

Query  695   A  693
             A
Sbjct  733   A  733



>ref|XP_006360614.1| PREDICTED: arginine decarboxylase 2-like [Solanum tuberosum]
Length=720

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/716 (79%), Positives = 620/716 (87%), Gaps = 17/716 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY+F     L  PE + SS  P  TNAVP T     +HWSP +S+ LYR+DGWG PYFTV
Sbjct  17    GYSF-----LSTPE-IFSSGVPPSTNAVPFT-----THWSPELSSDLYRVDGWGAPYFTV  65

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GGLGLQLPL+VRFPDVLKNRLESL
Sbjct  66    NSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGGLGLQLPLVVRFPDVLKNRLESL  125

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMS 
Sbjct  126   QSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSS  185

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVLEQEEE+DL+IDISRKMAVRPVI
Sbjct  186   LCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVLEQEEELDLVIDISRKMAVRPVI  245

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL+ES M+DCLQLLHFHIGSQIPS
Sbjct  246   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLEESGMLDCLQLLHFHIGSQIPS  305

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDYDG+KS+DS+VSVGY LQ+YAS 
Sbjct  306   TALLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDYDGTKSSDSDVSVGYGLQDYAST  365

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVSS++ +  +L + GLQSFVE 
Sbjct  366   VVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVGLQSFVEK  425

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCV+QFK+G+L IEQLAAVD +CD VS
Sbjct  426   LNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVEQFKDGNLDIEQLAAVDAVCDFVS  485

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA DPV TY+VNLSVFTSIPDFWA  QLFPIVPIH+LDERP ARGILSDLTCDSDGK
Sbjct  486   KAIGASDPVRTYHVNLSVFTSIPDFWAIDQLFPIVPIHKLDERPSARGILSDLTCDSDGK  545

Query  1205  IDKFVGGESSLPLHELG-GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             IDKF+GGESSLPLHELG GNG  YYLGMFLGGAYEEALGG HNLFGGPSV+RVSQSD PH
Sbjct  546   IDKFIGGESSLPLHELGSGNGAPYYLGMFLGGAYEEALGGLHNLFGGPSVLRVSQSDSPH  605

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRA----EEFLHDEDNGGMafaslassl  861
             SF+VT A PGPSCADVLR MQHEPELMFETLKHRA     +   +E+N  +AFASLASSL
Sbjct  606   SFAVTYAVPGPSCADVLRAMQHEPELMFETLKHRAEEFMHKEEEEEENKEVAFASLASSL  665

Query  860   ansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
               SFHNMPYL   S+CC +AA   G GYYY ND +     A+ + GE+E W YC+A
Sbjct  666   NQSFHNMPYLAPHSSCCFSAAANSG-GYYYCNDENIVGVGAECAIGEEEFWPYCVA  720



>ref|NP_001234064.1| arginine decarboxylase [Solanum lycopersicum]
 emb|CAI39242.1| arginine decarboxylase [Solanum lycopersicum]
Length=707

 Score =  1042 bits (2695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/712 (78%), Positives = 608/712 (85%), Gaps = 22/712 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY+F     L  PE + SS  P  TNAVP T     +HWSP +S+ LYRIDGWG PYFTV
Sbjct  17    GYSF-----LSTPE-IFSSGVPPSTNAVPLT-----THWSPELSSDLYRIDGWGAPYFTV  65

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GGLGLQLPL+VRFPDVLKNRLESL
Sbjct  66    NSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGGLGLQLPLVVRFPDVLKNRLESL  125

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKFG+ FRFGLEAGSKPELLLAMS 
Sbjct  126   QSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKFGTGFRFGLEAGSKPELLLAMSS  185

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVLEQEEE+DL+IDISRKMAV+PVI
Sbjct  186   LCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVLEQEEELDLVIDISRKMAVQPVI  245

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL+ES M+DCLQLLHFHIGSQIPS
Sbjct  246   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLKESGMLDCLQLLHFHIGSQIPS  305

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDYDG+KS+DS+VSVGY LQ+YAS 
Sbjct  306   TELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDYDGTKSSDSDVSVGYGLQDYAST  365

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVSS++ +  +L +  L SFVE 
Sbjct  366   VVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSMSLHSFVEK  425

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQFK+G+L IEQLAAVD +CD VS
Sbjct  426   LNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQFKDGNLDIEQLAAVDAVCDFVS  485

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA DPV TY+VNLSVFTSIPDFWA  QLFPIVPIH+LDE P ARGILSDLTCDSDGK
Sbjct  486   KAIGASDPVRTYHVNLSVFTSIPDFWAIDQLFPIVPIHKLDEHPSARGILSDLTCDSDGK  545

Query  1205  IDKFVGGESSLPLHELG-GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             IDKF+GGESSL LHELG GN   YYLGMFLGGAYEEALGG HNLFGGPSV+RVSQSD PH
Sbjct  546   IDKFIGGESSLALHELGSGNSAPYYLGMFLGGAYEEALGGLHNLFGGPSVLRVSQSDSPH  605

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansF  849
             SF+VT A PGPSCADVLR MQHEPELMFETLKHRAEEF+H E+       SLA+SL  SF
Sbjct  606   SFAVTYAVPGPSCADVLRAMQHEPELMFETLKHRAEEFVHKEEE---VEVSLANSLNQSF  662

Query  848   HNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             HNMPYL   S+CC        SGYYY ND +     A+ + GE+E W YC+A
Sbjct  663   HNMPYLAPHSSCCF-------SGYYYCNDENIVGVGAECAIGEEEFWPYCVA  707



>ref|XP_006359602.1| PREDICTED: arginine decarboxylase-like [Solanum tuberosum]
Length=735

 Score =  1040 bits (2690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/727 (78%), Positives = 620/727 (85%), Gaps = 27/727 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAF+WD SLPAPE L SS  P  TNA   T     SHWS  +S+ALYR+DGWG PYF+V
Sbjct  17    GYAFSWDSSLPAPE-LFSSGVPPATNAAAVTTG---SHWSTDLSSALYRVDGWGAPYFSV  72

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISVRPHG+ TL HQEIDLLKVVKKASDPK LGGLGLQ+PL+VRFPDVLKNRLE+L
Sbjct  73    NSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPKNLGGLGLQMPLVVRFPDVLKNRLETL  132

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+ AV SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS +RFGLEAGSKPELLLAM+C
Sbjct  133   QSAFDMAVNSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSPYRFGLEAGSKPELLLAMNC  192

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L KGS DALL+CNGFKD EYISLAL ARKLLLNTVIVLEQEEE+DL+IDISRKMAVRPVI
Sbjct  193   LSKGSADALLVCNGFKDTEYISLALVARKLLLNTVIVLEQEEELDLVIDISRKMAVRPVI  252

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL ES M+DCLQLLHFHIGSQIP+
Sbjct  253   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDESGMLDCLQLLHFHIGSQIPT  312

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEA QIY ELVRLGA MK IDIGGGLGIDYDGSKS++S+VSVGY ++EYASA
Sbjct  313   TELLADGVGEATQIYSELVRLGAGMKFIDIGGGLGIDYDGSKSSNSDVSVGYGIEEYASA  372

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP-GLQSFVE  1569
             VVQAV +VCDRKGV HPVICSESGRAIVSHHSILIFEAVS+S+  +   P+  GLQS VE
Sbjct  373   VVQAVLYVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASTTHVSTQPSSGGLQSLVE  432

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
             +L +DARADY+NLSAAA+RGEYDTC+LY+DQLKQRCV+QFK+GSL IEQLAAVD ICD V
Sbjct  433   TLNEDARADYRNLSAAAVRGEYDTCLLYSDQLKQRCVEQFKDGSLDIEQLAAVDSICDWV  492

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKAIG  DPV TY+VNLSVFTSIPDFW F QLFPIVPIHRLDE+P  RGILSDLTCDSDG
Sbjct  493   SKAIGVADPVRTYHVNLSVFTSIPDFWGFSQLFPIVPIHRLDEKPTMRGILSDLTCDSDG  552

Query  1208  KIDKFVGGESSLPLHEL----GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQS  1041
             K+DKF+GGESSLPLHE+    GG+GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRV QS
Sbjct  553   KVDKFIGGESSLPLHEIGSNAGGDGGRYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQS  612

Query  1040  DGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLH----DEDNGGMafasl  873
             D PHSF+VTR+ PGPSCADVLR MQ EPELMFETLKHRAEEFL     + ++ G+AFASL
Sbjct  613   DSPHSFAVTRSVPGPSCADVLRAMQFEPELMFETLKHRAEEFLEQGEGEGEDKGLAFASL  672

Query  872   asslansFHNMPYLV-VGSTCCL---------TAATTPGSGYYYGNDVSAANPIADSSPG  723
              SSLA SFHNMPYLV   S+CC            A     GYYY ++ +A    AD +  
Sbjct  673   TSSLAQSFHNMPYLVSSSSSCCFTAEATATASANANANNGGYYYYSEDNA----ADCATE  728

Query  722   EDEHWSY  702
             EDE WSY
Sbjct  729   EDEIWSY  735



>gb|AFN26936.1| arginine decarboxylase [Camellia sinensis]
Length=720

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/709 (77%), Positives = 606/709 (85%), Gaps = 16/709 (2%)
 Frame = -3

Query  2810  WDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGD  2631
             WD SLPAPE         P + VPP  +   + WSP +SAALY+ID WG PYF+VNSSG+
Sbjct  25    WDSSLPAPE---------PFSGVPPPINTT-TAWSPPLSAALYKIDEWGAPYFSVNSSGN  74

Query  2630  ISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFN  2451
             ISV+PHGSATLSHQEIDL+K+VKKASDPK  GGLGLQ PLIVR PDVLK+RLESLQSAFN
Sbjct  75    ISVKPHGSATLSHQEIDLMKIVKKASDPKSSGGLGLQFPLIVRLPDVLKSRLESLQSAFN  134

Query  2450  FAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGS  2271
             FAV +QGY SHYQGVYPVKCNQDRFVVEDIVKFGS  RFGLEAGSKPELLLAMSCLCKGS
Sbjct  135   FAVRAQGYDSHYQGVYPVKCNQDRFVVEDIVKFGSGLRFGLEAGSKPELLLAMSCLCKGS  194

Query  2270  PDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAK  2091
              +ALL+CNGFKD EYISLAL ARKL LNTVIVLEQ+EE+DL+ID+SRK+ VRPVIG+RAK
Sbjct  195   TEALLVCNGFKDVEYISLALIARKLALNTVIVLEQQEEIDLVIDLSRKLGVRPVIGVRAK  254

Query  2090  LRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLA  1911
             LRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL++S M+DCL+LLHFHIGSQIPSTALLA
Sbjct  255   LRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLEQSGMLDCLKLLHFHIGSQIPSTALLA  314

Query  1910  DGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAV  1731
             DGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKSADS++SV Y+L+EYA AVVQ+V
Sbjct  315   DGVGEAAQIYCELVRLGAFMEVIDIGGGLGIDYDGSKSADSDISVSYSLEEYALAVVQSV  374

Query  1730  RFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDA  1551
             + VCDRK V HPVICSESGRAIVSHHS+LIFEAVS+S      +    LQ F + + +DA
Sbjct  375   KMVCDRKSVKHPVICSESGRAIVSHHSVLIFEAVSASVYDAPAMNTLELQYFADGIPEDA  434

Query  1550  RADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             R DY+NLS AA   +Y+TC LYA+QLKQRCV+QFKEGSL IEQLAAVDG+C+LVSKAIGA
Sbjct  435   RGDYRNLSVAAFHRDYETCFLYAEQLKQRCVEQFKEGSLGIEQLAAVDGMCELVSKAIGA  494

Query  1370  YDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFV  1191
              DP+ TY+VNLSVFTSIPDFW  GQLFPIVPIHRLD+RPG RGILSDLTCDSDGKI+KF+
Sbjct  495   SDPIRTYHVNLSVFTSIPDFWGIGQLFPIVPIHRLDQRPGVRGILSDLTCDSDGKINKFI  554

Query  1190  GGESSLPLH---ELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFS  1020
             GGESSLPLH      G GG YYLGMFLGGAYEEALGG HNLFGGPSVVRVSQ+DGPHSF+
Sbjct  555   GGESSLPLHELEGEDGGGGTYYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQNDGPHSFA  614

Query  1019  VTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansFHNM  840
             VTRA PGPSC DVLRVMQHEPELMFE LKHRAEEF+HD+ N GMA ASLAS +A SF+N 
Sbjct  615   VTRAMPGPSCGDVLRVMQHEPELMFEVLKHRAEEFVHDDGN-GMATASLASGIARSFNNT  673

Query  839   PYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             PYLV+ S+CCLTA+      YY  ND   A   +DSS GEDE W+YC A
Sbjct  674   PYLVMASSCCLTASNGSNGYYYCNNDNYVA--ASDSSAGEDEQWTYCCA  720



>ref|XP_010091194.1| Arginine decarboxylase [Morus notabilis]
 gb|EXB43294.1| Arginine decarboxylase [Morus notabilis]
Length=715

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/707 (76%), Positives = 607/707 (86%), Gaps = 18/707 (3%)
 Frame = -3

Query  2807  DRSLPAPEALVSSDAPLPTNAVPP--TASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSG  2634
             D SLPAP          P   VPP  T +V+ SHWSPS+SAALY++DGWG PYF VNSSG
Sbjct  25    DSSLPAPVP--------PFAGVPPATTTTVETSHWSPSLSAALYKVDGWGAPYFNVNSSG  76

Query  2633  DISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAF  2454
             ++SVRP+GSAT+ HQEIDLLK+VKK SDPK  GGLGLQLPLIVR PDVLKNRLESLQSAF
Sbjct  77    NVSVRPYGSATMPHQEIDLLKIVKKVSDPKSSGGLGLQLPLIVRLPDVLKNRLESLQSAF  136

Query  2453  NFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKG  2274
              FA++SQ Y SHYQGVYPVKCNQDRFV+EDIV+FGS FRFGLEAGSKPELLLAMSCLCKG
Sbjct  137   QFAIQSQDYESHYQGVYPVKCNQDRFVIEDIVRFGSPFRFGLEAGSKPELLLAMSCLCKG  196

Query  2273  SPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRA  2094
             +P++LL+CNGFKDAEYISLAL ARKL LNTVIVLEQEEE+DL++++SR++++RPVIG+RA
Sbjct  197   NPESLLVCNGFKDAEYISLALVARKLALNTVIVLEQEEELDLVVELSRRLSIRPVIGVRA  256

Query  2093  KLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALL  1914
             KLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL++  M+DCLQLLHFHIGSQIP+TALL
Sbjct  257   KLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLEQIGMLDCLQLLHFHIGSQIPTTALL  316

Query  1913  ADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQA  1734
             ADGV EAAQIYCELVRLGA M++IDIGGGLGIDYDGSKS+DSE+SV Y L EYA AVV+A
Sbjct  317   ADGVSEAAQIYCELVRLGAHMRIIDIGGGLGIDYDGSKSSDSEISVSYGLDEYALAVVRA  376

Query  1733  VRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDD  1554
             VRFVCDR+GV HPVICSESGRAIVSHHS+LIFEAVS+S+ +   +   GLQ FVE L ++
Sbjct  377   VRFVCDRRGVKHPVICSESGRAIVSHHSVLIFEAVSASTYETPGMSALGLQYFVEGLSEE  436

Query  1553  ARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIG  1374
             ARADY+NLSAAAI+GE DTC+ YADQLKQRC+D+FK+GSL IEQLAAVDG C+ V K IG
Sbjct  437   ARADYRNLSAAAIKGESDTCLFYADQLKQRCIDEFKDGSLGIEQLAAVDGFCEFVWKVIG  496

Query  1373  AYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
               D   TY+VNLSVFTSIPDFW  GQLFPI+PIHRLD+RP  RGILSDLTCDSDGKIDKF
Sbjct  497   VSDSTRTYHVNLSVFTSIPDFWGIGQLFPIIPIHRLDQRPAVRGILSDLTCDSDGKIDKF  556

Query  1193  VGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVT  1014
             +GGESSLPLHEL    G+YYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSF+VT
Sbjct  557   IGGESSLPLHEL---EGKYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFAVT  613

Query  1013  RAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansFHNMPY  834
              A PG SC DVLRVMQHEPELMFE LKHRAEE   ++D  GMA A+LAS LA+ FH+MPY
Sbjct  614   LAVPGSSCGDVLRVMQHEPELMFEALKHRAEECGSEDD--GMANAALASGLAHCFHSMPY  671

Query  833   LVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             L VGS+CCLTA      G+YY ND    N  ADS+ GEDE WSYC A
Sbjct  672   L-VGSSCCLTAMNN--GGFYYCNDEDEYNAAADSASGEDEQWSYCCA  715



>ref|XP_010066227.1| PREDICTED: arginine decarboxylase-like [Eucalyptus grandis]
 gb|KCW64074.1| hypothetical protein EUGRSUZ_G01735 [Eucalyptus grandis]
Length=738

 Score =  1020 bits (2638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/723 (75%), Positives = 616/723 (85%), Gaps = 12/723 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVS--SDAPLPTNAVPPTASV----DHSHWSPSMSAALYRIDGWG  2664
             G+A A D SL    A+V   S APL T       +     D S WSPS+SA+LYRIDGWG
Sbjct  16    GFALAVDGSLREAAAVVPPFSGAPLSTTTAAAATATAAVDDGSFWSPSLSASLYRIDGWG  75

Query  2663  DPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLK  2484
              PYF VN SG+ISVRPHG+ TL HQEIDLLK+VKKASDPK +GGLGLQLPL+VRFPDVLK
Sbjct  76    APYFAVNGSGNISVRPHGTETLGHQEIDLLKIVKKASDPKSVGGLGLQLPLVVRFPDVLK  135

Query  2483  NRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEL  2304
             NRL+SLQ AF+FAV S  Y +HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPEL
Sbjct  136   NRLQSLQFAFDFAVRSLDYQAHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPEL  195

Query  2303  LLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKM  2124
             LLAMSCLCKG+P+ALL+CNGFKD EYI+LAL ARKL +NTVIVLEQEEE+DL+I++S+K+
Sbjct  196   LLAMSCLCKGNPEALLVCNGFKDCEYITLALVARKLAINTVIVLEQEEEIDLVINLSKKL  255

Query  2123  AVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHI  1944
             +VRPVIG+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL ++ M+DCLQLLHFHI
Sbjct  256   SVRPVIGVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLDQAGMLDCLQLLHFHI  315

Query  1943  GSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTL  1764
             GSQIPST LLADGVGEAAQIYCELVRLGA MKVIDIGGGLGIDYDGSKS+DS++SVGY L
Sbjct  316   GSQIPSTVLLADGVGEAAQIYCELVRLGAQMKVIDIGGGLGIDYDGSKSSDSDISVGYDL  375

Query  1763  QEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGL  1584
             QEYA+AVV+AVR VCDRK V HP+ICSESGRAIVSHHS+LIFEAVS+S+ +   L +PGL
Sbjct  376   QEYAAAVVRAVRIVCDRKSVKHPIICSESGRAIVSHHSVLIFEAVSASAYEAPVLSSPGL  435

Query  1583  QSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDG  1404
             Q F+ESL +DARADY NL +AA+RGEY+TC+L+ADQLKQRC++QFKEG L IEQLA VDG
Sbjct  436   QQFMESLTEDARADYGNLYSAAMRGEYETCLLHADQLKQRCIEQFKEGILGIEQLADVDG  495

Query  1403  ICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLT  1224
             +CD+VSKA+GA DPV TY+VNLS+FTSIPDFW  GQLFPIVPIHRLD+RPG RGILSDLT
Sbjct  496   LCDMVSKALGASDPVRTYHVNLSIFTSIPDFWGIGQLFPIVPIHRLDQRPGMRGILSDLT  555

Query  1223  CDSDGKIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPS  1062
             CDSDGKIDKF+GGESSLPLHEL       G+GGRY+LGMFLGGAYEEA+GG HNLFGGPS
Sbjct  556   CDSDGKIDKFIGGESSLPLHELEGERSVSGSGGRYFLGMFLGGAYEEAIGGLHNLFGGPS  615

Query  1061  VVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMaf  882
             VVRVSQSDGPH F+VTRA PGPSC DVLRVMQHEPELMFETL+HRAEE+   + N  M  
Sbjct  616   VVRVSQSDGPHGFAVTRAMPGPSCGDVLRVMQHEPELMFETLRHRAEEYGSGQYNDPMGN  675

Query  881   aslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
              +LAS LA SFHNMPYLV  S+C L A    G  Y   +D +AA  +AD++ GEDE WSY
Sbjct  676   DALASRLAQSFHNMPYLVATSSCALNAINNNGFYYCDEDDYNAAVAVADAASGEDEQWSY  735

Query  701   CIA  693
             C A
Sbjct  736   CCA  738



>gb|AEW69809.1| Hop-interacting protein THI107 [Solanum lycopersicum]
Length=721

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/720 (77%), Positives = 609/720 (85%), Gaps = 27/720 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAF+WD SLPAPE L SS  P  TNA   +     SHWS  +S+ LYR+DGWG PYF+V
Sbjct  17    GYAFSWDSSLPAPE-LFSSGVPPATNAAAVSTG---SHWSTDLSSDLYRVDGWGAPYFSV  72

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISVRPHG+ TL HQEIDLLKVVKKASDPK LGGLGLQ+PL+VRFPDVLKNRLE+L
Sbjct  73    NSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPKNLGGLGLQMPLVVRFPDVLKNRLETL  132

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+ A+ SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS +RFGLEAGSKPELLLAM+C
Sbjct  133   QSAFDMAINSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSPYRFGLEAGSKPELLLAMNC  192

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L KGS DALL+CNGFKD EYISLAL ARKLLLN+VIVLEQEEE+DL+IDISRKM+VRPVI
Sbjct  193   LSKGSADALLVCNGFKDTEYISLALVARKLLLNSVIVLEQEEELDLVIDISRKMSVRPVI  252

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL ES M+DCLQLLHFHIGSQIP+
Sbjct  253   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDESGMLDCLQLLHFHIGSQIPT  312

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEA QIY ELVRLGA MK IDIGGGLGIDYDGSKS++S+VSV Y+++EYASA
Sbjct  313   TELLADGVGEATQIYSELVRLGAGMKFIDIGGGLGIDYDGSKSSNSDVSVCYSIEEYASA  372

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP-GLQSFVE  1569
             VVQAV +VCDRKGV HPVICSESGRAIVSHHSILIFEAVS+S+  +   P+  GLQS VE
Sbjct  373   VVQAVLYVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASTSHVSTQPSSGGLQSLVE  432

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
             +L +DARADY+NLSAAA+RGEYDTC++Y+DQLKQRCV+QFK+GSL IEQLAAVD ICD V
Sbjct  433   TLNEDARADYRNLSAAAVRGEYDTCLIYSDQLKQRCVEQFKDGSLDIEQLAAVDSICDWV  492

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKAIG  DPV TY+VNLSVFTSIPDFW F QLFPIVPIHRLDE+P  RGILSDLTCDSDG
Sbjct  493   SKAIGVADPVRTYHVNLSVFTSIPDFWGFSQLFPIVPIHRLDEKPTMRGILSDLTCDSDG  552

Query  1208  KIDKFVGGESSLPLHELG-GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
             K+DKF+GGESSLPLHE+G G+GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRV QSD P
Sbjct  553   KVDKFIGGESSLPLHEIGSGDGGRYYLGMFLGGAYEEALGGLHNLFGGPSVVRVMQSDSP  612

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRA--EEFLHDEDNGGMafaslassla  858
             HSF+VTR+ PGPSCADVLR MQ EPELMFETLKHRA       + +  G+AF SL SSLA
Sbjct  613   HSFAVTRSVPGPSCADVLRAMQFEPELMFETLKHRAEEFLEQGEGEGEGVAFGSLTSSLA  672

Query  857   nsFHNMPYLVVGSTCCL--------TAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
              SFHNMPYL   S+CC            T  G  YYY  D +AA         EDE WSY
Sbjct  673   QSFHNMPYL---SSCCFTAEATANANTNTNNGGYYYYSEDNAAAE--------EDEIWSY  721



>ref|XP_002269030.1| PREDICTED: arginine decarboxylase [Vitis vinifera]
Length=720

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/717 (76%), Positives = 613/717 (85%), Gaps = 18/717 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAFA D SLPAP        PL TN      + +HSHWSPS+SA LYRIDGWG PYF+V
Sbjct  16    GYAFAGDSSLPAPVPFAGD--PLATNDAAALPTGEHSHWSPSLSADLYRIDGWGAPYFSV  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N+SG+ISVRP+G  TL HQEIDL+K+VKK SDPK  GGLGLQLPLIVR PDVL+NRLESL
Sbjct  74    NTSGNISVRPYGKNTLPHQEIDLMKIVKKVSDPKSAGGLGLQLPLIVRLPDVLQNRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+FA++SQGY SHYQGV+PVKCNQDRF+VED+VKFGS+FRFGLEAGSKPELLLAMSC
Sbjct  134   QSAFDFAIQSQGYESHYQGVFPVKCNQDRFIVEDVVKFGSAFRFGLEAGSKPELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+P+ALL+CNGFKDA+YI+LAL ARKL LNTVIVLEQEEE+DL+I++S+K++V PVI
Sbjct  194   LCKGNPEALLVCNGFKDADYIALALVARKLALNTVIVLEQEEELDLVINLSQKLSVHPVI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKHAGHFGSTSGEKGKFGLTT QILRVV+KL+++ M+D LQLLHFHIGSQIPS
Sbjct  254   GVRAKLRTKHAGHFGSTSGEKGKFGLTTIQILRVVRKLEQAGMLDSLQLLHFHIGSQIPS  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGV EAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS++S++SVGY L+EYA A
Sbjct  314   TDLLADGVSEAAQIYCELVRLGAHMRVIDIGGGLGIDYDGSKSSESDISVGYGLEEYAMA  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV+AV+ VCDRK V HPVICSESGRA+VSHHSILIFEAVS+S        +  LQ FVE 
Sbjct  374   VVRAVQHVCDRKSVKHPVICSESGRALVSHHSILIFEAVSASVHD-SPATSLSLQRFVEG  432

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L ++AR DYQNL+AAA+ GEY+TC+ +ADQLKQRCVDQFKEGSL IEQLA VDG+CDLVS
Sbjct  433   LSEEARVDYQNLAAAAVSGEYETCLRFADQLKQRCVDQFKEGSLGIEQLADVDGLCDLVS  492

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             K +GA DPV TY+VNLSVFT IPDFW  GQLFPIVPIHRLD+RPGARGILSDLTCDSDGK
Sbjct  493   KEVGATDPVRTYHVNLSVFTCIPDFWGIGQLFPIVPIHRLDQRPGARGILSDLTCDSDGK  552

Query  1205  IDKFVGGESSLPLHELGGN------GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQ  1044
             IDKF+GGESSLPLHEL G+       G+YYLGMFLGGAYEEALGG HNLFGGPSVVRV Q
Sbjct  553   IDKFIGGESSLPLHELEGSDVVFGGSGKYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQ  612

Query  1043  SDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslass  864
             SDGPHSF+VTRA PGPSC DVLRVMQHEPELMFETLKHRAEE  H++   GM   SLAS 
Sbjct  613   SDGPHSFAVTRAMPGPSCGDVLRVMQHEPELMFETLKHRAEECGHED---GMTNGSLASG  669

Query  863   lansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             LA SFH MPYLV GS+CC+T      SGYYYGN+    N  ADS+ G+D+HWSYC A
Sbjct  670   LALSFHKMPYLVAGSSCCMT-----NSGYYYGNE-DNYNRAADSAAGDDDHWSYCFA  720



>ref|XP_004290299.1| PREDICTED: arginine decarboxylase-like [Fragaria vesca subsp. 
vesca]
Length=717

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/714 (76%), Positives = 605/714 (85%), Gaps = 17/714 (2%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVN  2643
             YAFA D SLPAP         +P + V P  +   + WS S+S  LYRID WG PYFT N
Sbjct  17    YAFAGDSSLPAP---------VPFSGVFPATASAAAAWSTSLSNDLYRIDAWGGPYFTAN  67

Query  2642  SSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQ  2463
             SSG++SVRP+GS T+ HQEIDLLK+VKK SDPK   GLGLQLPLIVRFPDVLKNRLESLQ
Sbjct  68    SSGNVSVRPYGSGTMPHQEIDLLKIVKKVSDPKSESGLGLQLPLIVRFPDVLKNRLESLQ  127

Query  2462  SAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCL  2283
              AF+FAV+SQ YGSHYQGVYPVKCNQDRFVVEDIV+FG  FRFGLEAGSKPELLLAMSCL
Sbjct  128   GAFDFAVQSQDYGSHYQGVYPVKCNQDRFVVEDIVRFGKPFRFGLEAGSKPELLLAMSCL  187

Query  2282  CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIG  2103
             CKG+P++LL+CNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL+I++S+K+ VRPVIG
Sbjct  188   CKGNPESLLVCNGFKDFEYISLALMARKLELNTVIVLEQEEELDLVIELSKKLGVRPVIG  247

Query  2102  LRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPST  1923
              RAKLRTKH+GHFGSTSGEKGKFGLTT QILRVVKKL++  M+DC QLLHFHIGSQIP+T
Sbjct  248   ARAKLRTKHSGHFGSTSGEKGKFGLTTIQILRVVKKLEQVGMLDCFQLLHFHIGSQIPTT  307

Query  1922  ALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAV  1743
             ALLADGV EAAQIYCELVRLGA MKVIDIGGGLG+DYDGSKS+DSE+SV Y L+EYA AV
Sbjct  308   ALLADGVSEAAQIYCELVRLGAHMKVIDIGGGLGLDYDGSKSSDSEISVSYGLEEYAMAV  367

Query  1742  VQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQSFVES  1566
             V+ +R+VCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+S+ D    +    LQ F+E 
Sbjct  368   VRTIRYVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSASACDVAPSMSAFALQYFIEG  427

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L ++ARADY+NLSAAAIRGE++ C+ YADQLKQRCVDQFKEGSL IEQLA VDG+CDLVS
Sbjct  428   LTEEARADYRNLSAAAIRGEHEACLTYADQLKQRCVDQFKEGSLGIEQLATVDGLCDLVS  487

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA D V TYNVNLSVFTSIPDFW  GQLFPIVPIHRLD+RP  RG+LSDLTCDSDGK
Sbjct  488   KAIGASDSVRTYNVNLSVFTSIPDFWGIGQLFPIVPIHRLDQRPAVRGVLSDLTCDSDGK  547

Query  1205  IDKFVGGESSLPLHELGGN--GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
             I+KF+GGESSLPLHEL GN  GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGP
Sbjct  548   INKFIGGESSLPLHELEGNGSGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGP  607

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslans  852
             +SF+VTRA PGPSCADVLRVMQHEPELMFETLKHRAEE   + D  GMA ++LA+SLA S
Sbjct  608   YSFAVTRAVPGPSCADVLRVMQHEPELMFETLKHRAEE-CGEVDEDGMANSALAASLARS  666

Query  851   FHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADS-SPGEDEHWSYCIA  693
             FHNMPYL V S+CCLTA    G  Y   +D    + +ADS + GE+E WSYC A
Sbjct  667   FHNMPYLSVASSCCLTAMNNHGLYYCSEDDY---DIVADSGAAGEEEQWSYCCA  717



>ref|XP_008358425.1| PREDICTED: arginine decarboxylase-like [Malus domestica]
Length=730

 Score =  1001 bits (2589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/723 (74%), Positives = 609/723 (84%), Gaps = 20/723 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             G+ FA D SLPA     S  + +P   +  T + D+SHWSPS+S+ LYRID WG PYFTV
Sbjct  16    GHLFAGDSSLPA-----SPFSGVPPATITTTPAADNSHWSPSLSSDLYRIDXWGGPYFTV  70

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSG+++VRPHG ATL HQEIDLLK+VKK SDPKP  GLGLQLPLIVR PDVLKNRLESL
Sbjct  71    NSSGNVAVRPHGRATLPHQEIDLLKIVKKVSDPKPDCGLGLQLPLIVRLPDVLKNRLESL  130

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q AF+ A+ S  YGSHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  131   QGAFDLAIRSHDYGSHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSC  190

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+PDALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL++D+S+K+ VRPVI
Sbjct  191   LCKGNPDALLICNGFKDLEYISLALFARKLALNTVIVLEQEEELDLVVDLSQKLGVRPVI  250

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKL+TKH+GHFGSTSGEKGKFGLTTTQILRVVKKL +  M+DC QLLHFHIGSQIPS
Sbjct  251   GVRAKLKTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDKLGMLDCFQLLHFHIGSQIPS  310

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGV EAAQIYCELVRLGA MKVIDIGGGLGIDYDGSKS+ S++SV Y+L+EYASA
Sbjct  311   TALLADGVSEAAQIYCELVRLGAHMKVIDIGGGLGIDYDGSKSSXSDISVSYSLEEYASA  370

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQSFVE  1569
             VVQAVR VC+R+ V HPVICSESGRA+VSHHS+LIFEAVSSS+ D    +    LQ F+E
Sbjct  371   VVQAVRNVCERRSVKHPVICSESGRALVSHHSVLIFEAVSSSACDDAPPMSPYELQYFIE  430

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
              L ++ARADY NLSAAAIRGEY+ C+ YAD LKQRCV+QFKEGS+ IEQLA VDG+CD+V
Sbjct  431   GLTEEARADYLNLSAAAIRGEYEACLTYADVLKQRCVEQFKEGSVGIEQLATVDGLCDMV  490

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKAIGA+DPV TY+VNLSVFTSIPDFW  GQ+FPIVPIHRLD+RP  RG+LSDLTCDSDG
Sbjct  491   SKAIGAFDPVRTYHVNLSVFTSIPDFWGIGQMFPIVPIHRLDQRPAMRGVLSDLTCDSDG  550

Query  1208  KIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVS  1047
             KIDKF+GGESSLPLHEL       G G +YYLGMFLGGAY+EALGG HNLF GPS+VRVS
Sbjct  551   KIDKFIGGESSLPLHELEGNGGNNGGGQKYYLGMFLGGAYQEALGGVHNLFAGPSIVRVS  610

Query  1046  QSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslas  867
             QSDGPHSF+VTRA PGPSC DVLRVMQHEPELMFETLKHRAEE     D+GGMA A++A+
Sbjct  611   QSDGPHSFAVTRAVPGPSCGDVLRVMQHEPELMFETLKHRAEE-CGQGDDGGMASAAVAT  669

Query  866   slansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIAD-----SSPGEDEHWSY  702
             SL  SFHNMPYLV GS+C ++A      G+YY ++    + ++D     +S GE+E WSY
Sbjct  670   SLVQSFHNMPYLVTGSSCSMSAMNN--HGFYYCSEDDYDDVVSDSTGTAASAGEEEQWSY  727

Query  701   CIA  693
             C A
Sbjct  728   CCA  730



>gb|EYU37871.1| hypothetical protein MIMGU_mgv1a002100mg [Erythranthe guttata]
Length=714

 Score =   999 bits (2583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/713 (75%), Positives = 600/713 (84%), Gaps = 26/713 (4%)
 Frame = -3

Query  2822  YAFA-WDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             YAFA WD +LPAP              + PT +V+ + WSP  SA LYR+DGWG PYFTV
Sbjct  18    YAFAGWDTTLPAP--------------LSPTTAVNGAAWSPDHSALLYRVDGWGAPYFTV  63

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NS+G+++VRP+G+ TL+H+EIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESL
Sbjct  64    NSNGNVAVRPYGADTLAHEEIDLLKVVKKASDPKTSGGLGLQLPLVVRFPDVLKNRLESL  123

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QS+F FAV+SQGY SHYQGVYPVKCNQD+FVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  124   QSSFEFAVQSQGYQSHYQGVYPVKCNQDKFVVEDIVKFGSGFRFGLEAGSKPELLLAMSC  183

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LC GSPDALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+D++I++S K+ +RPVI
Sbjct  184   LCNGSPDALLICNGFKDVEYISLALVARKLQLNTVIVLEQEEELDIVINVSEKLGIRPVI  243

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTT QILRVVKKLQ+ EM+DCLQLLHFHIGSQIPS
Sbjct  244   GLRAKLRTKHSGHFGSTSGEKGKFGLTTMQILRVVKKLQQYEMLDCLQLLHFHIGSQIPS  303

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T+LLADGV EAAQIY ELVRLGA M+VIDIGGGLGIDYDGSKS DS+VSV YTLQEYASA
Sbjct  304   TSLLADGVSEAAQIYSELVRLGAGMRVIDIGGGLGIDYDGSKSQDSDVSVAYTLQEYASA  363

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQSFVE  1569
             VV+++R VCDRKGVSHP+ICSESGRAIVSHHSIL+F+AVS+SS D      + GLQ FVE
Sbjct  364   VVESIRLVCDRKGVSHPIICSESGRAIVSHHSILVFQAVSASSHDSSPPALSVGLQYFVE  423

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
              L D+A  DYQNLSAAAIRGE++TC+LYAD+LKQRCV+QFKEGSL IEQLAAVD +C++V
Sbjct  424   QLADEALIDYQNLSAAAIRGEHETCLLYADKLKQRCVEQFKEGSLGIEQLAAVDDLCEVV  483

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKA+G  DP+ TY+VN+SVFTSIPDFW   QLFPI+PIHRLDE P  RGILSDLTCDSDG
Sbjct  484   SKAVGVPDPIHTYHVNVSVFTSIPDFWGIQQLFPILPIHRLDETPSVRGILSDLTCDSDG  543

Query  1208  KIDKFVGGESSLPLHELGGNGG----RYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQS  1041
             KIDKF+GGESSLPLH+L GNGG     YYLGMFLGGAYEEALGG HNLFGGPSVVRVSQS
Sbjct  544   KIDKFIGGESSLPLHKLEGNGGGECAPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQS  603

Query  1040  DGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassl  861
             DGPHSF+VTRA PGPSC DVLRVM HEPELMF+TLKHR EE+  D D    +  S+ + L
Sbjct  604   DGPHSFAVTRAMPGPSCGDVLRVMHHEPELMFQTLKHRVEEYADDGDV--KSNVSIINGL  661

Query  860   ansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
             A+ F+NMPYL    TC LT A + G G  Y +D S    IA S   EDE WSY
Sbjct  662   ASCFNNMPYLAAAETCRLTTAGSGGGGGNYCDDDS----IASSDGAEDEQWSY  710



>ref|XP_007200307.1| hypothetical protein PRUPE_ppa002034mg [Prunus persica]
 dbj|BAG68575.1| arginine decarboxylase [Prunus persica]
 gb|EMJ01506.1| hypothetical protein PRUPE_ppa002034mg [Prunus persica]
Length=725

 Score =   995 bits (2573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/721 (75%), Positives = 606/721 (84%), Gaps = 21/721 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTAS---VDHSHWSPSMSAALYRIDGWGDPY  2655
             GYAFA D SLPAP          P + VPP  +    D SHWSPS+S+ LYRID WG PY
Sbjct  16    GYAFAGDSSLPAP----------PFSGVPPATTAVTTDSSHWSPSLSSDLYRIDAWGGPY  65

Query  2654  FTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRL  2475
             FTVNSSG++SVRPHGSATL HQEIDLLK+VKK SDPKP  GLGLQLPLIVR PDVLKNRL
Sbjct  66    FTVNSSGNVSVRPHGSATLPHQEIDLLKIVKKVSDPKPDCGLGLQLPLIVRLPDVLKNRL  125

Query  2474  ESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLA  2295
             ESLQ AF+ A++S  YGSHYQGV+PVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLA
Sbjct  126   ESLQGAFDLAIQSHDYGSHYQGVFPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPELLLA  185

Query  2294  MSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVR  2115
             MSCLCKG+P+ALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+D++ID+S+K+ VR
Sbjct  186   MSCLCKGNPEALLICNGFKDFEYISLALFARKLALNTVIVLEQEEELDVVIDLSKKLGVR  245

Query  2114  PVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQ  1935
             PVIG RAKL+TKH+GHFGSTSGEKGKFGLTTTQILRVVKKL +  ++DC QLLHFHIGSQ
Sbjct  246   PVIGARAKLKTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDQLGLLDCFQLLHFHIGSQ  305

Query  1934  IPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEY  1755
             IPSTALLADGV EAAQIYCELVRLGA MK IDIGGGLGIDYDGSKS+DSE+SV Y+L+EY
Sbjct  306   IPSTALLADGVSEAAQIYCELVRLGAHMKFIDIGGGLGIDYDGSKSSDSEISVSYSLEEY  365

Query  1754  ASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQS  1578
             A+AVV+AV  VCDRK V HPVICSESGRA+VSHHS++IFEA+SSS+ D +  +    LQ 
Sbjct  366   AAAVVRAVLNVCDRKSVKHPVICSESGRALVSHHSVMIFEAISSSACDDVPPMSAFALQY  425

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
             F+E L ++ARADY+NLSAAAIRGEY+ C+ YADQLKQRC+DQFKEGSL IEQLA VDG+C
Sbjct  426   FIEGLTEEARADYRNLSAAAIRGEYEACLTYADQLKQRCIDQFKEGSLGIEQLATVDGLC  485

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             D+VSKAIGA DPV TY+VNLSVFTSIPDFW  GQ FPIVPIHRLD+RP  RGILSDLTCD
Sbjct  486   DMVSKAIGASDPVRTYHVNLSVFTSIPDFWGIGQTFPIVPIHRLDQRPAVRGILSDLTCD  545

Query  1217  SDGKIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVV  1056
             SDGKIDKF+GGESSLPLHEL       G G +YYLGMFLGGAY+EALGG HNLFGGPSVV
Sbjct  546   SDGKIDKFIGGESSLPLHELEGNGGASGGGQKYYLGMFLGGAYQEALGGVHNLFGGPSVV  605

Query  1055  RVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafas  876
             RVSQSDGPHSF+VT A PGPSC+DVLRVMQHEPELMFETLKHRAEE+    D+GGMA A+
Sbjct  606   RVSQSDGPHSFAVTLAVPGPSCSDVLRVMQHEPELMFETLKHRAEEY-GQGDDGGMASAA  664

Query  875   lasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCI  696
             +A+SLA SFHNMPYLV  S+CCLTA    G  Y   +D       A    GE++ WSYC 
Sbjct  665   VATSLARSFHNMPYLVAASSCCLTAMNNHGLYYCSEDDYDVVADSAGGGGGEEDQWSYCC  724

Query  695   A  693
             A
Sbjct  725   A  725



>ref|XP_004507509.1| PREDICTED: arginine decarboxylase-like [Cicer arietinum]
Length=732

 Score =   992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/721 (73%), Positives = 609/721 (84%), Gaps = 16/721 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYA A D +LP P     S   + T+    +A+V+ ++WSPS+S  L++IDGWG PYF V
Sbjct  18    GYALAGDTTLPPP--FTFSAVTITTD--DASAAVEETNWSPSLSTKLFKIDGWGFPYFGV  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N++GDISVRPHG+AT+SHQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLESL
Sbjct  74    NNAGDISVRPHGTATMSHQEIDLLKVVKKASDPKCCGGLGLQLPLVVRFPDVLKNRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
              +AF+ A++SQGY SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLAMSC
Sbjct  134   HAAFDGAIQSQGYESHYQGVYPVKCNQDRFVVEDIVEFGSPFRFGLEAGSKPELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+ +A L+CNGFKD+EYI+LAL ARKL LNTVIVLEQEEE+D++IDIS+K+ +RPVI
Sbjct  194   LCKGNREAFLVCNGFKDSEYITLALVARKLALNTVIVLEQEEELDMVIDISKKLCIRPVI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFGSTSG+KGKFGLTT QILRVVKKL++ +M+DCLQLLHFHIGSQIP+
Sbjct  254   GVRAKLRTKHSGHFGSTSGDKGKFGLTTIQILRVVKKLEQLDMLDCLQLLHFHIGSQIPT  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEAAQIYCEL+RLGA M+V+DIGGGLGIDYDGSKS+DS++SV Y L+EYA+A
Sbjct  314   TELLADGVGEAAQIYCELLRLGAQMRVLDIGGGLGIDYDGSKSSDSDLSVAYGLEEYAAA  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV AV++VCDR+G  HPVICSESGRAIVSHHSILIFEA+ S+S     L + GLQ   E 
Sbjct  374   VVNAVKYVCDRRGFKHPVICSESGRAIVSHHSILIFEAIGSTSHCTPSLSSIGLQYLGEG  433

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L ++  ADYQN+SAA IRG+++ C+LY +Q K+ CV+QFK+G+L IEQLAAVDG+CDL++
Sbjct  434   LSEETLADYQNISAATIRGDHEACLLYTEQFKKGCVEQFKQGTLGIEQLAAVDGLCDLIT  493

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             + IGA DPV +YNVNLSVFTSIPDFW   QLFPIVPIHRLDE+P ARGILSDLTCDSDGK
Sbjct  494   ETIGAKDPVKSYNVNLSVFTSIPDFWGIEQLFPIVPIHRLDEKPTARGILSDLTCDSDGK  553

Query  1205  IDKFVGGESSLPLHEL-GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             I+KF+GGESSLPLHEL G NGG YYLGMFLGGAYEEALGGFHNLFGGPSVVRV QSDGPH
Sbjct  554   INKFIGGESSLPLHELEGQNGGGYYLGMFLGGAYEEALGGFHNLFGGPSVVRVLQSDGPH  613

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL--HDEDNGGMafaslasslan  855
              F+VTRA  GPSCADVLRVMQHEP+LMFETLKHR  EF   HD+D+  +  A LA+SLA 
Sbjct  614   GFAVTRAVSGPSCADVLRVMQHEPQLMFETLKHRVLEFCGQHDDDS-VVNAAGLANSLAR  672

Query  854   sFHNMPYLVVGSTCCLTAATTPGSGYYY--GND-----VSAANPIADSSPGEDEHWSYCI  696
             SF NMPYLV  S+CCL A T    G+YY  G+D      SA   +A S  GEDEHWSYC 
Sbjct  673   SFDNMPYLVSSSSCCLNAVTN-NEGFYYCSGDDFSADSASAVTSVAGSVAGEDEHWSYCC  731

Query  695   A  693
             A
Sbjct  732   A  732



>ref|XP_009378454.1| PREDICTED: arginine decarboxylase-like [Pyrus x bretschneideri]
Length=730

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/723 (74%), Positives = 610/723 (84%), Gaps = 20/723 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             G+ FA D SLPA     S  + +P   + P  + D+SHWSPS+S+ LYRID WG PYFTV
Sbjct  16    GHHFAGDSSLPA-----SPFSGVPPATIAPAPAADNSHWSPSLSSDLYRIDAWGGPYFTV  70

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSG+++VRPHG ATL HQEIDLLK+VKK SDPKP  GLGLQLPLIVR PDVLKNRLESL
Sbjct  71    NSSGNVAVRPHGRATLPHQEIDLLKIVKKVSDPKPDCGLGLQLPLIVRLPDVLKNRLESL  130

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q AF+ A+ S  YGSHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  131   QGAFDLAIRSHDYGSHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSC  190

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+PDALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL++D+S+K+ VRPV+
Sbjct  191   LCKGNPDALLICNGFKDLEYISLALFARKLALNTVIVLEQEEELDLVVDLSQKLGVRPVV  250

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKL+TKH+GHFGSTSGEKGKFGLTTTQILRVVKKL +  M+DC QLLHFHIGSQIPS
Sbjct  251   GVRAKLKTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDKLGMLDCFQLLHFHIGSQIPS  310

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGV EAAQIYCELVRLGA MKV+DIGGGLGIDYDGSKS++S++SV Y+L+EYASA
Sbjct  311   TDLLADGVSEAAQIYCELVRLGAHMKVLDIGGGLGIDYDGSKSSNSDISVSYSLEEYASA  370

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQSFVE  1569
             VVQAVR VC+R+ V HPVICSESGRA+VSHHS+LIFEAVSSS+ D    +    LQ F+E
Sbjct  371   VVQAVRNVCERRSVKHPVICSESGRALVSHHSVLIFEAVSSSACDDAPPMSAYELQYFIE  430

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
              L ++ARADY NLSAAAIRGEY+ C+ YAD LKQRCV+QFKEGS+ IEQLA VDG+CD+V
Sbjct  431   GLTEEARADYLNLSAAAIRGEYEACLTYADVLKQRCVEQFKEGSVGIEQLATVDGLCDMV  490

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKAIGA+DPV TY+VNLSVFTSIPDFW  GQ+FPIVPIHRLD+RP  RG+LSDLTCDSDG
Sbjct  491   SKAIGAFDPVRTYHVNLSVFTSIPDFWGIGQMFPIVPIHRLDQRPAMRGVLSDLTCDSDG  550

Query  1208  KIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVS  1047
             KIDKF+GGESSLPLHEL       G G +YYLGMFLGGAY+EALGG HNLFGGPS+VRVS
Sbjct  551   KIDKFIGGESSLPLHELEGNGGNNGGGQKYYLGMFLGGAYQEALGGVHNLFGGPSIVRVS  610

Query  1046  QSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslas  867
             QSDGPHSF+VTRA PGPSC DVLRVMQHEPELMFETLKHRAEE     D+GGMA A++A+
Sbjct  611   QSDGPHSFAVTRAVPGPSCGDVLRVMQHEPELMFETLKHRAEE-CGQGDDGGMASAAVAT  669

Query  866   slansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIAD-----SSPGEDEHWSY  702
             +LA SFHNMPYLV  S+C ++A      G+YY ++    + ++D     +S GE+E WSY
Sbjct  670   NLAGSFHNMPYLVTASSCSMSAMNN--HGFYYCSEDDYDDVVSDSTGTAASAGEEEQWSY  727

Query  701   CIA  693
             C A
Sbjct  728   CCA  730



>ref|XP_006487299.1| PREDICTED: arginine decarboxylase-like, partial [Citrus sinensis]
Length=715

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/711 (74%), Positives = 593/711 (83%), Gaps = 23/711 (3%)
 Frame = -3

Query  2765  APLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQE  2586
             +P   +A    A VD SHWSPS SA+LY+ID WG PYF VN SG++SVRP+G ATL+HQE
Sbjct  8     SPTSASAGSVAADVDASHWSPSHSASLYKIDSWGAPYFAVNPSGNVSVRPYGHATLAHQE  67

Query  2585  IDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGV  2406
             IDLLK+VKK SDPK +GGLGLQLPLIVR PDVL++RLESLQSAF FA+++QGY + YQGV
Sbjct  68    IDLLKIVKKVSDPKSVGGLGLQLPLIVRLPDVLRDRLESLQSAFEFAIQTQGYEARYQGV  127

Query  2405  YPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEY  2226
             +PVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSCLCKGSP+ALL+CNGFKDAEY
Sbjct  128   FPVKCNQDRFVVEDIVKFGSQFRFGLEAGSKPELLLAMSCLCKGSPEALLVCNGFKDAEY  187

Query  2225  ISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGE  2046
             I+L+L ARKL LN VIVLEQEEEVDL+I+IS+K+ VRPVIG RAKLRTKH+GHFGSTSGE
Sbjct  188   ITLSLLARKLDLNAVIVLEQEEEVDLVIEISKKLNVRPVIGARAKLRTKHSGHFGSTSGE  247

Query  2045  KGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVR  1866
             KGKFGLTTTQILRVVKKL+ +EM+DC QLLHFHIGSQIPSTALL DGVGEAAQIYCELVR
Sbjct  248   KGKFGLTTTQILRVVKKLEVAEMLDCFQLLHFHIGSQIPSTALLTDGVGEAAQIYCELVR  307

Query  1865  LGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVIC  1686
             LGA M+VIDIGGGLGIDYDGSKSADS++SV YTL+EYASAVVQA+R+VCDRK V HPV+C
Sbjct  308   LGANMQVIDIGGGLGIDYDGSKSADSDLSVAYTLEEYASAVVQAIRYVCDRKNVKHPVLC  367

Query  1685  SESGRAIVSHHSILIFEAVSSSSDKL--LQLPNPGLQSFVESLKDDARADYQNLSAAAIR  1512
             SESGRAIVSHHSILIFEAVS+S  +   + +   GLQ  VE L +DAR+DY  ++ AA+R
Sbjct  368   SESGRAIVSHHSILIFEAVSASVSRAAPVAMSPLGLQYLVEGLTEDARSDYTKMTTAALR  427

Query  1511  GEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSV  1332
             GE++TC+ YADQLKQRC++QFK+G+L IEQLA VDG+CD V+  IGA DPV TY+VNLS+
Sbjct  428   GEFETCLFYADQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAMEIGASDPVRTYHVNLSI  487

Query  1331  FTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGG  1152
             FTSIPD+WA GQLFPIVPIH LDERPG RG+LSDLTCDSDGKIDKF+GG +SLPLHE+ G
Sbjct  488   FTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVG  547

Query  1151  NG----GRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCAD  984
              G    G YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PGPSC D
Sbjct  548   GGCGERGPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGD  607

Query  983   VLRVMQHEPELMFETLKHRAEEFLHDEDNGGM-------------afaslasslansFHN  843
             VLRVMQHEPELMFETLKHRAEE+   E                    ++LASSLA  FH+
Sbjct  608   VLRVMQHEPELMFETLKHRAEEYCGQEHGSNGGDGDTDDYDHGMANNSALASSLAQYFHS  667

Query  842   MPYLVVGSTCCLTAATTPGSGYY-YGNDVSAANPIADSSPGEDEHWSYCIA  693
             MPYLVV S+C LTA    G  YY  G D  A   + DSSP EDE WSYC A
Sbjct  668   MPYLVVPSSCSLTAINNGGGLYYCNGEDYDA---VVDSSPNEDEQWSYCYA  715



>dbj|BAE71301.1| putative arginine decarboxylase [Trifolium pratense]
Length=729

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/717 (73%), Positives = 609/717 (85%), Gaps = 13/717 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYA A D +LP P    ++     T+ V    S   S+WSPS+S+ L++IDGWG PYF V
Sbjct  20    GYALAGDSTLPPPLTFTTA----TTDGVDDD-SDSASNWSPSLSSKLFKIDGWGFPYFGV  74

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N++GDI+VRPHG+AT+SHQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLES+
Sbjct  75    NNAGDIAVRPHGAATMSHQEIDLLKVVKKASDPKCCGGLGLQLPLVVRFPDVLKNRLESI  134

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q AF+ A++ QGY SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLAMSC
Sbjct  135   QGAFDGAIQLQGYESHYQGVYPVKCNQDRFVVEDIVEFGSGFRFGLEAGSKPELLLAMSC  194

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+ +A LICNGFKD+EYISLAL ARKL LNTVIVLEQEEE+D++++IS K+ +RPVI
Sbjct  195   LCKGNREAFLICNGFKDSEYISLALVARKLALNTVIVLEQEEELDMVVEISNKLCIRPVI  254

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFGSTSG+KGKFGLTT QILRVVKKL++ +M+DCLQLLHFHIGSQIP+
Sbjct  255   GVRAKLRTKHSGHFGSTSGDKGKFGLTTIQILRVVKKLEQLDMLDCLQLLHFHIGSQIPT  314

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEAAQIYCEL+RLGA M+V+DIGGGLGIDYDGSKS DS++SV Y ++EYA+A
Sbjct  315   TELLADGVGEAAQIYCELLRLGAQMRVLDIGGGLGIDYDGSKSGDSDISVAYGIEEYAAA  374

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV AV++VCDR+ V+HPVICSESGRAIVSHHS+LIFEA+ +SS+K   L + GLQ   E 
Sbjct  375   VVHAVKYVCDRRNVNHPVICSESGRAIVSHHSVLIFEAIGASSNKAPSLSSIGLQYLGEG  434

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L ++A ADYQN+SAA +RGE++ C+LY DQ K+RCV+QFK+G+L IEQLAAVDG+CDL++
Sbjct  435   LSEEALADYQNISAATLRGEHEACLLYTDQFKKRCVEQFKQGTLGIEQLAAVDGLCDLIT  494

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             + IGA D V  Y++NLSVFTSIPDFW+  QLFPIVPIHRLDE+P ARGILSDLTCDSDGK
Sbjct  495   ETIGAKDLVKKYHMNLSVFTSIPDFWSIDQLFPIVPIHRLDEKPTARGILSDLTCDSDGK  554

Query  1205  IDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHS  1026
             IDKF+GGESSLPLHEL G+GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH 
Sbjct  555   IDKFIGGESSLPLHELEGHGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQSDGPHG  614

Query  1025  FSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL--HDEDNGGMafaslasslans  852
             F+VTRA  GPSCADVLRVMQHEP+LMFETLKHRA EF   HD+D+  +  A LA+SLA S
Sbjct  615   FAVTRAVSGPSCADVLRVMQHEPQLMFETLKHRALEFCEQHDDDS-VVNAAGLANSLARS  673

Query  851   FHNMPYLVVGSTCCLTAATTPGSGYYY--GNDVSAAN--PIADSSPGEDEHWSYCIA  693
             F NMPYLV  +TCCL A T    G+YY  G+D SAA+   +  S  GEDEHW+YC A
Sbjct  674   FDNMPYLVSSTTCCLNALTN-NDGFYYCSGDDFSAADSASVVTSVAGEDEHWNYCCA  729



>ref|XP_006423501.1| hypothetical protein CICLE_v10027873mg [Citrus clementina]
 gb|ESR36741.1| hypothetical protein CICLE_v10027873mg [Citrus clementina]
Length=753

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/699 (75%), Positives = 588/699 (84%), Gaps = 21/699 (3%)
 Frame = -3

Query  2732  ASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKAS  2553
             A VD SHWSPS SA+LY+ID WG PYF VN SG++SVRP+G ATL+HQEIDLLK+VKK S
Sbjct  57    ADVDSSHWSPSHSASLYKIDSWGAPYFAVNPSGNVSVRPYGHATLAHQEIDLLKIVKKVS  116

Query  2552  DpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFV  2373
             DPK +GGLGLQLPLIVR PDVL++RLESL SAF FA+++QGY + YQGV+PVKCNQDRFV
Sbjct  117   DPKSVGGLGLQLPLIVRLPDVLRDRLESLHSAFEFAIQTQGYEARYQGVFPVKCNQDRFV  176

Query  2372  VEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLL  2193
             VEDIVKFGS FRFGLEAGSKPELLLAMSCLCKGSP+ALL+CNGFKDA YI+LAL ARKL 
Sbjct  177   VEDIVKFGSQFRFGLEAGSKPELLLAMSCLCKGSPEALLVCNGFKDAGYITLALLARKLD  236

Query  2192  LNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQI  2013
             LN VIVLEQEEEVDL+I+IS+K+ VRPVIG RAKLRTKH+GHFGSTSGEKGKFGLTTTQI
Sbjct  237   LNVVIVLEQEEEVDLVIEISKKLNVRPVIGARAKLRTKHSGHFGSTSGEKGKFGLTTTQI  296

Query  2012  LRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidig  1833
             LRVVKKL+ +EM+DC QLLHFHIGSQIPSTALL DGVGEAAQIYCELVRLGA M+VIDIG
Sbjct  297   LRVVKKLEVAEMLDCFQLLHFHIGSQIPSTALLTDGVGEAAQIYCELVRLGANMQVIDIG  356

Query  1832  gglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHH  1653
             GGLGIDYDGSKSADS++SV YTL+EYASAVVQA+R+VCDRK V HPV+CSESGRAIVSHH
Sbjct  357   GGLGIDYDGSKSADSDLSVAYTLEEYASAVVQAIRYVCDRKNVKHPVLCSESGRAIVSHH  416

Query  1652  SILIFEAVSSSSDKL--LQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYAD  1479
             SILIFEAVS+S  +     +   GLQ  VE L +DAR+DY  ++ AA+RGE++TC+ YAD
Sbjct  417   SILIFEAVSASVSRAAPAAMSPLGLQFLVEGLTEDARSDYTKMTTAALRGEFETCLFYAD  476

Query  1478  QLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFG  1299
             QLKQRC++QFK+G+L IEQLA VDG+CD V+K IGA DPV TY+VNLS+FTSIPD+WA G
Sbjct  477   QLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIG  536

Query  1298  QLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNG----GRYYL  1131
             QLFPIVPIH LDERPG RG+LSDLTCDSDGKIDKF+GG +SLPLHE+ G G    G YYL
Sbjct  537   QLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYL  596

Query  1130  GMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPEL  951
             GMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PGPSC DVLRVMQHEPEL
Sbjct  597   GMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPEL  656

Query  950   MFETLKHRAEEFLHDEDNGGM-------------afaslasslansFHNMPYLVVGSTCC  810
             MFETLKHRAEE+   E                    ++LASSLA  FH+MPYLVV S+C 
Sbjct  657   MFETLKHRAEEYCGQEHGSNGGDGDTDDYDHGMANNSALASSLAQYFHSMPYLVVPSSCS  716

Query  809   LTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             LTA    G G YY N     +P+ DSSP EDE WSYC A
Sbjct  717   LTAINN-GGGLYYCNG-EDCDPVVDSSPNEDEQWSYCYA  753



>ref|XP_004306445.1| PREDICTED: arginine decarboxylase-like [Fragaria vesca subsp. 
vesca]
Length=708

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/712 (75%), Positives = 597/712 (84%), Gaps = 26/712 (4%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVN  2643
             +AFA D SLPAP+         P + V PT +   S WS S+S  LYRID WG PYFTVN
Sbjct  17    HAFAGDSSLPAPD---------PFSGVFPTTA---SAWSTSLSNDLYRIDAWGGPYFTVN  64

Query  2642  SSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQ  2463
             SSG++SVRPHGS T+ HQEIDLLK+VKK SDPK   GLGL+LPLIVRFPDVLKNRLESLQ
Sbjct  65    SSGNVSVRPHGSDTMPHQEIDLLKIVKKVSDPKSDSGLGLRLPLIVRFPDVLKNRLESLQ  124

Query  2462  SAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCL  2283
              AF+FA+ SQ YGSHYQGVYPVKCNQDRFVVEDIV      RFGLEAGSKPELLLAMSCL
Sbjct  125   GAFDFAIRSQDYGSHYQGVYPVKCNQDRFVVEDIV------RFGLEAGSKPELLLAMSCL  178

Query  2282  CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIG  2103
             CKG+P+ALL+CNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL+I++S K+ VRPVIG
Sbjct  179   CKGNPEALLVCNGFKDFEYISLALMARKLELNTVIVLEQEEELDLVIELSNKLGVRPVIG  238

Query  2102  LRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPST  1923
              RAKLRTKH+GHFGSTSGEKGKFGLTT QILRVVKKL+   M+DC QLLHFHIGSQIPST
Sbjct  239   ARAKLRTKHSGHFGSTSGEKGKFGLTTVQILRVVKKLEHVGMLDCFQLLHFHIGSQIPST  298

Query  1922  ALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAV  1743
             ALLADGV EAAQIYCELVRLGA MKVIDIGGGLGIDYDGSKS+DSE+SV Y ++EYA AV
Sbjct  299   ALLADGVSEAAQIYCELVRLGAHMKVIDIGGGLGIDYDGSKSSDSEISVSYRIEEYAMAV  358

Query  1742  VQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQSFVES  1566
             V+A+R+VCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+S+ D    +    LQ F+E 
Sbjct  359   VRAIRYVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSASACDVAPSMSAFALQYFIEG  418

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L ++ARADY+NLSAAAIRGEY+ C+ YA++LKQRCVDQFKEG L IEQLA VDG+CDLVS
Sbjct  419   LTEEARADYRNLSAAAIRGEYEACLTYAEKLKQRCVDQFKEGYLGIEQLATVDGLCDLVS  478

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA+DPV TYNVNLSVFTSIPDFW  GQLFP+VPIHRLD+RP  R +LSDLTCDSDGK
Sbjct  479   KAIGAFDPVLTYNVNLSVFTSIPDFWGIGQLFPVVPIHRLDQRPAVRAVLSDLTCDSDGK  538

Query  1205  IDKFVGGESSLPLHELGGN--GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
             I+KF+GGESSLPLH+L GN  GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGP
Sbjct  539   INKFIGGESSLPLHDLEGNGSGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGP  598

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslans  852
             +SF+VTRA PGPSCA+V RVMQ+EPELMFETLKHRAEE   +    GMA ++LA+SLA S
Sbjct  599   YSFAVTRAVPGPSCAEVFRVMQYEPELMFETLKHRAEE-CGEVGEDGMANSALATSLARS  657

Query  851   FHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADS-SPGEDEHWSYC  699
             FHNMPYL V S+CCLTA    G  Y   +D    + +ADS + G+ E WSYC
Sbjct  658   FHNMPYLAVASSCCLTAINNHGLYYCSEDDY---DIVADSGAAGKAEQWSYC  706



>dbj|BAE71251.1| putative arginine decarboxylase [Trifolium pratense]
Length=729

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/717 (73%), Positives = 608/717 (85%), Gaps = 13/717 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYA A D +LP P    ++     T+ V    S   S+WSPS+S+ L++IDGWG PYF V
Sbjct  20    GYALAGDSTLPPPLTFTTA----TTDGVDDD-SDSASNWSPSLSSKLFKIDGWGFPYFGV  74

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N++GDI+VRPHG+AT+SHQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLKNRLES+
Sbjct  75    NNAGDIAVRPHGAATMSHQEIDLLKVVKKASDPKCCGGLGLQLPLVVRFPDVLKNRLESI  134

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q AF+ A++ QGY SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLAMSC
Sbjct  135   QGAFDGAIQLQGYESHYQGVYPVKCNQDRFVVEDIVEFGSGFRFGLEAGSKPELLLAMSC  194

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+ +A LICNGFKD+EYISLAL ARKL LNTVIVLEQEEE+D++++IS K+ +RPVI
Sbjct  195   LCKGNREAFLICNGFKDSEYISLALVARKLALNTVIVLEQEEELDMVVEISNKLCIRPVI  254

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFGSTSG+KGKFGLTT QILRVVKKL++ +M+DCLQLLHFHIGSQIP+
Sbjct  255   GVRAKLRTKHSGHFGSTSGDKGKFGLTTIQILRVVKKLEQLDMLDCLQLLHFHIGSQIPT  314

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEAAQIYCEL+RLGA M+V+DIGGGLGIDYDGSKS DS++SV Y ++EYA+A
Sbjct  315   TELLADGVGEAAQIYCELLRLGAQMRVLDIGGGLGIDYDGSKSGDSDISVAYGIEEYAAA  374

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV AV++VCDR+ V+HPVICSESGRAIVSHHS+LIFEA+ +SS+K   L + GLQ   E 
Sbjct  375   VVHAVKYVCDRRNVNHPVICSESGRAIVSHHSVLIFEAIGASSNKAPSLSSIGLQYLGEG  434

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L ++A  DYQN+SAA +RGE++ C+LY DQ K+RCV+QFK+G+L IEQLAAVDG+CDL++
Sbjct  435   LSEEALVDYQNISAATLRGEHEACLLYTDQFKKRCVEQFKQGTLGIEQLAAVDGLCDLIT  494

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             + IGA D V  Y++NLSVFTSIPDFW+  QLFPIVPIHRLDE+P ARGILSDLTCDSDGK
Sbjct  495   ETIGAKDLVKKYHMNLSVFTSIPDFWSIDQLFPIVPIHRLDEKPTARGILSDLTCDSDGK  554

Query  1205  IDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHS  1026
             IDKF+GGESSLPLHEL G+GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH 
Sbjct  555   IDKFIGGESSLPLHELEGHGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQSDGPHG  614

Query  1025  FSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL--HDEDNGGMafaslasslans  852
             F+VTRA  GPSCADVLRVMQHEP+LMFETLKHRA EF   HD+D+  +  A LA+SLA S
Sbjct  615   FAVTRAVSGPSCADVLRVMQHEPQLMFETLKHRALEFCEQHDDDS-VVNAAGLANSLARS  673

Query  851   FHNMPYLVVGSTCCLTAATTPGSGYYY--GNDVSAAN--PIADSSPGEDEHWSYCIA  693
             F NMPYLV  +TCCL A T    G+YY  G+D SAA+   +  S  GEDEHW+YC A
Sbjct  674   FDNMPYLVSSTTCCLNALTN-NDGFYYCSGDDFSAADSASVVTSVAGEDEHWNYCCA  729



>ref|XP_010271459.1| PREDICTED: arginine decarboxylase-like [Nelumbo nucifera]
Length=721

 Score =   987 bits (2552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/721 (74%), Positives = 606/721 (84%), Gaps = 25/721 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYA A D SLPAPEA   S  P  TN    T+SVDHSHWSPS+SA+LY+ID WG PYF+V
Sbjct  16    GYAIAGDSSLPAPEAF--SGVPPATNT---TSSVDHSHWSPSLSASLYKIDSWGAPYFSV  70

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSG+ISV PHG+ TL HQEIDL+KVVKK S+PK  GGLGLQ PLIVRFPDVLKNRLESL
Sbjct  71    NSSGNISVSPHGAETLPHQEIDLMKVVKKVSEPKFSGGLGLQFPLIVRFPDVLKNRLESL  130

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+ A+ SQGYGSHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLAMSC
Sbjct  131   QSAFDSAILSQGYGSHYQGVYPVKCNQDRFVVEDIVEFGSPFRFGLEAGSKPELLLAMSC  190

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+P+A L+CNG+KDAEYISLAL ARKL ++TVIV+EQEEE+DL+IDISRK+ VRP+I
Sbjct  191   LCKGNPEAFLVCNGYKDAEYISLALIARKLHVDTVIVIEQEEELDLVIDISRKLGVRPMI  250

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFGSTSGEKGKFGLTT QILRVV+ L++  M+DCLQLLHFHIGSQIPS
Sbjct  251   GVRAKLRTKHSGHFGSTSGEKGKFGLTTMQILRVVRNLEQVGMLDCLQLLHFHIGSQIPS  310

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T+LLADGVGEAAQIYCELVRLGA +KVIDIGGGLGIDYDGS+S+DS++SVGY L+EYA  
Sbjct  311   TSLLADGVGEAAQIYCELVRLGAGLKVIDIGGGLGIDYDGSQSSDSDISVGYGLKEYAKT  370

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSS--SDKLLQLPNPGLQSFV  1572
             VVQAVR+ CDRK V HP+ICSESGRAIVSHHS+LIFEAVSSS  S   ++   PGLQ  +
Sbjct  371   VVQAVRYACDRKFVKHPIICSESGRAIVSHHSVLIFEAVSSSATSRPTMRSFGPGLQGLL  430

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             E L DDAR DY NL+AAAIRGEY+TC+LYADQLKQRC+ QFKEGS+S+E LAA+D +C++
Sbjct  431   EELTDDARVDYGNLTAAAIRGEYETCLLYADQLKQRCIQQFKEGSVSLEHLAAIDDLCEI  490

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             VS+ IG  + V TY+VNLS+FTSIPDFWA GQLFPIVPIHRLD+RPG RGILSDLTCDSD
Sbjct  491   VSRVIGVSESVRTYHVNLSLFTSIPDFWAIGQLFPIVPIHRLDQRPGVRGILSDLTCDSD  550

Query  1211  GKIDKFVGGESSLPLHEL--------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVV  1056
             GK+DKF+GG+SSLPLHEL        GG GG YYLGMFLGGAY+EALGG HNLFGGPSV+
Sbjct  551   GKVDKFIGGQSSLPLHELEGGEGKAHGGGGGGYYLGMFLGGAYQEALGGLHNLFGGPSVI  610

Query  1055  RVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafas  876
             RVSQSDGPH F+VTRA PGPSC DVLR MQHEPELMFE LKHRAEE  H  +   +A A 
Sbjct  611   RVSQSDGPHGFAVTRAVPGPSCGDVLRAMQHEPELMFEALKHRAEECGHVNE---IARAE  667

Query  875   lasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCI  696
             LAS LA SFHNMPYL   ++C    AT   + YYY N+    N +A    G+DE W+YC 
Sbjct  668   LASGLARSFHNMPYLTTAASC----ATANNNFYYYCNEDKNNNSVA---VGDDEQWTYCC  720

Query  695   A  693
             A
Sbjct  721   A  721



>gb|KDO41479.1| hypothetical protein CISIN_1g004438mg [Citrus sinensis]
Length=753

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/700 (75%), Positives = 587/700 (84%), Gaps = 23/700 (3%)
 Frame = -3

Query  2732  ASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKAS  2553
             A VD SHWSPS SA+LY+ID WG PYF VN SG++SVRP+G ATL+HQEIDLLK+VKK S
Sbjct  57    ADVDSSHWSPSHSASLYKIDSWGAPYFAVNPSGNVSVRPYGHATLAHQEIDLLKIVKKVS  116

Query  2552  DpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFV  2373
             DPK +GGLGLQLPLIVR PDVL++RLESL SAF FA+++QGY + YQGV+PVKCNQDRFV
Sbjct  117   DPKSVGGLGLQLPLIVRLPDVLRDRLESLHSAFEFAIQTQGYEARYQGVFPVKCNQDRFV  176

Query  2372  VEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLL  2193
             VEDIVKFGS FRFGLEAGSKPELLLAMSCLCKGSP+ALL+CNGFKDA YI+LAL ARKL 
Sbjct  177   VEDIVKFGSQFRFGLEAGSKPELLLAMSCLCKGSPEALLVCNGFKDAGYITLALLARKLD  236

Query  2192  LNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQI  2013
             LN VIVLEQEEEVDL+I+IS+K+ VRPVIG RAKLRTKH+GHFGSTSGEKGKFGLTTTQI
Sbjct  237   LNVVIVLEQEEEVDLVIEISKKLNVRPVIGARAKLRTKHSGHFGSTSGEKGKFGLTTTQI  296

Query  2012  LRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidig  1833
             LRVVKKL+ +EM+DC QLLHFHIGSQIPSTALL DGVGEAAQIYCELVRLGA M+VIDIG
Sbjct  297   LRVVKKLEVAEMLDCFQLLHFHIGSQIPSTALLTDGVGEAAQIYCELVRLGANMQVIDIG  356

Query  1832  gglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHH  1653
             GGLGIDYDGSKSADS++SV YTL+EYASAVVQA+R+VCDRK V HPV+CSESGRAIVSHH
Sbjct  357   GGLGIDYDGSKSADSDLSVAYTLEEYASAVVQAIRYVCDRKNVKHPVLCSESGRAIVSHH  416

Query  1652  SILIFEAVSSSSDKL--LQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYAD  1479
             SILIFEAVS+S  +   + +   GLQ  VE L +DAR+DY  ++ AA+RGE++TC+ YAD
Sbjct  417   SILIFEAVSASVSRAAPVAMSPLGLQYLVEGLTEDARSDYTKMTTAALRGEFETCLFYAD  476

Query  1478  QLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFG  1299
             QLKQRC++QFK+G+L IEQLA VDG+CD V+  IGA DPV TY+VNLS+FTSIPD+WA G
Sbjct  477   QLKQRCIEQFKDGTLGIEQLATVDGLCDFVAMEIGASDPVRTYHVNLSIFTSIPDYWAIG  536

Query  1298  QLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNG----GRYYL  1131
             QLFPIVPIH LDERPG RG+LSDLTCDSDGKIDKF+GG +SLPLHE+ G G    G YYL
Sbjct  537   QLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYL  596

Query  1130  GMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPEL  951
             GMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PGPSC DVLRVMQHEPEL
Sbjct  597   GMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPEL  656

Query  950   MFETLKHRAEEFLHDEDNGGM-------------afaslasslansFHNMPYLVVGSTCC  810
             MFETLKHRAEE+   E                    ++LASSLA  FH+MPYLVV S+C 
Sbjct  657   MFETLKHRAEEYCGQEHGSNGGDGDTDDYDHGMANNSALASSLAQYFHSMPYLVVPSSCS  716

Query  809   LTAATTPGSGYY-YGNDVSAANPIADSSPGEDEHWSYCIA  693
             LTA    G  YY  G D  A   + DSSP EDE WSYC A
Sbjct  717   LTAINNGGGLYYCNGEDYDA---VVDSSPNEDEQWSYCYA  753



>gb|ACP56699.1| arginine decarboxylase [Lithospermum erythrorhizon]
Length=708

 Score =   984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/692 (76%), Positives = 597/692 (86%), Gaps = 10/692 (1%)
 Frame = -3

Query  2756  PTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDL  2577
             PTN    TA+VD  HWS ++S+ LY IDGWG+PYF+VNSSG+ISVRPHG+ TLSHQEIDL
Sbjct  23    PTNT-KATAAVDFPHWSITLSSTLYCIDGWGEPYFSVNSSGNISVRPHGAETLSHQEIDL  81

Query  2576  LKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPV  2397
             LKVVK+ASDPK  GGLG+QLP+IVRFPDVLKNRLESLQ AF+ A+ +QGYG HYQGVYPV
Sbjct  82    LKVVKRASDPKHSGGLGIQLPMIVRFPDVLKNRLESLQFAFDSAILAQGYGGHYQGVYPV  141

Query  2396  KCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISL  2217
             KCNQDR++VEDIV+FGSSFRFGLEAGSKPELLLAMSCLCKGSP++LLICNGFKDAEYI+L
Sbjct  142   KCNQDRYIVEDIVQFGSSFRFGLEAGSKPELLLAMSCLCKGSPESLLICNGFKDAEYIAL  201

Query  2216  ALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGK  2037
             A  ARKLLLNTVIVLEQEEE+DL+IDISRK++V PVIGLRAKLRTKH+GHFGSTSGEKGK
Sbjct  202   ACVARKLLLNTVIVLEQEEELDLVIDISRKISVIPVIGLRAKLRTKHSGHFGSTSGEKGK  261

Query  2036  FGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGA  1857
             FGLTT QILRVVKKL+++ M+DCLQLLHFHIGSQIPSTALL+DGVGEA Q++ ELVRLGA
Sbjct  262   FGLTTAQILRVVKKLEQAGMLDCLQLLHFHIGSQIPSTALLSDGVGEATQVFSELVRLGA  321

Query  1856  CMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSES  1677
              MKVIDIGGGLG+DYDGSKS +S++SV Y LQEYA+AVVQ+V++VCD+KG++HP+ICSES
Sbjct  322   NMKVIDIGGGLGLDYDGSKSTESDISVEYGLQEYAAAVVQSVKYVCDKKGINHPIICSES  381

Query  1676  GRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDT  1497
             GRAIVSHHSIL+FEAVS+SS       + GL+  VE L DDARADY+NLSAAAIRGE +T
Sbjct  382   GRAIVSHHSILVFEAVSASSYDSPVTSSLGLKYSVERLPDDARADYRNLSAAAIRGENET  441

Query  1496  CVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIP  1317
             C+ YADQLKQ+CV+QFK+GSL IEQLAAVD +CDLV+KAIG   PV TY+VNLSVFTSIP
Sbjct  442   CLFYADQLKQKCVEQFKDGSLGIEQLAAVDELCDLVTKAIGVAKPVQTYHVNLSVFTSIP  501

Query  1316  DFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELG----GN  1149
             DFW   QLFPIVPIHRLDERP  RGILSDLTCDSDGKID+F+GG+SSLPLHEL     G+
Sbjct  502   DFWGINQLFPIVPIHRLDERPTKRGILSDLTCDSDGKIDRFIGGDSSLPLHELNGDGRGS  561

Query  1148  GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVM  969
             GG YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VT A PGPSC+DVLRVM
Sbjct  562   GGGYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTLAIPGPSCSDVLRVM  621

Query  968   QHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansFHNMPYLVVGSTCCLTAATTP  789
             QHEPELMF+ LKHRA+E+LH  D+G M    LAS LA  F NMPYL  G +CCLTAA   
Sbjct  622   QHEPELMFQNLKHRADEYLHQNDDGSM---DLASGLAQCFRNMPYLSPGLSCCLTAANG-  677

Query  788   GSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
              +GYY+ N         DS   ED+ WSYC+A
Sbjct  678   NNGYYFCN-ADGFTSATDSVVSEDDQWSYCVA  708



>ref|XP_008236828.1| PREDICTED: arginine decarboxylase [Prunus mume]
Length=726

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/725 (74%), Positives = 607/725 (84%), Gaps = 28/725 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPP---TASVDHSHWSPSMSAALYRIDGWGDPY  2655
             G+      SLPAP          P + VPP   + S D SHWSPS+S+ LYRID WG PY
Sbjct  16    GHPLXXXSSLPAP----------PFSGVPPATTSVSTDSSHWSPSLSSDLYRIDAWGGPY  65

Query  2654  FTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRL  2475
             FTVNSSG+++VRPHGSATL HQEIDLLK+VKK SDPKP  GLGLQLPLIVR PDVLKNRL
Sbjct  66    FTVNSSGNVAVRPHGSATLPHQEIDLLKIVKKVSDPKPDCGLGLQLPLIVRLPDVLKNRL  125

Query  2474  ESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLA  2295
             ESLQ AF+ A++S  YGSHYQGV+PVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLA
Sbjct  126   ESLQGAFDLAIQSHDYGSHYQGVFPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPELLLA  185

Query  2294  MSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVR  2115
             MSCLCKG+P+ALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+D++ID+S+K+ VR
Sbjct  186   MSCLCKGNPEALLICNGFKDFEYISLALFARKLALNTVIVLEQEEELDVVIDLSKKLGVR  245

Query  2114  PVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQ  1935
             PVIG RAKL+TKH+GHFGSTSGEKGKFGLTTTQILRVVKKL +  ++DC QLLHFHIGSQ
Sbjct  246   PVIGARAKLKTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDQLGLLDCFQLLHFHIGSQ  305

Query  1934  IPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEY  1755
             IPSTALLA GV EAAQIYCELVRLGA MK IDIGGGLGIDYDGSKS+DSE+SV Y+L+EY
Sbjct  306   IPSTALLAGGVSEAAQIYCELVRLGAHMKFIDIGGGLGIDYDGSKSSDSEISVSYSLEEY  365

Query  1754  ASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQS  1578
             A+AVV+AVR VCDRK V HPVICSESGRA+VSH S++IFEA+SSS+ D +  +    LQ 
Sbjct  366   AAAVVRAVRNVCDRKSVKHPVICSESGRALVSHQSVMIFEAISSSACDDVPPMSAFALQY  425

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
             F+E L ++ARADY+NLSAAAIRGEY+ C+ YADQLKQRC+DQFKEGSL IEQLA VDG+C
Sbjct  426   FIEGLTEEARADYRNLSAAAIRGEYEACLTYADQLKQRCIDQFKEGSLGIEQLATVDGLC  485

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             D+VSKAIGA DPV TY+VNLSVFTSIPDFW  GQ FPIVPIHRLD+RP  RGILSDLTCD
Sbjct  486   DMVSKAIGASDPVRTYHVNLSVFTSIPDFWGIGQTFPIVPIHRLDQRPVVRGILSDLTCD  545

Query  1217  SDGKIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVV  1056
             SDGKIDKF+GGESSLPLHEL       G G +YYLGMFLGGAY+EALGG HNLFGGPSVV
Sbjct  546   SDGKIDKFIGGESSLPLHELEGNGGANGGGQKYYLGMFLGGAYQEALGGVHNLFGGPSVV  605

Query  1055  RVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafas  876
             RVSQSDGPHSF+VTRA PGPSC+DVLRVMQHEPELMFETLKHRAEE+    D+GGMA A+
Sbjct  606   RVSQSDGPHSFAVTRAVPGPSCSDVLRVMQHEPELMFETLKHRAEEY-GQGDDGGMASAA  664

Query  875   lasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSS----PGEDEHW  708
             +A+SLA SFHNMPYLV  S+CCLTA    G  Y   +D      +ADS+     GE++ W
Sbjct  665   VATSLARSFHNMPYLVASSSCCLTAMNNHGLYYCSEDDYDV---VADSAGGGGGGEEDTW  721

Query  707   SYCIA  693
             SYC A
Sbjct  722   SYCCA  726



>ref|XP_011092858.1| PREDICTED: arginine decarboxylase-like [Sesamum indicum]
Length=723

 Score =   978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/718 (73%), Positives = 595/718 (83%), Gaps = 19/718 (3%)
 Frame = -3

Query  2822  YAFA-WDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             YAF+ WD  LPA     ++ +    +AVP         WSP+ SA LYR+DGWG PYFTV
Sbjct  17    YAFSGWDSVLPASPPSHNTSSVASASAVPAV-------WSPAHSALLYRVDGWGAPYFTV  69

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NS+G++SVRP+G  TL+HQEIDLLK+VK AS PK LGGLGLQLPLI+RFPDVLK+RLESL
Sbjct  70    NSNGNVSVRPYGPDTLAHQEIDLLKIVKNASAPKTLGGLGLQLPLIIRFPDVLKHRLESL  129

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q AF+FA+ESQGY +HYQGVYPVKCNQ++FVVEDIVKFGS FRFGLEAGSKPELLLAMS 
Sbjct  130   QCAFDFAIESQGYQAHYQGVYPVKCNQNKFVVEDIVKFGSGFRFGLEAGSKPELLLAMSS  189

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LC GSP+ALL+CNGFKDAEYISLAL ARKL LNTVIVLEQEEE+D +I+IS+K+ VRP+I
Sbjct  190   LCNGSPEALLVCNGFKDAEYISLALVARKLHLNTVIVLEQEEELDTVIEISKKLEVRPII  249

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G RAKLRTKH+GHFGSTSGEKGKFGLTT QILRVVKKL + +M+DCLQLLHFHIGSQIPS
Sbjct  250   GARAKLRTKHSGHFGSTSGEKGKFGLTTMQILRVVKKLHDHDMLDCLQLLHFHIGSQIPS  309

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T+LLADGVGEAAQIYCELVRLGACMKVIDIGGGLGIDYDGSKS DS+ SVGY+LQ+YASA
Sbjct  310   TSLLADGVGEAAQIYCELVRLGACMKVIDIGGGLGIDYDGSKSQDSDSSVGYSLQDYASA  369

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VVQAVR VCDRKGV HPVICSESGRAIVSHHSIL+FEAVS+SS    Q+ + GLQ F+E 
Sbjct  370   VVQAVRLVCDRKGVKHPVICSESGRAIVSHHSILVFEAVSTSSHDAPQISSHGLQYFLER  429

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L DDA +DY+NLS+AAI  EYDTC+LYA+QLKQRCVDQFKEGSL +EQLAAVD +C+LVS
Sbjct  430   LTDDALSDYRNLSSAAIHNEYDTCLLYAEQLKQRCVDQFKEGSLGMEQLAAVDALCELVS  489

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
              AIG  D V TY+VNLS+FTSIPDFW   QLFPI+PIHRLDERP  RGILSDLTCDSDGK
Sbjct  490   NAIGVSDSVRTYHVNLSIFTSIPDFWGISQLFPIIPIHRLDERPAVRGILSDLTCDSDGK  549

Query  1205  IDKFVGGESSLPLHELGGN-------GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVS  1047
             IDKF+GGESSLPLHEL GN       G  YYLGMFLGGAYEEA+GG HNLFGGPSVV+VS
Sbjct  550   IDKFIGGESSLPLHELEGNRGVNGDGGASYYLGMFLGGAYEEAIGGVHNLFGGPSVVQVS  609

Query  1046  QSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslas  867
               +GPH F+VT A  GPSC DVLR+MQHEPELMFETLKHR EEF   +     +  +L +
Sbjct  610   LREGPHGFAVTHAILGPSCGDVLRLMQHEPELMFETLKHRVEEFSSSDGG--SSSMALIN  667

Query  866   slansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
              LA SF+NMPYL   S+C LTAA    +GYY  +D   A   AD+   EDE WSYC+A
Sbjct  668   GLACSFNNMPYLAAASSCSLTAAGI--NGYYCCDDEDYAAAAADTVTAEDEQWSYCVA  723



>gb|ACC43927.1| arginine decarboxylase [Malus hupehensis]
Length=728

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/726 (73%), Positives = 600/726 (83%), Gaps = 28/726 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPP---TASVDHSHWSPSMSAALYRIDGWGDPY  2655
             G+AFA D SLPA        +P P+  +PP   T + D+SHWSPS+S+ LYRID WG PY
Sbjct  16    GHAFAGDSSLPA--------SPFPS--LPPATITTAADNSHWSPSLSSDLYRIDAWGGPY  65

Query  2654  FTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRL  2475
             FTVNSSG+++VRPHG+ATL HQEIDLLK+VKK SD KP  GLGLQLPLIVR PDVLK+RL
Sbjct  66    FTVNSSGNVAVRPHGTATLPHQEIDLLKIVKKVSDSKPECGLGLQLPLIVRLPDVLKDRL  125

Query  2474  ESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLA  2295
             ESLQ AF+ A+ S  YGSHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLA
Sbjct  126   ESLQGAFDLAIRSHDYGSHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLA  185

Query  2294  MSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVR  2115
             MSCLCKG+PDALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL++D S+K+ VR
Sbjct  186   MSCLCKGNPDALLICNGFKDLEYISLALFARKLALNTVIVLEQEEELDLVVDFSQKLGVR  245

Query  2114  PVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQ  1935
             PVIG+RAKL+TKH+GH+GSTSGEKGKFGLTTTQILRVVKKL +  M+DC QLLHFHIGSQ
Sbjct  246   PVIGVRAKLKTKHSGHYGSTSGEKGKFGLTTTQILRVVKKLDKLGMLDCFQLLHFHIGSQ  305

Query  1934  IPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEY  1755
             IPSTALLADGV EA+QIYCELVRLGA MKVIDIGGGLGIDYDGSKS+DSE+SV Y L+EY
Sbjct  306   IPSTALLADGVSEASQIYCELVRLGAHMKVIDIGGGLGIDYDGSKSSDSEISVSYGLEEY  365

Query  1754  ASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQS  1578
              SAVV+ VR VC+R+ V HPVICSESGRA+VSHHS+LIFEA+SSS+ D    +     Q 
Sbjct  366   PSAVVRTVRNVCERRSVKHPVICSESGRALVSHHSVLIFEAISSSACDDAPPMSAFEHQY  425

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
             F+E L D+ARADY NLSAAAIRGEY+ C+ YAD LKQR V+QFKEGS+ IEQLA VDG C
Sbjct  426   FIEGLTDEARADYLNLSAAAIRGEYEACLTYADLLKQRSVEQFKEGSVGIEQLATVDGFC  485

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             D++SKAIGA D V TY+VNLSV TSIPDFW  GQ FPIVPIHRLD+RP  RG+LSDLTCD
Sbjct  486   DMLSKAIGASDAVRTYHVNLSVSTSIPDFWGIGQTFPIVPIHRLDQRPAVRGVLSDLTCD  545

Query  1217  SDGKIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVV  1056
             SDGKIDKF+GG SSLPLHEL       G G +YYLGMFLGGAY+EALGG HNLFGGPS+V
Sbjct  546   SDGKIDKFIGGGSSLPLHELEGNGGNNGGGQKYYLGMFLGGAYQEALGGVHNLFGGPSIV  605

Query  1055  RVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafas  876
             RVSQSDGPHSF+VT A  GPSC DVLRVMQHEPELMFETLKHRAEE     D+GGMA A+
Sbjct  606   RVSQSDGPHSFAVTGAVSGPSCGDVLRVMQHEPELMFETLKHRAEE-CGQGDDGGMASAA  664

Query  875   lasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSP-----GEDEH  711
             +A+SLA SFHNMP+LV  S+C LTA      G+YY ++    + +ADS+      GE+E 
Sbjct  665   VATSLARSFHNMPHLVSASSCSLTAMNN--HGFYYCSEDDYDDIVADSAGAAAPVGEEEQ  722

Query  710   WSYCIA  693
             WSYC A
Sbjct  723   WSYCCA  728



>dbj|BAD74163.1| arginine decarboxylase [Malus domestica]
Length=728

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/726 (73%), Positives = 597/726 (82%), Gaps = 28/726 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPP---TASVDHSHWSPSMSAALYRIDGWGDPY  2655
             G+AFA D SLPA        +P P   +PP   T + D+SHWSPS+S+ LYRID WG PY
Sbjct  16    GHAFAGDSSLPA--------SPFP--GLPPATITTAADNSHWSPSLSSDLYRIDAWGGPY  65

Query  2654  FTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRL  2475
             FTVNSSG+++VRPHG+ATL HQEIDLLK+VKK SD KP  GLGLQLPLIVR PDVLK+RL
Sbjct  66    FTVNSSGNVAVRPHGTATLPHQEIDLLKIVKKVSDSKPECGLGLQLPLIVRLPDVLKDRL  125

Query  2474  ESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLA  2295
             ESLQ AF+ A+ S  YGSHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLA
Sbjct  126   ESLQGAFDLAIRSHDYGSHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLA  185

Query  2294  MSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVR  2115
             MSCLCKG PDALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL++D S+K+ VR
Sbjct  186   MSCLCKGHPDALLICNGFKDLEYISLALFARKLALNTVIVLEQEEELDLVVDFSQKLGVR  245

Query  2114  PVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQ  1935
             PVIG+RAKL+TKH+GHFGSTSGE+GKFGLTTTQILRVVKKL +  M+DC QLLHFH GSQ
Sbjct  246   PVIGVRAKLKTKHSGHFGSTSGEEGKFGLTTTQILRVVKKLDKLGMLDCFQLLHFHTGSQ  305

Query  1934  IPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEY  1755
             IPSTALLADGV EA+QIYCELVRLGA MKVIDIGGGLGIDYDGSKS+DSE+SV Y L+EY
Sbjct  306   IPSTALLADGVSEASQIYCELVRLGAHMKVIDIGGGLGIDYDGSKSSDSEISVSYGLEEY  365

Query  1754  ASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQS  1578
             ASAVV+ VR VC+R+ V HPVICSESGRA+VSHHS+LIFEA+SSS+ D    +     Q 
Sbjct  366   ASAVVRTVRNVCERRSVKHPVICSESGRALVSHHSVLIFEAISSSACDDAPPMSAFEHQY  425

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
             F+E L D+ARADY NLSAAAIRGEY+ C+ YAD LKQR V+QFKEGS+ IEQLA VDG C
Sbjct  426   FIEGLTDEARADYLNLSAAAIRGEYEACLTYADLLKQRSVEQFKEGSVGIEQLATVDGFC  485

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             D+ SKAIGA D V TY+VNLSVFTSIPDFW  GQ FPIVPIHRLD+ P  RG+LSDLTCD
Sbjct  486   DMFSKAIGASDAVRTYHVNLSVFTSIPDFWGIGQTFPIVPIHRLDQWPAVRGVLSDLTCD  545

Query  1217  SDGKIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVV  1056
             SDGKIDKF+GG SSLPLHEL       G G +YYLGMFLGGAY+EALGG HNLFGGPS+V
Sbjct  546   SDGKIDKFIGGGSSLPLHELEGDGGNNGGGQKYYLGMFLGGAYQEALGGVHNLFGGPSIV  605

Query  1055  RVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafas  876
             RVSQSDGPHSF+VT A  GPSC DVLRVMQHEPELMFETLKHRAEE     D+GGMA A+
Sbjct  606   RVSQSDGPHSFAVTGAVSGPSCGDVLRVMQHEPELMFETLKHRAEE-CGQGDDGGMASAA  664

Query  875   lasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSP-----GEDEH  711
             +A+SLA SFHNMPYLV  S+C LTA      G+YY ++    + +ADS+      GE+E 
Sbjct  665   VATSLARSFHNMPYLVSASSCSLTAMNN--HGFYYCSEDDYGDIVADSAGAAAPVGEEEQ  722

Query  710   WSYCIA  693
             WSYC A
Sbjct  723   WSYCCA  728



>ref|XP_010526909.1| PREDICTED: arginine decarboxylase 2-like [Tarenaya hassleriana]
Length=726

 Score =   974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/720 (72%), Positives = 600/720 (83%), Gaps = 17/720 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHS-HWSPSMSAALYRIDGWGDPYFT  2649
             GYAF  D SL      ++     P    P +A+ D S HWSPS+S++LYRIDGWG PYFT
Sbjct  15    GYAFTGDSSL------LTGGVFFPAE-TPASAAADGSCHWSPSLSSSLYRIDGWGAPYFT  67

Query  2648  VNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLES  2469
             VNSSG+ISVR HG+ TL HQEIDLLK+VKK +DPK  GGL LQLPL+VRFPDVLKNRL+S
Sbjct  68    VNSSGNISVRSHGTDTLPHQEIDLLKIVKKVTDPKSSGGLDLQLPLVVRFPDVLKNRLQS  127

Query  2468  LQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMS  2289
             LQS+F+FA++SQGY SHYQGVYPVKCNQDRFVVEDIV+ GS FRFGLEAGSKPE+LLAMS
Sbjct  128   LQSSFDFAIQSQGYESHYQGVYPVKCNQDRFVVEDIVEVGSPFRFGLEAGSKPEILLAMS  187

Query  2288  CLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPV  2109
             CLCKG+P+A LICNGFKDAEYISLAL  +KL LNTVIVLEQEEE+DL+ID+S+KM VRPV
Sbjct  188   CLCKGNPEAFLICNGFKDAEYISLALLGQKLALNTVIVLEQEEELDLVIDLSQKMNVRPV  247

Query  2108  IGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIP  1929
             IG+RAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV+KL +  M+DCLQLLHFHIGSQIP
Sbjct  248   IGIRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLDQMGMLDCLQLLHFHIGSQIP  307

Query  1928  STALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYAS  1749
             STALL+DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+EYAS
Sbjct  308   STALLSDGVSEAAQLYCELVRLGAHMRVIDIGGGLGIDYDGSKSGESDLSVSYSLEEYAS  367

Query  1748  AVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVE  1569
             AVV AVRFVCDRK V+HPVICSESGRAIVSHHS+LIFEAVS+S      +    ++  +E
Sbjct  368   AVVSAVRFVCDRKSVTHPVICSESGRAIVSHHSVLIFEAVSASGSVGHGVDPTDIEFLLE  427

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
                ++AR+DYQNL AAAI+GE+++C+LY DQLKQRCV+ FKEG LSIEQLAAVDG C+ V
Sbjct  428   GYSEEARSDYQNLYAAAIQGEFESCLLYMDQLKQRCVEGFKEGLLSIEQLAAVDGFCEWV  487

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
              KAI + DP+ TY+VNLSVFTSIPDFW   QLFPI+PIH+LD+RPG RG+LSDLTCDSDG
Sbjct  488   LKAIDSSDPIRTYHVNLSVFTSIPDFWGIEQLFPIIPIHKLDQRPGTRGVLSDLTCDSDG  547

Query  1208  KIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             KIDKF+GGESSLPLHEL  +GG+YYLGMFLGGAYEEALGG HNLFGGPSVVRV+QSDGPH
Sbjct  548   KIDKFIGGESSLPLHELDNSGGKYYLGMFLGGAYEEALGGVHNLFGGPSVVRVTQSDGPH  607

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEF-----LHDEDNGGMafaslass  864
             SF+VTRA PG SCADVLRVMQHEPELMF+TLKHRAEEF       + D        +A+ 
Sbjct  608   SFAVTRAMPGQSCADVLRVMQHEPELMFQTLKHRAEEFGNNNSNDNGDYNNDDDDDVAAL  667

Query  863   lansFHNMPYLV-VGSTCCLTAATTPGSGYYYGND--VSAANPIADSSPGEDEHWSYCIA  693
             LA SFHNMPYLV   STC LTAA     G+YY ++   +A      ++ GEDE+WSYC A
Sbjct  668   LAQSFHNMPYLVSATSTCSLTAAIN-NLGFYYCDEDGYNAVFEAPAAAGGEDENWSYCCA  726



>gb|AEZ01223.1| arginine decarboxylase [Carica papaya]
Length=738

 Score =   973 bits (2516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/731 (73%), Positives = 607/731 (83%), Gaps = 27/731 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASV------DH---SHWSPSMSAALYRID  2673
             GY FA D SLPA   +VS  AP  TN +P  A+       DH   S WSP++SAALY+ID
Sbjct  15    GYVFAGDSSLPA---VVSPPAPTTTN-LPTAAAAATAAAGDHTSQSRWSPALSAALYKID  70

Query  2672  GWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPD  2493
             GWG PYF+VN+SG+ISVRPHG+ TL HQEIDLLK+VKK SDPK +GGLGLQLPLIVR PD
Sbjct  71    GWGAPYFSVNTSGNISVRPHGAETLPHQEIDLLKIVKKVSDPKSVGGLGLQLPLIVRLPD  130

Query  2492  VLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSK  2313
             VLKNRLESLQSAF++A++SQGY +HYQGVYPVKCNQDRFVVEDIV+FG+ FRFGLEAGSK
Sbjct  131   VLKNRLESLQSAFDYAIQSQGYEAHYQGVYPVKCNQDRFVVEDIVRFGTPFRFGLEAGSK  190

Query  2312  PELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDIS  2133
             PELLLAMSCLCKGSPDALL+CNGFKDAEYISLAL ARKL LNTVIVLEQEEE+DL+ID+S
Sbjct  191   PELLLAMSCLCKGSPDALLVCNGFKDAEYISLALFARKLSLNTVIVLEQEEEIDLVIDLS  250

Query  2132  RKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLH  1953
              K++V+PVIG+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV KL+++ M+DCLQLLH
Sbjct  251   TKLSVKPVIGVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVGKLKQAGMLDCLQLLH  310

Query  1952  FHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVG  1773
             FHIGSQIPST LLADGVGEA+QIYCEL RLGA M+V+DIGGGLGIDYDGSKSA+S+VSV 
Sbjct  311   FHIGSQIPSTTLLADGVGEASQIYCELTRLGARMQVVDIGGGLGIDYDGSKSAESDVSVA  370

Query  1772  YTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPN  1593
             Y+L+EYA+AVV+ V  VCDRK V HPVICSESGRAIVSHHS+LIFEA+S S      +  
Sbjct  371   YSLEEYAAAVVRTVAGVCDRKSVKHPVICSESGRAIVSHHSVLIFEAMSVSVPSAPAMNT  430

Query  1592  PGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAA  1413
               +Q F +  KDDARA Y NL+ A  RG+YDTC  YAD+LK+RC++ FKEG++ IEQLAA
Sbjct  431   FLMQCFFDRFKDDARAAYLNLATADARGDYDTCWFYADKLKERCLEDFKEGTICIEQLAA  490

Query  1412  VDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILS  1233
             VDG C+LVS+ IGA DPV TY+VNLSVFTSIPDFW  GQLFPIVPIHRLD+RPG RG+LS
Sbjct  491   VDGFCELVSELIGAPDPVRTYHVNLSVFTSIPDFWGIGQLFPIVPIHRLDQRPGVRGVLS  550

Query  1232  DLTCDSDGKIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFG  1071
             DLTCDSDGKI+KF+GGESSLPLHEL      GG+GGRY LGMFLGGAYEEALGG HNLFG
Sbjct  551   DLTCDSDGKIEKFIGGESSLPLHELEGCGGSGGDGGRYLLGMFLGGAYEEALGGVHNLFG  610

Query  1070  GPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL--HDEDN  897
             GPSVV+V QSDGPHSF+VTRA PGP+CADVLRVMQHEPELMFETLKHRA E+   ++ DN
Sbjct  611   GPSVVQVLQSDGPHSFAVTRAMPGPTCADVLRVMQHEPELMFETLKHRALEYTGQNNHDN  670

Query  896   G---GMafaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSP  726
             G         +AS++A SFHNMPYL    +C LTA     SG+YY N+      + +S  
Sbjct  671   GDGINEDGHGIASTIARSFHNMPYL-FSLSCSLTAINN--SGFYYCNEDDYNAAVIESGA  727

Query  725   GEDEHWSYCIA  693
             GEDE WSYC A
Sbjct  728   GEDEQWSYCCA  738



>ref|XP_008461023.1| PREDICTED: arginine decarboxylase [Cucumis melo]
Length=717

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/720 (73%), Positives = 599/720 (83%), Gaps = 28/720 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPP--TASVDHSHWSPSMSAALYRIDGWGDPYF  2652
             GY FA D SLP+   L S   P  T    P  T + +   WSP +S++LY+IDGWG PYF
Sbjct  17    GYVFAGDSSLPS-SVLFSGGPPETTIFSSPDSTPTSETMSWSPPLSSSLYKIDGWGAPYF  75

Query  2651  TVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLE  2472
             +VN SG+++VRP+G+ATL HQEIDLLK+VKKASDP   GGLGLQLPLIVRFPDVLKNRLE
Sbjct  76    SVNGSGNMAVRPYGTATLPHQEIDLLKIVKKASDPICSGGLGLQLPLIVRFPDVLKNRLE  135

Query  2471  SLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAM  2292
             SLQSAF++A++SQGYGSHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAM
Sbjct  136   SLQSAFDYAIQSQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAM  195

Query  2291  SCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRP  2112
             SCLCKG+ DA L+CNGFKDAEYISLAL ARKL LNTVIVLEQEEE+DL+ID+S+++ VRP
Sbjct  196   SCLCKGNSDAFLVCNGFKDAEYISLALIARKLALNTVIVLEQEEEIDLVIDLSKRLFVRP  255

Query  2111  VIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQI  1932
             V+G+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL++++M+DCLQLLHFHIGSQI
Sbjct  256   VVGMRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLEQADMLDCLQLLHFHIGSQI  315

Query  1931  PSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYA  1752
             PSTALLADGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS+DSE+SV Y L+EYA
Sbjct  316   PSTALLADGVGEAAQIYCELVRLGANMRVIDIGGGLGIDYDGSKSSDSELSVAYGLEEYA  375

Query  1751  SAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFV  1572
             +AVV AVR VCDR+ V HP+ICSESGRAIVSHHS+LIFEAVS+SS ++  + +  LQ  V
Sbjct  376   AAVVDAVRCVCDRRSVKHPIICSESGRAIVSHHSVLIFEAVSASSYEVPSMSSLELQYLV  435

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             + L DDAR DYQNLSAAA  GEY TC++YADQLKQRCV++FK+G L +EQLAAVDG+C L
Sbjct  436   DGLTDDARVDYQNLSAAAYMGEYKTCLVYADQLKQRCVEKFKDGCLGMEQLAAVDGLCAL  495

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             V+KA+G  D V TY+VNLSVFTSIPDFW   QLFPIVPIHRLD+RP  RG+LSDLTCDSD
Sbjct  496   VAKAVGELDSVRTYHVNLSVFTSIPDFWGIDQLFPIVPIHRLDQRPTVRGVLSDLTCDSD  555

Query  1211  GKIDKFVGGESSLPLHEL-------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVR  1053
             GK+DKF+GGESSLPLHEL       GG GGRYYLGMFLGGAYEEALGG HNLFGGPSVVR
Sbjct  556   GKVDKFIGGESSLPLHELEGNGNLSGGGGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVR  615

Query  1052  VSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafasl  873
             V QSDGPHSF+VTR  PGPSC DVLRVMQHEPELMFETLKHRAEEF  ++D+GG     +
Sbjct  616   VMQSDGPHSFAVTRTVPGPSCGDVLRVMQHEPELMFETLKHRAEEFGQEDDDGG---EGI  672

Query  872   asslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             A+SLA SF NMPYL   S+CC                 +  N   DS  G+ E W+YC A
Sbjct  673   ANSLAMSFRNMPYLSSASSCC---------------SETDYNGAVDSGAGDAEQWTYCYA  717



>ref|XP_007042018.1| Arginine decarboxylase [Theobroma cacao]
 gb|EOX97849.1| Arginine decarboxylase [Theobroma cacao]
Length=732

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/723 (73%), Positives = 605/723 (84%), Gaps = 27/723 (4%)
 Frame = -3

Query  2795  PAPEALVSSDAPLPTNAVPPTASV-------------DHSHWSPSMSAALYRIDGWGDPY  2655
             P   A ++ D+ LP  AVP ++S+             + +HWSP+ S+ALYRIDGWG PY
Sbjct  15    PGYAAFIAGDSSLPA-AVPCSSSITTTTVTAAAAPNSNSTHWSPAHSSALYRIDGWGAPY  73

Query  2654  FTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRL  2475
             F+VN+SG+I+VRP+G+ TL+HQEIDLLK+VKK SDPK +GGLGLQLPLIVR PDVLK+RL
Sbjct  74    FSVNNSGNITVRPYGTDTLAHQEIDLLKIVKKVSDPKSVGGLGLQLPLIVRLPDVLKDRL  133

Query  2474  ESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLA  2295
             ESLQSAF  A+++QGY SHYQGVYPVKCNQDRFVVEDIV+FG+ FRFGLEAGSKPELLLA
Sbjct  134   ESLQSAFELAIQAQGYESHYQGVYPVKCNQDRFVVEDIVRFGAPFRFGLEAGSKPELLLA  193

Query  2294  MSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVR  2115
             MSCLCKG+P+ALL+CNGFKDAEYISLAL ARKL LNTVIVLEQEEEV+++IDIS+K++VR
Sbjct  194   MSCLCKGNPEALLVCNGFKDAEYISLALLARKLALNTVIVLEQEEEVNMVIDISKKLSVR  253

Query  2114  PVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQ  1935
             PVIG+RAKLRTKH+GHFGSTSGEKGKFGLTTTQ+LRVVKKLQ+S M+DCLQLLHFHIGSQ
Sbjct  254   PVIGVRAKLRTKHSGHFGSTSGEKGKFGLTTTQVLRVVKKLQDSGMLDCLQLLHFHIGSQ  313

Query  1934  IPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEY  1755
             IPSTALL DGVGEAAQIY ELVRLGA MKV+DIGGGLGIDYDGSKS +S++SV Y LQEY
Sbjct  314   IPSTALLQDGVGEAAQIYSELVRLGAGMKVLDIGGGLGIDYDGSKSGNSDLSVSYGLQEY  373

Query  1754  ASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSF  1575
             ASAVV A+RFVCDRK V HP+ICSESGRAIVSHHSILIFEA+S+++     + +  +   
Sbjct  374   ASAVVNAIRFVCDRKSVKHPIICSESGRAIVSHHSILIFEALSATAPTTPAMNHINIPFI  433

Query  1574  VESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICD  1395
             +E L +DARADY NL  AA+R E + C+LYADQLKQRCV+QFKEG+L IEQLAAVDG+CD
Sbjct  434   MEGLSEDARADYWNLRDAAMRHENEACLLYADQLKQRCVEQFKEGTLGIEQLAAVDGLCD  493

Query  1394  LVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDS  1215
              VSK IGA +PV TY+VNLS+FTSIPDFW+ GQ+FPIVPIHRLDERP  RG LSDLTCDS
Sbjct  494   FVSKVIGASEPVRTYHVNLSIFTSIPDFWSIGQIFPIVPIHRLDERPEVRGTLSDLTCDS  553

Query  1214  DGKIDKFVGGESSLPLHEL--------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSV  1059
             DGKIDKF+GGE+SLPLHEL        GG  GRYYLGMFLGGAYEEALGG HNLFGGPSV
Sbjct  554   DGKIDKFIGGETSLPLHELEGNGGGSSGGANGRYYLGMFLGGAYEEALGGVHNLFGGPSV  613

Query  1058  VRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL-HDEDNGGMaf  882
             VRV QSDGPHSF+VTRA PGPSC DVLRVMQHEPELMFETLKHRAEEF   D  N G+  
Sbjct  614   VRVLQSDGPHSFAVTRAVPGPSCGDVLRVMQHEPELMFETLKHRAEEFFGQDHANNGV-N  672

Query  881   aslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
             A+LA+SLA SFHNMPYL   S+C LTA     +G+YY N+    N   +S   EDE WSY
Sbjct  673   AALANSLARSFHNMPYLAKVSSCSLTAMNN--NGFYYCNE-EDYNAAVESGASEDEQWSY  729

Query  701   CIA  693
             C A
Sbjct  730   CCA  732



>ref|XP_002306141.1| arginine decarboxylase family protein [Populus trichocarpa]
 gb|EEE86652.1| arginine decarboxylase family protein [Populus trichocarpa]
Length=730

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/720 (74%), Positives = 611/720 (85%), Gaps = 22/720 (3%)
 Frame = -3

Query  2825  GYAF-AWDRSLPAPEALVSSDAPLPTNAVPPTASVDHS--HWSPSMSAALYRIDGWGDPY  2655
             GYAF A D SLP P    S   PL T +    A+ ++S  HWSPS+SAALY+IDGWG PY
Sbjct  16    GYAFPAGDSSLPFP-VPCSPGVPLSTTSTHTAAASENSSAHWSPSLSAALYKIDGWGAPY  74

Query  2654  FTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRL  2475
             F+VNSSG++S RP+G+ TL HQEIDLLK+VKK SDPK +GGLGLQLP+IVR PDVLKNRL
Sbjct  75    FSVNSSGNVSARPYGTDTLPHQEIDLLKIVKKVSDPKWVGGLGLQLPVIVRLPDVLKNRL  134

Query  2474  ESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLA  2295
             ESLQSAF+FA++SQ Y +HYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLA
Sbjct  135   ESLQSAFDFAIQSQVYEAHYQGVYPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPELLLA  194

Query  2294  MSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVR  2115
             MSCLCKG+P+ALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL+I++S+KM+VR
Sbjct  195   MSCLCKGNPEALLICNGFKDGEYISLALIARKLALNTVIVLEQEEEIDLVIELSKKMSVR  254

Query  2114  PVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQ  1935
             PV+G+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL+++ M+DC QLLHFHIGSQ
Sbjct  255   PVVGVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLEQAGMLDCFQLLHFHIGSQ  314

Query  1934  IPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEY  1755
             IPST+LLADGV EAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV Y L+EY
Sbjct  315   IPSTSLLADGVSEAAQIYCELVRLGARMQVIDIGGGLGIDYDGSKSGNSDLSVAYGLEEY  374

Query  1754  ASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSF  1575
             A AVVQAV+FVCDRK V HPVICSESGRAIVSHHSILIFEA+SSSS     + +  +Q +
Sbjct  375   ALAVVQAVKFVCDRKNVKHPVICSESGRAIVSHHSILIFEAISSSSTSAASMTSYEMQYY  434

Query  1574  VESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICD  1395
             +  L +DARADY+NL+A+AIRGE++ C+LYADQLKQ CVDQFKEG++ +EQLAAVD +C+
Sbjct  435   LGGLTEDARADYRNLTASAIRGEHEACLLYADQLKQSCVDQFKEGNIGMEQLAAVDALCE  494

Query  1394  LVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDS  1215
             L  K IGA DPV TY+VNLS+FTSIPDFW  GQLFPIVPIHRLD+RPGARGILSDLTCDS
Sbjct  495   LFYKTIGASDPVRTYHVNLSLFTSIPDFWGIGQLFPIVPIHRLDQRPGARGILSDLTCDS  554

Query  1214  DGKIDKFVGGESSLPLHEL-----GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRV  1050
             DGKIDKF+GGESSLPLHE+     GGNGG+YYLGMFLGGAYEEALGG HNLFGGPSVVRV
Sbjct  555   DGKIDKFIGGESSLPLHEIEGGGAGGNGGKYYLGMFLGGAYEEALGGIHNLFGGPSVVRV  614

Query  1049  SQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGM------  888
             SQSDGPHSF VT+A PGPSC DVLRVMQHEPELMFETLKHR EE+ H +++         
Sbjct  615   SQSDGPHSFLVTQAVPGPSCGDVLRVMQHEPELMFETLKHRVEEYCHHDEDSDDGDSDHG  674

Query  887   --afaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDE  714
               + ASLA+ LA+ FHNMPYLV  + C +TA     SG+YY N+    N  AD+SP EDE
Sbjct  675   MGSIASLANRLASYFHNMPYLV--APCSVTAMNN--SGFYYCNE-DDYNAAADTSPCEDE  729



>ref|XP_010263903.1| PREDICTED: arginine decarboxylase-like [Nelumbo nucifera]
Length=720

 Score =   969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/718 (73%), Positives = 604/718 (84%), Gaps = 20/718 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYA A D SLPAPEA   S  P  TN  P  + +DHS WSPS+SA+LY+IDGWG PYF+V
Sbjct  16    GYAIAGDSSLPAPEAF--SGVPPATNITP--SVLDHSPWSPSLSASLYKIDGWGVPYFSV  71

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSG+ISVRPHG+ TL HQEIDL+KVVKKAS+PK  GGLGLQ PLIVRFPDVL++R+ESL
Sbjct  72    NSSGNISVRPHGAETLHHQEIDLMKVVKKASEPKSSGGLGLQFPLIVRFPDVLRHRVESL  131

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q+AF+FA+ SQGY SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLAMSC
Sbjct  132   QAAFDFAIHSQGYDSHYQGVYPVKCNQDRFVVEDIVEFGSPFRFGLEAGSKPELLLAMSC  191

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+P+A LICNG+KD+EYISLAL ARKL LNTVIV+EQEEE+DL+I+ SRK++VRPVI
Sbjct  192   LCKGNPEAFLICNGYKDSEYISLALIARKLHLNTVIVIEQEEELDLVIENSRKLSVRPVI  251

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFG+TSGE+GKFGLTTTQILR+V KL++  M+DCLQLLHFHIGSQIPS
Sbjct  252   GVRAKLRTKHSGHFGATSGERGKFGLTTTQILRLVSKLEQVGMLDCLQLLHFHIGSQIPS  311

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEAAQIYCELVRLGA ++VIDIGGGLGIDYDGS+S+DS++SVGY L+EYA+ 
Sbjct  312   TLLLADGVGEAAQIYCELVRLGAGLQVIDIGGGLGIDYDGSRSSDSDISVGYGLEEYAAT  371

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVS--SSSDKLLQLPNPGLQSFV  1572
             VVQ++R+ CDRK V+HPVICSESGRAIVSHHS+LIFEAVS  +SS   +    PGLQ  V
Sbjct  372   VVQSIRYACDRKFVNHPVICSESGRAIVSHHSVLIFEAVSATASSTPTISSLGPGLQYLV  431

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             + L D+AR DY+NL+AAA+RGEY+TC+LYADQLKQRC+ QFKEGS+ +E LA+VDG+CD 
Sbjct  432   DGLTDEARMDYRNLTAAAVRGEYETCLLYADQLKQRCIQQFKEGSVGLEHLASVDGLCDF  491

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             V+KAIG  + V TY+VNLS+FTSIPDFWA  QLFPIVPIHRLD+RPG RGILSDLTCDSD
Sbjct  492   VAKAIGMSESVRTYHVNLSLFTSIPDFWAIEQLFPIVPIHRLDQRPGVRGILSDLTCDSD  551

Query  1211  GKIDKFVGGESSLP-----LHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVS  1047
             GK+DKF+GGESSLP       E G  GG YYLGMFLGGAYEEALGG HNLFGGPSVVRVS
Sbjct  552   GKVDKFIGGESSLPLHELGGEEGGHGGGGYYLGMFLGGAYEEALGGLHNLFGGPSVVRVS  611

Query  1046  QSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslas  867
             QSDGPHSF+VTRA PGPSC DVLR MQHEPELMFE LKHRAEE    ED   MA A LA 
Sbjct  612   QSDGPHSFAVTRAVPGPSCGDVLRAMQHEPELMFEALKHRAEECGGHEDE--MACAELAR  669

Query  866   slansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
              LA SFHNMPYL+  ++C    AT   + YYY    +  N    ++ GE+E WSYC A
Sbjct  670   GLARSFHNMPYLITAASC----ATANNNFYYY---CNDDNNNNSAAVGEEEQWSYCCA  720



>sp|Q43075.1|SPE1_PEA RecName: Full=Arginine decarboxylase; Short=ADC; Short=ARGDC 
[Pisum sativum]
 emb|CAA85773.1| arginine decarboxylase [Pisum sativum]
Length=728

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/717 (72%), Positives = 600/717 (84%), Gaps = 16/717 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVD-HSHWSPSMSAALYRIDGWGDPYFT  2649
             GYA A D +LP P     S A   T+    TA  D +S WSPS+S+ L+RIDGWG PYF 
Sbjct  19    GYALAGDFTLPLP--FTFSAAATITDDADATAVEDSNSIWSPSLSSKLFRIDGWGFPYFG  76

Query  2648  VNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLES  2469
             VN++GDISVRPHGSAT+SHQEIDLLKVVKKASDPK  GGLGLQLPL+VRFPDVLK+RLES
Sbjct  77    VNAAGDISVRPHGSATMSHQEIDLLKVVKKASDPKCCGGLGLQLPLVVRFPDVLKDRLES  136

Query  2468  LQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMS  2289
             + +AF+ A++ QGY SHYQGVYPVKCNQDR++VEDIV+FGSSFRFGLEAGSKPELLLAMS
Sbjct  137   IHAAFDGAIQLQGYESHYQGVYPVKCNQDRYIVEDIVEFGSSFRFGLEAGSKPELLLAMS  196

Query  2288  CLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPV  2109
             CLCKG+ +A L+CNGFKD+EYISLAL ARKL LNTVIVLEQEEE+D++++IS K+ +RPV
Sbjct  197   CLCKGNREAFLVCNGFKDSEYISLALIARKLALNTVIVLEQEEELDMVVEISNKLCIRPV  256

Query  2108  IGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIP  1929
             IG+RAKL+TKH+GHFG+TSG+KGKFGLTT QIL VVKKL++ +M+DCLQLLHFHIGSQIP
Sbjct  257   IGVRAKLKTKHSGHFGATSGDKGKFGLTTIQILHVVKKLEQLDMLDCLQLLHFHIGSQIP  316

Query  1928  STALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYAS  1749
             +T LLADGV EA+QIYCEL+RLGA MKV+DIGGGLGIDYDGSKS DS+ SV Y L+EYA+
Sbjct  317   TTELLADGVREASQIYCELLRLGAQMKVLDIGGGLGIDYDGSKSGDSDESVAYGLEEYAA  376

Query  1748  AVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVE  1569
             AVV AV++VCDRK V HPVICSESGRAIVSHHSILIFEA  +S++    L +  LQ   E
Sbjct  377   AVVHAVKYVCDRKNVKHPVICSESGRAIVSHHSILIFEASGASTNTAPSLSSIELQYLGE  436

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
              L ++A ADYQN+SAA +RGEY+ C+LY +Q K+RCV++FK+G+L IEQLAAVDG+CDL+
Sbjct  437   GLSEEALADYQNISAATLRGEYEACLLYTEQFKKRCVEEFKQGTLGIEQLAAVDGLCDLI  496

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             ++ IG  DPV  Y+VNLSVFTS+PDFW   QLFPIVPIHRLDE+P ARGILSDLTCDSDG
Sbjct  497   TETIGVKDPVKKYHVNLSVFTSVPDFWGINQLFPIVPIHRLDEKPTARGILSDLTCDSDG  556

Query  1208  KIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             KIDKF+GGESSLPLHE+ G+GG YYLGMFLGG+YEEALGG HNLFGGPSVVRV QSDGPH
Sbjct  557   KIDKFIGGESSLPLHEMEGHGGGYYLGMFLGGSYEEALGGLHNLFGGPSVVRVLQSDGPH  616

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL--HDED---NGGMafaslass  864
              F+VTRA  G SCADVLRVMQHEP+LMFETLKHRA EF   HD+D   N G+    LA+S
Sbjct  617   GFAVTRAVAGSSCADVLRVMQHEPQLMFETLKHRALEFCGQHDDDSVVNAGV----LANS  672

Query  863   lansFHNMPYLVVGSTCCLTAATTPGSGYYY--GNDVSAAN-PIADSSPGEDEHWSY  702
             LA SF NMPYLV  +TCCL A T   +G+YY  G+D SA    +A S  GEDE+WSY
Sbjct  673   LAQSFDNMPYLVSSTTCCLNALTN-NNGFYYCSGDDFSADTVSVATSVAGEDENWSY  728



>gb|AEE99192.1| arginine decarboxylase [Citrus trifoliata]
Length=751

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/709 (74%), Positives = 591/709 (83%), Gaps = 21/709 (3%)
 Frame = -3

Query  2765  APLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQE  2586
             +P   +A    A VD SHWSPS SA+LY+ID WG PYF VN SG++SVRP+G ATL+HQE
Sbjct  46    SPTSASAGSVAADVDASHWSPSHSASLYKIDSWGAPYFAVNPSGNVSVRPYGHATLAHQE  105

Query  2585  IDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGV  2406
             IDLLK+VKK +DPK +GGLGLQLPLIVR PDVL++RLESLQSAF FA+++Q Y +HYQGV
Sbjct  106   IDLLKIVKKVTDPKSVGGLGLQLPLIVRLPDVLRDRLESLQSAFEFAIQTQCYEAHYQGV  165

Query  2405  YPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEY  2226
             +PVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSCLCKGSP+ALL+CNGFKDAEY
Sbjct  166   FPVKCNQDRFVVEDIVKFGSQFRFGLEAGSKPELLLAMSCLCKGSPEALLVCNGFKDAEY  225

Query  2225  ISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGE  2046
             I+LAL ARKL LN VIVLEQEEEVDL+I+IS+K+ VRPVIG RAKLRTKH+GHFG+TSGE
Sbjct  226   ITLALLARKLALNAVIVLEQEEEVDLVIEISKKLNVRPVIGARAKLRTKHSGHFGATSGE  285

Query  2045  KGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVR  1866
             KGKFGLTT QILRVVKKL+ +EM+DC QLLHFHIGSQIPSTALL DGVGEAAQIYCELVR
Sbjct  286   KGKFGLTTCQILRVVKKLELAEMLDCFQLLHFHIGSQIPSTALLTDGVGEAAQIYCELVR  345

Query  1865  LGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVIC  1686
             LGA M+VIDIGGGLGIDYDGSKSADS++SV YTL+EYASAVVQA+R+VCDRK V HPV+C
Sbjct  346   LGANMQVIDIGGGLGIDYDGSKSADSDLSVAYTLEEYASAVVQAIRYVCDRKNVKHPVLC  405

Query  1685  SESGRAIVSHHSILIFEAVSSSSDKL--LQLPNPGLQSFVESLKDDARADYQNLSAAAIR  1512
             SESGRAIVSHHSILIFEAVS+S  +   + +   GLQ  VE L +DAR+DY  ++ AA+R
Sbjct  406   SESGRAIVSHHSILIFEAVSASVSRAAPVAMSPLGLQYLVEGLTEDARSDYTKMTTAALR  465

Query  1511  GEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSV  1332
             GE++TC+ YADQLKQRC++QFK+G+L IEQLA VDG+CD V+K IGA DPV TY+VNLS+
Sbjct  466   GEFETCLFYADQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSI  525

Query  1331  FTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL--  1158
             FTSIPD+W  GQLFPIVPIH LDERPG RGILSDLTCDSDGKIDKF+GG +SLPLHE+  
Sbjct  526   FTSIPDYWGIGQLFPIVPIHHLDERPGVRGILSDLTCDSDGKIDKFIGGGTSLPLHEMVG  585

Query  1157  --GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCAD  984
               GG  G YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PGPSC D
Sbjct  586   GGGGERGPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGD  645

Query  983   VLRVMQHEPELMFETLKHRAEEFL----------HDEDNGGMafaslasslansF-HNMP  837
             VLRVMQHEPELMFETLKHRAEE             D D+ GMA  S  +S    + H+MP
Sbjct  646   VLRVMQHEPELMFETLKHRAEECCGQEHGSNGGNGDTDDYGMANNSALASSLAQYFHSMP  705

Query  836   YLVVGSTCCLTAATTPGSGYY-YGNDVSAANPIADSSPGEDEHWSYCIA  693
             YLVV S+C LTA    G  YY  G D  A   + DSSP EDE WSYC A
Sbjct  706   YLVVPSSCSLTAINNGGGLYYCNGEDYDA---VVDSSPNEDEQWSYCYA  751



>gb|KDP27633.1| hypothetical protein JCGZ_19638 [Jatropha curcas]
Length=724

 Score =   966 bits (2496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/723 (73%), Positives = 612/723 (85%), Gaps = 26/723 (4%)
 Frame = -3

Query  2825  GYA-FAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHS---HWSPSMSAALYRIDGWGDP  2658
             GYA  A D SL +   L S   P PT      +++D+S   HWSPS+SAALY+IDGWG P
Sbjct  16    GYANHAGDSSLQS-SILFSGVPPAPTTTT--ASAIDNSPFSHWSPSLSAALYKIDGWGAP  72

Query  2657  YFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNR  2478
             YF+VNSSG+I+V P+G+ TL+HQEIDL+K+++K SDPK +GGLGLQLPLIVR PD+LKNR
Sbjct  73    YFSVNSSGNIAVHPYGTDTLAHQEIDLMKIMRKVSDPKSMGGLGLQLPLIVRLPDILKNR  132

Query  2477  LESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLL  2298
             +ESLQSAFN+A+ SQG+ +HYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLL
Sbjct  133   IESLQSAFNYAIHSQGFEAHYQGVYPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPELLL  192

Query  2297  AMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAV  2118
             AMSCLCKG+PD+ L+CNGFKDAEYISLAL ARKL LNTVIVLEQEEE+DL++++S+K+++
Sbjct  193   AMSCLCKGNPDSFLVCNGFKDAEYISLALLARKLALNTVIVLEQEEELDLVLEMSKKLSI  252

Query  2117  RPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGS  1938
             RPVIG+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL+ + M+DCLQLLHFHIGS
Sbjct  253   RPVIGVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLEGAGMLDCLQLLHFHIGS  312

Query  1937  QIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQE  1758
             QIPSTALLADGVGEAAQIYCELVRLGA M+V+DIGGGLGIDYDGSKS DS++SV Y L+E
Sbjct  313   QIPSTALLADGVGEAAQIYCELVRLGAQMQVLDIGGGLGIDYDGSKSGDSDISVAYGLEE  372

Query  1757  YASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFE-AVSSSSDKLLQLPNPGLQ  1581
             YA AVVQAV+FVCDRK + HPV+CSESGRAIVSHHSILIFE   +S S     + + G Q
Sbjct  373   YAHAVVQAVKFVCDRKNIKHPVLCSESGRAIVSHHSILIFEAVSASMSSAAASMTSAGFQ  432

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
              FV+ L +DA +DY+NL++AA+RGE DTC+LYADQLKQRCVDQFKEGS+ +EQLAAVD +
Sbjct  433   YFVDGLTEDAISDYRNLTSAAMRGENDTCLLYADQLKQRCVDQFKEGSIGMEQLAAVDSL  492

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+LV KA+G  DP+ TY+VNLSVFTSIPDFW  GQLFPIVPIHRLD+RP  RGILSDLTC
Sbjct  493   CELVGKAVGLSDPIRTYHVNLSVFTSIPDFWGIGQLFPIVPIHRLDQRPAVRGILSDLTC  552

Query  1220  DSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQS  1041
             DSDGKIDKF+GGESSLPLHE+   GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRVSQS
Sbjct  553   DSDGKIDKFIGGESSLPLHEI--EGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQS  610

Query  1040  DGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEF-------LHDEDNGGMaf  882
             DGPHSF+VTRA PGPSC DVLRVMQHEPELMFETLKHRAEE+          + +  M  
Sbjct  611   DGPHSFAVTRAVPGPSCGDVLRVMQHEPELMFETLKHRAEEYCHHDEDSDDSDGDHHMGN  670

Query  881   aslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
             A+LASSLA SFHNMPYLV  ++C LTA      G+YY N+ +     ADS+ G+++ WSY
Sbjct  671   ATLASSLARSFHNMPYLV--ASCSLTALNN--GGFYYCNEDA-----ADSATGDEDQWSY  721

Query  701   CIA  693
             C A
Sbjct  722   CCA  724



>ref|XP_004150135.1| PREDICTED: arginine decarboxylase-like [Cucumis sativus]
 ref|XP_004172332.1| PREDICTED: arginine decarboxylase-like [Cucumis sativus]
 gb|KGN61856.1| hypothetical protein Csa_2G252050 [Cucumis sativus]
Length=717

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/723 (72%), Positives = 604/723 (84%), Gaps = 34/723 (5%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAV-----PPTASVDHSHWSPSMSAALYRIDGWGD  2661
             GY FA D SLP+  +++ S  P  T        PPT+  ++  WSP +S++LY+IDGWG 
Sbjct  17    GYVFAGDSSLPS--SVLFSGGPPETTIFSSPDSPPTS--ENMSWSPPLSSSLYKIDGWGA  72

Query  2660  PYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKN  2481
             PYF+VN SG+++VRP+G+ATL HQEIDLLK+VKKASDP   GGLGLQLPLIVRFPDVLKN
Sbjct  73    PYFSVNGSGNMAVRPYGTATLPHQEIDLLKIVKKASDPICSGGLGLQLPLIVRFPDVLKN  132

Query  2480  RLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELL  2301
             RLESLQSAF++A++SQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELL
Sbjct  133   RLESLQSAFDYAIQSQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELL  192

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+ DA L+CNGFKDAEYISLAL ARKL LNTVIV+EQEEE+DL+ID+S+++ 
Sbjct  193   LAMSCLCKGNSDAFLVCNGFKDAEYISLALIARKLALNTVIVIEQEEEIDLVIDLSKRLF  252

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPV+G+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL++++M+DCLQLLHFHIG
Sbjct  253   VRPVVGMRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLEQADMLDCLQLLHFHIG  312

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALLADGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS+DSE+SV Y L+
Sbjct  313   SQIPSTALLADGVGEAAQIYCELVRLGANMRVIDIGGGLGIDYDGSKSSDSELSVAYGLE  372

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV AVR VCDR+ V HP+ICSESGRAIVSHHS+LIFEAVS+SS ++  + +  LQ
Sbjct  373   EYAAAVVDAVRCVCDRRSVKHPIICSESGRAIVSHHSVLIFEAVSASSYEVPSMSSLELQ  432

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               V+ L D+AR DYQNLSAAA  GEY TC++YADQLKQRCV++FK+G L +EQLAAVDG+
Sbjct  433   YLVDGLTDEARVDYQNLSAAAYMGEYKTCLVYADQLKQRCVEKFKDGCLGMEQLAAVDGL  492

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C LV+KA+G  D V TY+VNLS+FTSIPDFW   QLFPIVPIHRLD+RP  RG+LSDLTC
Sbjct  493   CALVAKAVGELDSVRTYHVNLSIFTSIPDFWGIDQLFPIVPIHRLDQRPTVRGVLSDLTC  552

Query  1220  DSDGKIDKFVGGESSLPLHEL-------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPS  1062
             DSDGKIDKF+GGESSLPLHEL       GG GGRYYLGMFLGGAYEEALGG HNLFGGPS
Sbjct  553   DSDGKIDKFIGGESSLPLHELEGNGSLSGGGGGRYYLGMFLGGAYEEALGGVHNLFGGPS  612

Query  1061  VVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMaf  882
             V+RV QSDGPHSF+VTR  PGPSC DVLRVMQHEPELMFETLKHRAEEF  ++D+GG   
Sbjct  613   VIRVMQSDGPHSFAVTRTVPGPSCGDVLRVMQHEPELMFETLKHRAEEFGQEDDDGG---  669

Query  881   aslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
               +A+SLA SF NMPYL   S+CC                 +  N   DS  G+ E W+Y
Sbjct  670   EGIANSLAMSFRNMPYLASASSCC---------------SETDYNGAVDSGAGDAEQWTY  714

Query  701   CIA  693
             C A
Sbjct  715   CYA  717



>gb|AAP36992.2| arginine decarboxylase [Cucumis sativus]
Length=717

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/723 (72%), Positives = 602/723 (83%), Gaps = 34/723 (5%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAV-----PPTASVDHSHWSPSMSAALYRIDGWGD  2661
             GY FA D SLP+  +++ S  P  T        PPT+  ++  WSP +S++LY+IDGWG 
Sbjct  17    GYVFAGDSSLPS--SVLFSGGPPETTIFSSPDSPPTS--ENMSWSPPLSSSLYKIDGWGA  72

Query  2660  PYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKN  2481
             PYF+VN SG+++VRP+G+ATL HQ+IDLLK+VKKASDP   GGLGLQLPLIVRFPDVLKN
Sbjct  73    PYFSVNGSGNMAVRPYGTATLPHQKIDLLKIVKKASDPICSGGLGLQLPLIVRFPDVLKN  132

Query  2480  RLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELL  2301
             RLESLQSAF++A++SQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELL
Sbjct  133   RLESLQSAFDYAIQSQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELL  192

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+ DA L+CNGFKDAEYISLAL ARKL LNTVIV+EQEEE+DL+ID+S+++ 
Sbjct  193   LAMSCLCKGNSDAFLVCNGFKDAEYISLALIARKLALNTVIVIEQEEEIDLVIDLSKRLF  252

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPV+G+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL++++M+DCLQLLHFHIG
Sbjct  253   VRPVVGMRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLEQADMLDCLQLLHFHIG  312

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALLADGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS+DSE+SV Y L+
Sbjct  313   SQIPSTALLADGVGEAAQIYCELVRLGANMRVIDIGGGLGIDYDGSKSSDSELSVAYGLE  372

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV AVR VCD + V HP+ICSESGRAIVS HS+LIFEAVS+SS ++  + +  LQ
Sbjct  373   EYAAAVVDAVRCVCDCRSVKHPIICSESGRAIVSRHSVLIFEAVSASSYEVPSMSSLELQ  432

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               V+ L D+AR DYQNLSAAA  GEY TC++YADQLKQRCV++FK+G L +EQLAAVDG+
Sbjct  433   YLVDGLTDEARVDYQNLSAAAYMGEYKTCLVYADQLKQRCVEKFKDGCLGMEQLAAVDGL  492

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C LV+KA+G  D V TY+VNLS+FTSIPDFW   QLFPIVPIHRLD+RP  RG+LSDLTC
Sbjct  493   CALVAKAVGELDSVRTYHVNLSIFTSIPDFWGIDQLFPIVPIHRLDQRPTVRGVLSDLTC  552

Query  1220  DSDGKIDKFVGGESSLPLHEL-------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPS  1062
             DSDGKIDKF+GGESSLPLHEL       GG GGRYYLGMFLGGAYEEALGG HNLFGGPS
Sbjct  553   DSDGKIDKFIGGESSLPLHELEGNGSLSGGGGGRYYLGMFLGGAYEEALGGVHNLFGGPS  612

Query  1061  VVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMaf  882
             V+RV QSDGPHSF+VTR  PGPSC DVLRVMQHEPELMFETLKHRAEEF  ++D+GG   
Sbjct  613   VIRVMQSDGPHSFAVTRTVPGPSCGDVLRVMQHEPELMFETLKHRAEEFGQEDDDGG---  669

Query  881   aslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
               +A+SLA SF NMPYL   S+CC                 +  N   DS  G+ E W+Y
Sbjct  670   EGIANSLAMSFRNMPYLASASSCC---------------SETDYNGAVDSGAGDAEQWTY  714

Query  701   CIA  693
             C A
Sbjct  715   CYA  717



>ref|XP_011037225.1| PREDICTED: arginine decarboxylase [Populus euphratica]
Length=731

 Score =   946 bits (2446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/721 (74%), Positives = 605/721 (84%), Gaps = 23/721 (3%)
 Frame = -3

Query  2825  GYAF-AWDRSLPAPEALVSSDAPLPTNAVPPTASVDHS---HWSPSMSAALYRIDGWGDP  2658
             GYAF A D SLP P    S   PL T +    A+   +   HWSPS+SAALY+IDGWG P
Sbjct  16    GYAFPAGDSSLPFP-VPCSPGVPLSTTSTHTAAAASENSSAHWSPSLSAALYKIDGWGAP  74

Query  2657  YFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNR  2478
             YF+VNSSG++S RP+G+ TL HQEIDLLK+VKK SDPK +GGLGLQLP+IVR PDVLKNR
Sbjct  75    YFSVNSSGNVSARPYGTDTLPHQEIDLLKIVKKVSDPKWIGGLGLQLPVIVRLPDVLKNR  134

Query  2477  LESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLL  2298
             LESLQSAF+FA++SQ Y +HYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLL
Sbjct  135   LESLQSAFDFAIQSQVYEAHYQGVYPVKCNQDRFVVEDIVRFGSRFRFGLEAGSKPELLL  194

Query  2297  AMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAV  2118
             AMSCLCKG+P+ALLICNGFKD EYISLAL ARKL LNTVIVLEQEEE+DL+I++S+KM+V
Sbjct  195   AMSCLCKGNPEALLICNGFKDGEYISLALIARKLALNTVIVLEQEEEIDLVIELSKKMSV  254

Query  2117  RPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGS  1938
             RPV+G+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL+++ M+DC QLLHFHIGS
Sbjct  255   RPVVGVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLEQAGMLDCFQLLHFHIGS  314

Query  1937  QIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQE  1758
             QIPST+LLADGV EAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV Y L E
Sbjct  315   QIPSTSLLADGVSEAAQIYCELVRLGARMQVIDIGGGLGIDYDGSKSGNSDLSVAYGLDE  374

Query  1757  YASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQS  1578
             YA AVVQAV+FVCDRK V HPVICSESGRAIVSHHSILIFEA+SSSS     + +  +Q 
Sbjct  375   YALAVVQAVKFVCDRKNVKHPVICSESGRAIVSHHSILIFEAISSSSTSAASMTSYEMQY  434

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
             ++  L +DA ADY+NL+A+AIRGE++ C+LYADQLKQ CVDQFKEG + +EQLAAVD +C
Sbjct  435   YLGGLTEDALADYRNLTASAIRGEHEACLLYADQLKQSCVDQFKEGIIGMEQLAAVDALC  494

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             +L  K I A DPV TY+VNLS+FTSIPDFW  GQLFPIVPIHRLD+RPGARGILSDLTCD
Sbjct  495   ELFYKTICASDPVRTYHVNLSLFTSIPDFWGIGQLFPIVPIHRLDQRPGARGILSDLTCD  554

Query  1217  SDGKIDKFVGGESSLPLHEL-----GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVR  1053
             SDGKIDKF+GGESSLPLHE+     GGNGG+YYLGMFLGGAYEEALGG HNLFGGPSVVR
Sbjct  555   SDGKIDKFIGGESSLPLHEIEGGGAGGNGGKYYLGMFLGGAYEEALGGIHNLFGGPSVVR  614

Query  1052  VSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGM-----  888
             VSQSDGPHSF VT+A PGPSC DVLRVMQHEPELMFETLKHR EE+ H +++        
Sbjct  615   VSQSDGPHSFLVTQAVPGPSCGDVLRVMQHEPELMFETLKHRVEEYCHHDEDSDDGDSDH  674

Query  887   ---afaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGED  717
                + ASLA+SLA+ FHNMPYLV  + C +TA     SG+YY N+    N  AD+S  ED
Sbjct  675   GMGSIASLANSLASYFHNMPYLV--APCSVTAMNN--SGFYYCNE-DDYNAAADTSRCED  729

Query  716   E  714
             E
Sbjct  730   E  730



>ref|XP_010516630.1| PREDICTED: arginine decarboxylase 1-like [Camelina sativa]
Length=708

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/712 (72%), Positives = 587/712 (82%), Gaps = 26/712 (4%)
 Frame = -3

Query  2783  ALVSSDAPLPTNAV----------PPTASVDHS-HWSPSMSAALYRIDGWGDPYFTVNSS  2637
             +L   D P+ T +V             A VD S HWSPS+S++LYRIDGWG PYF+ N+S
Sbjct  3     SLACVDTPIDTFSVDCSGVFVPSSTTAAVVDGSCHWSPSLSSSLYRIDGWGAPYFSANTS  62

Query  2636  GDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSA  2457
             G+ISVRPHGS TL HQ+IDL+KVVKK +DPK  GGLGLQLPLIVRFPDVLKNRLE LQSA
Sbjct  63    GNISVRPHGSNTLPHQDIDLMKVVKKVTDPKTSGGLGLQLPLIVRFPDVLKNRLECLQSA  122

Query  2456  FNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCK  2277
             F++AV++QGYGSHYQGVYPVKCNQDRFV+EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCK
Sbjct  123   FDYAVQTQGYGSHYQGVYPVKCNQDRFVIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCK  182

Query  2276  GSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLR  2097
             G+PDA L+CNGFKD+EY+SLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLR
Sbjct  183   GNPDAFLVCNGFKDSEYVSLALFGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLR  242

Query  2096  AKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTAL  1917
             AKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV++L++  M+DCLQLLHFHIGSQIPSTAL
Sbjct  243   AKLRTKHSGHFGSTSGEKGKFGLTTIQIIRVVQRLRQVGMLDCLQLLHFHIGSQIPSTAL  302

Query  1916  LADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQ  1737
             L+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA+AVV 
Sbjct  303   LSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAAAVVA  362

Query  1736  AVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKD  1557
             +VRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVS+S  K  + P   +Q  +E   +
Sbjct  363   SVRFVCDRKSVKHPVICSESGRAIVSHHSVLIFEAVSAS--KQHETPTD-VQFMLEGNSE  419

Query  1556  DARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAI  1377
             + R DY+NL  AA+RG+ ++C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+C+ V KAI
Sbjct  420   EVRNDYENLYGAAMRGDRESCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGLCEWVIKAI  479

Query  1376  GAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDK  1197
             GA DPV +Y+VNLSVFTSIPDFW   QLFPIVPIHRLD+RP ARGILSDLTCDSDGKI+K
Sbjct  480   GASDPVLSYHVNLSVFTSIPDFWGIDQLFPIVPIHRLDQRPVARGILSDLTCDSDGKINK  539

Query  1196  FVGGESSLPLHEL---GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHS  1026
             F+GGESSLPLHEL   G +GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH 
Sbjct  540   FIGGESSLPLHELEKNGCSGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHG  599

Query  1025  FSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNG---GMafaslasslan  855
             F+VTRA  G S ADVLR MQHEPELMF+TLKHRAEE  ++   G   G      A+ LA 
Sbjct  600   FAVTRAVMGQSSADVLRAMQHEPELMFQTLKHRAEEQRNNNKAGSDKGNDKLVAATCLAR  659

Query  854   sFHNMPYLVV-GSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
             SF+NMPYL +  ST  LTAA     G YY ++ +A         G+DE WSY
Sbjct  660   SFNNMPYLSMETSTDALTAAIN-NLGVYYQDEAAAGG----DGKGKDEKWSY  706



>ref|XP_010489221.1| PREDICTED: arginine decarboxylase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010489222.1| PREDICTED: arginine decarboxylase 1-like isoform X2 [Camelina 
sativa]
Length=709

 Score =   946 bits (2444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/694 (73%), Positives = 580/694 (84%), Gaps = 17/694 (2%)
 Frame = -3

Query  2759  LPTNAVPPTASVDHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEI  2583
             LP++A    A VD S HWSPS+S++LYRIDGWG PYF+ N+SG+ISVRPHGS TL HQ+I
Sbjct  23    LPSSAT--AAVVDGSCHWSPSLSSSLYRIDGWGAPYFSANTSGNISVRPHGSNTLPHQDI  80

Query  2582  DLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVY  2403
             DL+KVVKK +DPK  GGLGLQLPLIVRFPDVLKNRLE LQSAF++AV++QGYGSHYQGVY
Sbjct  81    DLMKVVKKVTDPKTSGGLGLQLPLIVRFPDVLKNRLECLQSAFDYAVQTQGYGSHYQGVY  140

Query  2402  PVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYI  2223
             PVKCNQDRFV+EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+ DA L+CNGFKD+EY+
Sbjct  141   PVKCNQDRFVIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNTDAFLVCNGFKDSEYV  200

Query  2222  SLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEK  2043
             SLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGSTSGEK
Sbjct  201   SLALFGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEK  260

Query  2042  GKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRL  1863
             GKFGLTT QI+RVV++L++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YCELVRL
Sbjct  261   GKFGLTTIQIVRVVQRLRQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYCELVRL  320

Query  1862  GACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICS  1683
             GA MKVIDIGGGLGIDYDGSKS +S++SV YTL EYA+AVV +VRFVCD+K V HPVICS
Sbjct  321   GAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLDEYAAAVVASVRFVCDQKSVKHPVICS  380

Query  1682  ESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEY  1503
             ESGRAIVSHHS+LIFEAVS+S  K  + P   +Q  +E   ++ R DY+NL  AA+RG++
Sbjct  381   ESGRAIVSHHSVLIFEAVSAS--KQHETPTD-VQFMLEGYSEEVRNDYENLYGAAMRGDH  437

Query  1502  DTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTS  1323
             ++C+LY DQLKQRCV +FKEGSLSIEQLA VDG+C+ V KAIGA DPV +Y+VNLSVFTS
Sbjct  438   ESCLLYVDQLKQRCVKRFKEGSLSIEQLAGVDGLCEWVIKAIGASDPVLSYHVNLSVFTS  497

Query  1322  IPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGN--  1149
             IPDFW   QLFPIVPIHRLD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHEL  N  
Sbjct  498   IPDFWGIDQLFPIVPIHRLDQRPVARGILSDLTCDSDGKINKFIGGESSLPLHELENNGC  557

Query  1148  -GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRV  972
              GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTRA  G S ADVLR 
Sbjct  558   SGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVMGQSSADVLRA  617

Query  971   MQHEPELMFETLKHRAEEFLHDE----DNGGMafaslasslansFHNMPYLVVGSTCCLT  804
             MQHEPELMF+TLKHRAEE  ++     DN G      A+ LA SF+NMPYL + ++    
Sbjct  618   MQHEPELMFQTLKHRAEEQRNNNKAGSDNKGNDKLVAATCLARSFNNMPYLSMETSTDAL  677

Query  803   AATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
              A     G YY ++ +A         G+DE WSY
Sbjct  678   IAAINNLGVYYQDEAAAGG----DGKGKDEKWSY  707



>ref|XP_002513004.1| arginine decarboxylase, putative [Ricinus communis]
 gb|EEF49507.1| arginine decarboxylase, putative [Ricinus communis]
Length=724

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/684 (76%), Positives = 592/684 (87%), Gaps = 18/684 (3%)
 Frame = -3

Query  2714  HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplg  2535
             +WSPS+SAALY++DGWG PYF+VNSSG+ISV P+G+ TL HQEIDL+K+VKK SDPK LG
Sbjct  49    NWSPSLSAALYKLDGWGAPYFSVNSSGNISVHPYGAETLPHQEIDLMKIVKKVSDPKSLG  108

Query  2534  glglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVK  2355
             GLGLQLPLIVR PD+LKNRLESLQSAFNFA++SQGY SHYQGVYPVKCNQDRFVVEDIV+
Sbjct  109   GLGLQLPLIVRLPDILKNRLESLQSAFNFAIQSQGYDSHYQGVYPVKCNQDRFVVEDIVR  168

Query  2354  FGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIV  2175
             FGS FRFGLEAGSKPELLLAMSCLCKGSPDALL+CNGFKD EYISLAL ARKL LNTVIV
Sbjct  169   FGSPFRFGLEAGSKPELLLAMSCLCKGSPDALLVCNGFKDGEYISLALLARKLALNTVIV  228

Query  2174  LEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKK  1995
             LEQEEE+DL+I +S+KM+VRPVIG+RAKLRT+H+GHFGSTSGEKGKFGLTT QILRVVKK
Sbjct  229   LEQEEELDLVIGLSKKMSVRPVIGVRAKLRTRHSGHFGSTSGEKGKFGLTTIQILRVVKK  288

Query  1994  LQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgid  1815
             L+E+ M+DCLQLLHFHIGSQIPST+LLADGVGEAAQIYCELVRLGA M+VIDIGGGLGID
Sbjct  289   LEEAGMLDCLQLLHFHIGSQIPSTSLLADGVGEAAQIYCELVRLGANMQVIDIGGGLGID  348

Query  1814  ydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFE  1635
             YDGSKS +S++SV Y L+EYA AVVQAV+FVCDRK + HPVI SESGRAIVSHHS+LIFE
Sbjct  349   YDGSKSGNSDLSVAYGLEEYALAVVQAVKFVCDRKNIKHPVIASESGRAIVSHHSVLIFE  408

Query  1634  --AVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRC  1461
               + S  S     + + G Q  +E L ++A +DY+NL+AAA+RGEYDTC+LYADQLKQRC
Sbjct  409   AVSSSVVSSAAASMTSAGFQYLMEGLAEEAISDYRNLTAAAVRGEYDTCLLYADQLKQRC  468

Query  1460  VDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIV  1281
             VDQFKEGS+ +EQLAAVDG+C+LV KAIG  +P  TY+VNLSVFTSIPDFW   QLFPIV
Sbjct  469   VDQFKEGSIGMEQLAAVDGLCELVGKAIGLSEPTRTYHVNLSVFTSIPDFWGIDQLFPIV  528

Query  1280  PIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL-GGNGGRYYLGMFLGGAYE  1104
             PIHRLDERP  RGILSDLTCDSDGKIDKF+GGESSLPLHE+ GG G RYYLGMFLGGAYE
Sbjct  529   PIHRLDERPLVRGILSDLTCDSDGKIDKFIGGESSLPLHEIEGGGGRRYYLGMFLGGAYE  588

Query  1103  EALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRA  924
             EALGG HNLFGGPSVVRVSQSDGP SF+VTRA PGPSC+DVLRVMQHEPELMF+TLKHRA
Sbjct  589   EALGGVHNLFGGPSVVRVSQSDGPQSFAVTRAVPGPSCSDVLRVMQHEPELMFQTLKHRA  648

Query  923   EEFLHDEDNG-------GMafaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGN  765
             EEF H +++        G+   +LASSLA SFHNMPYL V ++C LTA      G+YY N
Sbjct  649   EEFCHHDEDSDDGESDHGIGNGALASSLAQSFHNMPYL-VATSCSLTALNN--GGFYYCN  705

Query  764   DVSAANPIADSSPGEDEHWSYCIA  693
             + +      DS+ GE+E WSYC A
Sbjct  706   EDA-----TDSAAGEEEQWSYCCA  724



>gb|AES89273.2| arginine decarboxylase [Medicago truncatula]
Length=730

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/683 (73%), Positives = 580/683 (85%), Gaps = 7/683 (1%)
 Frame = -3

Query  2726  VDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDp  2547
             V  ++WSPS+SA L+++DGWG PYF VN++GDISVRPHGSAT+SHQEIDLLKVVKKASDP
Sbjct  50    VSDTNWSPSLSAKLFKVDGWGFPYFGVNTAGDISVRPHGSATMSHQEIDLLKVVKKASDP  109

Query  2546  kplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVE  2367
             K  GGLGLQLPL+VRFPDVLK+RLESL +AF  A++  GY +HYQGVYPVKCNQDRFVVE
Sbjct  110   KCCGGLGLQLPLLVRFPDVLKDRLESLHAAFVGAIQLHGYENHYQGVYPVKCNQDRFVVE  169

Query  2366  DIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLN  2187
             DIV+FGS FRFGLEAGSKPELLLAMSCLCKG+ +A LICNGFKD+EYISLAL ARKL LN
Sbjct  170   DIVEFGSQFRFGLEAGSKPELLLAMSCLCKGNREAFLICNGFKDSEYISLALIARKLALN  229

Query  2186  TVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILR  2007
             +VIVLEQEEE+D++++IS K+ +RPVIG+RAKLRTKH+GHFGSTSG+KGKFGLTT QILR
Sbjct  230   SVIVLEQEEELDMVVEISNKLCIRPVIGVRAKLRTKHSGHFGSTSGDKGKFGLTTIQILR  289

Query  2006  VVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggg  1827
             VVKKL++ +M+DCLQLLHFHIGSQIP+T LLADGVGEAAQIYCEL+RLGA M+V+ IGGG
Sbjct  290   VVKKLEQLDMLDCLQLLHFHIGSQIPTTELLADGVGEAAQIYCELLRLGAQMRVLYIGGG  349

Query  1826  lgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSI  1647
             LGIDYDGSKS+DS++SV Y L+EYA+AVV AV++VCDR+ V HPVICSESGRAIVSHHS+
Sbjct  350   LGIDYDGSKSSDSDLSVAYGLEEYAAAVVHAVKYVCDRRNVKHPVICSESGRAIVSHHSV  409

Query  1646  LIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQ  1467
             LIFEA+ +SS     L + GLQ   E L ++A ADYQN+SAA + G+++ C+LY DQ K+
Sbjct  410   LIFEAIGASSKSAPSLSSIGLQYLGEGLSEEALADYQNISAATLHGDHEACLLYTDQFKK  469

Query  1466  RCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFP  1287
              CV+QFK+G+L IEQLAAVDG+CDL+++ IG  D V  Y++NLSVFTSIPDFW+  QLFP
Sbjct  470   HCVEQFKQGTLGIEQLAAVDGLCDLITETIGVKDQVRKYHMNLSVFTSIPDFWSIDQLFP  529

Query  1286  IVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAY  1107
             I+PIHRLDE+P ARGILSDLTCDSDGKIDKF+GGESSLPLHEL G+GG YYLGMFLGGAY
Sbjct  530   IIPIHRLDEKPTARGILSDLTCDSDGKIDKFIGGESSLPLHELEGHGGGYYLGMFLGGAY  589

Query  1106  EEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHR  927
             EEALGG HNLFGGPSVVRV QSDGPH F+VTRA  GPS ADVLRVMQHEP+LMFETLKHR
Sbjct  590   EEALGGLHNLFGGPSVVRVLQSDGPHGFAVTRAVAGPSSADVLRVMQHEPQLMFETLKHR  649

Query  926   AEEFL--HDEDNGGMafaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSA  753
             A EF   HD+D+  +  A LA+ LA SF NMPYLV  S CCL A T    G+YY +    
Sbjct  650   ALEFCGQHDDDS-VVGAAGLANCLARSFDNMPYLVSSSACCLNAVTN-NDGFYYCSGDDF  707

Query  752   ANPIADSS---PGEDEHWSYCIA  693
             +   A ++    GEDEHWSYC A
Sbjct  708   SADSASAATSVAGEDEHWSYCCA  730



>ref|NP_195197.1| arginine decarboxylase 2 [Arabidopsis thaliana]
 ref|NP_974684.1| arginine decarboxylase 2 [Arabidopsis thaliana]
 sp|O23141.1|SPE2_ARATH RecName: Full=Arginine decarboxylase 2; Short=ADC 2; Short=ARGDC 
2; AltName: Full=ADC-N [Arabidopsis thaliana]
 gb|AAB72179.1| arginine decarboxylase [Arabidopsis thaliana]
 emb|CAA18850.1| arginine decarboxylase SPE2 [Arabidopsis thaliana]
 emb|CAB80188.1| arginine decarboxylase SPE2 [Arabidopsis thaliana]
 gb|AAK62636.1| AT4g34710/T4L20_290 [Arabidopsis thaliana]
 gb|AAM16243.1| AT4g34710/T4L20_290 [Arabidopsis thaliana]
 gb|AEE86413.1| arginine decarboxylase 2 [Arabidopsis thaliana]
 gb|AEE86414.1| arginine decarboxylase 2 [Arabidopsis thaliana]
Length=711

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/687 (73%), Positives = 577/687 (84%), Gaps = 16/687 (2%)
 Frame = -3

Query  2777  VSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATL  2598
              + D  +P ++ P +A+V    WSPS+S++LYRIDGWG PYF  NSSG+ISVRPHGS TL
Sbjct  21    TAGDVFIPASS-PTSAAVVVDRWSPSLSSSLYRIDGWGAPYFIANSSGNISVRPHGSETL  79

Query  2597  SHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSH  2418
              HQ+IDLLK+VKK + PK  GGLGLQLPLIVRFPDVLKNRLE LQSAF++A++SQGY SH
Sbjct  80    PHQDIDLLKIVKKVTGPKSSGGLGLQLPLIVRFPDVLKNRLECLQSAFDYAIKSQGYDSH  139

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKGSPDA L+CNGFK
Sbjct  140   YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFK  199

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  200   DAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVRPVIGLRAKLRTKHSGHFGS  259

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV+KL++S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  260   TSGEKGKFGLTTTQIVRVVRKLRQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  319

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VR VCDR  V H
Sbjct  320   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRVVCDRSSVKH  379

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q   PG   F+    ++ARA+Y++L AA 
Sbjct  380   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQ-ATPGDIQFLLEGNEEARANYEDLYAAV  438

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  439   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  498

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL  1158
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF+GGESSLPLHEL
Sbjct  499   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKFIGGESSLPLHEL  558

Query  1157  --GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCAD  984
                G+GGRY+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PG S AD
Sbjct  559   DKNGSGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSAD  618

Query  983   VLRVMQHEPELMFETLKHRAEEFLHDE---------DNGGMafaslasslansFHNMPYL  831
             VLR MQHEPELMF+TLKHRAEE +H +         +     F ++A+SL  SFHNMPYL
Sbjct  619   VLRAMQHEPELMFQTLKHRAEEMMHTKGGSEGENEEEEEDDEFNNVAASLDRSFHNMPYL  678

Query  830   VV---GSTCCLTAATTPGSGYYYGNDV  759
                    +  L+AA +    YY   DV
Sbjct  679   ATEQASPSNSLSAAISNLGFYYCDEDV  705



>emb|CAA65585.1| arginine decarboxylase [Vitis vinifera]
Length=630

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/640 (78%), Positives = 563/640 (88%), Gaps = 16/640 (3%)
 Frame = -3

Query  2594  HQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHY  2415
             HQEIDL+K+VKK SDPK  GGLGLQLPLIVR PDVL+NRLESLQSAF+FA++SQGY SHY
Sbjct  1     HQEIDLMKIVKKVSDPKSAGGLGLQLPLIVRLPDVLQNRLESLQSAFDFAIQSQGYESHY  60

Query  2414  QGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKD  2235
             QGV+PVKCNQDRF+VED+VKFGS+FRFGLEAGSKPELLLAMSCLCKG+P+ALL+CNGFKD
Sbjct  61    QGVFPVKCNQDRFIVEDVVKFGSAFRFGLEAGSKPELLLAMSCLCKGNPEALLVCNGFKD  120

Query  2234  AEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGST  2055
             A+YI+LAL ARKL LNTVIVLEQEEE+DL+I++S+K++VRPVIG+RAKLRTKHAGHFGST
Sbjct  121   ADYIALALVARKLALNTVIVLEQEEELDLVINLSQKLSVRPVIGVRAKLRTKHAGHFGST  180

Query  2054  SGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCE  1875
             SGEKGKFGLTTTQILRVV+KL+++ M+D LQLLHFHIGSQIPST LLADGV EAAQIYCE
Sbjct  181   SGEKGKFGLTTTQILRVVRKLEQAGMLDSLQLLHFHIGSQIPSTDLLADGVSEAAQIYCE  240

Query  1874  LVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHP  1695
             LVRLGA M+VIDIGGGLGIDYDGSKS++S++SVGY L+EYA AVV+AV+ VCDRK V HP
Sbjct  241   LVRLGAHMRVIDIGGGLGIDYDGSKSSESDISVGYGLEEYAMAVVRAVQHVCDRKSVKHP  300

Query  1694  VICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAI  1515
             VICSESGRA+VSHHSILIFEAVS+S        +  LQ FVE L ++AR DYQNL+AAA+
Sbjct  301   VICSESGRALVSHHSILIFEAVSASVHD-SPATSLSLQRFVEGLSEEARVDYQNLAAAAV  359

Query  1514  RGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLS  1335
              GEY+TC+ +ADQLKQRCVDQFKEGSL IEQLA VDG+CDLVSK +GA DPV TY+VNLS
Sbjct  360   SGEYETCLRFADQLKQRCVDQFKEGSLGIEQLADVDGLCDLVSKEVGATDPVRTYHVNLS  419

Query  1334  VFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELG  1155
             VFT IPDFW  GQLFPIVPIHRLD+RPGARGILSDLTCDSDGKIDKF+GGESSLPLHEL 
Sbjct  420   VFTCIPDFWGIGQLFPIVPIHRLDQRPGARGILSDLTCDSDGKIDKFIGGESSLPLHELE  479

Query  1154  GN------GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPS  993
             G+       G+YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PGPS
Sbjct  480   GSDVVFGGSGKYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPS  539

Query  992   CADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansFHNMPYLVVGSTC  813
             C DVLRVMQHEPELMFETLKHRAEE  H++   GM   SLAS LA SFH MPYLV GS+C
Sbjct  540   CGDVLRVMQHEPELMFETLKHRAEECGHED---GMTNGSLASGLALSFHKMPYLVAGSSC  596

Query  812   CLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             C+T      SGYYYGN+ + +  +ADS+ G+D+HWSYC A
Sbjct  597   CMT-----NSGYYYGNEDNYSR-VADSAAGDDDHWSYCFA  630



>ref|XP_010467377.1| PREDICTED: arginine decarboxylase 1 [Camelina sativa]
Length=708

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/684 (73%), Positives = 576/684 (84%), Gaps = 14/684 (2%)
 Frame = -3

Query  2732  ASVDHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKA  2556
             A VD S HWSP++S++LYRIDGWG PYF+ N+SG+ISVRPHGS TL HQ+IDL+KVVKK 
Sbjct  30    AVVDGSCHWSPTLSSSLYRIDGWGAPYFSANTSGNISVRPHGSNTLPHQDIDLMKVVKKV  89

Query  2555  SDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRF  2376
             +DPK  GGLGLQLPLIVRFPDVLKNRLE LQSAF++AV++QGYGSHYQGVYPVKCNQDRF
Sbjct  90    TDPKTSGGLGLQLPLIVRFPDVLKNRLECLQSAFDYAVQTQGYGSHYQGVYPVKCNQDRF  149

Query  2375  VVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKL  2196
             V+EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFKD+EY+SLAL  RKL
Sbjct  150   VIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFKDSEYVSLALFGRKL  209

Query  2195  LLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQ  2016
              LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT Q
Sbjct  210   ELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQ  269

Query  2015  ILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidi  1836
             I+RVV++L++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YCELVRLGA MKVIDI
Sbjct  270   IVRVVQRLRQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYCELVRLGAHMKVIDI  329

Query  1835  ggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSH  1656
             GGGLGIDYDGSKS +S++SV YTL+EYA+AVV +VRFVCD+K V HPVICSESGRAIVSH
Sbjct  330   GGGLGIDYDGSKSGESDLSVAYTLEEYAAAVVASVRFVCDKKSVKHPVICSESGRAIVSH  389

Query  1655  HSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQ  1476
             HS+LIFEAVS+S  K  + P   +Q  +E   ++ R DY+NL  AA+RG++++C+LY DQ
Sbjct  390   HSVLIFEAVSAS--KQHETPTD-VQFMLEGYSEEVRNDYENLYGAAMRGDHESCLLYVDQ  446

Query  1475  LKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQ  1296
             LKQRCV+ FKEGSLSIEQLA VDG+C+ V KAIGA DPV +Y+VNLSVFTSIPDFW   Q
Sbjct  447   LKQRCVEGFKEGSLSIEQLAGVDGLCEWVIKAIGASDPVLSYHVNLSVFTSIPDFWGIDQ  506

Query  1295  LFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGN---GGRYYLGM  1125
             LFPIVPIH+LD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHEL  N   GG+YYLGM
Sbjct  507   LFPIVPIHKLDQRPVARGILSDLTCDSDGKINKFIGGESSLPLHELDNNGCSGGKYYLGM  566

Query  1124  FLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMF  945
             FLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTRA  G S ADVLR MQHEPELMF
Sbjct  567   FLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVMGQSSADVLRAMQHEPELMF  626

Query  944   ETLKHRAEEFLHDEDNG---GMafaslasslansFHNMPYLVVGSTCCLTAATTPGSGYY  774
             +TLKHRAEE  ++   G   G      A+ LA SF+NMPYL + ++     A     G Y
Sbjct  627   QTLKHRAEEQRNNNKAGSDKGNDKLVAATCLARSFNNMPYLSMETSTDALTAAIDNLGVY  686

Query  773   YGNDVSAANPIADSSPGEDEHWSY  702
             Y ++ +A         G+DE W+Y
Sbjct  687   YQDEAAAGG----DGKGKDEKWAY  706



>gb|AEQ02349.1| arginine decarboxylase, partial [Erythroxylum coca]
Length=678

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/681 (76%), Positives = 579/681 (85%), Gaps = 22/681 (3%)
 Frame = -3

Query  2678  IDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRF  2499
             +DGWG PYF+VN SG+++VRPHGS TL HQEIDLLKVVKKASDPK  GGLGLQLPLIVRF
Sbjct  1     MDGWGAPYFSVNCSGNVTVRPHGSRTLVHQEIDLLKVVKKASDPKFSGGLGLQLPLIVRF  60

Query  2498  PDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAG  2319
             PDVLKNRLE LQ+AF+FAV+SQGY +HYQGVYPVKCNQDR+VVEDIVKFGS FRFGLEAG
Sbjct  61    PDVLKNRLECLQTAFDFAVQSQGYETHYQGVYPVKCNQDRYVVEDIVKFGSPFRFGLEAG  120

Query  2318  SKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIID  2139
             SKPELLLAMSCLCKGSP+ALL+CNGFKD+EYISLAL ARKL LNTVIVLEQEEE+DL++ 
Sbjct  121   SKPELLLAMSCLCKGSPEALLVCNGFKDSEYISLALLARKLALNTVIVLEQEEELDLVLG  180

Query  2138  ISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQL  1959
             ++ KM+VRPVIG+RAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL++S M+DCLQL
Sbjct  181   LANKMSVRPVIGVRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLEQSSMLDCLQL  240

Query  1958  LHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVS  1779
             LHFHIGSQIP+TALLADGVGEAAQIYCELVRLGA M+V D+GGGLGIDYDGS+S DS++S
Sbjct  241   LHFHIGSQIPTTALLADGVGEAAQIYCELVRLGANMQVFDVGGGLGIDYDGSRSGDSDLS  300

Query  1778  VGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQL  1599
             V Y L+EYA AVVQAV+FVCDRK V HPV+CSESGRA+VSHHSILIFEAVS+S      +
Sbjct  301   VAYGLEEYALAVVQAVKFVCDRKNVKHPVLCSESGRAVVSHHSILIFEAVSASLSSAGAV  360

Query  1598  PNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQL  1419
                GLQ  V+ L +DA +DY+NL++AAIRGEYDTC LYADQLKQRCV++FKEGS+ +EQL
Sbjct  361   TPFGLQYLVDGLSEDAHSDYRNLTSAAIRGEYDTCFLYADQLKQRCVEKFKEGSIGMEQL  420

Query  1418  AAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGI  1239
             AAVD +C+ VS AIGA + V TY+VNLSVFTSIPDFW  GQLFPIVPIHRLD+RPG RGI
Sbjct  421   AAVDALCEFVSNAIGAAESVRTYHVNLSVFTSIPDFWGIGQLFPIVPIHRLDQRPGVRGI  480

Query  1238  LSDLTCDSDGKIDKFVGGESSLPLHEL----GGNGGRYYLGMFLGGAYEEALGGFHNLFG  1071
             LSDLTCDSDGKIDKF+GGESSLPLHE+    GGNGGRYYLGMFLGGAYEEALGG HNLFG
Sbjct  481   LSDLTCDSDGKIDKFIGGESSLPLHEIEGGGGGNGGRYYLGMFLGGAYEEALGGVHNLFG  540

Query  1070  GPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL-----HD  906
             GPSVVRVSQSDGPHSF+VT A PGPSC+DVLRVMQHEPELMFETLKHRAEE        D
Sbjct  541   GPSVVRVSQSDGPHSFAVTSAVPGPSCSDVLRVMQHEPELMFETLKHRAEEICPQEVESD  600

Query  905   EDN------GGMafaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANP  744
             +DN       G+  A+LASSLA SFHNMPYLV     C  +A   G  Y+   D   +N 
Sbjct  601   DDNISSGGGRGLGNAALASSLAQSFHNMPYLVAS---CSFSALNAGGCYFLNEDEFNSNT  657

Query  743   IADSSP----GEDEHWSYCIA  693
                S P     +DE WSYC A
Sbjct  658   ETASGPAAAAADDEQWSYCCA  678



>ref|XP_010548847.1| PREDICTED: arginine decarboxylase 2-like [Tarenaya hassleriana]
Length=740

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/639 (75%), Positives = 554/639 (87%), Gaps = 8/639 (1%)
 Frame = -3

Query  2807  DRSLPAPEALVSSDAPLPTNAV------PPTASVDHS-HWSPSMSAALYRIDGWGDPYFT  2649
             D ++  P    S D+ LPT  V      P  A+V  S HWSPS+SA+LYRIDGWG PYFT
Sbjct  8     DAAVAPPGYAFSGDSSLPTGGVFFPAITPAAAAVGGSPHWSPSLSASLYRIDGWGAPYFT  67

Query  2648  VNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLES  2469
             VNSSG+ISVRPHGS TLSHQEIDLLK+VKK +D K LGGLGLQLPL++RFPDVLKNRLE 
Sbjct  68    VNSSGNISVRPHGSDTLSHQEIDLLKIVKKVTDAKSLGGLGLQLPLVMRFPDVLKNRLEC  127

Query  2468  LQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMS  2289
             LQSAF+FA+ SQGY SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMS
Sbjct  128   LQSAFDFAIRSQGYESHYQGVYPVKCNQDRFVVEDIVEFGSPFRFGLEAGSKPEILLAMS  187

Query  2288  CLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPV  2109
             CLCKG+PDA L+CNGFKDAEYI+LAL  RKL LNTVIVLEQEEE+DL+ID+S+ M VRPV
Sbjct  188   CLCKGNPDAFLVCNGFKDAEYITLALLGRKLALNTVIVLEQEEELDLVIDLSKNMNVRPV  247

Query  2108  IGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIP  1929
             IG+RAKLRTKH+GHFGSTSGEKGKFGLTTTQ++RVV+KL+++ M+DCLQLLHFHIGSQIP
Sbjct  248   IGIRAKLRTKHSGHFGSTSGEKGKFGLTTTQVVRVVRKLEQAGMLDCLQLLHFHIGSQIP  307

Query  1928  STALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYAS  1749
             ST+LL+DGV EAAQ+YCELVRLGA M++IDIGGGLGIDYDGSKS +S++SV Y+++EYA+
Sbjct  308   STSLLSDGVAEAAQLYCELVRLGAHMRIIDIGGGLGIDYDGSKSGESDLSVSYSIEEYAA  367

Query  1748  AVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVE  1569
             AVV AVRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVSS+      +    LQ  ++
Sbjct  368   AVVTAVRFVCDRKSVKHPVICSESGRAIVSHHSVLIFEAVSSTGPVKHGVDQTDLQFMLD  427

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
                ++AR+DYQNL +AAI G+Y++C+LY D+LKQRCV+ FK+GSLSIEQLAAVDG+C+LV
Sbjct  428   GHWEEARSDYQNLYSAAIHGDYESCLLYVDKLKQRCVEGFKDGSLSIEQLAAVDGLCELV  487

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
              K IG  D + TYNVNLSVFTSIPDFW   QLFPIVPI +LD+RPG RGILSDLTCDSDG
Sbjct  488   LKDIGGSDSIRTYNVNLSVFTSIPDFWGIEQLFPIVPIQKLDQRPGTRGILSDLTCDSDG  547

Query  1208  KIDKFVGGESSLPLHELGGN-GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
              ++KF+GGESSLPLHEL  N GGRYYLGMFLGGAYEEALGG HNLFGGPS+VRVSQSDGP
Sbjct  548   IVNKFIGGESSLPLHELDNNGGGRYYLGMFLGGAYEEALGGVHNLFGGPSMVRVSQSDGP  607

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEF  915
             H F+VTRA PG SC DVLR MQHEPELMF+TL+HRA+EF
Sbjct  608   HGFAVTRAMPGQSCVDVLRAMQHEPELMFQTLEHRADEF  646



>gb|AAN31828.1| putative arginine decarboxylase SPE2 [Arabidopsis thaliana]
Length=711

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/687 (73%), Positives = 576/687 (84%), Gaps = 16/687 (2%)
 Frame = -3

Query  2777  VSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATL  2598
              + D  +P ++ P +A+V    WSPS+S++LYRIDGWG PYF  NSSG+ISVRPHGS TL
Sbjct  21    TAGDVFIPASS-PTSAAVVVDRWSPSLSSSLYRIDGWGAPYFIANSSGNISVRPHGSETL  79

Query  2597  SHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSH  2418
              HQ+IDLLK+VKK + PK  GGLGLQLPLIVRFPDVLKNRLE LQSAF++A++SQGY SH
Sbjct  80    PHQDIDLLKIVKKVTGPKSSGGLGLQLPLIVRFPDVLKNRLECLQSAFDYAIKSQGYDSH  139

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKGSPDA L+CNGFK
Sbjct  140   YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFK  199

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  200   DAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVRPVIGLRAKLRTKHSGHFGS  259

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV+KL++S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  260   TSGEKGKFGLTTTQIVRVVRKLRQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  319

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA A V +VR VCDR  V H
Sbjct  320   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAFVASVRVVCDRSSVKH  379

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q   PG   F+    ++ARA+Y++L AA 
Sbjct  380   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQ-ATPGDIQFLLEGNEEARANYEDLYAAV  438

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ +KEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  439   MRGDHESCLLYVDQLKQRCVEGYKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  498

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL  1158
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF+GGESSLPLHEL
Sbjct  499   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKFIGGESSLPLHEL  558

Query  1157  --GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCAD  984
                G+GGRY+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PG S AD
Sbjct  559   DKNGSGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSAD  618

Query  983   VLRVMQHEPELMFETLKHRAEEFLHDE---------DNGGMafaslasslansFHNMPYL  831
             VLR MQHEPELMF+TLKHRAEE +H +         +     F ++A+SL  SFHNMPYL
Sbjct  619   VLRAMQHEPELMFQTLKHRAEEMMHTKGGSEGENEEEEEDDEFNNVAASLDRSFHNMPYL  678

Query  830   VV---GSTCCLTAATTPGSGYYYGNDV  759
                    +  L+AA +    YY   DV
Sbjct  679   ATEQASPSNSLSAAISNLGFYYCDEDV  705



>dbj|BAA25685.1| arginine decarboxylase [Nicotiana sylvestris]
Length=621

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/606 (82%), Positives = 540/606 (89%), Gaps = 9/606 (1%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY+F WD SLPAPE   S    +P +     A+   +HWSP+ S+ALY IDGWG PYFTV
Sbjct  17    GYSFLWDSSLPAPEIFPSG---VPPSTNTAVATTTTTHWSPAHSSALYSIDGWGAPYFTV  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSGDISV+PHG+ TL HQEIDLLKVVKKASDPK LGGLGLQ PL+VRFPD+LKNRLESL
Sbjct  74    NSSGDISVKPHGTDTLPHQEIDLLKVVKKASDPKNLGGLGLQFPLVVRFPDILKNRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QS F++AV+SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  134   QSVFDYAVQSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKGS + LL+CNGFKDAEYISLAL ARKL+LNTVIVLEQEEE+DL+IDIS+KMAVRPVI
Sbjct  194   LCKGSHEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISKKMAVRPVI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVVKKL+ES M+DCLQLLHFHIGSQIPS
Sbjct  254   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPS  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCELVRLGA MK ID GGGLGIDYDG+KS DS+ SVGY LQEYAS 
Sbjct  314   TALLADGVGEAAQIYCELVRLGAGMKYIDCGGGLGIDYDGTKSCDSDCSVGYGLQEYAST  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEAVSS++ +  +L +  LQSFVE 
Sbjct  374   VVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVDLQSFVEK  433

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L DDARADY+NLSAAAIRGEYDTCVLYADQLKQRCV+QFK+G L IEQLAAVDGICD VS
Sbjct  434   LNDDARADYRNLSAAAIRGEYDTCVLYADQLKQRCVEQFKDGDLDIEQLAAVDGICDFVS  493

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA DPV TY+VNLS+FTS+PDFWA  QLFPIVPIH+LDERP  RGILSDLTCDSDGK
Sbjct  494   KAIGASDPVRTYHVNLSIFTSVPDFWAIDQLFPIVPIHKLDERPVVRGILSDLTCDSDGK  553

Query  1205  IDKFVGGESSLPLHEL------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQ  1044
             IDKF+GGESSLPLHEL      GG+GG+YYLGMFLGGAYEEALGG HNLFGGPSV+RVSQ
Sbjct  554   IDKFIGGESSLPLHELGSNGGGGGDGGKYYLGMFLGGAYEEALGGLHNLFGGPSVLRVSQ  613

Query  1043  SDGPHS  1026
             SD PH+
Sbjct  614   SDSPHT  619



>ref|XP_002867107.1| hypothetical protein ARALYDRAFT_491183 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43366.1| hypothetical protein ARALYDRAFT_491183 [Arabidopsis lyrata subsp. 
lyrata]
Length=707

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/684 (72%), Positives = 565/684 (83%), Gaps = 14/684 (2%)
 Frame = -3

Query  2774  SSDAPLPTNAVPPTASVDHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATL  2598
             + D  +P++     A VD S  WS S+S++LYRIDGWG PYF  NSSG+ISVRPHGS TL
Sbjct  17    AGDVFIPSSPTSAAAVVDSSCRWSTSLSSSLYRIDGWGAPYFIANSSGNISVRPHGSETL  76

Query  2597  SHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSH  2418
              HQ+IDLLK+VKK +DPK  GGLGLQLPLIVRFPDVLKNRLE LQSAF+FA++SQGY SH
Sbjct  77    PHQDIDLLKIVKKVTDPKSSGGLGLQLPLIVRFPDVLKNRLECLQSAFDFAIKSQGYDSH  136

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  137   YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  196

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  197   DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  256

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  257   TSGEKGKFGLTTTQIVRVLRKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  316

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VRFVCDR+ V H
Sbjct  317   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRFVCDRRSVKH  376

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q  +E   ++ARA+Y++L AA 
Sbjct  377   PVICSESGRAIVSHHSVLIFEAVSAVKPMVHQATPEDIQFLLEG-NEEARANYEDLYAAV  435

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG+ ++C++Y DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  436   MRGDQESCLIYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  495

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL  1158
             SVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTCDSDGKIDKF+GGESSLPLHEL
Sbjct  496   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGVRGILSDLTCDSDGKIDKFIGGESSLPLHEL  555

Query  1157  GGN-GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADV  981
               N GG Y+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PG S ADV
Sbjct  556   DNNGGGGYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSADV  615

Query  980   LRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla---------nsFHNMPYLV  828
             LR MQHEPELMF+TLKHRAEE +H +             +           SFHNMPYL 
Sbjct  616   LRAMQHEPELMFQTLKHRAEEMMHTKGGSEGENEEEEEDVEFNNVAACLDRSFHNMPYLA  675

Query  827   V--GSTCCLTAATTPGSGYYYGND  762
                 S     +A     G+YY ++
Sbjct  676   TEQASPSNSLSAAISNLGFYYCDE  699



>ref|XP_006297087.1| hypothetical protein CARUB_v10013090mg [Capsella rubella]
 gb|EOA29985.1| hypothetical protein CARUB_v10013090mg [Capsella rubella]
Length=703

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/706 (71%), Positives = 580/706 (82%), Gaps = 19/706 (3%)
 Frame = -3

Query  2783  ALVSSDAPLPT-----NAVPPTASVDHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISV  2622
             AL   D P+ T     +AV   +S+D S HWSPS+S++LYRI+GWG PYF  NSSG+ISV
Sbjct  3     ALAFVDTPIDTFSGDCSAVFVPSSIDGSCHWSPSLSSSLYRIEGWGAPYFAANSSGNISV  62

Query  2621  RPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAV  2442
             RPHGS TL HQ+IDL+KVVKK +DPK  GGLGLQLPLIVRFPDVLKNRL+ LQSAF++A+
Sbjct  63    RPHGSNTLPHQDIDLMKVVKKVTDPKISGGLGLQLPLIVRFPDVLKNRLQCLQSAFDYAI  122

Query  2441  ESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDA  2262
             ++QGYGSHYQGVYPVKCNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+ +A
Sbjct  123   QTQGYGSHYQGVYPVKCNQDRFIIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNTEA  182

Query  2261  LLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRT  2082
              L+CNGFKD+EYISLAL  RKL LNTVIVLEQEEE+DL+ID+SRKM VRPVIGLRAKLRT
Sbjct  183   FLVCNGFKDSEYISLALFGRKLELNTVIVLEQEEELDLVIDLSRKMNVRPVIGLRAKLRT  242

Query  2081  KHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGV  1902
             KH+GHFGSTSGEKGKFGLTT QI+RVV+KL+E  M+DCLQLLHFHIGSQIPSTALL+DGV
Sbjct  243   KHSGHFGSTSGEKGKFGLTTIQIVRVVRKLREVGMLDCLQLLHFHIGSQIPSTALLSDGV  302

Query  1901  GEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFV  1722
              EAAQ+YCEL+RLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV +VRFV
Sbjct  303   AEAAQLYCELIRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFV  362

Query  1721  CDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARAD  1542
             CD+K V HPVICSESGRAIVSHHS+LIFEAVS+   K  + P   +Q  +E   ++ R D
Sbjct  363   CDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAG--KQHETPTD-VQFMLEGYSEEVRND  419

Query  1541  YQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDP  1362
             Y+NL  AA+RG+ ++C+LY DQLKQRCV+ FKEGSL IEQLA VDG+C+ V KAIGA DP
Sbjct  420   YENLYGAAMRGDRESCLLYVDQLKQRCVEGFKEGSLGIEQLAGVDGLCESVIKAIGAADP  479

Query  1361  VCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGE  1182
             V TYNVNLSVFTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGKI+KF+GGE
Sbjct  480   VLTYNVNLSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTCDSDGKINKFIGGE  539

Query  1181  SSLPLHELGGN---GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTR  1011
             SSLPLHEL  N   G RYYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTR
Sbjct  540   SSLPLHELDNNGCSGDRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTR  599

Query  1010  AAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDED---NGGMafaslasslansFHNM  840
             A  G S ADVLR MQHEPELMF+TLKHRAEE +++     + G      AS LA SF+NM
Sbjct  600   AVMGQSSADVLRAMQHEPELMFQTLKHRAEEQMNNNKACGDIGKEKLVAASCLARSFNNM  659

Query  839   PYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
             PYL + ++     A     G YY ++     P      GEDE WSY
Sbjct  660   PYLSMETSADALTAAINNLGVYYRDEA----PAGGGGKGEDEKWSY  701



>gb|AAL09792.1| AT4g34710/T4L20_290 [Arabidopsis thaliana]
Length=711

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/687 (73%), Positives = 575/687 (84%), Gaps = 16/687 (2%)
 Frame = -3

Query  2777  VSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATL  2598
              + D  +P ++ P +A+V    WSPS+S++LYRI GWG PYF  NSSG+ISVRPHGS TL
Sbjct  21    TAGDVFIPASS-PTSAAVVVDRWSPSLSSSLYRIYGWGAPYFIANSSGNISVRPHGSETL  79

Query  2597  SHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSH  2418
              HQ+IDLLK+VKK + PK  GGLGLQLPLIVRFPDVLKNRLE LQSAF++A++SQGY SH
Sbjct  80    PHQDIDLLKIVKKVTGPKSSGGLGLQLPLIVRFPDVLKNRLECLQSAFDYAIKSQGYDSH  139

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKC QDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKGSPDA L+CNGFK
Sbjct  140   YQGVYPVKCXQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFK  199

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  200   DAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVRPVIGLRAKLRTKHSGHFGS  259

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV+KL++S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  260   TSGEKGKFGLTTTQIVRVVRKLRQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  319

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VR VCDR  V H
Sbjct  320   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRVVCDRSSVKH  379

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q   PG   F+    ++ARA+Y++L AA 
Sbjct  380   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQ-ATPGDIQFLLEGNEEARANYEDLYAAV  438

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  439   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  498

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL  1158
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF+GGESSLPLHEL
Sbjct  499   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKFIGGESSLPLHEL  558

Query  1157  --GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCAD  984
                G+GGRY+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PG S AD
Sbjct  559   DKNGSGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSAD  618

Query  983   VLRVMQHEPELMFETLKHRAEEFLHDE---------DNGGMafaslasslansFHNMPYL  831
             VLR MQHEPELMF+TLKHRAEE +H +         +     F ++A+SL  SFHNMPYL
Sbjct  619   VLRAMQHEPELMFQTLKHRAEEMMHTKGGSEGENEEEEEDDEFNNVAASLDRSFHNMPYL  678

Query  830   VV---GSTCCLTAATTPGSGYYYGNDV  759
                    +  L+AA +    YY   DV
Sbjct  679   ATEQASPSNSLSAAISNLGFYYCDEDV  705



>ref|XP_010530808.1| PREDICTED: arginine decarboxylase 2-like [Tarenaya hassleriana]
Length=712

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/715 (70%), Positives = 580/715 (81%), Gaps = 21/715 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAF+ D S P          PL + A    A+    HWSPS+S++LYRIDGWG PYFT+
Sbjct  15    GYAFSGDNSHPTG----GVSFPLSSPAAAAVATDGSCHWSPSLSSSLYRIDGWGAPYFTI  70

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSG+ISVRPHGS TL HQEIDLLK+VKK +DPK  GGLGLQLPL+VRFPDVLKNRLE L
Sbjct  71    NSSGNISVRPHGSETLPHQEIDLLKIVKKVTDPKSSGGLGLQLPLVVRFPDVLKNRLECL  130

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+FA+ SQ Y SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSC
Sbjct  131   QSAFDFAILSQSYESHYQGVYPVKCNQDRFVVEDIVEFGSPFRFGLEAGSKPEILLAMSC  190

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+P+A L+CNGFKD+EYISLAL   KL LNTVIVLEQEEE+DL+ID S KM VRPVI
Sbjct  191   LCKGNPEAFLVCNGFKDSEYISLALLGLKLGLNTVIVLEQEEELDLVIDRSAKMNVRPVI  250

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFGSTSGEKGKFGLTTT+I+RVV+KL++  M+DCLQLLHFHIGSQIP+
Sbjct  251   GIRAKLRTKHSGHFGSTSGEKGKFGLTTTEIVRVVRKLEQVGMLDCLQLLHFHIGSQIPT  310

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALL+DGV EAAQ++CELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+EYA+A
Sbjct  311   TALLSDGVAEAAQLFCELVRLGAHMRVIDIGGGLGIDYDGSKSGESDLSVSYSLEEYATA  370

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV  VRFVCDR+ V HPVICSESGRAIVSHHS+L+FEAVS++      +    LQ  ++ 
Sbjct  371   VVATVRFVCDRRSVKHPVICSESGRAIVSHHSVLVFEAVSATGSVGHAVEQTDLQFLLDG  430

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
               ++AR DYQNL +AA+ GEY++C+LY DQLKQRCV+ FK+G +SIEQLAAVDG+C+ VS
Sbjct  431   HLEEARTDYQNLYSAAVSGEYESCLLYVDQLKQRCVEGFKDGLVSIEQLAAVDGLCEWVS  490

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             K IG  DPV TY+VNLSVFTSIPDFW   QLFPIVPIH+LD+RPG RGILSDLTCDSDGK
Sbjct  491   KEIGESDPVGTYHVNLSVFTSIPDFWGIEQLFPIVPIHKLDQRPGTRGILSDLTCDSDGK  550

Query  1205  IDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHS  1026
             I+KF+GG+SSLPLHEL  NGG YYLGMFLGGAYEEALGG HNLFGGPSVVRV+QSDGPHS
Sbjct  551   INKFIGGDSSLPLHELDNNGGGYYLGMFLGGAYEEALGGVHNLFGGPSVVRVTQSDGPHS  610

Query  1025  FSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansFH  846
             F+VTRA PG SCADVLR +QHEPELMF+TLKHRA+EF    ++ G      A+ L   F 
Sbjct  611   FAVTRAVPGQSCADVLRTVQHEPELMFQTLKHRADEF--GNNDCGDDDNVAAALLGRCFE  668

Query  845   NMPYL----VVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             NMPYL    V+ +TC LTAA     G+ Y           D     DE+WS C A
Sbjct  669   NMPYLVTENVLATTCSLTAAIN-NLGFCY----------CDCDEDVDENWSDCGA  712



>ref|XP_010432382.1| PREDICTED: arginine decarboxylase 2 [Camelina sativa]
Length=716

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/682 (72%), Positives = 561/682 (82%), Gaps = 15/682 (2%)
 Frame = -3

Query  2756  PTNAVPPTASVDHSHWSPSMSAA-LYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEID  2580
             PT+A    + VD S    S  ++ LYRIDGWG PYF  NSSG+ISVRPHGS TL HQ++D
Sbjct  29    PTSATAAASVVDSSCRWSSSLSSSLYRIDGWGAPYFVANSSGNISVRPHGSETLPHQDVD  88

Query  2579  LLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYP  2400
             LLK+VKK +DPK  GGLGLQLPLIVRFPDVLKNRLE LQSAF+FA++SQGYGSHYQGV+P
Sbjct  89    LLKIVKKVTDPKSSGGLGLQLPLIVRFPDVLKNRLECLQSAFDFAIQSQGYGSHYQGVFP  148

Query  2399  VKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYIS  2220
             VKCNQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFKDAEY+S
Sbjct  149   VKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFKDAEYVS  208

Query  2219  LALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKG  2040
             LAL  RKL LNTVIVLEQEEE+DLII++S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKG
Sbjct  209   LALLGRKLALNTVIVLEQEEELDLIIELSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKG  268

Query  2039  KFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLG  1860
             KFGLTTTQI+RVV+KL ES M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YCELVRLG
Sbjct  269   KFGLTTTQIVRVVRKLSESGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYCELVRLG  328

Query  1859  ACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSE  1680
             A MKV DIGGGLGIDYDGSKS DS++SV YTL+EYA AVV +VRFVCDR+ V HPVICSE
Sbjct  329   AHMKVFDIGGGLGIDYDGSKSGDSDLSVAYTLEEYAEAVVASVRFVCDRRSVKHPVICSE  388

Query  1679  SGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYD  1500
             SGRAIVSHHS+LIFEAVS +   +     P    F+    ++ARA+Y++L AA +RG+ +
Sbjct  389   SGRAIVSHHSVLIFEAVSVAKPTVHHQATPNDIQFLLEGDEEARANYEDLYAAVMRGDRE  448

Query  1499  TCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSI  1320
             +C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NLSVFTSI
Sbjct  449   SCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINLSVFTSI  508

Query  1319  PDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL--GGNG  1146
             PD W   QLFPIVPIH+LD+RPGARGI SDLTCDSDGKI+KF+GGE+SLPLHEL   G+G
Sbjct  509   PDLWGIDQLFPIVPIHKLDQRPGARGIFSDLTCDSDGKINKFIGGETSLPLHELDSNGSG  568

Query  1145  GRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQ  966
             GRY+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PG S ADVLRVMQ
Sbjct  569   GRYFLGMFLGGAYEEALGGLHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSADVLRVMQ  628

Query  965   HEPELMFETLKHRAEEFLHDEDNGGMafaslasslan----------sFHNMPYLVV--G  822
             +EPELMF+TLKHRAEE +H + +                        SFHNMPYL     
Sbjct  629   YEPELMFQTLKHRAEEMMHTKSSSDEEEEEEEEEDTEFNNVAACLDRSFHNMPYLATEQA  688

Query  821   STCCLTAATTPGSGYYYGNDVS  756
             S     +A     G+YY ++ S
Sbjct  689   SPSNSLSAAINNLGFYYCDEDS  710



>ref|XP_010437573.1| PREDICTED: arginine decarboxylase 2-like [Camelina sativa]
Length=716

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/703 (70%), Positives = 569/703 (81%), Gaps = 16/703 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAF+   +  A +  + + +P        +       WS S+S++LYRIDGWG PYF  
Sbjct  11    GYAFS---NTTAADVFIPASSPTSVATTAASVVDSSCRWSSSLSSSLYRIDGWGAPYFAA  67

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSG+ISVRPHGS TL HQ++DLLK+VKK +DPK  GGLGLQLPLIVRFPDVLKNRLE L
Sbjct  68    NSSGNISVRPHGSETLPHQDVDLLKIVKKVTDPKSSGGLGLQLPLIVRFPDVLKNRLECL  127

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+FA++SQGYGSHYQGVYPVKCNQDRFVVED+VKFGSSFRFGLEAGSKPE+LLAMSC
Sbjct  128   QSAFDFAIQSQGYGSHYQGVYPVKCNQDRFVVEDVVKFGSSFRFGLEAGSKPEILLAMSC  187

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+PDA L+CNGFKDAEY+SLAL  RKL LN VIVLEQEEE+DL+I++S+KM VRPVI
Sbjct  188   LCKGNPDAFLVCNGFKDAEYVSLALLGRKLALNAVIVLEQEEELDLVIELSQKMNVRPVI  247

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV+KL ES M+DCLQLLHFHIGSQIPS
Sbjct  248   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLSESGMLDCLQLLHFHIGSQIPS  307

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T+LL+DGV EAAQ+YCELVRLGA MKV DIGGGLGIDYDGSKS DS++SV YTL+EYA A
Sbjct  308   TSLLSDGVAEAAQLYCELVRLGANMKVFDIGGGLGIDYDGSKSGDSDLSVAYTLEEYAEA  367

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEA+S +   L     P    F+  
Sbjct  368   VVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEALSVAKPTLHHQATPNDIQFLLE  427

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
               ++ARA+Y++L AA +RG+ ++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V 
Sbjct  428   GDEEARANYEDLYAAVLRGDRESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVL  487

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIGA D V TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARGI SDLTCDSDGK
Sbjct  488   KAIGASDAVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGIFSDLTCDSDGK  547

Query  1205  IDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
             I+KF+GGE+SLPLHEL   G+GGRY+LGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP
Sbjct  548   INKFIGGETSLPLHELDNNGSGGRYFLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  607

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla--  858
             HSF+VTRA PG S ADVLRVMQHEPELMF+TLKHRAEE +H + +               
Sbjct  608   HSFAVTRAVPGQSSADVLRVMQHEPELMFQTLKHRAEEMMHTKSSSDEDEEEEEDDTELN  667

Query  857   -------nsFHNMPYLVV--GSTCCLTAATTPGSGYYYGNDVS  756
                     SFHNMPYL     S     +A     G+YY ++ S
Sbjct  668   DVAACLDRSFHNMPYLATEQASPSNSLSAAINNLGFYYCDEDS  710



>ref|XP_007135913.1| hypothetical protein PHAVU_009G002500g [Phaseolus vulgaris]
 gb|ESW07907.1| hypothetical protein PHAVU_009G002500g [Phaseolus vulgaris]
Length=684

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/668 (75%), Positives = 567/668 (85%), Gaps = 23/668 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAFA D S PAP A   +D PLPT         + SHWSPS+SAALY +DGWG PYF V
Sbjct  15    GYAFAGDISFPAPVAF--TDVPLPTT------DDNTSHWSPSLSAALYNVDGWGGPYFAV  66

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N++G+ISVR HGSATL HQEIDLLK+VKKASDPK +GGLGLQLPLIVRFPDVLKNRLE L
Sbjct  67    NAAGNISVRSHGSATLPHQEIDLLKIVKKASDPKSIGGLGLQLPLIVRFPDVLKNRLECL  126

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF++A++S+GYGSHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSC
Sbjct  127   QSAFDYAIQSEGYGSHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSC  186

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+PDALLICNGFKDAEYISLAL A KL LNTVIVLEQEEEVDLII++S+K+ ++PVI
Sbjct  187   LCKGNPDALLICNGFKDAEYISLALVANKLALNTVIVLEQEEEVDLIIELSKKLCIKPVI  246

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFG TSGEKGKFGLTT QILRVVKKL  + M+DCLQLLHFHIGSQIPS
Sbjct  247   GLRAKLRTKHSGHFGGTSGEKGKFGLTTAQILRVVKKLDLAGMLDCLQLLHFHIGSQIPS  306

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS DS++SVGY+L+EYASA
Sbjct  307   TALLADGVGEAAQIYCELVRLGANMRVIDIGGGLGIDYDGSKSCDSDISVGYSLEEYASA  366

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV A++ VCDR+ V +PVICSESGRAIVSH SIL+FEAV +S+         G+ S   +
Sbjct  367   VVHAIQCVCDRRSVKNPVICSESGRAIVSHQSILVFEAVGTSTTV------GGVSSAFSA  420

Query  1565  --LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
               +  D   DY+ LS AA  G+Y++C+ Y ++LK+RCV+QFK+G++ +EQLAAVDG+C+L
Sbjct  421   PYVAGDLSEDYRFLSEAAFGGDYESCLAYTEELKERCVEQFKQGAVCMEQLAAVDGLCEL  480

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             V KA+GA +PV  Y+VNLSVFTSIPD W   Q+FPI+PIHRLDE+P  RGILSDLTCDSD
Sbjct  481   VRKAVGAGEPVRRYHVNLSVFTSIPDAWGIEQVFPIIPIHRLDEKPSVRGILSDLTCDSD  540

Query  1211  GKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
             GKIDKF+ GESSLPLHE+   GG YYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP
Sbjct  541   GKIDKFINGESSLPLHEV--EGGSYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  598

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslans  852
             HSF+VTRA PGPSC DVLRVMQH+PELMFETLKHRA E++   DN  +    LAS LA +
Sbjct  599   HSFAVTRAVPGPSCGDVLRVMQHQPELMFETLKHRAYEYV-SHDNAAV----LASGLART  653

Query  851   FHNMPYLV  828
             F  MPYLV
Sbjct  654   FDRMPYLV  661



>gb|AAF26434.1| arginine decarboxylase [Brassica juncea]
Length=692

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/629 (76%), Positives = 555/629 (88%), Gaps = 6/629 (1%)
 Frame = -3

Query  2783  ALVSSDAPLPTNAVPPTASV-DHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHG  2610
             ALV + A  P  + P +A+V D S  W+ S+S++LYRIDGWG PYF  N+SG+ISVRPHG
Sbjct  5     ALVDTTAFAPPPSTPTSAAVVDTSCRWNSSLSSSLYRIDGWGAPYFAANTSGNISVRPHG  64

Query  2609  SATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQG  2430
             S TL HQ+IDLLKVVKK +DPKPLGGLGLQLP+IVRFPDVLKNRLE LQSAF+ AV+SQG
Sbjct  65    SVTLPHQDIDLLKVVKKVTDPKPLGGLGLQLPVIVRFPDVLKNRLECLQSAFDLAVQSQG  124

Query  2429  YGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLIC  2250
             YGSHYQGVYPVKCNQDRF+VEDIVKFGS FRFGLEAGSKPE+LLAMSCL KG+ +A L+C
Sbjct  125   YGSHYQGVYPVKCNQDRFIVEDIVKFGSGFRFGLEAGSKPEILLAMSCLSKGNREAFLVC  184

Query  2249  NGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAG  2070
             NGFKD EYISLAL  RKL LNTVIVLEQEEE+DL+ID+SRKM VRPVIGLRAKLRTKH+G
Sbjct  185   NGFKDVEYISLALLGRKLALNTVIVLEQEEELDLVIDLSRKMNVRPVIGLRAKLRTKHSG  244

Query  2069  HFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAA  1890
             HFGSTSGEKGKFGLTT QI+RVV++L+ES M+DCLQLLHFHIGSQIPSTALL+DGVGEAA
Sbjct  245   HFGSTSGEKGKFGLTTGQIVRVVRRLRESCMLDCLQLLHFHIGSQIPSTALLSDGVGEAA  304

Query  1889  QIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRK  1710
             Q+YCELVRLGA MKVID+GGGLGIDYDGSKS +S++SVGYTL+EYA AVV +VR VCDR+
Sbjct  305   QLYCELVRLGADMKVIDVGGGLGIDYDGSKSGESDLSVGYTLEEYAEAVVASVRSVCDRR  364

Query  1709  GVSHPVICSESGRAIVSHHSILIFEAVSSSSD--KLLQLPNPGLQSFVESLKDDARADYQ  1536
              V HPVICSESGRAIVSHHS+LIFEAVS++    ++ Q+ +  +Q  +ES  ++ARA+Y+
Sbjct  365   SVKHPVICSESGRAIVSHHSVLIFEAVSAAKPMAQVDQVMHDDIQFLLES--EEARANYE  422

Query  1535  NLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVC  1356
             +L AA +RG+ ++C+LY D+LKQRCVD FK+G LSIEQLA+VDG+C+ V KAIGA DPV 
Sbjct  423   DLYAAVMRGDQESCLLYVDKLKQRCVDGFKDGVLSIEQLASVDGLCEWVLKAIGASDPVQ  482

Query  1355  TYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESS  1176
             TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARG+LSDLTCDSDGKIDKF+GGESS
Sbjct  483   TYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGVLSDLTCDSDGKIDKFIGGESS  542

Query  1175  LPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGP  996
             LPLHEL G GG+Y+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPH+F+VTRA PG 
Sbjct  543   LPLHELDGGGGKYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHTFAVTRAVPGQ  602

Query  995   SCADVLRVMQHEPELMFETLKHRAEEFLH  909
             S ADVLR +QHEPE+MF+ LKHRAE+ +H
Sbjct  603   SSADVLRAVQHEPEIMFQNLKHRAEKLMH  631



>gb|KFK40065.1| hypothetical protein AALP_AA3G325600 [Arabis alpina]
Length=704

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/679 (73%), Positives = 567/679 (84%), Gaps = 20/679 (3%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSPS+SA+LYRID WG PYFT N+SG+ISVRPHGS TL +Q+IDLL VVK  +DPK  GG
Sbjct  29    WSPSLSASLYRIDAWGAPYFTTNTSGNISVRPHGSYTLPNQDIDLLNVVKHVTDPKSTGG  88

Query  2531  lglqlpL----IVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVED  2364
             LGL L L    IVRFPDVLKNRLESLQS+F+FA+++QGY SHYQGVYPVKCNQDR+++ED
Sbjct  89    LGLGLGLGLPLIVRFPDVLKNRLESLQSSFDFAIQTQGYDSHYQGVYPVKCNQDRYIIED  148

Query  2363  IVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNT  2184
             IV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+ +A L+CNGFKDAEY+SLAL  RKL LNT
Sbjct  149   IVEFGSSFRFGLEAGSKPEILLAMSCLCKGNLEAFLVCNGFKDAEYVSLALLGRKLELNT  208

Query  2183  VIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRV  2004
             VIVLEQE+E+DL++D+S+KM ++PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RV
Sbjct  209   VIVLEQEDELDLVVDLSKKMNIKPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTVQIVRV  268

Query  2003  VKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidigggl  1824
             VKKL+E  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YCELVRLGACM VIDIGGGL
Sbjct  269   VKKLREKGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYCELVRLGACMGVIDIGGGL  328

Query  1823  gidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSIL  1644
             GIDYDGSKS +S++SV Y+L+EYA+AVV +VRFVCD+K V HPVICSESGRAIVSHHS+L
Sbjct  329   GIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFVCDQKSVKHPVICSESGRAIVSHHSVL  388

Query  1643  IFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQR  1464
             IFEAVS+   K  + P   +Q  +E   ++AR DY+NL  AA+RG+ D+C++Y DQLKQR
Sbjct  389   IFEAVSAG--KQHETPTD-IQFLLEGYSEEARGDYENLYGAAMRGDRDSCLIYVDQLKQR  445

Query  1463  CVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPI  1284
             CV+ FKEGSLSIEQLA VDG+C+ V KAIGA DPV TYNVNLSVFTSIPDFW   QLFPI
Sbjct  446   CVEGFKEGSLSIEQLAGVDGLCESVIKAIGASDPVLTYNVNLSVFTSIPDFWGIDQLFPI  505

Query  1283  VPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNG---GRYYLGMFLGG  1113
             VPIHRLD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHEL  NG   GRYYLGMFLGG
Sbjct  506   VPIHRLDQRPMARGILSDLTCDSDGKINKFIGGESSLPLHELDTNGCSNGRYYLGMFLGG  565

Query  1112  AYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLK  933
             AYEEALGG HNLFGGPSVVRV QSDGPH F VTRA  G S ADVLR MQHEPELMF+TL+
Sbjct  566   AYEEALGGVHNLFGGPSVVRVLQSDGPHGFEVTRAVMGQSSADVLRAMQHEPELMFQTLQ  625

Query  932   HRAEEFLHDEDNGGMafaslass-lansFHNMPYLVV-GSTCCLTAATTPGSGYYYGNDV  759
             HRAEE    + N  ++   LA+S LA SF+NMPYL +  ST  LTAA     G YY ++ 
Sbjct  626   HRAEELSKAQRNNKVSAEKLAASCLARSFNNMPYLSMETSTNALTAAIN-NLGVYYRDE-  683

Query  758   SAANPIADSSPGEDEHWSY  702
                   A    G+DE W+Y
Sbjct  684   ------APCDGGKDEKWAY  696



>ref|NP_179243.1| arginine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9SI64.1|SPE1_ARATH RecName: Full=Arginine decarboxylase 1; Short=ADC 1; Short=ADC-O; 
Short=ARGDC 1 [Arabidopsis thaliana]
 gb|AAD26494.1| arginine decarboxylase [Arabidopsis thaliana]
 gb|AAP40453.1| putative arginine decarboxylase [Arabidopsis thaliana]
 gb|AEC06503.1| arginine decarboxylase 1 [Arabidopsis thaliana]
Length=702

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/688 (72%), Positives = 563/688 (82%), Gaps = 22/688 (3%)
 Frame = -3

Query  2735  TASVDHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKK  2559
             TA VD S HWSPS+S++LYRIDGWG PYF  NSSG+ISVRPHGS TL HQ+IDL+KVVKK
Sbjct  25    TAVVDGSCHWSPSLSSSLYRIDGWGAPYFAANSSGNISVRPHGSNTLPHQDIDLMKVVKK  84

Query  2558  ASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDR  2379
              +DP  LG        IVRFPDVLKNRLE LQSAF++A++SQGY SHYQGVYPVKCNQDR
Sbjct  85    VTDPSGLGLQLPL---IVRFPDVLKNRLECLQSAFDYAIQSQGYDSHYQGVYPVKCNQDR  141

Query  2378  FVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARK  2199
             F++EDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFKD+EYISLAL  RK
Sbjct  142   FIIEDIVEFGSGFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFKDSEYISLALFGRK  201

Query  2198  LLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTT  2019
             L LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT 
Sbjct  202   LELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTV  261

Query  2018  QILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVid  1839
             QILRVV+KL +  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YCELVRLGA MKVID
Sbjct  262   QILRVVRKLSQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYCELVRLGAHMKVID  321

Query  1838  iggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVS  1659
             IGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV +VRFVCD+K V HPVICSESGRAIVS
Sbjct  322   IGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFVCDQKSVKHPVICSESGRAIVS  381

Query  1658  HHSILIFEAVSSSSDKLLQLPNPGLQSF-VESLKDDARADYQNLSAAAIRGEYDTCVLYA  1482
             HHS+LIFEAVS+      Q   P    F +E   ++ R DY+NL  AA+RG+ ++C+LY 
Sbjct  382   HHSVLIFEAVSAGQ----QHETPTDHQFMLEGYSEEVRGDYENLYGAAMRGDRESCLLYV  437

Query  1481  DQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAF  1302
             DQLKQRCV+ FKEGSL IEQLA VDG+C+ V KAIGA DPV TY+VNLSVFTSIPDFW  
Sbjct  438   DQLKQRCVEGFKEGSLGIEQLAGVDGLCEWVIKAIGASDPVLTYHVNLSVFTSIPDFWGI  497

Query  1301  GQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGN---GGRYYL  1131
              QLFPIVPIH+LD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHE+  N   GGRYYL
Sbjct  498   DQLFPIVPIHKLDQRPAARGILSDLTCDSDGKINKFIGGESSLPLHEMDNNGCSGGRYYL  557

Query  1130  GMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPEL  951
             GMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTRA  G S ADVLR MQHEPEL
Sbjct  558   GMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVMGQSSADVLRAMQHEPEL  617

Query  950   MFETLKHRAEEFLHDEDNG----GMafaslasslansFHNMPYLVV-GSTCCLTAATTPG  786
             MF+TLKHRAEE  ++ +      G     +AS LA SF+NMPYL +  ST  LTAA    
Sbjct  618   MFQTLKHRAEEPRNNNNKACGDKGNDKLVVASCLAKSFNNMPYLSMETSTNALTAAVN-N  676

Query  785   SGYYYGNDVSAANPIADSSPGEDEHWSY  702
              G YY ++ +A           DE+WSY
Sbjct  677   LGVYYCDEAAAGGGGKGK----DENWSY  700



>gb|AAB60880.1| arginine decarboxylase [Dianthus caryophyllus]
Length=725

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/718 (70%), Positives = 581/718 (81%), Gaps = 15/718 (2%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVN  2643
             Y  A   SLPAPE +  S  P  TN+           WSPS+SA LYRID WG PYF VN
Sbjct  15    YGGAGALSLPAPE-INFSGVPPTTNSTTVNQPPLPQQWSPSLSAELYRIDRWGPPYFAVN  73

Query  2642  SSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQ  2463
             SSG+++V+P G ATL HQEIDLLKVVKK SDPK   GLGL LP+I+RFPDVLK+RLESLQ
Sbjct  74    SSGNVTVKPFGDATLPHQEIDLLKVVKKVSDPKSSSGLGLHLPVIIRFPDVLKHRLESLQ  133

Query  2462  SAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCL  2283
             SAF+FAV + GYGSHYQGVYPVKCNQDR++VEDIV+FGS FRFGLEAGSKPELL+AMS L
Sbjct  134   SAFDFAVRTHGYGSHYQGVYPVKCNQDRYIVEDIVEFGSGFRFGLEAGSKPELLMAMSSL  193

Query  2282  CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIG  2103
             CKGSPD+LL+CNGFKDAEYISLA+  RKL LNTVIV+EQEEEVD+ I++SRKM +RPV+G
Sbjct  194   CKGSPDSLLVCNGFKDAEYISLAIIGRKLGLNTVIVIEQEEEVDMAIELSRKMGIRPVVG  253

Query  2102  LRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPST  1923
             +RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL+   M+DCLQLLHFHIGSQIP+T
Sbjct  254   VRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLESFGMLDCLQLLHFHIGSQIPTT  313

Query  1922  ALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAV  1743
             ALL+DGV EA+Q+YCEL RLGA M+VIDIGGGLGIDYDGSKS DS++SVGYTL+EYASAV
Sbjct  314   ALLSDGVAEASQVYCELTRLGAHMRVIDIGGGLGIDYDGSKSGDSDLSVGYTLEEYASAV  373

Query  1742  VQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP--GLQSFVE  1569
             V  V+ VCDRKGV  PVICSESGRAIVSHHSIL+FEAVSSSS     +P     L   V+
Sbjct  374   VGTVKSVCDRKGVKSPVICSESGRAIVSHHSILVFEAVSSSSSASPPMPGSTLALDYLVD  433

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
              L D+ + +Y++L+AAA+RGEY++C++Y+  LKQRCV+ FK+G L +EQLAAVDG+C+LV
Sbjct  434   GLTDEVKGEYRSLTAAAMRGEYESCLMYSGMLKQRCVELFKDGCLGMEQLAAVDGLCELV  493

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKA+G  D VCTYNVNLSVFTSIPDFW  GQLFPI+PIHRLD++P ARGILSDLTCDSDG
Sbjct  494   SKALGVADGVCTYNVNLSVFTSIPDFWGIGQLFPIMPIHRLDQQPKARGILSDLTCDSDG  553

Query  1208  KIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             KIDKF+G ESSLPLHEL G  G YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGP 
Sbjct  554   KIDKFIGDESSLPLHELSGGEG-YYLGMFLGGAYEEALGGVHNLFGGPSVVRVQQSDGPQ  612

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansF  849
             S++VTRA PGPS +DVLRVM HEPELMF+TLKHRAEE  +D   G +     A  LA SF
Sbjct  613   SYAVTRAVPGPSSSDVLRVMHHEPELMFQTLKHRAEECDNDYTAGPL-----ADMLAQSF  667

Query  848   HNMPYLVVG---STCCLTAATTPGSG---YYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             ++ PYLV G    +C L+  +   +G   Y+YG D        D++ GE+E WSY  A
Sbjct  668   NSTPYLVPGHATGSCGLSNGSGLVNGCREYFYGVDDGCNAAAVDAAAGEEEQWSYVCA  725



>ref|XP_002886234.1| hypothetical protein ARALYDRAFT_900320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62493.1| hypothetical protein ARALYDRAFT_900320 [Arabidopsis lyrata subsp. 
lyrata]
Length=702

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/684 (71%), Positives = 560/684 (82%), Gaps = 20/684 (3%)
 Frame = -3

Query  2783  ALVSSDAPLPTNA------VPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISV  2622
             AL   D P+ T +       P +AS     WSPS+S++LYRIDGWG PYFT N+SG ISV
Sbjct  3     ALAFVDTPIDTFSSDCSVFTPSSASAAVVDWSPSLSSSLYRIDGWGAPYFTANTSGTISV  62

Query  2621  RPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAV  2442
             RPHGS TL HQ+IDL+KVVKK +DP  LG        IVRFPDVLKNRLE LQSAF++A+
Sbjct  63    RPHGSNTLPHQDIDLMKVVKKVTDPSGLGLQLPL---IVRFPDVLKNRLECLQSAFDYAI  119

Query  2441  ESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDA  2262
             +SQGYGSHYQGVYPVKCNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+P+A
Sbjct  120   QSQGYGSHYQGVYPVKCNQDRFIIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNPEA  179

Query  2261  LLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRT  2082
              L+CNGFKD+EYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRT
Sbjct  180   FLVCNGFKDSEYISLALFGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRT  239

Query  2081  KHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGV  1902
             KH+GHFGSTSGEKGKFGLTT QI+RVV+KL +  M++CLQLLHFHIGSQIPSTALL+DGV
Sbjct  240   KHSGHFGSTSGEKGKFGLTTIQIVRVVRKLSQVGMLECLQLLHFHIGSQIPSTALLSDGV  299

Query  1901  GEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFV  1722
              EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV +VRFV
Sbjct  300   AEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFV  359

Query  1721  CDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARAD  1542
             CD+K V HPVICSESGRAIVSHHS+LIFEAVS+      + P   L+  +E   ++ R D
Sbjct  360   CDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAGQQH--ETPTD-LKFMLEGYSEEVRND  416

Query  1541  YQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDP  1362
             Y+NL  +A+RG+ ++C LY DQLKQRCV+ FKEGSLSIEQLA VDG+C+ V KAIGA DP
Sbjct  417   YENLYGSAMRGDRESCFLYVDQLKQRCVEGFKEGSLSIEQLAGVDGLCEWVIKAIGASDP  476

Query  1361  VCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGE  1182
             V TY+VNLSVFTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGKI+KF+GGE
Sbjct  477   VLTYHVNLSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTCDSDGKINKFIGGE  536

Query  1181  SSLPLHELGGN---GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTR  1011
             SSLPLHEL  N   GGRYYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTR
Sbjct  537   SSLPLHELDNNGCSGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTR  596

Query  1010  AAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNG----GMafaslasslansFHN  843
             A  G S ADVLR MQHEPELMF+TLKHRAEE  ++ +      G     +AS LA SF+N
Sbjct  597   AVMGQSSADVLRAMQHEPELMFQTLKHRAEEQRNNNNKAGGDKGNDKLVVASCLARSFNN  656

Query  842   MPYLVV-GSTCCLTAATTPGSGYY  774
             MPYL +  ST  LTAA      YY
Sbjct  657   MPYLSMETSTNALTAAINNLGVYY  680



>gb|AAB09723.1| arginine decarboxylase [Arabidopsis thaliana]
Length=702

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/688 (72%), Positives = 562/688 (82%), Gaps = 22/688 (3%)
 Frame = -3

Query  2735  TASVDHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKK  2559
             TA VD S HWSPS+S++LYRIDGWG PYF  NSSG+ISVRPHGS TL HQ+IDL+KVVKK
Sbjct  25    TAVVDGSCHWSPSLSSSLYRIDGWGAPYFAANSSGNISVRPHGSNTLPHQDIDLMKVVKK  84

Query  2558  ASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDR  2379
              +DP  LG        IVRFPDVLKNRLE LQSAF++A++SQGY SHYQGVYPVKCNQDR
Sbjct  85    VTDPSGLGLQLPL---IVRFPDVLKNRLECLQSAFDYAIQSQGYDSHYQGVYPVKCNQDR  141

Query  2378  FVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARK  2199
             F++EDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFKD+EYISLAL  RK
Sbjct  142   FIIEDIVEFGSGFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFKDSEYISLALFGRK  201

Query  2198  LLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTT  2019
             L LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT 
Sbjct  202   LELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTV  261

Query  2018  QILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVid  1839
             QILRVV+KL +  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YCELVRLGA MKVID
Sbjct  262   QILRVVRKLSQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYCELVRLGAHMKVID  321

Query  1838  iggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVS  1659
             IGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV +VRFVCD+K V HPVICSESGRAIVS
Sbjct  322   IGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFVCDQKSVKHPVICSESGRAIVS  381

Query  1658  HHSILIFEAVSSSSDKLLQLPNPGLQSF-VESLKDDARADYQNLSAAAIRGEYDTCVLYA  1482
             HHS+LIFEAVS+      Q   P    F +E   ++ R DY+NL  AA+RG+ ++C+LY 
Sbjct  382   HHSVLIFEAVSAGQ----QHETPTDHQFMLEGYSEEVRGDYENLYGAAMRGDRESCLLYV  437

Query  1481  DQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAF  1302
             DQLKQRCV+ FKEG L IEQLA VDG+C+ V KAIGA DPV TY+VNLSVFTSIPDFW  
Sbjct  438   DQLKQRCVEGFKEGFLGIEQLAGVDGLCEWVIKAIGASDPVLTYHVNLSVFTSIPDFWGI  497

Query  1301  GQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGN---GGRYYL  1131
              QLFPIVPIH+LD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHE+  N   GGRYYL
Sbjct  498   DQLFPIVPIHKLDQRPAARGILSDLTCDSDGKINKFIGGESSLPLHEMDNNGCSGGRYYL  557

Query  1130  GMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPEL  951
             GMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTRA  G S ADVLR MQHEPEL
Sbjct  558   GMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVMGQSSADVLRAMQHEPEL  617

Query  950   MFETLKHRAEEFLHDEDNG----GMafaslasslansFHNMPYLVV-GSTCCLTAATTPG  786
             MF+TLKHRAEE  ++ +      G     +AS LA SF+NMPYL +  ST  LTAA    
Sbjct  618   MFQTLKHRAEEPRNNNNKACGDKGNDKLVVASCLAKSFNNMPYLSMETSTNALTAAVN-N  676

Query  785   SGYYYGNDVSAANPIADSSPGEDEHWSY  702
              G YY ++ +A           DE+WSY
Sbjct  677   LGVYYCDEAAAGGGGKGK----DENWSY  700



>ref|XP_003522832.1| PREDICTED: arginine decarboxylase-like [Glycine max]
Length=697

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/645 (75%), Positives = 552/645 (86%), Gaps = 19/645 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVD----HSHWSPSMSAALYRIDGWGDP  2658
             GYAFA D S PAP A            VPP  + D    ++HWSPS+SAALY +DGWG P
Sbjct  15    GYAFAGDISFPAPIAF---------TGVPPATADDTNNSNNHWSPSLSAALYNVDGWGGP  65

Query  2657  YFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNR  2478
             YF VN++G+ISVRPHGS TLSHQEIDLLK+VKKASDPK LGGLGLQLPLIVRFPDVLKNR
Sbjct  66    YFAVNTAGNISVRPHGSDTLSHQEIDLLKIVKKASDPKSLGGLGLQLPLIVRFPDVLKNR  125

Query  2477  LESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLL  2298
             L+SLQSAF++A++S GY SHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLL
Sbjct  126   LDSLQSAFDYAIQSGGYESHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLL  185

Query  2297  AMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAV  2118
             AMSCLCKG+PDALLICNGFKDAEYISLAL A KL LNTVIVLEQEEEVDLI+++S+K+ +
Sbjct  186   AMSCLCKGNPDALLICNGFKDAEYISLALVANKLALNTVIVLEQEEEVDLIVELSKKLCI  245

Query  2117  RPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGS  1938
             +PVIGLRAKLRTKH+GHFG TSGEKGKFGLTT QILRVVKKL  + M+DCLQLLHFHIGS
Sbjct  246   KPVIGLRAKLRTKHSGHFGGTSGEKGKFGLTTAQILRVVKKLAHAGMLDCLQLLHFHIGS  305

Query  1937  QIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQE  1758
             QIPSTALLADGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS DS++SV Y L+E
Sbjct  306   QIPSTALLADGVGEAAQIYCELVRLGANMRVIDIGGGLGIDYDGSKSCDSDISVEYGLEE  365

Query  1757  YASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQS  1578
             YA+AVV AV+ VCDR+ V HPVICSESGRAIVSHHS+LIFEAV +SS      P P L +
Sbjct  366   YAAAVVHAVQCVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVGTSSTNGGGAP-PALSA  424

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
                 L ++   DY  LS  A RG+Y+TC++Y +++K+RCV+QFK+G++ +EQLAAV+G+C
Sbjct  425   --HYLAEELSEDYGYLSELAFRGDYETCLVYTEEMKERCVEQFKQGTVCMEQLAAVEGLC  482

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             +LV KA+GA + V  Y+VNLS+FTS+PD W   Q+FPI+PIHRL+E+P  RGILSDLTCD
Sbjct  483   ELVRKAVGAAESVRRYHVNLSIFTSVPDAWGIDQVFPIIPIHRLEEKPSVRGILSDLTCD  542

Query  1217  SDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             SDGKIDKF+ GESSL LHE+   GG YYLGMFLGGAYEEALGG HNLFGGPSV+RVSQSD
Sbjct  543   SDGKIDKFINGESSLALHEM--EGGSYYLGMFLGGAYEEALGGVHNLFGGPSVIRVSQSD  600

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL-HD  906
             GPHSF+VTRA PGPSC DVLRVMQH+PELMFETLKHRA+E++ HD
Sbjct  601   GPHSFAVTRAVPGPSCGDVLRVMQHQPELMFETLKHRAQEYVSHD  645



>ref|XP_006283215.1| hypothetical protein CARUB_v10004246mg [Capsella rubella]
 gb|EOA16113.1| hypothetical protein CARUB_v10004246mg [Capsella rubella]
Length=717

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/654 (74%), Positives = 550/654 (84%), Gaps = 12/654 (2%)
 Frame = -3

Query  2687  LYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLI  2508
             LYRIDGWG PYFT NSSG+ISVRPHGS TL HQ+IDLLK+VKK +DPK  GGLGLQLPLI
Sbjct  56    LYRIDGWGAPYFTANSSGNISVRPHGSETLPHQDIDLLKIVKKVTDPKSSGGLGLQLPLI  115

Query  2507  VRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGL  2328
             VRFPDVLKNRLE LQSAF FA++SQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGL
Sbjct  116   VRFPDVLKNRLECLQSAFEFAIQSQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGL  175

Query  2327  EAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDL  2148
             EAGSKPE+LLAMSCLCKG+PDA L+CNGFKDAEY+SLAL  RKL LNT+IVLEQEEE+DL
Sbjct  176   EAGSKPEILLAMSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLALNTMIVLEQEEELDL  235

Query  2147  IIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDC  1968
             +I++S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV KL ++ M+DC
Sbjct  236   VIELSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVSKLSQAGMLDC  295

Query  1967  LQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADS  1788
             LQLLHFHIGSQIPST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS DS
Sbjct  296   LQLLHFHIGSQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGDS  355

Query  1787  EVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKL  1608
             ++SV Y+L+EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS++    
Sbjct  356   DLSVAYSLEEYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSAAKPTG  415

Query  1607  LQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSI  1428
                  P    F+    ++ARA+Y++L AA +RG+ + C+LY DQLKQRCV+ FKEG LSI
Sbjct  416   HHQVTPNDIQFLLEGDEEARANYEDLYAAVMRGDQERCLLYVDQLKQRCVEGFKEGVLSI  475

Query  1427  EQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGA  1248
             EQLA+VDG+C+ V KAIGA D V TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG 
Sbjct  476   EQLASVDGLCEWVLKAIGASDTVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGT  535

Query  1247  RGILSDLTCDSDGKIDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLF  1074
             R ILSDLTCDSDGKI+KF+GGESSLPLHEL   G+GGRY+LGMFLGGAYEEALGG HNLF
Sbjct  536   RAILSDLTCDSDGKINKFIGGESSLPLHELDNNGSGGRYFLGMFLGGAYEEALGGVHNLF  595

Query  1073  GGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNG  894
             GGPSVVRVSQSDGPHSF+VTRA PG S ADVLR +QHEPELMF+TLKHRAEE +H + + 
Sbjct  596   GGPSVVRVSQSDGPHSFAVTRAVPGQSSADVLRAVQHEPELMFQTLKHRAEEMMHTKGSS  655

Query  893   GMaf--------aslasslansFHNMPYLVV--GSTCCLTAATTPGSGYYYGND  762
                          ++A+ L  SFHNMPYL     S     +A     G+YY ++
Sbjct  656   DEDEEEEDDDEFNNVAAYLDRSFHNMPYLATEPASPSNSLSAAINNLGFYYCDE  709



>ref|XP_010447040.1| PREDICTED: arginine decarboxylase 2 isoform X2 [Camelina sativa]
Length=737

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/711 (69%), Positives = 568/711 (80%), Gaps = 27/711 (4%)
 Frame = -3

Query  2822  YAF----AWDRSLPAPEALVSSDAPLPTNAVPPTAS--------VDHSHWSPSMSAAL-Y  2682
             YAF    A D  +PA     ++ APL T A+P ++         VD S    S  ++  Y
Sbjct  16    YAFSNTTAADVFIPASSPTSAAQAPLSTCAIPASSPTSAAAASVVDSSRRWSSSLSSSLY  75

Query  2681  RIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVR  2502
             RIDGWG PYF  N SG+ISVRPHGS TL HQ++DLLK+VKK +DPK  GGLGLQLPLIVR
Sbjct  76    RIDGWGAPYFVANPSGNISVRPHGSETLPHQDVDLLKIVKKVTDPKSSGGLGLQLPLIVR  135

Query  2501  FPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA  2322
             FPDVLKNRLE LQSAF+FA++SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA
Sbjct  136   FPDVLKNRLECLQSAFDFAIQSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA  195

Query  2321  GSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLII  2142
             GSKPE+LLAMSCLCKG+PDA L+CNGFKDAEY+SLAL  RKL LN+VIVLEQEEE+DL+I
Sbjct  196   GSKPEILLAMSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLALNSVIVLEQEEELDLVI  255

Query  2141  DISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQ  1962
             ++S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV++L ES M+DCLQ
Sbjct  256   ELSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRRLSESGMLDCLQ  315

Query  1961  LLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEV  1782
             LLHFHIGSQIPST+LL+DGV EAAQ+YCELVRLGA MKV DIGGGLGIDYDGSKS DS++
Sbjct  316   LLHFHIGSQIPSTSLLSDGVSEAAQLYCELVRLGANMKVFDIGGGLGIDYDGSKSGDSDL  375

Query  1781  SVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQ  1602
             SV YTL+EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS +   +  
Sbjct  376   SVAYTLEEYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSVAKPMVHH  435

Query  1601  LPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQ  1422
                P    F+    ++A A+Y+++ AA +RG+ ++C+LY DQLKQRCV  FKEG  SIEQ
Sbjct  436   QETPNDIQFLLEGDEEALANYEDIYAALMRGDRESCLLYVDQLKQRCVKGFKEGVFSIEQ  495

Query  1421  LAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARG  1242
             LA+VDG+C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARG
Sbjct  496   LASVDGLCEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARG  555

Query  1241  ILSDLTCDSDGKIDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLFGG  1068
             I SDLTCDSDGKI+KF+GGE+SLPLHEL   G+GGRY+LGMFLGGAYEEALGGFHNLFGG
Sbjct  556   IFSDLTCDSDGKINKFIGGETSLPLHELDNNGSGGRYFLGMFLGGAYEEALGGFHNLFGG  615

Query  1067  PSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGM  888
             PSVVRVSQSDGPHSF+VTRA PG S ADVLR+MQHEPELMF+TLKHRAEE +H + +   
Sbjct  616   PSVVRVSQSDGPHSFAVTRAVPGQSSADVLRLMQHEPELMFQTLKHRAEEMMHTKSSSDE  675

Query  887   afaslassla----------nsFHNMPYLVV--GSTCCLTAATTPGSGYYY  771
                                  SFHNMPYL     S     +A     G+YY
Sbjct  676   DEVEEEDDDNEFNDVAACLDRSFHNMPYLATEQASPSNSLSAAINNLGFYY  726



>ref|XP_010447039.1| PREDICTED: arginine decarboxylase 2 isoform X1 [Camelina sativa]
Length=737

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/711 (70%), Positives = 573/711 (81%), Gaps = 27/711 (4%)
 Frame = -3

Query  2822  YAF----AWDRSLPAPEALVSSDAPLPTNAVPPTAS--------VDHSHWSPSMSAAL-Y  2682
             YAF    A D  +PA     ++ APL T A+P ++         VD S    S  ++  Y
Sbjct  16    YAFSNTTAADVFIPASSPTSAAQAPLSTCAIPASSPTSAAAASVVDSSRRWSSSLSSSLY  75

Query  2681  RIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVR  2502
             RIDGWG PYF  N SG+ISVRPHGS TL HQ++DLLK+VKK +DPK  GGLGLQLPLIVR
Sbjct  76    RIDGWGAPYFVANPSGNISVRPHGSETLPHQDVDLLKIVKKVTDPKSSGGLGLQLPLIVR  135

Query  2501  FPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA  2322
             FPDVLKNRLE LQSAF+FA++SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA
Sbjct  136   FPDVLKNRLECLQSAFDFAIQSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA  195

Query  2321  GSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLII  2142
             GSKPE+LLAMSCLCKG+PDA L+CNGFKDAEY+SLAL  RKL LN+VIVLEQEEE+DL+I
Sbjct  196   GSKPEILLAMSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLALNSVIVLEQEEELDLVI  255

Query  2141  DISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQ  1962
             ++S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV++L ES M+DCLQ
Sbjct  256   ELSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRRLSESGMLDCLQ  315

Query  1961  LLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEV  1782
             LLHFHIGSQIPST+LL+DGV EAAQ+YCELVRLGA MKV DIGGGLGIDYDGSKS DS++
Sbjct  316   LLHFHIGSQIPSTSLLSDGVSEAAQLYCELVRLGANMKVFDIGGGLGIDYDGSKSGDSDL  375

Query  1781  SVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQ  1602
             SV YTL+EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS +   +  
Sbjct  376   SVAYTLEEYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSVAKPMVHH  435

Query  1601  LPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQ  1422
                P    F+    ++A A+Y+++ AA +RG+ ++C+LY DQLKQRCV  FKEG  SIEQ
Sbjct  436   QETPNDIQFLLEGDEEALANYEDIYAALMRGDRESCLLYVDQLKQRCVKGFKEGVFSIEQ  495

Query  1421  LAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARG  1242
             LA+VDG+C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARG
Sbjct  496   LASVDGLCEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARG  555

Query  1241  ILSDLTCDSDGKIDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLFGG  1068
             I SDLTCDSDGKI+KF+GGE+SLPLHEL   G+GGRY+LGMFLGGAYEEALGGFHNLFGG
Sbjct  556   IFSDLTCDSDGKINKFIGGETSLPLHELDNNGSGGRYFLGMFLGGAYEEALGGFHNLFGG  615

Query  1067  PSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGM  888
             PSVVRVSQSDGPHSF+VTRA PG S ADVLR+MQHEPELMF+TLKHRAEE +H + +   
Sbjct  616   PSVVRVSQSDGPHSFAVTRAVPGQSSADVLRLMQHEPELMFQTLKHRAEEMMHTKSSSDE  675

Query  887   af----------aslasslansFHNMPYLVV--GSTCCLTAATTPGSGYYY  771
                          ++A+ L  SFHNMPYL     S     +A     G+YY
Sbjct  676   DEVEEEDDDNEFNNVAACLDRSFHNMPYLATEQASPSNSLSAAINNLGFYY  726



>sp|O82475.1|SPE1_BRAJU RecName: Full=Arginine decarboxylase; Short=ADC; Short=ARGDC 
[Brassica juncea]
 gb|AAC62017.1| arginine decarboxylase [Brassica juncea]
Length=702

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/675 (73%), Positives = 559/675 (83%), Gaps = 12/675 (2%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSPS+S++LYRIDGWG PYF  NSSG+ISVRPHGS T+ HQEIDL KVVKKA+DPK  GG
Sbjct  36    WSPSLSSSLYRIDGWGAPYFAANSSGNISVRPHGSNTMPHQEIDLTKVVKKATDPKSSGG  95

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             L LQ PLIVRFPDVLKNRLESLQSAF FA+++QGY S YQGVYPVKCNQDRF++EDIV+F
Sbjct  96    LALQFPLIVRFPDVLKNRLESLQSAFEFAIQTQGYESRYQGVYPVKCNQDRFIIEDIVEF  155

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GSSFRFGLEAGSKPE+LLAMSCLCKGSP+A L+CNGFKDAEY+SLAL  RKL LNTVIVL
Sbjct  156   GSSFRFGLEAGSKPEILLAMSCLCKGSPEAFLVCNGFKDAEYVSLALLGRKLQLNTVIVL  215

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+I +S+K+ VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL
Sbjct  216   EQEEELDLVIALSKKVNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTVQIIRVVRKL  275

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             ++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDY
Sbjct  276   RDVGMLDCLQLLHFHIGSQIPSTALLSDGVSEAAQLYCELVRLGARMEVIDIGGGLGIDY  335

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DGSKS +S++SV Y+L+EYA+AVV +VRFVCD+K V HPVICSESGRAIVSHHS+LIFEA
Sbjct  336   DGSKSGESDLSVAYSLEEYAAAVVASVRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEA  395

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VS+   K  +     LQ  +E   ++AR DY+NL  A +RG+ ++C+LY DQLKQRCV++
Sbjct  396   VSAG--KRHETTPSDLQFLLEGYSEEARGDYENLYDAVMRGDRESCLLYVDQLKQRCVEE  453

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIH  1272
             FKEGSLSIEQLA VDG+C+ V+K IG  DPV TYNVNLSVF SIPDFW   QLFPIVPIH
Sbjct  454   FKEGSLSIEQLAGVDGLCEWVTKEIGGSDPVLTYNVNLSVFHSIPDFWGIDQLFPIVPIH  513

Query  1271  RLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALG  1092
             RLD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHEL  NG  YYLGMFLGGAYEEALG
Sbjct  514   RLDQRPVARGILSDLTCDSDGKINKFIGGESSLPLHELDNNG--YYLGMFLGGAYEEALG  571

Query  1091  GFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEE--  918
             G HNLFGGPSVVRV Q DGPH F+VTRA  G S ADVLR MQHEPELMF+TLKHRAEE  
Sbjct  572   GVHNLFGGPSVVRVLQKDGPHGFAVTRAMMGQSSADVLRAMQHEPELMFQTLKHRAEELS  631

Query  917   FLHDEDNGGMafaslasslansFHNMPYLVVG-STCCLTAATTPGSGYYYGNDVSAANPI  741
              +H           +AS LA SF+NMPYL VG ST  LTAA    +  YY ++ +  N  
Sbjct  632   LVHKPGGDKGNDKLVASCLARSFNNMPYLSVGTSTNALTAAIN--NLVYYSDEAAVGNGG  689

Query  740   ADSSPGEDEHWSYCI  696
                    +  WSY +
Sbjct  690   GCGK---NGKWSYSV  701



>gb|AAR08422.1| arginine decarboxylase 1 [Pringlea antiscorbutica]
Length=735

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/690 (73%), Positives = 572/690 (83%), Gaps = 22/690 (3%)
 Frame = -3

Query  2732  ASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKAS  2553
             ASVD   WSPS+SA+LYRID WG PYFT NSSG+ISVRPHGS T+ HQ+IDL+KVVKKA+
Sbjct  59    ASVD---WSPSLSASLYRIDRWGAPYFTANSSGNISVRPHGSNTMPHQDIDLMKVVKKAT  115

Query  2552  DpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFV  2373
             DPK  GGL LQLPLIVRFPDVLKNRLESLQSAF+FA+++QGY SHYQGVYPVKCNQDRF+
Sbjct  116   DPKSTGGLALQLPLIVRFPDVLKNRLESLQSAFDFAIQTQGYDSHYQGVYPVKCNQDRFI  175

Query  2372  VEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLL  2193
             +EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFKDAEY+SLAL  RKL 
Sbjct  176   IEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLE  235

Query  2192  LNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQI  2013
             LNTVIVLEQEEE++L+ID+S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI
Sbjct  236   LNTVIVLEQEEELELVIDLSKKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQI  295

Query  2012  LRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidig  1833
             +RVV+KL++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YCEL+RLGA M+VIDIG
Sbjct  296   VRVVRKLRQVGMLDCLQLLHFHIGSQIPSTALLSDGVSEAAQLYCELIRLGARMEVIDIG  355

Query  1832  gglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHH  1653
             GGLGIDYDGSKS +S++SV Y+L+EYA+AVV ++RFVCD+K V HPVICSESGRAIVSHH
Sbjct  356   GGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASIRFVCDQKSVKHPVICSESGRAIVSHH  415

Query  1652  SILIFEAVSSSSDKLLQLPNPGLQSF-VESLKDDARADYQNLSAAAIRGEYDTCVLYADQ  1476
             S+LIFEAVS+      Q   P    F +E   ++AR DY+NL  AA+RG+ ++C+LY DQ
Sbjct  416   SVLIFEAVSTGQ----QHETPSDHQFLLEGYSEEARGDYENLYGAAMRGDRESCLLYVDQ  471

Query  1475  LKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQ  1296
             +KQRCVD FKEGSLSIEQLA VDG+C+ V KAIGA DPV TYNVNLSVFTSIPDFW   Q
Sbjct  472   MKQRCVDGFKEGSLSIEQLAGVDGLCEWVIKAIGASDPVLTYNVNLSVFTSIPDFWGIDQ  531

Query  1295  LFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGN---GGRYYLGM  1125
             LFPIVPIHRLD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHEL  N   GGRYYLGM
Sbjct  532   LFPIVPIHRLDQRPVARGILSDLTCDSDGKINKFIGGESSLPLHELDNNGCSGGRYYLGM  591

Query  1124  FLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMF  945
             FLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTRA  G S ADVLR MQHEPELMF
Sbjct  592   FLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVMGQSSADVLRAMQHEPELMF  651

Query  944   ETLKHRAEEF--LHDEDNGGMafaslasslansFHNMPYLVV-GSTCCLTAATTPGSGYY  774
             +TLKHRAEE   +H            AS LA SF+NMPYL +  ST  LTAA +  + YY
Sbjct  652   QTLKHRAEELSSVHKAGGDKGNDKLAASCLARSFNNMPYLSMETSTNALTAAISNLAVYY  711

Query  773   YGNDVSAANPIADSSPGEDEHWSYCIA*VR  684
                     +  A    G+D  WS C   +R
Sbjct  712   -------RDEAAVGGGGKDGKWS-CFGGLR  733



>gb|EPS61793.1| arginine decarboxylase [Genlisea aurea]
Length=715

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/721 (70%), Positives = 580/721 (80%), Gaps = 33/721 (5%)
 Frame = -3

Query  2822  YAFA-WDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             YAFA WD SLPA  A  S D                  WS   S+ LYR+DGWG PYFTV
Sbjct  17    YAFASWDSSLPAINAAASGD------------------WSAFHSSLLYRVDGWGAPYFTV  58

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NS+G+I+VRP+G  TL+HQEIDLL+VVK+ SDPK  GGLGLQLPLI RFPDVLKNR++SL
Sbjct  59    NSNGNIAVRPYGPNTLAHQEIDLLQVVKRTSDPKISGGLGLQLPLIARFPDVLKNRMDSL  118

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QS+F++AV   GY SHYQGV+PVKCNQDRFVVEDIVKFGS +RFGLEAGSKPELLLAMSC
Sbjct  119   QSSFDYAVRCHGYESHYQGVFPVKCNQDRFVVEDIVKFGSGYRFGLEAGSKPELLLAMSC  178

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L  GSPDALL+CNGFKD EYISL+L ARKL LNTVIVLEQEEE+D +ID  RK+ VRPV+
Sbjct  179   LSGGSPDALLVCNGFKDMEYISLSLIARKLHLNTVIVLEQEEELDTLIDAHRKLGVRPVL  238

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             G+RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KLQ+ EM+DCLQLLHFHIGSQIPS
Sbjct  239   GVRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLQQCEMLDCLQLLHFHIGSQIPS  298

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TAL+ADGVGEAAQIYCELVRLGACM+VIDIGGGLGIDYDGSKS +S++SVGY+LQEYASA
Sbjct  299   TALVADGVGEAAQIYCELVRLGACMRVIDIGGGLGIDYDGSKSQNSDISVGYSLQEYASA  358

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPG-LQSFVE  1569
             VV+AV+ VC  KGV HP+ICSESGRAIVSHHSIL+FEAVS+SS    Q+ +PG LQSF++
Sbjct  359   VVEAVKLVCGGKGVKHPIICSESGRAIVSHHSILLFEAVSASSLHSRQIISPGELQSFLD  418

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
              L  ++ ADY NLSAAA+RGEYD C+LYA+QLK  CV QFKEGSL IE+LAA D +C+L+
Sbjct  419   DLTGESLADYDNLSAAALRGEYDNCLLYAEQLKLHCVQQFKEGSLGIERLAAADALCELL  478

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKAIG  DP+ TY+VNLSVFTSIPDFW  GQLFPIVPIHRLDE+P  RGI+SDLTCDSDG
Sbjct  479   SKAIGVSDPIATYHVNLSVFTSIPDFWGIGQLFPIVPIHRLDEKPSVRGIISDLTCDSDG  538

Query  1208  KIDKFVGGESSLPLHELGGNGGRYY-LGMFLGGAYEEALGGFHNLFGGPSVVRV-----S  1047
             KIDKF+GGESSLPLHEL   GG  Y LGMFLGGAYEEALGG HNLFGGPSVVRV     +
Sbjct  539   KIDKFIGGESSLPLHELAEGGGGGYCLGMFLGGAYEEALGGMHNLFGGPSVVRVAAAAAT  598

Query  1046  QSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslas  867
             Q DG   F+VT A+PG SC +VLRVMQ+EP  MF TLK R +E+  D D+ G A A LA+
Sbjct  599   QGDG---FAVTLASPGMSCGEVLRVMQYEPAAMFRTLKRRLDEYCDDGDDAGAAKAGLAN  655

Query  866   slansFHNMPYLVVGSTCCLTAATTPGSGYY---YGNDVSAANPIADSSPGEDEHWSYCI  696
              LA  F+N+PYL     C LTAA     G Y   Y +D S  +   +S   E++HWS+ +
Sbjct  656   GLARCFNNVPYLSSPELCSLTAAEAVNDGGYGHGYFSDDSLESS-GESIGSEEDHWSHIL  714

Query  695   A  693
             A
Sbjct  715   A  715



>gb|AAR08423.1| arginine decarboxylase 2 [Pringlea antiscorbutica]
Length=711

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/700 (70%), Positives = 568/700 (81%), Gaps = 23/700 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHS--HWSPSMSAALYRIDGWGDPYF  2652
             GYAF+ D  LP      ++D  +P  A P +A+V  S   W+ S+SA+LYRIDGWG PYF
Sbjct  15    GYAFSGDSPLP-----TAADVFIP--ASPTSAAVLDSSCRWNSSLSASLYRIDGWGAPYF  67

Query  2651  TVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLE  2472
               N SG+ISVRPHGS TL HQ+IDLLK+VKK +DPK  GGLGLQLPLIVRFPDVLKNRLE
Sbjct  68    VANLSGNISVRPHGSDTLPHQDIDLLKIVKKVTDPKSSGGLGLQLPLIVRFPDVLKNRLE  127

Query  2471  SLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAM  2292
              LQSAF+ A++S GY SHYQGV+PVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAM
Sbjct  128   CLQSAFDCAIQSLGYDSHYQGVFPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPEILLAM  187

Query  2291  SCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRP  2112
             SCLCKG+PDA L+CNGFKDAEY+SLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRP
Sbjct  188   SCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRP  247

Query  2111  VIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQI  1932
             VIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV+ KL ++ M+DCLQLLHFHIGSQI
Sbjct  248   VIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMGKLSQTGMLDCLQLLHFHIGSQI  307

Query  1931  PSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYA  1752
             PST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSK  +S++SV YTL+EYA
Sbjct  308   PSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKCGESDLSVAYTLEEYA  367

Query  1751  SAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFV  1572
              AVV +VR+VCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q  +
Sbjct  368   EAVVASVRYVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSAVKPMVHQAIPDDIQFLL  427

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             E   ++ARA+Y++L AA + G+++ C+LY DQLKQRCV+ FK+G LSIEQLA+VDG+C+ 
Sbjct  428   EG--EEARANYEDLYAAVMHGDHERCLLYVDQLKQRCVEGFKDGVLSIEQLASVDGLCEW  485

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             V KAIGA DPV TYN+NLSVFTSIPD W   +LFPIVPIH+LD+RPG RGILSDLTCDSD
Sbjct  486   VLKAIGASDPVQTYNINLSVFTSIPDLWGIDRLFPIVPIHKLDQRPGTRGILSDLTCDSD  545

Query  1211  GKIDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             GKIDKF+GGESSLPLHEL   G GGRY+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSD
Sbjct  546   GKIDKFIGGESSLPLHELDSNGGGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSD  605

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla  858
             GPHSF+VTRA PG S ADVLR MQHEPE+MF+TLKHRA E +H +  GG           
Sbjct  606   GPHSFAVTRAVPGQSSADVLRAMQHEPEIMFQTLKHRAAELMHTK--GGEEEEDDDEFNN  663

Query  857   nsF------HNMPYLV--VGSTCCLTAATTPGSGYYYGND  762
              +       HNMPYL     S     +A     G+YY ++
Sbjct  664   AAACLDRSFHNMPYLANEPASLSNSLSAAINNLGFYYCDE  703



>gb|AHJ38851.1| arginine decarboxylase [Gossypium hirsutum]
Length=726

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/715 (72%), Positives = 592/715 (83%), Gaps = 18/715 (3%)
 Frame = -3

Query  2795  PAPEALVSSDAPLPTNAVPPTASV------DHSHWSPSMSAALYRIDGWGDPYFTVNSSG  2634
             P   A ++ D+ LP+ AVP +AS       + +HWSP+ S+ALYRIDGWG PYF+VN++G
Sbjct  16    PGYAAFIAGDSSLPS-AVPFSASTADAADSNSTHWSPAHSSALYRIDGWGAPYFSVNNAG  74

Query  2633  DISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAF  2454
             +I+VRP+G+ TL+HQEIDLLK+VKK SDPK +GGLGLQLPLIVR PDVLKNRLESLQSAF
Sbjct  75    NITVRPYGTDTLAHQEIDLLKIVKKVSDPKSVGGLGLQLPLIVRVPDVLKNRLESLQSAF  134

Query  2453  NFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKG  2274
               A+++QGY SHYQGVYPVKCNQDRFVV+DIVKFG+ FRFGLEAGSK ELLLAMSCLCKG
Sbjct  135   ESAIQAQGYESHYQGVYPVKCNQDRFVVQDIVKFGAPFRFGLEAGSKAELLLAMSCLCKG  194

Query  2273  SPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRA  2094
             +P+ALL+CNGFKDAEYI LAL ARKL LNTVIVLE+EEEVDL+I+IS+K+ VRPVIG+RA
Sbjct  195   NPEALLVCNGFKDAEYIFLALLARKLALNTVIVLEEEEEVDLVIEISKKLYVRPVIGVRA  254

Query  2093  KLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALL  1914
             KLRTKH+GHFGSTSGEKGKFGLTT QILRVVKKLQ+S M+DCLQLLHFHIGSQIPSTALL
Sbjct  255   KLRTKHSGHFGSTSGEKGKFGLTTIQILRVVKKLQDSGMLDCLQLLHFHIGSQIPSTALL  314

Query  1913  ADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQA  1734
               GV EAAQIY EL RLGA MKVIDIGGGLGIDYDGSKS +S++SV Y LQEYASAVV A
Sbjct  315   QAGVVEAAQIYSELARLGADMKVIDIGGGLGIDYDGSKSGNSDLSVSYGLQEYASAVVNA  374

Query  1733  VRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDD  1554
             VRFVCDRK + HP+ICSESGRAIVSHHSILIFEA+S+++     +    L   +E L +D
Sbjct  375   VRFVCDRKSIKHPIICSESGRAIVSHHSILIFEAMSATAPTTPAMNQVDLPFILEGLSED  434

Query  1553  ARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIG  1374
             AR D  NLS AA+R E ++C +YADQLKQRCV+QFKEG+L IEQLAAVDG+CDLVSK + 
Sbjct  435   ARVDCWNLSQAAMRHETESCFVYADQLKQRCVEQFKEGTLGIEQLAAVDGLCDLVSKVVD  494

Query  1373  AYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             A +P  TY+VNLS+FTSIPDFW+ GQ+FPIVPIHRLDERP  RGILSDLTCDSDGKIDKF
Sbjct  495   ASEPARTYHVNLSIFTSIPDFWSIGQIFPIVPIHRLDERPEVRGILSDLTCDSDGKIDKF  554

Query  1193  VGGESSLPLHEL--------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             +GGE+SLPLH L        GG  GRYYLGMFLGGAY+E+LGG HNLFGGPSVV VSQSD
Sbjct  555   IGGETSLPLHGLEGNGGGSSGGANGRYYLGMFLGGAYQESLGGVHNLFGGPSVVSVSQSD  614

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla  858
             GP+SF+VTRAAPGPSC DVLRVMQHEPELMFETLKHRAEEF   +       A+L S++A
Sbjct  615   GPYSFAVTRAAPGPSCGDVLRVMQHEPELMFETLKHRAEEFCGQDHGNEGTHAALVSTIA  674

Query  857   nsFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
              SFHNMPYLV  S C LTA     +G+YY N+    N   DS   EDE WSYC A
Sbjct  675   RSFHNMPYLVAASPCSLTAMNN--NGFYYCNE-EDYNAAVDSGASEDEQWSYCYA  726



>ref|XP_006409427.1| hypothetical protein EUTSA_v10022578mg [Eutrema salsugineum]
 gb|ESQ50880.1| hypothetical protein EUTSA_v10022578mg [Eutrema salsugineum]
Length=716

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/666 (74%), Positives = 565/666 (85%), Gaps = 11/666 (2%)
 Frame = -3

Query  2747  AVPPTASVDHS--HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLL  2574
             A P +A+V  +  HWSPS+SA+LYRIDGWGDPYF  NSSG+ISVRPHGS TL HQ+IDL+
Sbjct  25    ASPNSAAVVDTTCHWSPSLSASLYRIDGWGDPYFAANSSGNISVRPHGSNTLPHQDIDLM  84

Query  2573  KVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVK  2394
             KVVKKA+DPK  GGL LQLPLIVRFPDVLKNRLE LQSAF+FA+++QGY SHYQGV+PVK
Sbjct  85    KVVKKATDPKSSGGLALQLPLIVRFPDVLKNRLECLQSAFDFAIQTQGYDSHYQGVFPVK  144

Query  2393  CNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLA  2214
             CNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFKD+EYISLA
Sbjct  145   CNQDRFIIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFKDSEYISLA  204

Query  2213  LAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKF  2034
             L  RKL LNTVIVLEQEEE++L+ID+S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKF
Sbjct  205   LLGRKLELNTVIVLEQEEELELVIDLSKKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKF  264

Query  2033  GLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGAC  1854
             GLTT QI+RVV+KL++  M+DCL+LLHFHIGSQIPSTALL+DGV EAAQ+YCEL RLGAC
Sbjct  265   GLTTVQIVRVVRKLRQVGMLDCLKLLHFHIGSQIPSTALLSDGVAEAAQLYCELTRLGAC  324

Query  1853  MKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESG  1674
             M+VIDIGGGLGIDYDGSKS +S++SV Y+L+EYASAVV ++RFVCD K V HPVICSESG
Sbjct  325   MEVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYASAVVSSIRFVCDSKSVKHPVICSESG  384

Query  1673  RAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTC  1494
             RAIVSHHS+LIFEAVS+      + P+  +Q  +E   ++AR DY+NL  AA+RG+ ++C
Sbjct  385   RAIVSHHSVLIFEAVSAGQQH--ETPSD-VQFLLEGYSEEARGDYENLYGAAMRGDRESC  441

Query  1493  VLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPD  1314
             +LY DQLKQRCV+ FKEG+LSIEQLA VDG+C+ V KAIGA DPV TY+VNLSVFTSIPD
Sbjct  442   LLYVDQLKQRCVEGFKEGNLSIEQLAGVDGLCEWVVKAIGASDPVLTYHVNLSVFTSIPD  501

Query  1313  FWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGN-GGRY  1137
             FW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGKI+KF+GGESSLPLHEL  N GGRY
Sbjct  502   FWGIDQLFPIVPIHKLDQRPLARGILSDLTCDSDGKINKFIGGESSLPLHELDNNGGGRY  561

Query  1136  YLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEP  957
             YLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTRA  G S ADVLR MQHEP
Sbjct  562   YLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVMGQSSADVLRAMQHEP  621

Query  956   ELMFETLKHRAEEF--LHDEDNGGMafaslassl--ansFHNMPYLVV-GSTCCLTAATT  792
             ELMF+TLKHRAEE   +H    GG       ++   A SF NMPYL +  ST  LTAA  
Sbjct  622   ELMFQTLKHRAEELSSVHKAGGGGDKGNEKLAASCLARSFDNMPYLSMETSTNALTAAIN  681

Query  791   PGSGYY  774
                 YY
Sbjct  682   DLGVYY  687



>emb|CDY45328.1| BnaA03g53010D [Brassica napus]
Length=688

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/679 (71%), Positives = 559/679 (82%), Gaps = 17/679 (3%)
 Frame = -3

Query  2774  SSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLS  2595
             ++D  +P +  P + +     WSPS+S++LYRIDGWG PYF+ NSSG+ISVRPHGS TL 
Sbjct  11    TTDVFIPPSPQPSSTAAVVDTWSPSLSSSLYRIDGWGAPYFSANSSGNISVRPHGSNTLP  70

Query  2594  HQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHY  2415
             HQ+IDLLK+VKK +DPK  GGLGL LP+IVRFPDVLKNRLE LQSAF+FAV+SQGY SHY
Sbjct  71    HQDIDLLKLVKKVTDPKQTGGLGLHLPVIVRFPDVLKNRLECLQSAFDFAVQSQGYESHY  130

Query  2414  QGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKD  2235
             QGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+ +A LICNGFKD
Sbjct  131   QGVYPVKCNQDRFVVEDIVRFGSQFRFGLEAGSKPEILLAMSCLCKGNNEAFLICNGFKD  190

Query  2234  AEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGST  2055
             AEY+SLAL  RKL LNTVIVLEQEEE+DL+ID+S KM VRPVIGLRAKLRTKH+GHFGST
Sbjct  191   AEYVSLALLGRKLALNTVIVLEQEEELDLVIDLSHKMNVRPVIGLRAKLRTKHSGHFGST  250

Query  2054  SGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCE  1875
             SGEKGKFGLTTTQI+RVV+KL E+ M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YCE
Sbjct  251   SGEKGKFGLTTTQIVRVVRKLSEACMLDCLQLLHFHIGSQIPSTSLLSDGVSEAAQLYCE  310

Query  1874  LVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHP  1695
             LVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVC+R+ V HP
Sbjct  311   LVRLGANMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCERRSVKHP  370

Query  1694  VICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAI  1515
             VICSESGRAIVSHHS+LIFEAVS+      Q  +  +Q  +E        DY+ L +A +
Sbjct  371   VICSESGRAIVSHHSVLIFEAVSTVKH---QADHDDIQFLLEG------DDYEELYSAVM  421

Query  1514  RGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLS  1335
             RG+ + C+LY D+LKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIG  DPV TYN+NLS
Sbjct  422   RGDQERCLLYVDKLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGGSDPVQTYNINLS  481

Query  1334  VFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELG  1155
             VFTS+PD W   QLFPIVPIH+LD+RPG RG+LSDLTCDSDGKIDKF+GGES+LPLHEL 
Sbjct  482   VFTSVPDLWGIEQLFPIVPIHKLDQRPGTRGVLSDLTCDSDGKIDKFIGGESTLPLHELE  541

Query  1154  GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLR  975
               GGRY+LGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PG S ADVLR
Sbjct  542   SGGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAVPGQSSADVLR  601

Query  974   VMQHEPELMFETLKHRAEEFLHDEDNGGMafa-----slasslansFHNMPYLVVGSTCC  810
              MQHEPE+MFETLKHRAEE +H +   G         ++A+ L  SFHNMPYL       
Sbjct  602   GMQHEPEMMFETLKHRAEEVMHRKGGEGEDDDEGEFCNVAACLDRSFHNMPYLATEEVLS  661

Query  809   LTAATTPGS---GYYYGND  762
             ++ + +      G+YY ++
Sbjct  662   MSNSLSDAVSNLGFYYCDE  680



>ref|XP_009138322.1| PREDICTED: arginine decarboxylase 2-like [Brassica rapa]
Length=688

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/679 (71%), Positives = 559/679 (82%), Gaps = 17/679 (3%)
 Frame = -3

Query  2774  SSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLS  2595
             ++D  +P +  P + +     WSPS+S++LYRIDGWG PYF+ NSSG+ISVRPHGS TL 
Sbjct  11    TTDVFIPPSPQPSSTAAVVDTWSPSLSSSLYRIDGWGAPYFSANSSGNISVRPHGSNTLP  70

Query  2594  HQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHY  2415
             HQ+IDLLK+VKK +DPK  GGLGL LP+IVRFPDVLKNRLE LQSAF+FAV+SQGY SHY
Sbjct  71    HQDIDLLKLVKKVTDPKQTGGLGLHLPVIVRFPDVLKNRLECLQSAFDFAVQSQGYESHY  130

Query  2414  QGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKD  2235
             QGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+ +A LICNGFKD
Sbjct  131   QGVYPVKCNQDRFVVEDIVRFGSQFRFGLEAGSKPEILLAMSCLCKGNNEAFLICNGFKD  190

Query  2234  AEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGST  2055
             AEY+SLAL  RKL LNTVIVLEQEEE+DL+ID+S KM VRPVIGLRAKLRTKH+GHFGST
Sbjct  191   AEYVSLALLGRKLALNTVIVLEQEEELDLVIDLSHKMNVRPVIGLRAKLRTKHSGHFGST  250

Query  2054  SGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCE  1875
             SGEKGKFGLTTTQI+RVV+KL E+ M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YCE
Sbjct  251   SGEKGKFGLTTTQIVRVVRKLSEACMLDCLQLLHFHIGSQIPSTSLLSDGVSEAAQLYCE  310

Query  1874  LVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHP  1695
             LVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVC+R+ V HP
Sbjct  311   LVRLGANMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCERRSVKHP  370

Query  1694  VICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAI  1515
             VICSESGRAIVSHHS+LIFEAVS+      Q  +  +Q  +E        DY+ L +A +
Sbjct  371   VICSESGRAIVSHHSVLIFEAVSTVKH---QADHDDIQFLLEG------DDYEELYSAVM  421

Query  1514  RGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLS  1335
             RG+ + C+LY ++LKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIG  DPV TYN+NLS
Sbjct  422   RGDQERCLLYVEKLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGGSDPVQTYNINLS  481

Query  1334  VFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELG  1155
             VFTS+PD W   QLFPIVPIH+LD+RPG RG+LSDLTCDSDGKIDKF+GGES+LPLHEL 
Sbjct  482   VFTSVPDLWGIEQLFPIVPIHKLDQRPGTRGVLSDLTCDSDGKIDKFIGGESTLPLHELE  541

Query  1154  GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLR  975
               GGRY+LGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PG S ADVLR
Sbjct  542   SGGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAVPGQSSADVLR  601

Query  974   VMQHEPELMFETLKHRAEEFLHDEDNGGMafa-----slasslansFHNMPYLVVGSTCC  810
              MQHEPE+MFETLKHRAEE +H +   G         ++A+ L  SFHNMPYL       
Sbjct  602   GMQHEPEMMFETLKHRAEEVMHRKGGEGEDDDEGEFCNVAACLDRSFHNMPYLATEEVLS  661

Query  809   LTAATTPGS---GYYYGND  762
             ++ + +      G+YY ++
Sbjct  662   MSNSLSDAVSNLGFYYCDE  680



>ref|XP_006412194.1| hypothetical protein EUTSA_v10024529mg [Eutrema salsugineum]
 gb|ESQ53647.1| hypothetical protein EUTSA_v10024529mg [Eutrema salsugineum]
Length=725

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/710 (70%), Positives = 576/710 (81%), Gaps = 29/710 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASV--DHSHWSPSMSAALYRIDGWGDPYF  2652
             GYAF+ D SLP      + D  +P +     ASV      WS S+SA+LYRIDGWG PYF
Sbjct  15    GYAFSGDSSLP-----TAGDVFMPASPNSAAASVVDSSCRWSSSLSASLYRIDGWGAPYF  69

Query  2651  TVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLE  2472
               NSSG+ISVRPHGS T+ HQ+IDLLK+VKK +DPK  GGLGLQLPLIVRFPDVLKNRLE
Sbjct  70    VANSSGNISVRPHGSDTMPHQDIDLLKIVKKVTDPKSSGGLGLQLPLIVRFPDVLKNRLE  129

Query  2471  SLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAM  2292
              LQSAF+FA++SQGY SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAM
Sbjct  130   CLQSAFDFAIQSQGYDSHYQGVYPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPEILLAM  189

Query  2291  SCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRP  2112
             SCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNT+IVLEQEEE+DL+ID+S+KM VRP
Sbjct  190   SCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTLIVLEQEEELDLVIDLSQKMNVRP  249

Query  2111  VIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQI  1932
             VIGLRAKLRTKH+GHFGSTSGEKGKFGLTT+QI+RV++KL +S M+DCLQLLHFHIGSQI
Sbjct  250   VIGLRAKLRTKHSGHFGSTSGEKGKFGLTTSQIVRVMRKLSQSGMLDCLQLLHFHIGSQI  309

Query  1931  PSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYA  1752
             PST LL DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA
Sbjct  310   PSTPLLTDGVAEAAQLYCELVRLGANMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYA  369

Query  1751  SAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSD--KLLQLPNP-GLQ  1581
              AVV ++RFVCDR+ V HP ICSESGRAIVSHHS+LIFEAVS+SS+   +    NP  +Q
Sbjct  370   EAVVASIRFVCDRRSVKHPAICSESGRAIVSHHSVLIFEAVSASSNVKPMAHRANPDDIQ  429

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARA+Y++L AA +RG++ +C+LY D+LKQRCV+ FK+G LSIEQLA+VDG+
Sbjct  430   FLLES--EEARANYEDLYAAVMRGDHKSCLLYVDELKQRCVEGFKDGVLSIEQLASVDGL  487

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLS+FTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTC
Sbjct  488   CEWVLKAIGASDPVQTYNINLSLFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTC  547

Query  1220  DSDGKIDKFVGGESSLPLHELGGN----GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVR  1053
             DSDG IDKF+GGE+SLPLHE+  N    GG+Y+LGMFLGGAYEEALGG HNLFGGPSVVR
Sbjct  548   DSDGIIDKFIGGETSLPLHEVDNNGGGGGGKYFLGMFLGGAYEEALGGVHNLFGGPSVVR  607

Query  1052  VSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMaf---  882
             V+QSDGPHSF+VTRA PG S ADVLR MQHEPEL+F+TLKHRAEE  H +          
Sbjct  608   VTQSDGPHSFAVTRAVPGQSSADVLRAMQHEPELLFQTLKHRAEELRHTKGGDDEGGEEE  667

Query  881   --------aslasslansFHNMPYLVV--GSTCCLTAATTPGSGYYYGND  762
                       +A+ L  SFHNMPYL     S     +A     G+YY ++
Sbjct  668   DDDDGDEFNDIANRLDRSFHNMPYLATEPASPSNSLSAAIDNLGFYYCDE  717



>ref|XP_010447041.1| PREDICTED: arginine decarboxylase 2 isoform X3 [Camelina sativa]
Length=740

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/714 (69%), Positives = 568/714 (80%), Gaps = 30/714 (4%)
 Frame = -3

Query  2822  YAF----AWDRSLPAPEALVSSDAPLPTNAVPPTAS--------VDHSHWSPSMSAAL-Y  2682
             YAF    A D  +PA     ++ APL T A+P ++         VD S    S  ++  Y
Sbjct  16    YAFSNTTAADVFIPASSPTSAAQAPLSTCAIPASSPTSAAAASVVDSSRRWSSSLSSSLY  75

Query  2681  RIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVR  2502
             RIDGWG PYF  N SG+ISVRPHGS TL HQ++DLLK+VKK +DPK  GGLGLQLPLIVR
Sbjct  76    RIDGWGAPYFVANPSGNISVRPHGSETLPHQDVDLLKIVKKVTDPKSSGGLGLQLPLIVR  135

Query  2501  FPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA  2322
             FPDVLKNRLE LQSAF+FA++SQGYG+HYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA
Sbjct  136   FPDVLKNRLECLQSAFDFAIQSQGYGAHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA  195

Query  2321  GSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLII  2142
             GSKPE+LLAMSCLCKG+PDA L+CNGFKDAEY+SLAL  RKL LN+VIVLEQEEE+DL+I
Sbjct  196   GSKPEILLAMSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLALNSVIVLEQEEELDLVI  255

Query  2141  DISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQ  1962
             ++S+KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV++L ES M+DCLQ
Sbjct  256   ELSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRRLSESGMLDCLQ  315

Query  1961  LLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEV  1782
             LLHFHIGSQIPST+LL+DGV EAAQ+YCELVRLGA MKV DIGGGLGIDYDGSKS DS++
Sbjct  316   LLHFHIGSQIPSTSLLSDGVSEAAQLYCELVRLGANMKVFDIGGGLGIDYDGSKSGDSDL  375

Query  1781  SVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQ  1602
             SV YTL+EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS +   +  
Sbjct  376   SVAYTLEEYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSVAKPMVHH  435

Query  1601  LPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQ  1422
                P    F+    ++A A+Y+++ AA +RG+ ++C+LY DQLKQRCV  FKEG  SIEQ
Sbjct  436   QETPNDIQFLLEGDEEALANYEDIYAALMRGDRESCLLYVDQLKQRCVKGFKEGVFSIEQ  495

Query  1421  LAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARG  1242
             LA+VDG+C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARG
Sbjct  496   LASVDGLCEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARG  555

Query  1241  ILSDLTCDSDGKIDKFVGGESSLPLHELG-----GNGGRYYLGMFLGGAYEEALGGFHNL  1077
             I SDLTCDSDGKI+KF+GGE+SLPLHEL      G+GGRY+LGMFLGGAYEEALGGFHNL
Sbjct  556   IFSDLTCDSDGKINKFIGGETSLPLHELDNNGSGGSGGRYFLGMFLGGAYEEALGGFHNL  615

Query  1076  FGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDN  897
             FGGPSVVRVSQSDGPHSF+VTRA PG S ADVLR+MQHEPELMF+TLKHRAEE +H + +
Sbjct  616   FGGPSVVRVSQSDGPHSFAVTRAVPGQSSADVLRLMQHEPELMFQTLKHRAEEMMHTKSS  675

Query  896   GGMafaslassla----------nsFHNMPYLVV--GSTCCLTAATTPGSGYYY  771
                                     SFHNMPYL     S     +A     G+YY
Sbjct  676   SDEDEVEEEDDDNEFNDVAACLDRSFHNMPYLATEQASPSNSLSAAINNLGFYY  729



>ref|XP_010690749.1| PREDICTED: arginine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=733

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/690 (72%), Positives = 567/690 (82%), Gaps = 21/690 (3%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WS   SA LYRID WG PYF VN++G+++++P G A+L HQEIDLLKVVKK SDPK  GG
Sbjct  48    WSSDHSANLYRIDRWGPPYFKVNNNGNLAIKPFGEASLPHQEIDLLKVVKKVSDPKSNGG  107

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPLI+RFPD+LK+RLESLQSAF+FAV+SQGYG HYQGVYPVKCNQDRF+VEDIVKF
Sbjct  108   LGLQLPLIIRFPDILKHRLESLQSAFDFAVQSQGYGGHYQGVYPVKCNQDRFIVEDIVKF  167

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS+FRFGLEAGSKPELLLAMS LCKG PDA L+CNGFKDAEYISLA+ ARKL +NTVIVL
Sbjct  168   GSAFRFGLEAGSKPELLLAMSSLCKGHPDAFLVCNGFKDAEYISLAIIARKLAINTVIVL  227

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEEVDL+I++SR + VRPVIG+RAKLRTKH+GHFGSTSGEKGKFGLTT QILRVV+KL
Sbjct  228   EQEEEVDLVIELSRLLHVRPVIGVRAKLRTKHSGHFGSTSGEKGKFGLTTVQILRVVRKL  287

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +   M+DCLQLLHFHIGSQIPST LLADGV E AQ+YCEL RLGACM+VIDIGGGLGIDY
Sbjct  288   EVVGMLDCLQLLHFHIGSQIPSTTLLADGVSEGAQVYCELARLGACMRVIDIGGGLGIDY  347

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DGSKS +S+VSVGYTL+EYASAVV+AV  VCDRKG+ HPVICSESGRAIVSHHSIL+FEA
Sbjct  348   DGSKSTESDVSVGYTLEEYASAVVRAVGVVCDRKGMKHPVICSESGRAIVSHHSILLFEA  407

Query  1631  VSSSSDKLLQLPNP-GLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVD  1455
             VSS+        +P GL   V+ L ++AR D  N+SA+   G++D+C+LYADQLKQRC++
Sbjct  408   VSSTGSAAPPAMSPEGLDCLVQGLPEEARGDVHNISASVKNGDFDSCLLYADQLKQRCIE  467

Query  1454  QFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPI  1275
             QFK+G L +EQLAAVDG+C++VS A+G  DPV +Y+VNLSVFTSIPDFW  GQLFPI PI
Sbjct  468   QFKDGCLGMEQLAAVDGLCEMVSNALGMSDPVRSYHVNLSVFTSIPDFWGIGQLFPITPI  527

Query  1274  HRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL------GGNGGRYYLGMFLGG  1113
             H+LD+RPG RGILSDLTCDSDGKIDKF+GGESSLPLH+L       G  G YYLGMFLGG
Sbjct  528   HKLDQRPGVRGILSDLTCDSDGKIDKFIGGESSLPLHDLRRENGNDGGDGGYYLGMFLGG  587

Query  1112  AYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLK  933
             AYEEALGGFHNLFGGPSVVRV QSDGP+SF+VTRA PGPS ADVLRVMQHEPELM++TLK
Sbjct  588   AYEEALGGFHNLFGGPSVVRVLQSDGPYSFAVTRAVPGPSSADVLRVMQHEPELMYQTLK  647

Query  932   HRAEEFL-HDEDNGGMafaslasslansFHNMPYLVVGSTCCLTAATTPGSG--------  780
             HRAEE L HDED      A+LA+ LA SF NMPYLV G T   +      +         
Sbjct  648   HRAEECLQHDEDE----TATLANGLACSFSNMPYLVAGPTALTSGFVKSNNNNNVNGYHH  703

Query  779   -YYYGNDVSAANPIADSSPGEDEHWSYCIA  693
              Y+ G + S      + +  EDE WSY  A
Sbjct  704   PYFCGAEDSCNGSSVEVANAEDEQWSYVCA  733



>dbj|BAJ34222.1| unnamed protein product [Thellungiella halophila]
Length=725

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/710 (70%), Positives = 576/710 (81%), Gaps = 29/710 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASV--DHSHWSPSMSAALYRIDGWGDPYF  2652
             GYAF+ D SLP      + D  +P +     ASV      WS S+SA+LYRIDGWG PYF
Sbjct  15    GYAFSGDSSLP-----TAGDVFMPASPNSAAASVVDSSCRWSSSLSASLYRIDGWGAPYF  69

Query  2651  TVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLE  2472
               NSSG+ISVRPHGS T+ HQ+IDLLK+VKK +DPK  GGLGLQLPLIVRFPDVLKNRLE
Sbjct  70    VANSSGNISVRPHGSDTMPHQDIDLLKIVKKVTDPKSSGGLGLQLPLIVRFPDVLKNRLE  129

Query  2471  SLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAM  2292
              LQSAF+FA++SQGY SHYQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAM
Sbjct  130   CLQSAFDFAIQSQGYDSHYQGVYPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPEILLAM  189

Query  2291  SCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRP  2112
             SCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNT+IVLEQEEE+DL+ID+S+KM VRP
Sbjct  190   SCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTLIVLEQEEELDLVIDLSQKMNVRP  249

Query  2111  VIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQI  1932
             VIGLRAKLRTKH+GHFGSTSGEKGKFGLTT+QI+RV++KL +S M+DCLQLLHFHIGSQI
Sbjct  250   VIGLRAKLRTKHSGHFGSTSGEKGKFGLTTSQIVRVMRKLSQSGMLDCLQLLHFHIGSQI  309

Query  1931  PSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYA  1752
             PST LL DGV EAAQ+YCELVRLGA +KVIDIGGGLGIDYDGSKS +S++SV YTL+EYA
Sbjct  310   PSTPLLTDGVAEAAQLYCELVRLGANIKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYA  369

Query  1751  SAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSD--KLLQLPNP-GLQ  1581
              AVV ++RFVCDR+ V HP ICSESGRAIVSHHS+LIFEAVS+SS+   +    NP  +Q
Sbjct  370   EAVVASIRFVCDRRSVKHPAICSESGRAIVSHHSVLIFEAVSASSNVKPMAHRANPDDIQ  429

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARA+Y++L AA +RG++ +C+LY D+LKQRCV+ FK+G LSIEQLA+VDG+
Sbjct  430   FLLES--EEARANYEDLYAAVMRGDHKSCLLYVDELKQRCVEGFKDGVLSIEQLASVDGL  487

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLS+FTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTC
Sbjct  488   CEWVLKAIGASDPVQTYNINLSLFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTC  547

Query  1220  DSDGKIDKFVGGESSLPLHELGGN----GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVR  1053
             DSDG IDKF+GGE+SLPLHE+  N    GG+Y+LGMFLGGAYEEALGG HNLFGGPSVVR
Sbjct  548   DSDGIIDKFIGGETSLPLHEVDNNGGGGGGKYFLGMFLGGAYEEALGGVHNLFGGPSVVR  607

Query  1052  VSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMaf---  882
             V+QSDGPHSF+VTRA PG S ADVLR MQHEPEL+F+TLKHRAEE  H +          
Sbjct  608   VTQSDGPHSFAVTRAVPGQSSADVLRAMQHEPELLFQTLKHRAEELRHTKGGDDEGGEEE  667

Query  881   --------aslasslansFHNMPYLVV--GSTCCLTAATTPGSGYYYGND  762
                       +A+ L  SFHNMPYL     S     +A     G+YY ++
Sbjct  668   DDDDGDEFNDIANRLDRSFHNMPYLATEPASPSNSLSAAIDNLGFYYCDE  717



>emb|CDX72498.1| BnaC07g45200D [Brassica napus]
Length=684

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/666 (72%), Positives = 553/666 (83%), Gaps = 18/666 (3%)
 Frame = -3

Query  2738  PTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKK  2559
             P+A+VD   WSPS+S++LYRIDGWG PYF+ NSSG+ISVRPHGS TL HQ+IDLLK+V K
Sbjct  22    PSAAVDT--WSPSLSSSLYRIDGWGAPYFSANSSGNISVRPHGSNTLPHQDIDLLKLVTK  79

Query  2558  ASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDR  2379
              +DPK  GGLGLQLP+IVRFPDVLKNRLE LQSAF+FAV+SQGY SHYQGVYPVKCNQDR
Sbjct  80    VTDPKQTGGLGLQLPVIVRFPDVLKNRLECLQSAFDFAVQSQGYESHYQGVYPVKCNQDR  139

Query  2378  FVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARK  2199
             FVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+ +A LICNGFKDAEY+SLAL  RK
Sbjct  140   FVVEDIVRFGSQFRFGLEAGSKPEILLAMSCLCKGNNEAFLICNGFKDAEYVSLALLGRK  199

Query  2198  LLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTT  2019
             L L TVIVLEQEEE+DL+ID+S KM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTT
Sbjct  200   LALKTVIVLEQEEELDLVIDLSHKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTT  259

Query  2018  QILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVid  1839
             QI+RVV+KL+E+ M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YCELVRLGA MKVID
Sbjct  260   QIVRVVRKLREACMLDCLQLLHFHIGSQIPSTSLLSDGVSEAAQLYCELVRLGANMKVID  319

Query  1838  iggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVS  1659
             IGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVC+R+ V HPVICSESGRAIVS
Sbjct  320   IGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCERRAVKHPVICSESGRAIVS  379

Query  1658  HHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYAD  1479
             HHS+LIFEAVS+ +    Q     +Q  +E        DY+ + +A +RG+ + C+LY D
Sbjct  380   HHSVLIFEAVSTVNH---QADRDDIQFLLEG------GDYEEMYSAVMRGDQERCLLYVD  430

Query  1478  QLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFG  1299
             +LKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIG  DPV TYN+NLSVFTS+PD W   
Sbjct  431   KLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGGSDPVQTYNINLSVFTSVPDLWGIE  490

Query  1298  QLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFL  1119
             QLFPIVPIH+LD+RPG RG+LSDLTCDSDGKIDKF+GGES+LPLHEL   GGRY+LGMFL
Sbjct  491   QLFPIVPIHKLDQRPGTRGVLSDLTCDSDGKIDKFIGGESTLPLHELESGGGRYFLGMFL  550

Query  1118  GGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFET  939
             GGAYEEALGG HNLFGGPSVVRV QSDGPH F+VTRA PG S ADVLR MQHEPE+MFET
Sbjct  551   GGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVPGQSSADVLRGMQHEPEMMFET  610

Query  938   LKHRAEEFLHDEDNGGMafaslasslan----sFHNMPYLVVGSTCCLTAATTPGS---G  780
             LKHRAEE +H +  G         ++A     SFHNMPYL       ++ + +      G
Sbjct  611   LKHRAEEVMHTKGCGEGEDVDEFGNVAACLDRSFHNMPYLATEEVLSMSNSLSDAVSNLG  670

Query  779   YYYGND  762
             +YY ++
Sbjct  671   FYYCDE  676



>gb|KFK30109.1| hypothetical protein AALP_AA7G217900 [Arabis alpina]
Length=691

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/660 (73%), Positives = 556/660 (84%), Gaps = 13/660 (2%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WS S+S++LY+IDGWG PYFTVN+SG+ISVRPHG  TL HQ+IDLLK+VKK +DPK  GG
Sbjct  27    WSSSLSSSLYKIDGWGAPYFTVNTSGNISVRPHGCDTLPHQDIDLLKIVKKVTDPKLSGG  86

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPLI+RFPDVLKNRLE LQSAF+FAVESQGY +HYQGV+PVKCNQDRFVVEDIVKF
Sbjct  87    LGLQLPLIIRFPDVLKNRLECLQSAFDFAVESQGYENHYQGVFPVKCNQDRFVVEDIVKF  146

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPE+LLA+SCLCKG+PDA L+CNGFKDAEY+SLAL  RKL LNTVIVL
Sbjct  147   GSGFRFGLEAGSKPEILLALSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLELNTVIVL  206

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+I++S+KM V+PVIGLRAKLRTKH GHFG+TSGEK KFGLTTTQI+ VV+KL
Sbjct  207   EQEEELDLVIELSKKMNVKPVIGLRAKLRTKHEGHFGATSGEKSKFGLTTTQIVHVVRKL  266

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
              ++ M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDY
Sbjct  267   SQAGMLDCLQLLHFHIGSQIPSTSLLSDGVSEAAQLYCELVRLGAHMKVIDIGGGLGIDY  326

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DGSKS  S++S+ YTL+EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEA
Sbjct  327   DGSKSGKSDLSIAYTLEEYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEA  386

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VS+    + Q     +Q  +ES  ++ARA+Y++L AA +RG++++C+LY DQLKQRC + 
Sbjct  387   VSAVKPSVHQASPDDIQFLLES--EEARANYEDLYAALMRGDHESCLLYVDQLKQRCAEG  444

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIH  1272
             FK+G LSIEQL +VDG+C+ V KAIGA D V TYN+NLSVFTSIPD W   QLFPIVPIH
Sbjct  445   FKDGVLSIEQLVSVDGLCEWVLKAIGASDSVQTYNINLSVFTSIPDLWGIDQLFPIVPIH  504

Query  1271  RLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALG  1092
             +LD+RPGARGILSDLTCDSDGKIDKF+GGE+SLPLHEL  NGGRY+LGMFLGGAYEEALG
Sbjct  505   KLDQRPGARGILSDLTCDSDGKIDKFIGGETSLPLHEL-DNGGRYFLGMFLGGAYEEALG  563

Query  1091  GFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL  912
             G HNLFGGPSVVRVSQSDGPHSF+VTRA PG S ADVLR M HEPELMF+TLKHRAEE +
Sbjct  564   GVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSADVLRAMHHEPELMFQTLKHRAEELM  623

Query  911   HDEDNGGMaf--------aslasslansFHNMPYLVV--GSTCCLTAATTPGSGYYYGND  762
             H +  G             ++A  L  SFHNMPYL    GS     +A     G+YY ++
Sbjct  624   HTKGGGDNEGEEEDDDEYNNVAVRLDRSFHNMPYLATEQGSLSNSLSAAINNLGFYYCDE  683



>gb|KHG07349.1| Arginine decarboxylase [Gossypium arboreum]
Length=794

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/692 (73%), Positives = 583/692 (84%), Gaps = 17/692 (2%)
 Frame = -3

Query  2795  PAPEALVSSDAPLPTNAVPPTASV------DHSHWSPSMSAALYRIDGWGDPYFTVNSSG  2634
             P   A  + D+ LP+ AVP +AS       + +HWSP+ S+ALYRIDGWG PYF+VN++G
Sbjct  16    PGYAAFFAGDSSLPS-AVPFSASTADAADSNSTHWSPAHSSALYRIDGWGAPYFSVNNAG  74

Query  2633  DISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAF  2454
             +I+VRP+G+ TL+HQEIDLLK+VKK SDPK +GGLGLQLPLIVR PDVLKNRL+SLQSAF
Sbjct  75    NITVRPYGTDTLAHQEIDLLKIVKKVSDPKSVGGLGLQLPLIVRVPDVLKNRLDSLQSAF  134

Query  2453  NFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKG  2274
               A+++QGY SHYQGVYPVKCNQDRFVVEDIVKFG+ FRFGLEAGSKPELLLAMSCLCKG
Sbjct  135   ESAIQAQGYESHYQGVYPVKCNQDRFVVEDIVKFGAPFRFGLEAGSKPELLLAMSCLCKG  194

Query  2273  SPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRA  2094
             +P+ALL+CNGFKDAEYI LAL ARKL LNTVIVLE+EEEVDL+I+IS+K++VRPVIG+RA
Sbjct  195   NPEALLVCNGFKDAEYIFLALLARKLALNTVIVLEEEEEVDLVIEISKKLSVRPVIGVRA  254

Query  2093  KLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALL  1914
             KLRTKH+GHFGSTSGEKGKFGLTT QILRVVK+LQ+S M+DCLQLLHFHIGSQIPSTALL
Sbjct  255   KLRTKHSGHFGSTSGEKGKFGLTTIQILRVVKRLQDSGMLDCLQLLHFHIGSQIPSTALL  314

Query  1913  ADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQA  1734
               GV EAAQIY ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y LQEYASAVV A
Sbjct  315   QAGVVEAAQIYSELVRLGADMKVIDIGGGLGIDYDGSKSGNSDLSVSYGLQEYASAVVNA  374

Query  1733  VRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDD  1554
             VRFVCDRK + HP+ICSESGRAIVSHHSILIFEA+S+++     +    L   +E L +D
Sbjct  375   VRFVCDRKSIKHPIICSESGRAIVSHHSILIFEAMSATAPTTPAMNQVDLPFILEGLSED  434

Query  1553  ARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIG  1374
             AR D  NLS AA+R E ++C +YADQLKQRCV+QFKEG+L IEQLAAVDG+CDLVSK + 
Sbjct  435   ARVDCWNLSQAAMRHETESCFVYADQLKQRCVEQFKEGTLGIEQLAAVDGLCDLVSKVVD  494

Query  1373  AYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             A +P  TY+VNLS+FTSIPDFW+ GQ+FPIVPIHRLDERP  RGILSDLTCDSDGKIDKF
Sbjct  495   ASEPARTYHVNLSIFTSIPDFWSIGQIFPIVPIHRLDERPEVRGILSDLTCDSDGKIDKF  554

Query  1193  VGGESSLPLHEL--------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             +GGE+SLPLH L        GG  GRYYLGMFLGGAY+E+LGG HNLFGGPSVV VSQSD
Sbjct  555   IGGETSLPLHGLEGNGGGSSGGANGRYYLGMFLGGAYQESLGGVHNLFGGPSVVSVSQSD  614

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla  858
             GP+SF+VTRAAPGPSC DVLRVMQHEPELMFETLKHRAEEF   +       A+L S++A
Sbjct  615   GPYSFAVTRAAPGPSCGDVLRVMQHEPELMFETLKHRAEEFCGQDHGNEGTHAALVSTIA  674

Query  857   nsFHNMPYLVVGSTCCLTAATTPGSGYYYGND  762
              SFHNMPYLV  S C LTA     +G+YY N+
Sbjct  675   RSFHNMPYLVAASPCSLTAMNN--NGFYYCNE  704



>gb|KDO41478.1| hypothetical protein CISIN_1g004438mg [Citrus sinensis]
Length=712

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/700 (70%), Positives = 550/700 (79%), Gaps = 64/700 (9%)
 Frame = -3

Query  2732  ASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKAS  2553
             A VD SHWSPS SA+LY+ID WG PYF VN SG++SVRP+G ATL+HQEIDLLK+VKK S
Sbjct  57    ADVDSSHWSPSHSASLYKIDSWGAPYFAVNPSGNVSVRPYGHATLAHQEIDLLKIVKKVS  116

Query  2552  DpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFV  2373
             DPK +GGLGLQLPLIVR PDVL++RLESL SAF FA+++QGY + YQGV+PVKCNQDRFV
Sbjct  117   DPKSVGGLGLQLPLIVRLPDVLRDRLESLHSAFEFAIQTQGYEARYQGVFPVKCNQDRFV  176

Query  2372  VEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLL  2193
             VEDIVKFGS FRFGLEAGSKPELLLAMSCLCKGSP+ALL+CNGFKDA YI+LAL ARKL 
Sbjct  177   VEDIVKFGSQFRFGLEAGSKPELLLAMSCLCKGSPEALLVCNGFKDAGYITLALLARKLD  236

Query  2192  LNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQI  2013
             LN VIVLEQEEEVDL+I+IS+K+ VRPVIG RAKLRTKH+GHFGSTSGEKGKFGLTTTQI
Sbjct  237   LNVVIVLEQEEEVDLVIEISKKLNVRPVIGARAKLRTKHSGHFGSTSGEKGKFGLTTTQI  296

Query  2012  LRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidig  1833
             LRVVKKL+ +EM+DC QLLHFHIGSQIPSTALL DGVGEAAQIYCELVRLGA M+VIDIG
Sbjct  297   LRVVKKLEVAEMLDCFQLLHFHIGSQIPSTALLTDGVGEAAQIYCELVRLGANMQVIDIG  356

Query  1832  gglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHH  1653
             GGLGIDYDGSKSADS++SV YTL+EYASAVVQA+R+VCDRK V HPV+CSESGRAIVSHH
Sbjct  357   GGLGIDYDGSKSADSDLSVAYTLEEYASAVVQAIRYVCDRKNVKHPVLCSESGRAIVSHH  416

Query  1652  SILIFEAVSSSSDKL--LQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYAD  1479
             SILIFEAVS+S  +   + +   GLQ  VE L +DAR+DY  ++ AA+R           
Sbjct  417   SILIFEAVSASVSRAAPVAMSPLGLQYLVEGLTEDARSDYTKMTTAALR-----------  465

Query  1478  QLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFG  1299
                                           +  IGA DPV TY+VNLS+FTSIPD+WA G
Sbjct  466   ------------------------------AMEIGASDPVRTYHVNLSIFTSIPDYWAIG  495

Query  1298  QLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNG----GRYYL  1131
             QLFPIVPIH LDERPG RG+LSDLTCDSDGKIDKF+GG +SLPLHE+ G G    G YYL
Sbjct  496   QLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYL  555

Query  1130  GMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPEL  951
             GMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PGPSC DVLRVMQHEPEL
Sbjct  556   GMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPEL  615

Query  950   MFETLKHRAEEFLHDEDNGGM-------------afaslasslansFHNMPYLVVGSTCC  810
             MFETLKHRAEE+   E                    ++LASSLA  FH+MPYLVV S+C 
Sbjct  616   MFETLKHRAEEYCGQEHGSNGGDGDTDDYDHGMANNSALASSLAQYFHSMPYLVVPSSCS  675

Query  809   LTAATTPGSGYY-YGNDVSAANPIADSSPGEDEHWSYCIA  693
             LTA    G  YY  G D  A   + DSSP EDE WSYC A
Sbjct  676   LTAINNGGGLYYCNGEDYDA---VVDSSPNEDEQWSYCYA  712



>sp|Q96412.1|SPE1_DIACA RecName: Full=Arginine decarboxylase; Short=ADC; Short=ARGDC 
[Dianthus caryophyllus]
 gb|AAB67887.1| arginine decarboxylase [Dianthus caryophyllus]
Length=725

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/718 (69%), Positives = 574/718 (80%), Gaps = 15/718 (2%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVN  2643
             Y  A   SLPA E +  S  P  T +           WSPS+SA LYRID WG PYF VN
Sbjct  15    YGGAGALSLPASE-INFSGVPPTTTSTTVNQPPPPQQWSPSLSAELYRIDRWGPPYFAVN  73

Query  2642  SSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQ  2463
             SSG+++V+P G ATL HQEIDLLKVVKK SD K   GLGL LP+I+RFPDVLK+RLESLQ
Sbjct  74    SSGNVTVKPFGDATLPHQEIDLLKVVKKVSDSKSSSGLGLHLPVIIRFPDVLKHRLESLQ  133

Query  2462  SAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCL  2283
             SAF+FAV + GYGSHYQGVYPVKCNQDR++VEDIV+FGS FRFGLEAGSKPELL+AMS L
Sbjct  134   SAFDFAVRTHGYGSHYQGVYPVKCNQDRYIVEDIVEFGSGFRFGLEAGSKPELLMAMSSL  193

Query  2282  CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIG  2103
             CKGSPD+LL+CNGFKDAEYISLA+  RKL LNTVIV+EQEEEVD+ I++SRKM +RPV+G
Sbjct  194   CKGSPDSLLVCNGFKDAEYISLAIIGRKLGLNTVIVIEQEEEVDMAIELSRKMGIRPVVG  253

Query  2102  LRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPST  1923
             +RAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL+   M+DCLQLLHFHIGSQIP+T
Sbjct  254   VRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKLENFGMLDCLQLLHFHIGSQIPTT  313

Query  1922  ALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAV  1743
              LL+DGV EA+Q+YCEL RLGA M+VIDIGGGLGIDYDGSKS DS++SVGYTL+EYASAV
Sbjct  314   TLLSDGVAEASQVYCELTRLGAHMRVIDIGGGLGIDYDGSKSGDSDLSVGYTLEEYASAV  373

Query  1742  VQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP--GLQSFVE  1569
             V  V  VCDRKGV  PVICSES RAIVSHHSIL+FEAVSSSS     +P     L   V+
Sbjct  374   VGTVMSVCDRKGVKSPVICSESVRAIVSHHSILVFEAVSSSSSASPPMPGSTLALDYLVD  433

Query  1568  SLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLV  1389
              L D+ + +Y++L+AAA+RGEY++C++Y+  LKQRCV+ FK+G L +EQLAAVDG+C+LV
Sbjct  434   GLTDEVKGEYRSLTAAAMRGEYESCLMYSGMLKQRCVELFKDGCLGMEQLAAVDGLCELV  493

Query  1388  SKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             SKA+G  D VCTYNVNLSVFTSIPDFW  GQLFPI+PIHRLD++P ARGILSDLTCDSDG
Sbjct  494   SKALGVADGVCTYNVNLSVFTSIPDFWGIGQLFPIMPIHRLDQQPKARGILSDLTCDSDG  553

Query  1208  KIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPH  1029
             KIDKF+G ESSLPLHEL G  G YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGP 
Sbjct  554   KIDKFIGDESSLPLHELSGGEG-YYLGMFLGGAYEEALGGVHNLFGGPSVVRVQQSDGPQ  612

Query  1028  SFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansF  849
             S++VTRA PGPS +DVLRVM HEPELMF+TLKHRAEE  +D   G +     A  LA SF
Sbjct  613   SYAVTRAVPGPSSSDVLRVMHHEPELMFQTLKHRAEECDNDYTAGPL-----ADMLAQSF  667

Query  848   HNMPYLVVG---STCCLTAATTPGSG---YYYGNDVSAANPIADSSPGEDEHWSYCIA  693
             ++ PYLV G    +C  +  +   +G   Y+YG D        D++ GE+E WSY  A
Sbjct  668   NSTPYLVPGHATGSCGFSNGSGLVNGCREYFYGVDDGCNAAAVDAAAGEEEQWSYVCA  725



>gb|AAF26435.1| arginine decarboxylase [Brassica juncea]
Length=680

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/682 (70%), Positives = 552/682 (81%), Gaps = 26/682 (4%)
 Frame = -3

Query  2774  SSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLS  2595
             ++D  +P +  P + +     WSPS+S++LYRIDGWG PYF+ NSSG+ISVRPHGS TL 
Sbjct  11    TTDVFIPPSPQPSSTAAVVDTWSPSLSSSLYRIDGWGAPYFSANSSGNISVRPHGSNTLP  70

Query  2594  HQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHY  2415
             HQ+IDLLK+VKK +DPK  GGLGL LP+IVRFPDVLKNRLE LQSAF+FAV+SQGY SHY
Sbjct  71    HQDIDLLKLVKKVTDPKQTGGLGLHLPVIVRFPDVLKNRLECLQSAFDFAVQSQGYESHY  130

Query  2414  QGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKD  2235
             QGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+ +A LICNGFKD
Sbjct  131   QGVYPVKCNQDRFVVEDIVRFGSQFRFGLEAGSKPEILLAMSCLCKGNNEAFLICNGFKD  190

Query  2234  AEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGST  2055
             AEY+SLAL  RKL LNTVIVLEQEEE+DL ID+S KM VRPVIGLRAKLRTKH+GHFGST
Sbjct  191   AEYVSLALLGRKLALNTVIVLEQEEELDLGIDLSHKMNVRPVIGLRAKLRTKHSGHFGST  250

Query  2054  SGEKGKFGLTTTQILRVVKKLQESEMIDCLQL---LHFHIGSQIPSTALLADGVGEAAQI  1884
             SGEKGKFGLTTTQI+RVV+KL       CL +   LHFHIGSQIPST+LL+DGV EAAQ+
Sbjct  251   SGEKGKFGLTTTQIVRVVRKLV------CLTVSSFLHFHIGSQIPSTSLLSDGVSEAAQL  304

Query  1883  YCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGV  1704
             YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVC+R+ V
Sbjct  305   YCELVRLGANMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCERRSV  364

Query  1703  SHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSA  1524
              HPVICSESGRAIVSHHS+LIFEAVS+      Q  +  +Q  +E        DY+ L +
Sbjct  365   KHPVICSESGRAIVSHHSVLIFEAVSTVKH---QADHDDIQFLLEG------DDYEELYS  415

Query  1523  AAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNV  1344
             A +RG+ + C+LY ++LKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIG  DPV TYN+
Sbjct  416   AVMRGDQERCLLYVEKLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGGSDPVQTYNI  475

Query  1343  NLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLH  1164
             NLSVFTS+PD W   QLFPIVPIH+LD+RPG RG+LSDLTCDSDGKIDKF+GGES+LPLH
Sbjct  476   NLSVFTSVPDLWGIEQLFPIVPIHKLDQRPGTRGVLSDLTCDSDGKIDKFIGGESTLPLH  535

Query  1163  ELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCAD  984
             EL   GGRY+LGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PG S AD
Sbjct  536   ELESGGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAVPGQSSAD  595

Query  983   VLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafa-----slasslansFHNMPYLVVGS  819
             VLR MQHEPE+MFETLKHRAEE +H +   G         ++A+ L  SFHNMPYL    
Sbjct  596   VLRGMQHEPEMMFETLKHRAEEVMHRKGGEGEDDDEGEFCNVAACLDRSFHNMPYLATEE  655

Query  818   TCCLTAATTPGS---GYYYGND  762
                ++ + +      G+YY ++
Sbjct  656   VLSMSNSLSDAVSNLGFYYCDE  677



>emb|CAN65288.1| hypothetical protein VITISV_008959 [Vitis vinifera]
Length=613

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/634 (76%), Positives = 543/634 (86%), Gaps = 27/634 (4%)
 Frame = -3

Query  2576  LKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPV  2397
             +K+VKK SDPK  GGLGLQLPLIVR PDVL+NRLESLQSAF+FA++SQGY SHYQGV+PV
Sbjct  1     MKIVKKVSDPKSAGGLGLQLPLIVRLPDVLQNRLESLQSAFDFAIQSQGYESHYQGVFPV  60

Query  2396  KCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISL  2217
             KCNQDRF+VED+VKFGS+FRFGLEAGSKPELLLAMSCLCKG+P+ALL+CNGFKDA+YI+L
Sbjct  61    KCNQDRFIVEDVVKFGSAFRFGLEAGSKPELLLAMSCLCKGNPEALLVCNGFKDADYIAL  120

Query  2216  ALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGK  2037
             AL ARKL LNTVIVLEQEEE+DL+I++S+K++V PVIG+RAKLRTKHAGHFGSTSGEKGK
Sbjct  121   ALVARKLALNTVIVLEQEEELDLVINLSQKLSVHPVIGVRAKLRTKHAGHFGSTSGEKGK  180

Query  2036  FGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGA  1857
             FGLTT QILRVV+KL+++ M+D LQLLHFHIGSQIPST LLADGV EAAQIYCELVRLGA
Sbjct  181   FGLTTXQILRVVRKLEQAGMLDSLQLLHFHIGSQIPSTDLLADGVSEAAQIYCELVRLGA  240

Query  1856  CMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSES  1677
              M+VIDIGGGLGIDYDGSKS++S++SVGY L+EYA AV            V HPVICSES
Sbjct  241   HMRVIDIGGGLGIDYDGSKSSESDISVGYGLEEYAMAV-----------SVKHPVICSES  289

Query  1676  GRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDT  1497
             GRA+VSHHSILIFEAVS+S        +  LQ FVE L ++AR DYQNL+AAA+ GEY+T
Sbjct  290   GRALVSHHSILIFEAVSASVHD-SPATSLSLQRFVEGLSEEARVDYQNLAAAAVSGEYET  348

Query  1496  CVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIP  1317
             C+ +ADQLKQRCVDQFKEGSL IEQLA VDG+CDLVSK +GA DPV TY+VNLSVFT IP
Sbjct  349   CLRFADQLKQRCVDQFKEGSLGIEQLADVDGLCDLVSKEVGATDPVRTYHVNLSVFTCIP  408

Query  1316  DFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGN----  1149
             DFW  GQLFPIVPIHRLD+RPGARGILSDLTCDSDGKIDKF+GGESSLPLHEL G+    
Sbjct  409   DFWGIGQLFPIVPIHRLDQRPGARGILSDLTCDSDGKIDKFIGGESSLPLHELEGSDVVF  468

Query  1148  --GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLR  975
                G+YYLGMFLGGAYEEALGG HNLFGGPSVVRV QSDGPHSF+VTRA PGPSC DVLR
Sbjct  469   GGSGKYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLR  528

Query  974   VMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansFHNMPYLVVGSTCCLTAAT  795
             VMQHEPELMFETLKHRAEE  H++   GM   SLAS LA SFH MPYLV GS+CC+T   
Sbjct  529   VMQHEPELMFETLKHRAEECGHED---GMTNGSLASGLALSFHKMPYLVAGSSCCMT---  582

Query  794   TPGSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
                SGYYYGN+    N  ADS+ G+D+HWSYC A
Sbjct  583   --NSGYYYGNE-DNYNRAADSAAGDDDHWSYCFA  613



>ref|NP_001238359.1| arginine decarboxylase [Glycine max]
 sp|Q39827.1|SPE1_SOYBN RecName: Full=Arginine decarboxylase; Short=ADC; Short=ARGDC 
[Glycine max]
 gb|AAD09204.1| arginine decarboxylase [Glycine max]
Length=692

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/646 (73%), Positives = 543/646 (84%), Gaps = 19/646 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVD----HSHWSPSMSAALYRIDGWGDP  2658
             GYAFA D S PAP A            VPP  + D    ++HWSPS+SAALY +DGWG P
Sbjct  15    GYAFAGDISFPAPIAF---------TGVPPATADDTNNSNNHWSPSLSAALYNVDGWGGP  65

Query  2657  YFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNR  2478
             YF VN++G+ISVRPHGS T+SHQEIDLLK+VKKASDPK LGGL LQLPLI RFPDVLKNR
Sbjct  66    YFAVNTAGNISVRPHGSDTVSHQEIDLLKIVKKASDPKSLGGLSLQLPLIARFPDVLKNR  125

Query  2477  LESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLL  2298
             LESLQSAF++A++S GY SHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLL
Sbjct  126   LESLQSAFDYAIQSGGYESHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLL  185

Query  2297  AMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAV  2118
             AMSCLCKG+PD LLICNGFKDAEYISLAL A KL LNTVIV+EQEEEVDLI+++S+K+ +
Sbjct  186   AMSCLCKGNPDGLLICNGFKDAEYISLALVANKLALNTVIVVEQEEEVDLIVELSKKLCI  245

Query  2117  RPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGS  1938
             +PVIGLRAKLRTKH+GHFG     +GKFGLTT ++LRVVK L  + M+DCLQLLHFHIGS
Sbjct  246   KPVIGLRAKLRTKHSGHFGGIFRRRGKFGLTTARVLRVVKNLDLAGMLDCLQLLHFHIGS  305

Query  1937  QIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQE  1758
             QIPSTALLADGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDGSKS DS++SV Y L+E
Sbjct  306   QIPSTALLADGVGEAAQIYCELVRLGANMRVIDIGGGLGIDYDGSKSCDSDISVEYGLEE  365

Query  1757  YASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQS  1578
             YA+AVV AV+ VCDR  V HPVICSESGRAIVSHHS+LIFEAV +SS      P P L +
Sbjct  366   YAAAVVHAVQCVCDRS-VKHPVICSESGRAIVSHHSVLIFEAVGTSSTNGGGAP-PALSA  423

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
                 L ++   DY  LS  A RG+Y+TC++Y +++K+RCV+QFK+G++ +EQLAAV+G+C
Sbjct  424   --HYLAEELSEDYGYLSELAFRGDYETCLVYTEEMKERCVEQFKQGTVCMEQLAAVEGLC  481

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             +LV KA+GA + V  Y+VNLS+FTS+PD W   Q+FPI+PIHRLDE+P  RGILSDLTCD
Sbjct  482   ELVRKAVGAAESVRRYHVNLSIFTSVPDAWGIEQVFPIIPIHRLDEKPSVRGILSDLTCD  541

Query  1217  SDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             SDGKIDKF+ GESSLPLHE+ G G  YYLGMFLGGAYEEALGG HNLFGGPSVVRVSQSD
Sbjct  542   SDGKIDKFINGESSLPLHEMEG-GRTYYLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSD  600

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL-HDE  903
             GPHSF+VTRA PGPSC DVLRVMQH+PELMFETLKHRA+E++ HD 
Sbjct  601   GPHSFAVTRAVPGPSCGDVLRVMQHQPELMFETLKHRAQEYVSHDN  646



>ref|XP_009418323.1| PREDICTED: arginine decarboxylase-like [Musa acuminata subsp. 
malaccensis]
Length=718

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/682 (70%), Positives = 554/682 (81%), Gaps = 17/682 (2%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY FAW  +LPAP A        PT A   T+    S WS   SAALYRI+GWG PYF V
Sbjct  15    GYGFAWGGALPAPGAFPGG---APTTAGGATSDWT-SPWSTDHSAALYRINGWGAPYFCV  70

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N++GDI+VRPHG+ATL HQEIDL+KVVKKASDPK  GG+GL+LPL+VR PDVLK+RL+SL
Sbjct  71    NAAGDIAVRPHGAATLPHQEIDLMKVVKKASDPKSAGGIGLRLPLLVRLPDVLKHRLQSL  130

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
              +AF+FA+ S GYGS YQGVYPVKCNQDR++VEDIV+FGS F FGLEAGSK ELLLAM+C
Sbjct  131   HAAFDFAIRSNGYGSRYQGVYPVKCNQDRYIVEDIVEFGSPFGFGLEAGSKAELLLAMNC  190

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L + SP+A LICNG+KD EYI+LAL AR + LNTVIVLEQEEE+D +++ S ++ VRPVI
Sbjct  191   LTRASPEAFLICNGYKDEEYIALALVARSMDLNTVIVLEQEEELDTVVETSHRLGVRPVI  250

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTTTQIL V +KLQ  EM+DCLQLLHFHIGSQIPS
Sbjct  251   GLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILSVAQKLQRLEMLDCLQLLHFHIGSQIPS  310

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T LLADGVGEAAQIYCEL RLGA M+VIDIGGGLGIDYDGS S  S++SVGY L+EYA A
Sbjct  311   TTLLADGVGEAAQIYCELARLGAAMRVIDIGGGLGIDYDGSHSCGSDMSVGYGLEEYAGA  370

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPG--LQSFV  1572
             VV+AV   CDRK V HP+ICSESGRA+VSHHS+LIFEAVSSS+ K   LP+ G  L  F+
Sbjct  371   VVRAVMSACDRKHVRHPIICSESGRALVSHHSVLIFEAVSSSTTKAEPLPSIGSNLAYFL  430

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             + L DDAR+DY NL AAA+ GEY+TC LYADQLK+RC+D FK+G L +E LAAVDG+CDL
Sbjct  431   DELADDARSDYHNLMAAALDGEYETCALYADQLKRRCIDHFKDGVLGLEHLAAVDGLCDL  490

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             VSK +G  DPV TY+VNLS+FTS+PDFWA GQLFPIVPIHRLD+RP  +GILSDLTCDSD
Sbjct  491   VSKELGVADPVKTYHVNLSLFTSMPDFWAIGQLFPIVPIHRLDQRPAIKGILSDLTCDSD  550

Query  1211  GKIDKFVGGESSLPLHE---LGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQS  1041
             GK+D+F+GG+SSLPLHE     G GG YYLGMFLGGAY+EALGG HNLFGGPSVVRVSQ+
Sbjct  551   GKVDRFIGGQSSLPLHELGGGDGLGGGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQA  610

Query  1040  DGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassl  861
             DG H F+VT A PGPSCADVLR MQHEPE+MFE LKHRA E    +        ++  +L
Sbjct  611   DGSHCFAVTLAVPGPSCADVLRAMQHEPEVMFEALKHRAAECAAGD--------AVPRAL  662

Query  860   ansFHNMPYLVVGSTCCLTAAT  795
             A +FH+MPYLV  +     +A+
Sbjct  663   ALAFHSMPYLVCAANAAGVSAS  684



>ref|XP_008787396.1| PREDICTED: arginine decarboxylase-like [Phoenix dactylifera]
 ref|XP_008787397.1| PREDICTED: arginine decarboxylase-like [Phoenix dactylifera]
Length=725

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/680 (68%), Positives = 549/680 (81%), Gaps = 21/680 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDH-SHWSPSMSAALYRIDGWGDPYFT  2649
             GY  AWD SLPAP           + AV  TA ++H S WSP +SAALY+IDGWG PYFT
Sbjct  15    GYGLAWDGSLPAPGTFPGG----ASTAV--TADLEHLSPWSPDLSAALYKIDGWGAPYFT  68

Query  2648  VNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLES  2469
             VN++G+I+VRP+G  TL HQEIDL+KVV+KASDPK  GGLGLQLPLIVR PDVL++RLES
Sbjct  69    VNAAGNIAVRPYGPVTLPHQEIDLMKVVRKASDPKSAGGLGLQLPLIVRLPDVLRHRLES  128

Query  2468  LQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMS  2289
             L SAF+FA+ S GYG+HYQGVYPVKCNQDRF+VED+V+FGS FRFGLEAGSKPELLLAMS
Sbjct  129   LHSAFDFAIRSSGYGAHYQGVYPVKCNQDRFIVEDVVEFGSPFRFGLEAGSKPELLLAMS  188

Query  2288  CLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPV  2109
             CL +GSP+A LICNG+KD EY++LAL AR L LN VIVLEQEEE+D +++ SR++ +RPV
Sbjct  189   CLARGSPEAFLICNGYKDEEYVALALLARTLDLNAVIVLEQEEELDTVVETSRRLGIRPV  248

Query  2108  IGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIP  1929
             IGLRAKLRT+H+GHFGSTSGEKGKFGLTT  IL V +KLQ  EM+DCLQ+LHFH+GSQIP
Sbjct  249   IGLRAKLRTRHSGHFGSTSGEKGKFGLTTAHILSVARKLQRLEMLDCLQILHFHLGSQIP  308

Query  1928  STALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYAS  1749
             ST LLADGV EAA IYCEL RLGA M+VID+GGGLGIDYDGS S+ S++SVGY+L EYA 
Sbjct  309   STTLLADGVSEAAHIYCELARLGAAMRVIDVGGGLGIDYDGSHSSGSDMSVGYSLDEYAD  368

Query  1748  AVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQS---  1578
             AV+QAV++ CDRKGV HP++CSESGRA+VSHHS+L+FEAVSS++   +            
Sbjct  369   AVIQAVQYACDRKGVRHPILCSESGRALVSHHSVLVFEAVSSTTAAAVDPAAALGAGPAY  428

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
             F++ L DDAR DY++L AAA + E D  ++Y DQLK++CV+QFK+G L IE LAAVDG+C
Sbjct  429   FLDELPDDARGDYRDLIAAAFQAECDKSLIYMDQLKRKCVEQFKDGVLGIEHLAAVDGLC  488

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             +LV+  IGA +PV TY+VNLS FTS+PDFWA GQLFPIVPIHRLD+RP   G+LSDLTCD
Sbjct  489   ELVANEIGAANPVKTYHVNLSFFTSMPDFWAIGQLFPIVPIHRLDQRPRVEGVLSDLTCD  548

Query  1217  SDGKIDKFVGGESSLPLHEL---------GGNGGRYYLGMFLGGAYEEALGGFHNLFGGP  1065
             SDGK D+F+GG  SLPLHE           G  G YYLGMF+GGAY+EALGG HNLFGGP
Sbjct  549   SDGKADRFIGGRPSLPLHEFGGGRGGRGGSGKEGGYYLGMFMGGAYQEALGGLHNLFGGP  608

Query  1064  SVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMa  885
             SVVRV+QSDGPH F+VT+A PGPSCADVLR MQHEPELMFE LK RAEE       GG  
Sbjct  609   SVVRVTQSDGPHCFAVTQAVPGPSCADVLRSMQHEPELMFEALKMRAEE--SGARGGGRN  666

Query  884   faslasslansFHNMPYLVV  825
               ++A++LA +FH+MPYLVV
Sbjct  667   AGAVATALARAFHSMPYLVV  686



>ref|XP_009420802.1| PREDICTED: arginine decarboxylase-like [Musa acuminata subsp. 
malaccensis]
Length=686

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/636 (71%), Positives = 527/636 (83%), Gaps = 8/636 (1%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY FAWD +LPAP  +   D P     V      D   WS  +SA+LYRI+GWG PYF V
Sbjct  15    GYVFAWDGALPAP-GIFPGDTPTTAGGVTADRPSD---WSTDLSASLYRIEGWGAPYFCV  70

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NS GDI+VRPHG+ATL+HQEIDL+KVVKKA+DPK  GGLGL+LPL+VR PDVLK+RLESL
Sbjct  71    NSDGDIAVRPHGAATLAHQEIDLMKVVKKATDPKSAGGLGLRLPLLVRLPDVLKHRLESL  130

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q AF+FA+ S  YGS YQGVYPVKCNQDR++VED+V+FG+ FRFGLEAGSK ELLLAMSC
Sbjct  131   QQAFDFAIRSNVYGSRYQGVYPVKCNQDRYIVEDVVEFGAPFRFGLEAGSKAELLLAMSC  190

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L +GSPDA LICNG+KD EYI+LAL AR + LNTVIVLEQEEE+D ++D S+++ VRPVI
Sbjct  191   LTRGSPDAFLICNGYKDEEYIALALFARSMDLNTVIVLEQEEELDTVVDTSQRLGVRPVI  250

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGLTT QIL V +KLQ  +M+DCLQLLHFHIGSQIP+
Sbjct  251   GLRAKLRTKHSGHFGSTSGEKGKFGLTTAQILSVARKLQRLDMLDCLQLLHFHIGSQIPT  310

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             T+LL+DGVGEAAQIYCEL RLGA M+VIDIGGGLGIDYDGS S  S++SVGY L EYA A
Sbjct  311   TSLLSDGVGEAAQIYCELARLGAAMRVIDIGGGLGIDYDGSHSDASDMSVGYGLDEYAGA  370

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQS--FV  1572
             VV+AV F CDRK V HP+ICSESGRA+VSH S+LIFEAVSS++ +   L + G  S  F+
Sbjct  371   VVRAVMFACDRKRVRHPIICSESGRALVSHQSVLIFEAVSSNATRAAPLSSVGPNSALFL  430

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             + L DDAR+DY NL AAA  GEY+TC +YA+QLKQRC+D FK+G L +E LAAVDG+CDL
Sbjct  431   DELADDARSDYNNLMAAAYCGEYETCAVYANQLKQRCIDHFKDGVLGLEHLAAVDGLCDL  490

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             V++ +G  DPV TY++NLS+F S+PDFWA GQLFP+VPIH LD++PG +GILSDLTCDSD
Sbjct  491   VAEELGVADPVRTYHINLSLFASMPDFWAIGQLFPVVPIHHLDQQPGVKGILSDLTCDSD  550

Query  1211  GKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
             GK+D+F+GG+SSLPLHE+   GG YYLGMFLGGAY+EALGG HNLFGGPSVVRV+QSDGP
Sbjct  551   GKVDRFIGGQSSLPLHEI--KGGEYYLGMFLGGAYQEALGGLHNLFGGPSVVRVAQSDGP  608

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRA  924
             H F+VT A PG SCAD LR M+HEPE M   L HRA
Sbjct  609   HCFAVTLAVPGRSCADTLRAMRHEPEAMIAALGHRA  644



>ref|XP_010908989.1| PREDICTED: LOW QUALITY PROTEIN: arginine decarboxylase-like [Elaeis 
guineensis]
Length=720

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/715 (66%), Positives = 564/715 (79%), Gaps = 22/715 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDH-SHWSPSMSAALYRIDGWGDPYFT  2649
             GYA AWD SLPAP          P  A P   +++H S WSP +SAALY+ID WG PYF+
Sbjct  15    GYALAWDGSLPAP-------GTFPGGA-PTAVALEHVSPWSPDLSAALYKIDSWGAPYFS  66

Query  2648  VNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLES  2469
             VN++G+I+VRP+G+ATL HQEIDL+KVV KASD K  GGLGLQLPLIVRFP+VL++RLES
Sbjct  67    VNAAGNIAVRPYGAATLPHQEIDLMKVVWKASDSKSAGGLGLQLPLIVRFPNVLRHRLES  126

Query  2468  LQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMS  2289
             L SAF+FA+ S GYG+HYQGVYPVKCNQDRF+VED+V+FG+ FRFGLEAGSKPELLLAMS
Sbjct  127   LHSAFDFAIRSTGYGAHYQGVYPVKCNQDRFIVEDVVEFGAPFRFGLEAGSKPELLLAMS  186

Query  2288  CLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPV  2109
             CL +GSPDALLICNG+KD EY++LAL AR L LN VIVLEQEEE+D +++ SR++ VRPV
Sbjct  187   CLARGSPDALLICNGYKDQEYVALALLARTLDLNAVIVLEQEEELDTVVETSRRLGVRPV  246

Query  2108  IGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIP  1929
             IGLRAKLRT+H+GHFGSTSGEKGKFGLTT QIL V +KLQ   M+DCLQLLHFHIGSQIP
Sbjct  247   IGLRAKLRTRHSGHFGSTSGEKGKFGLTTAQILSVARKLQRLGMLDCLQLLHFHIGSQIP  306

Query  1928  STALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYAS  1749
             STALLADGVGEAAQIYCEL RLGA M+VID+GGGLGIDYDGS S+ S++SVGY L EYA 
Sbjct  307   STALLADGVGEAAQIYCELARLGAAMRVIDVGGGLGIDYDGSHSSVSDMSVGYGLDEYAE  366

Query  1748  AVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS----DKLLQLPNPGLQ  1581
             AVV+AV+  CDRKGV HP++CSESGRA+VSHHS+LIFEAVSS++    D    L   GL 
Sbjct  367   AVVRAVQHACDRKGVPHPILCSESGRALVSHHSVLIFEAVSSTAVAAVDPATAL-GSGLT  425

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E L DD + DY+NL  A  + + + C++Y DQLK++CV+ FK+G L +E LAAVDG+
Sbjct  426   YSLEDLPDDMQGDYRNLMEATFQFDCEKCLIYMDQLKRKCVELFKDGLLGLEHLAAVDGL  485

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+LV+K IG  +PV TY+VNLS+FTSIPDFWA GQLFPIVPIHRL++RP   G+LSDLTC
Sbjct  486   CELVAKEIGLANPVKTYHVNLSLFTSIPDFWAIGQLFPIVPIHRLEQRPVVEGVLSDLTC  545

Query  1220  DSDGKIDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVS  1047
             DSDGK+D+F+GG  SLPLHE   GG  G YYLGMFLGGAY+EALGG HNLFGGPSVVRV+
Sbjct  546   DSDGKVDRFIGGRPSLPLHEFGGGGKEGGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVT  605

Query  1046  QSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslas  867
             QSDGPH F+VT+A PGPSCADVLR MQHEPELMFE LK RAEE       G +   ++A+
Sbjct  606   QSDGPHCFAVTQAVPGPSCADVLRAMQHEPELMFEALKRRAEE--SATRGGVVNAGAVAT  663

Query  866   slansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEHWSY  702
             +LA +F +MPYLVVG        ++   G   G +         S   EDE W +
Sbjct  664   ALACAFRSMPYLVVGGEAGGDGMSSDSEGSAGGTEAGDGG----SYEVEDEEWEF  714



>ref|XP_009393201.1| PREDICTED: arginine decarboxylase-like [Musa acuminata subsp. 
malaccensis]
Length=722

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/641 (71%), Positives = 535/641 (83%), Gaps = 6/641 (1%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY F WD +LPAP A     A         TA+   S WS  +SAALYRIDGWG PYF V
Sbjct  15    GYGFEWDGALPAPGAY-PRGASTTEGGGDLTAAEYPSPWSTDLSAALYRIDGWGAPYFCV  73

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N++GDI+VR +G+AT+SHQEIDL+KVVKKASDPK  GGLGL+LPL+VRFPD+LK+RLESL
Sbjct  74    NAAGDIAVRSYGAATVSHQEIDLMKVVKKASDPKAAGGLGLRLPLLVRFPDILKHRLESL  133

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
              +AF+FA+ S  YG+ YQGVYPVKCNQDR++VEDI++FG  F FGLEAGSK ELLLAMSC
Sbjct  134   HAAFDFAIRSNSYGACYQGVYPVKCNQDRYIVEDIMEFGLPFDFGLEAGSKAELLLAMSC  193

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L + S  ALLICNGFKD EYI+LA+ AR++ +NTVIVLEQ EE+D +++ S+++ +RPVI
Sbjct  194   LTRASRKALLICNGFKDEEYIALAVVARRMDMNTVIVLEQAEELDTVVETSQRLGIRPVI  253

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFG+TSGEKGKFGLTT QIL V +KLQ  +M+DCLQLLHFHIGSQIPS
Sbjct  254   GLRAKLRTKHSGHFGATSGEKGKFGLTTAQILSVAQKLQRLQMLDCLQLLHFHIGSQIPS  313

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALL+DGVGEAAQIYCEL RLGA M+VID+GGGLGIDYDGS+S  S++SVGY L +YASA
Sbjct  314   TALLSDGVGEAAQIYCELARLGAAMRVIDVGGGLGIDYDGSRSGGSDMSVGYGLHDYASA  373

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPN--PGLQSFV  1572
             VV+AV F CDRK V HP+ICSESGRA+VSHHS+LIFEAVSS++ K   L +  P   S +
Sbjct  374   VVRAVMFACDRKHVRHPIICSESGRALVSHHSVLIFEAVSSTTTKAEPLSSIGPNFASLL  433

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             E L DDAR+DY NL AAA  GEY+TC LYADQLK+  +D FK+G L +E LAAVDG+C+L
Sbjct  434   EELADDARSDYHNLRAAAYLGEYETCALYADQLKRTSIDHFKDGMLGLEHLAAVDGLCEL  493

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             V++ +G  DPV TY+VNLS+FTS+PDFWA GQLFPI+PIH LD+RPG +GILSDLTCDSD
Sbjct  494   VAQELGVADPVKTYHVNLSIFTSMPDFWAIGQLFPIIPIHHLDQRPGVKGILSDLTCDSD  553

Query  1211  GKIDKFVGGESSLPLHE---LGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQS  1041
             GK+D+F+GG+SSLPLHE    G  GG YYLGMFLGGAY+EALGG HNLFGGPSVVRVSQS
Sbjct  554   GKVDRFIGGQSSLPLHELGRGGVGGGGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQS  613

Query  1040  DGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEE  918
             +GPH F+VT AAPGPSCADVLR MQHEPE+MFE+LKHRAEE
Sbjct  614   EGPHGFAVTLAAPGPSCADVLRAMQHEPEVMFESLKHRAEE  654



>ref|XP_008777956.1| PREDICTED: arginine decarboxylase-like [Phoenix dactylifera]
Length=722

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/679 (69%), Positives = 554/679 (82%), Gaps = 23/679 (3%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTAS----VDH-SHWSPSMSAALYRIDGWGD  2661
             GYA AWD SLPAP        P P  A  PTAS    ++H S WSP +SAALY+ID WG 
Sbjct  15    GYALAWDGSLPAP-------GPFPGGA--PTASTAAALEHVSLWSPDLSAALYKIDSWGA  65

Query  2660  PYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKN  2481
             PYF+VN++G+I+V P+G++TL HQEIDL KVV+KAS+PK  GGLGLQLPLIVRFPDVL++
Sbjct  66    PYFSVNAAGNIAVHPYGASTLPHQEIDLTKVVRKASEPKSAGGLGLQLPLIVRFPDVLRH  125

Query  2480  RLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELL  2301
             RLESL SAF+FA+ S GYG+HYQGVYPVKCNQDRF+VED+V FG+ FRFGLEAGSKPELL
Sbjct  126   RLESLHSAFDFAIRSTGYGAHYQGVYPVKCNQDRFIVEDVVGFGAPFRFGLEAGSKPELL  185

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCL +GSPDA LICNG+KD EY++LAL AR L LN VIVLEQEEE+  +++ SR++ 
Sbjct  186   LAMSCLARGSPDAFLICNGYKDEEYVALALLARTLDLNVVIVLEQEEELSTVVETSRRIG  245

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRT+H+GHFGSTSGEKGKFGLTT QIL V +KLQ  EM+DCLQLLHFHIG
Sbjct  246   VRPVIGLRAKLRTRHSGHFGSTSGEKGKFGLTTAQILSVARKLQLLEMLDCLQLLHFHIG  305

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL DGVGEAAQIYCEL RLGA M+VID+GGGLGIDYDGS S+ S++SVGY L 
Sbjct  306   SQIPSTALLVDGVGEAAQIYCELARLGAAMRVIDVGGGLGIDYDGSHSSGSDMSVGYGLD  365

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS----DKLLQLPN  1593
             EYA AVV+AV++ CDRKGV  P++CSESGRA+VSHHS+LIFEAVSS++    D    L  
Sbjct  366   EYAEAVVRAVQYACDRKGVPPPILCSESGRALVSHHSVLIFEAVSSTAVAAVDPATAL-G  424

Query  1592  PGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAA  1413
             PGL   +E L DD R DY++L  A  + + D C++Y +QLK++CV+QFK+G L +E LAA
Sbjct  425   PGLTYLLEDLPDDMRGDYRDLMEATFQFDCDKCLIYTEQLKRKCVEQFKDGLLGLEHLAA  484

Query  1412  VDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILS  1233
             VDG+C+LV+K IG   PV TY+VNLS+FTSIPDFWA GQLFPIVPIHRLD++P   G+LS
Sbjct  485   VDGLCELVAKEIGLAKPVKTYHVNLSLFTSIPDFWAIGQLFPIVPIHRLDQQPVVEGVLS  544

Query  1232  DLTCDSDGKIDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSV  1059
             DLTCDSDGK+D+F+GG  SLPLHE   GG  G YYLGMFLGGAY+EALGG HNLFGGPSV
Sbjct  545   DLTCDSDGKVDRFIGGRRSLPLHEFGGGGKEGGYYLGMFLGGAYQEALGGLHNLFGGPSV  604

Query  1058  VRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafa  879
             VRV+QSDGPH F+VT+A PGPSCADVLR MQHEPELMFE LK RAEE       G +   
Sbjct  605   VRVTQSDGPHCFAVTQAVPGPSCADVLRAMQHEPELMFEALKRRAEE--SAARGGVVDAG  662

Query  878   slasslansFHNMPYLVVG  822
             ++A++LA +F +MPYLVVG
Sbjct  663   AVATTLACAFRSMPYLVVG  681



>emb|CDX76301.1| BnaA08g10990D [Brassica napus]
Length=666

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/660 (71%), Positives = 538/660 (82%), Gaps = 38/660 (6%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             W+ S+SAALYRIDGWG PYFT N+SG+IS+RPHGS TL HQ+IDLLKVVKK +DPKPLGG
Sbjct  27    WNSSLSAALYRIDGWGAPYFTANTSGNISIRPHGSNTLPHQDIDLLKVVKKVTDPKPLGG  86

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLP+IVRFPDVLKNRLE LQSAF+FAV+SQGYGSHYQGVYPVKCNQDRFVVEDIVKF
Sbjct  87    LGLQLPVIVRFPDVLKNRLECLQSAFDFAVQSQGYGSHYQGVYPVKCNQDRFVVEDIVKF  146

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPE+LLAMSCL KG+ +A L+CNGFKD EYISLAL  RKL LNTVIVL
Sbjct  147   GSGFRFGLEAGSKPEILLAMSCLVKGNREAFLVCNGFKDVEYISLALLGRKLALNTVIVL  206

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+ID+SRKM VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLT+TQI+RVV+KL
Sbjct  207   EQEEELDLVIDLSRKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTSTQIVRVVRKL  266

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LL+DGVGEAAQ+YCELVRLGA MKVID+GGGLGIDY
Sbjct  267   RESCMLDCLQLLHFHIGSQIPSTGLLSDGVGEAAQLYCELVRLGAGMKVIDVGGGLGIDY  326

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DGSKS DS++SVGYTL+EYA AVV +VR VCDR+ V HPVICSESGRAIVSHHS+LIFEA
Sbjct  327   DGSKSGDSDLSVGYTLEEYAEAVVASVRSVCDRRSVKHPVICSESGRAIVSHHSVLIFEA  386

Query  1631  VSSS---SDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRC  1461
             VS++   + +  Q+ +  +Q  +E   D+AR DY++L AA +RG+ ++C+LY D+LKQRC
Sbjct  387   VSAAKPMAQEAHQVNHDDIQFLLEC--DEARVDYEDLYAAVMRGDQESCLLYVDKLKQRC  444

Query  1460  VDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIV  1281
             VD FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPI 
Sbjct  445   VDGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVQTYNINLSVFTSIPDLWGIDQLFPI-  503

Query  1280  PIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELG-GNGGRYYLGMFLGGAYE  1104
                                      IDKF+GGESSLPLHEL  G GGRY+LGMFLGGAYE
Sbjct  504   -------------------------IDKFIGGESSLPLHELDGGGGGRYFLGMFLGGAYE  538

Query  1103  EALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRA  924
             EALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PG S ADVLR +QHEPE+MF++LKHRA
Sbjct  539   EALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAMPGQSSADVLRAVQHEPEIMFQSLKHRA  598

Query  923   EEFLHDEDNGGMafaslasslan----sFHNMPYLVV--GSTCCLTAATTPGSGYYYGND  762
             E+ +H +  G        +++      SF+NMPYL     S     +A     G+YY ++
Sbjct  599   EKLMHTKGGGEDEDDEELNNVVACLDRSFNNMPYLATEPASMSNSLSAAISNLGFYYSDE  658



>ref|XP_010690748.1| PREDICTED: arginine decarboxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=730

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/664 (69%), Positives = 539/664 (81%), Gaps = 23/664 (3%)
 Frame = -3

Query  2735  TASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKA  2556
              A++D   WSPS+S++LYRID WG PYF+VNSSG+I++RP G AT  HQEIDLLKVV + 
Sbjct  70    NATIDSLPWSPSLSSSLYRIDRWGPPYFSVNSSGNITIRPFGDATQPHQEIDLLKVVSEV  129

Query  2555  SDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRF  2376
             S+ KP GGLGL+LPLIVRFPD+LK+RLESLQ+AF+ A +S GY S YQGVYPVKCNQDRF
Sbjct  130   SNTKPNGGLGLKLPLIVRFPDILKHRLESLQAAFDLACQSHGYRSPYQGVYPVKCNQDRF  189

Query  2375  VVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKL  2196
             VVEDIVK+G  F FGLEAGSKPELLL+MS LCKG PDALL+CNGFKDAEYISLA+ ARKL
Sbjct  190   VVEDIVKYGYGFGFGLEAGSKPELLLSMSSLCKGHPDALLVCNGFKDAEYISLAMIARKL  249

Query  2195  LLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQ  2016
              +NTVIVLEQEEEVDL+I++S  + V PVIG+RAKLRTKH GHFGSTSGEKGKFGLTTTQ
Sbjct  250   AINTVIVLEQEEEVDLVIELSHTLRVHPVIGVRAKLRTKHLGHFGSTSGEKGKFGLTTTQ  309

Query  2015  ILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidi  1836
             ILRVVK+L  + M+DCLQLLHFHIGSQIPST LL+D V E AQIYCELV LGACMKVIDI
Sbjct  310   ILRVVKRLDAAGMLDCLQLLHFHIGSQIPSTTLLSDAVAEGAQIYCELVLLGACMKVIDI  369

Query  1835  ggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSH  1656
             GGGLGIDYDGSKS  S++S+GY+L+EYASAVV AV+  CDRKGV HPVICSESGRAIVSH
Sbjct  370   GGGLGIDYDGSKSTASDISIGYSLEEYASAVVGAVQVACDRKGVKHPVICSESGRAIVSH  429

Query  1655  HSILIFEAVSSSSDKLLQLPNP-GLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYAD  1479
             HSIL+FEAVS++        +P  L S VE L ++A  D QN+ A+  RGE + C+LYAD
Sbjct  430   HSILVFEAVSATVPPAPPAISPLALNSLVEGLTEEAHRDVQNIFASLRRGECEACLLYAD  489

Query  1478  QLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFG  1299
             QLKQ C+D FK+GSL +EQLAAVDG+CD++SK +G   PV TY VNLS+FTS+PDFW  G
Sbjct  490   QLKQHCIDLFKDGSLGMEQLAAVDGLCDIISKGLGVGYPVSTYYVNLSIFTSVPDFWGIG  549

Query  1298  QLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELG-------GNGGR  1140
             Q FPI+PIH+LD+RPG RGIL+DLTCDSDGKIDKF+GGES LPLHE+        G+GG 
Sbjct  550   QSFPIIPIHKLDQRPGVRGILADLTCDSDGKIDKFIGGESDLPLHEMRRGNANGCGDGGC  609

Query  1139  YYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHE  960
             YYLGMFLGGAYEEALGG HNLFGGPSV++V Q++G H+F+VTR  PGPSC D+LR +QHE
Sbjct  610   YYLGMFLGGAYEEALGGAHNLFGGPSVIQVLQNNGLHNFAVTRIVPGPSCRDILRSVQHE  669

Query  959   PELMFETLKHRAEEFLH---DEDNGGMafaslasslansFHNMPYLVVGSTCCLTAATTP  789
             PELM E LKHRAEE LH   D+D+  +     A  LA+  ++ PYLVV S       TTP
Sbjct  670   PELMLEALKHRAEECLHSLEDQDSASL-----ADRLAHFLNHTPYLVVHS-------TTP  717

Query  788   GSGY  777
               G+
Sbjct  718   TCGF  721



>emb|CDY17482.1| BnaC03g65810D [Brassica napus]
Length=661

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/678 (69%), Positives = 543/678 (80%), Gaps = 39/678 (6%)
 Frame = -3

Query  2765  APLPTNAVPPTASV--DHS-HWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLS  2595
             A + T A PP  SV  D S  W+ S+SAALYRIDGWG PYFT N+SG+IS+RPHGS TL 
Sbjct  5     ACVDTTAFPPPPSVVSDTSCRWNSSLSAALYRIDGWGAPYFTANTSGNISIRPHGSNTLP  64

Query  2594  HQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHY  2415
             HQ+IDLLKVVKK +DPKP GGLGLQLP+IVRFPDVLKNRLE LQSAF+FAV+SQGY SHY
Sbjct  65    HQDIDLLKVVKKVTDPKPFGGLGLQLPVIVRFPDVLKNRLECLQSAFDFAVQSQGYDSHY  124

Query  2414  QGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKD  2235
             QGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPE+LLAMSCL KG+ +A L+CNGFKD
Sbjct  125   QGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPEILLAMSCLVKGNREAFLVCNGFKD  184

Query  2234  AEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGST  2055
              EYISLAL  RKL LNTVIVLEQEEE+DL+ID+SRKM VRPV+GLRAKLRTKH+GHFGST
Sbjct  185   LEYISLALLGRKLALNTVIVLEQEEELDLVIDLSRKMNVRPVVGLRAKLRTKHSGHFGST  244

Query  2054  SGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCE  1875
             SGEKGKFGLTT+QI+RVV+KL+ES M+DCLQLLHFHIGSQIPSTALL+DGVGEAAQ+YCE
Sbjct  245   SGEKGKFGLTTSQIVRVVRKLRESGMLDCLQLLHFHIGSQIPSTALLSDGVGEAAQLYCE  304

Query  1874  LVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHP  1695
             LVRLGA MKVID+GGGLGIDYDGSKS +S++SV YTL+EYA AVV +VR VCDR+ V HP
Sbjct  305   LVRLGAGMKVIDVGGGLGIDYDGSKSGESDLSVCYTLEEYAEAVVASVRSVCDRRSVKHP  364

Query  1694  VICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAI  1515
             VICSESGRAIVSHHS+LIFEAVS++   + Q  +  +Q  +E   D+AR DY++L AA +
Sbjct  365   VICSESGRAIVSHHSVLIFEAVSAAK-PMAQAHHDDIQFLLEC--DEARVDYEDLYAAVM  421

Query  1514  RGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLS  1335
             RG+ ++C+LY D+LKQRCVD FK+G LSIEQLA+VDG+C+ V KAIGA DPV TYN+NLS
Sbjct  422   RGDQESCLLYVDKLKQRCVDGFKDGVLSIEQLASVDGLCEWVLKAIGASDPVQTYNINLS  481

Query  1334  VFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELG  1155
             VFTSIPD W   QL                          DGKIDKF+GGESSLPLHEL 
Sbjct  482   VFTSIPDLWGIDQL--------------------------DGKIDKFIGGESSLPLHELD  515

Query  1154  -GNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVL  978
              G GG Y+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PG S ADVL
Sbjct  516   GGGGGSYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAMPGQSSADVL  575

Query  977   RVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslasslan----sFHNMPYLVV--GST  816
             R +QHEPE+MF++LKHRAE+ +H +  G        +++      SF+NMPYL     S 
Sbjct  576   RAVQHEPEIMFQSLKHRAEKLMHTKGGGEDEDDEELNNVVACLDRSFNNMPYLATEPASM  635

Query  815   CCLTAATTPGSGYYYGND  762
                 +A     G+YY ++
Sbjct  636   SNSLSAAISNLGFYYSDE  653



>gb|AAR84411.2| arginine decarboxylase [Daucus carota]
Length=570

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/572 (76%), Positives = 492/572 (86%), Gaps = 4/572 (1%)
 Frame = -3

Query  2405  YPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEY  2226
             Y VKCNQD+FVV+DIVKFGS+FRFGLEAGSKPELLLAMS LCKGSPD+ L+CNGFKDAEY
Sbjct  2     YAVKCNQDKFVVDDIVKFGSAFRFGLEAGSKPELLLAMSALCKGSPDSFLVCNGFKDAEY  61

Query  2225  ISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGE  2046
             I+LAL  RKL  NTVIVLE EEEVDL+ID+SRK+ VRPVIG+RAKLRTKH GHFGSTSGE
Sbjct  62    ITLALIGRKLNFNTVIVLELEEEVDLVIDLSRKLGVRPVIGMRAKLRTKHQGHFGSTSGE  121

Query  2045  KGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVR  1866
             KGKFGLTTTQILRVVKKL +  M+DCLQLLHFHIGSQIP+TALLADGVGEAAQ+YCELVR
Sbjct  122   KGKFGLTTTQILRVVKKLAQCGMLDCLQLLHFHIGSQIPTTALLADGVGEAAQVYCELVR  181

Query  1865  LGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVIC  1686
             LGA M VIDIGGGLGIDYDGSKS +S+VSVGYTL+EYA+AVV+A+R VCDRK V HPVIC
Sbjct  182   LGARMGVIDIGGGLGIDYDGSKSPNSDVSVGYTLEEYAAAVVRAIRSVCDRKMVKHPVIC  241

Query  1685  SESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGE  1506
             SESGRAIVSHHSIL+FEAVS+S + + Q+ +  L   +E L  DA  DYQ LSAAA+ GE
Sbjct  242   SESGRAIVSHHSILVFEAVSASKNSVPQMTSGDLNYLIERLPQDAIVDYQKLSAAAVGGE  301

Query  1505  YDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFT  1326
             Y+TC+ Y+DQLKQ+CV+QFK+GS  +EQLAAVDG+C+LV KAIGA DPV TY+VNLSVFT
Sbjct  302   YETCLHYSDQLKQKCVEQFKDGSFDLEQLAAVDGLCELVYKAIGASDPVRTYHVNLSVFT  361

Query  1325  SIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNG  1146
             SIPDFW  GQLFPI+PIHRL+++P  +GILSDLTCDSDGKI+KF+GGE SLPLHEL G+G
Sbjct  362   SIPDFWGIGQLFPIMPIHRLEQKPVVKGILSDLTCDSDGKIEKFIGGEESLPLHELEGSG  421

Query  1145  -GRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVM  969
              G YYLGMFLGGAYEEALG  HNLFGGPSVVRVSQSDGPHSF+VTRA PGPSCADVLRVM
Sbjct  422   EGSYYLGMFLGGAYEEALGSIHNLFGGPSVVRVSQSDGPHSFAVTRAVPGPSCADVLRVM  481

Query  968   QHEPELMFETLKHRAEEFLHDEDNGGMafaslasslansFHNMPYLVVGSTCCLTAATTP  789
             QHEPE+MFE LKHRAEE++ DE   G+   ++A+ LA SFHNMPYL V S+C LTAA   
Sbjct  482   QHEPEMMFEELKHRAEEYVLDEGGHGLDHDAIANGLACSFHNMPYL-VNSSCSLTAANG-  539

Query  788   GSGYYYGNDVSAANPIADSSPGEDEHWSYCIA  693
              +GYYY +DV   + + DS   EDE WSYC A
Sbjct  540   NNGYYY-SDVDNYSTVTDSDAAEDEQWSYCCA  570



>ref|XP_010919152.1| PREDICTED: arginine decarboxylase-like [Elaeis guineensis]
Length=696

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/636 (69%), Positives = 520/636 (82%), Gaps = 12/636 (2%)
 Frame = -3

Query  2816  FAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSS  2637
             FAW  S   PE+L    APL   A   +A    + WSP +SAALY+IDGWG  YF+VN++
Sbjct  16    FAWAASPLPPESL-PGGAPLAATA---SALDQLTPWSPDLSAALYKIDGWGATYFSVNTA  71

Query  2636  GDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSA  2457
             G+I+VRPHG+ATL HQEIDL+K V+KA DPKP GGLGL+ PL+VRFPDVL++RLESL +A
Sbjct  72    GNIAVRPHGAATLPHQEIDLMKAVRKAIDPKPAGGLGLRPPLLVRFPDVLRHRLESLHAA  131

Query  2456  FNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCK  2277
             F+ AV S GYGS YQGVYPVKCNQDR+VVEDIV+ G+ F FGLEAGSKPELLLAMSCL +
Sbjct  132   FDLAVRSNGYGSRYQGVYPVKCNQDRYVVEDIVEAGAPFHFGLEAGSKPELLLAMSCLLR  191

Query  2276  GSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLR  2097
             GS +A LICNG+KDAEY+ LAL A  L LN ++VLEQEEE+  ++D  R++ VRP IGLR
Sbjct  192   GSSEAFLICNGYKDAEYVELALTATALGLNAIVVLEQEEELLTVVDACRRLGVRPAIGLR  251

Query  2096  AKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTAL  1917
             AKLRTKHAGHFGSTSGEKGKFGLTT QIL V ++LQ  EM+DCLQLLHFHIGSQIP+TAL
Sbjct  252   AKLRTKHAGHFGSTSGEKGKFGLTTAQILSVARRLQRLEMLDCLQLLHFHIGSQIPTTAL  311

Query  1916  LADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQ  1737
             LADGV EAAQIYCEL RLGA M+VID+GGGLGIDYDG++SA S+ SVGY L+EYA+AVV+
Sbjct  312   LADGVSEAAQIYCELARLGAAMRVIDVGGGLGIDYDGTRSACSDASVGYELEEYAAAVVR  371

Query  1736  AVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLP---NPGLQSFVES  1566
             AVR  CDR+ + HP+ICSESGRA+VSHHS+L+FE +SSSS      P    P +   +E 
Sbjct  372   AVRDACDRRRMRHPIICSESGRALVSHHSVLVFEVLSSSSCSGAAEPVPVGPDVAHLLEG  431

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
             L      DY++L+AAA+RGEY+TC+LYA+QLK+RCV++FK+G L +E LAAVDG+C+L++
Sbjct  432   L-----VDYRSLAAAAMRGEYETCLLYAEQLKRRCVERFKDGLLGLEHLAAVDGLCELLA  486

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             K  GA  PV  Y+VNLSVFTS+PDFWA GQLFPI PIHRLD+RPG   +L DLTCDSDGK
Sbjct  487   KENGAAAPVRAYHVNLSVFTSLPDFWAIGQLFPIAPIHRLDQRPGVSAVLQDLTCDSDGK  546

Query  1205  IDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHS  1026
             +D+F+GG SSLP+HEL G  GRY+LGMFLGGAY+EALGG HNLF GPSVVRV QS+GPH 
Sbjct  547   VDRFIGGRSSLPVHELDGGDGRYFLGMFLGGAYQEALGGAHNLFAGPSVVRVEQSEGPHC  606

Query  1025  FSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEE  918
             F+VTRA PG SCADVLR MQHEPE+MFE LK RAEE
Sbjct  607   FAVTRAVPGASCADVLRAMQHEPEVMFEGLKGRAEE  642



>ref|XP_009383023.1| PREDICTED: arginine decarboxylase-like [Musa acuminata subsp. 
malaccensis]
Length=717

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/639 (71%), Positives = 523/639 (82%), Gaps = 8/639 (1%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GYAFAWD +LPA  A    DA   T A  PTA +  S WS  +SA LYRIDGWG PYF V
Sbjct  15    GYAFAWDGALPAQGAF-PGDAS--TTADGPTADLS-SPWSTDLSAKLYRIDGWGAPYFCV  70

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N+SGDISVRPHG+ATL HQEIDL+KVVKKAS PK  GGLGL+LPL+VRF DVLK+RLESL
Sbjct  71    NASGDISVRPHGAATLPHQEIDLMKVVKKASGPKSAGGLGLRLPLLVRFTDVLKHRLESL  130

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             Q AF+ A+ S GYGS YQGVYPVKCNQDR +VEDI++FG+ F FGLEAGSK ELLLAM+C
Sbjct  131   QQAFDVAIRSNGYGSRYQGVYPVKCNQDRHLVEDIMEFGAPFDFGLEAGSKAELLLAMTC  190

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L +  P+A LICNG+KD EYI+LAL AR + LNTVIVLEQEEE+D +++ S ++ VRPVI
Sbjct  191   LTRARPEAFLICNGYKDEEYITLALIARSMDLNTVIVLEQEEELDTVVETSERLGVRPVI  250

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKH+GHFGSTSGEKGKFGL+T QIL V +KLQ  EM+DCLQLLHFHIGSQIPS
Sbjct  251   GLRAKLRTKHSGHFGSTSGEKGKFGLSTAQILSVAQKLQRLEMLDCLQLLHFHIGSQIPS  310

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALL+DGVGEAA IYCEL RLGA M+VIDIGGGLGIDYDGS+S  S++SVGY L EYA+A
Sbjct  311   TALLSDGVGEAANIYCELARLGALMRVIDIGGGLGIDYDGSRSGGSDMSVGYGLDEYANA  370

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPN--PGLQSFV  1572
             VV+AV   CDRK V HP+ICSESGRA+VSH S+LIFEAVSS+S K     +  P     +
Sbjct  371   VVRAVMLACDRKHVGHPIICSESGRALVSHQSVLIFEAVSSTSTKSEASSSIWPNHACLL  430

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             + L DDA +DY NL AA++R E +T VLYA++LKQ+CVD FK+G L +E LAAVD +CDL
Sbjct  431   DELADDAHSDYHNLIAASLRRENETSVLYAEKLKQKCVDHFKDGILGLEHLAAVDAVCDL  490

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             VSK     DPV TY+VNLS+FTSIPDFWA GQLFPIVPIHRLD+RP  +GILSDLTCDSD
Sbjct  491   VSKEFDVADPVKTYHVNLSLFTSIPDFWAIGQLFPIVPIHRLDQRPVVKGILSDLTCDSD  550

Query  1211  GKIDKFVGGESSLPLHEL--GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSD  1038
             GK+D+F+GG+SSLPLHEL  GG  G YYLGMFLGGAY+EALGG HNLFG PSVVRVSQ+D
Sbjct  551   GKVDRFIGGQSSLPLHELERGGGAGGYYLGMFLGGAYQEALGGLHNLFGTPSVVRVSQAD  610

Query  1037  GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAE  921
             GP  F+VT A PG SC DVLR MQHEPE+MFETLK RAE
Sbjct  611   GPRCFAVTLAVPGASCTDVLRAMQHEPEVMFETLKQRAE  649



>gb|ACX56223.1| arginine decarboxylase [Humulus lupulus]
Length=554

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/554 (78%), Positives = 486/554 (88%), Gaps = 5/554 (1%)
 Frame = -3

Query  2594  HQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHY  2415
             HQEIDLLK+VKK SDPK +GGLGL LPL++R PDVLKNRLESLQSAF+ A++SQ Y +HY
Sbjct  1     HQEIDLLKIVKKVSDPKSVGGLGLPLPLVIRLPDVLKNRLESLQSAFDIAIQSQDYENHY  60

Query  2414  QGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKD  2235
             QGVYP+K NQDRFVVEDIVKFGS FRFGLEAGSKPELLLA+SC  +GSPD+ L+CNGFKD
Sbjct  61    QGVYPMKFNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAVSCYVQGSPDSFLVCNGFKD  120

Query  2234  AEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGST  2055
              EYISLAL ARKL LNTVIVLEQEEE+DL+I++SRK+++RPVIG RAKLRTKH+GHFGST
Sbjct  121   VEYISLALVARKLALNTVIVLEQEEELDLVIELSRKLSIRPVIGPRAKLRTKHSGHFGST  180

Query  2054  SGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCE  1875
             SGEKGKFGLTTTQILRVV+KL+++ M+D LQLLHFHIGSQIP+TALLADGV EAAQIYCE
Sbjct  181   SGEKGKFGLTTTQILRVVRKLEQAGMLDYLQLLHFHIGSQIPTTALLADGVSEAAQIYCE  240

Query  1874  LVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHP  1695
             LVRLGA M+VIDIGGGLGIDYDGSKS DSE+SV Y L+EYASAVV+A+R VCDR+ V HP
Sbjct  241   LVRLGAHMQVIDIGGGLGIDYDGSKSTDSEISVSYGLEEYASAVVRAIRLVCDRRSVWHP  300

Query  1694  VICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAI  1515
             ++CSESGRAIVSHHSILIFEAVS+SS     +    LQ FVE+L ++A ADY+NLSAAAI
Sbjct  301   IVCSESGRAIVSHHSILIFEAVSASSYDTPGMSPLDLQYFVETLSEEALADYKNLSAAAI  360

Query  1514  RGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLS  1335
             +GE DTC+ YADQLKQRC+DQFKEGSL +EQLAAVDG C+ V K +G      TY+VNLS
Sbjct  361   KGESDTCLFYADQLKQRCIDQFKEGSLGMEQLAAVDGFCEFVCKVLGVSGSTRTYHVNLS  420

Query  1334  VFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHEL-  1158
             VFTSIPDFW  GQLFPI+PIHRLD+RP ARGILSDLTCDSDGKIDKFVGGESSLPL+EL 
Sbjct  421   VFTSIPDFWGIGQLFPIIPIHRLDQRPAARGILSDLTCDSDGKIDKFVGGESSLPLYELE  480

Query  1157  ----GGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSC  990
                    G  Y+LGMFLGGAYEEALGG HNLFGGPSVVRVSQSDGPHSF+VTRA PGP C
Sbjct  481   GGNGNNGGCGYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAMPGPCC  540

Query  989   ADVLRVMQHEPELM  948
             +DVLR MQHEPELM
Sbjct  541   SDVLRAMQHEPELM  554



>ref|XP_008805579.1| PREDICTED: arginine decarboxylase-like [Phoenix dactylifera]
Length=692

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/634 (68%), Positives = 514/634 (81%), Gaps = 18/634 (3%)
 Frame = -3

Query  2822  YAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDH-SHWSPSMSAALYRIDGWGDPYFTV  2646
             Y FA   S   PE+L       P  A  P A  DH + WS  +SA LY+IDGWG PYF+V
Sbjct  14    YGFARTGSRIPPESL-------PGGA--PLAGRDHLTPWSTDLSAELYKIDGWGAPYFSV  64

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             N++G+I+VRPHG+ TL HQEIDL+K V+KA D KP GGLGL+LPL+VRFPDVL++RLESL
Sbjct  65    NAAGNIAVRPHGATTLPHQEIDLMKAVRKAVDQKPAGGLGLRLPLLVRFPDVLRHRLESL  124

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
              +AF+ AV S GYGS YQGVYPVKCNQDR+VVEDIV+ G+ F FGLEAGSKPELLLAMSC
Sbjct  125   HAAFDLAVRSNGYGSRYQGVYPVKCNQDRYVVEDIVEAGAPFHFGLEAGSKPELLLAMSC  184

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             L +GSP+A LICNG+KD EY+ LAL AR L LN ++VLEQEEE+  +++  R++ +RPVI
Sbjct  185   LLRGSPEAFLICNGYKDVEYVELALTARALGLNAIVVLEQEEELLTVVEAGRRLGIRPVI  244

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTKHAGHFGSTSGEKGKFGLT  QIL VV++LQ  EM+DCLQLLHFHIGSQIP+
Sbjct  245   GLRAKLRTKHAGHFGSTSGEKGKFGLTAAQILPVVRRLQRLEMLDCLQLLHFHIGSQIPT  304

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             TALLADGV EAAQIYCEL RLGA M+V+D+GGGLGIDYDG++SA S+ SVGY L+EYA+A
Sbjct  305   TALLADGVREAAQIYCELARLGAAMRVMDVGGGLGIDYDGTRSAGSDASVGYGLEEYAAA  364

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLP---NPGLQSF  1575
             VV+ VR  CDR+ + HP+ICSESGRA+VSHHS+L+FEA SSSS   +  P    P +   
Sbjct  365   VVRTVRDACDRRRMRHPIICSESGRALVSHHSVLVFEAFSSSSCSAVAEPVPIGPDVAHL  424

Query  1574  VESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICD  1395
             +E L      DY++L AAA+RGEY+TC+LYA+QLK+RCV++FKEG L +E LAAVDG+C+
Sbjct  425   LEGL-----VDYRSLVAAAVRGEYETCLLYAEQLKRRCVERFKEGLLGLEHLAAVDGLCE  479

Query  1394  LVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDS  1215
             +++K  G  +PV  Y+VNLSVFTS+PDFWA GQLFPI PIHRLD+RPG   +L DLTCDS
Sbjct  480   VLAKENGHAEPVRAYHVNLSVFTSLPDFWAIGQLFPIAPIHRLDQRPGVSAVLQDLTCDS  539

Query  1214  DGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDG  1035
             DGK+D+F+GG SSLP+HEL G  G Y+LGMFLGGAY+EALGG HNLF GPSVVRV QS+G
Sbjct  540   DGKVDRFIGGWSSLPVHELDGEDGGYFLGMFLGGAYQEALGGAHNLFAGPSVVRVEQSEG  599

Query  1034  PHSFSVTRAAPGPSCADVLRVMQHEPELMFETLK  933
             PH F+VTRA PG SCADVLR MQHEPE+MFE LK
Sbjct  600   PHCFAVTRAVPGASCADVLRAMQHEPEVMFEGLK  633



>gb|EYU40397.1| hypothetical protein MIMGU_mgv1a020386mg [Erythranthe guttata]
Length=659

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/621 (71%), Positives = 511/621 (82%), Gaps = 22/621 (4%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKAS--Dpkpl  2538
             WSP+ S+ LYR++GWG PYFTVNS+G+ISVRPHG+ TL+HQEIDLLKVVKKAS  +    
Sbjct  23    WSPADSSRLYRVEGWGAPYFTVNSNGNISVRPHGAQTLAHQEIDLLKVVKKASGPETSDG  82

Query  2537  gglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIV  2358
               LGL LPL+VRFPDVLKNRLESLQS+F+ A+ESQ Y SHYQGVYPVKCNQD+FVVEDIV
Sbjct  83    LELGLGLPLVVRFPDVLKNRLESLQSSFDSAIESQKYNSHYQGVYPVKCNQDKFVVEDIV  142

Query  2357  KFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVI  2178
             KFGS F+FGLEAGSKPELLLAMS LC GSPDALL+CNGFKD E++SLAL A+KL LNTVI
Sbjct  143   KFGSGFKFGLEAGSKPELLLAMSSLCSGSPDALLVCNGFKDVEFVSLALVAKKLHLNTVI  202

Query  2177  VLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVK  1998
             VLEQEEE+D++I++S+K+ VRPVIG RAKLRTKH+GHFGSTSGEKGKFGLTT+Q+LRVVK
Sbjct  203   VLEQEEELDIVIEVSKKLGVRPVIGARAKLRTKHSGHFGSTSGEKGKFGLTTSQLLRVVK  262

Query  1997  KLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgi  1818
             KL++ EM+DCL++LHFHIGSQIPST LLAD V EAAQIYCELVRLGA M VID+GGGLGI
Sbjct  263   KLRDYEMLDCLRMLHFHIGSQIPSTNLLADAVDEAAQIYCELVRLGAHMGVIDVGGGLGI  322

Query  1817  dydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIF  1638
             DYDGSKS+DS+ SV YTLQ+YASAVV++VR VCD +GV HP+ICSESGRAIVSHHSIL+F
Sbjct  323   DYDGSKSSDSKNSVAYTLQDYASAVVRSVRSVCDSRGVKHPIICSESGRAIVSHHSILVF  382

Query  1637  EAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTC------------  1494
             EAVS+S+      P      F E LKDDA A+Y+NLSAAA + +Y++C            
Sbjct  383   EAVSNSTSS-CNSPEISSLDFEEQLKDDALANYRNLSAAAAKNDYESCLNYAEQLKERRV  441

Query  1493  --VLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSI  1320
               + YA+QLK+RCV QFK+GSL +E++AAVD  C+L+ K IG  +PV TY+VNLS+FTSI
Sbjct  442   EQLNYAEQLKERCVKQFKKGSLGMEEMAAVDARCELMFKEIGFPEPVSTYHVNLSIFTSI  501

Query  1319  PDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLH----ELGG  1152
             PDFW   QLFPI+PIHRL E P    ILSDLTCDSDGKIDKF+GG+SSL LH      G 
Sbjct  502   PDFWGIDQLFPIIPIHRLTESPKKEAILSDLTCDSDGKIDKFIGGKSSLRLHELGEGGGK  561

Query  1151  NGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVT-RAAPGPSCADVLR  975
               G YYLGMFLGGAYEEALGG HNLFG PSVVRVSQSDGP SF+V   A PG SC DVLR
Sbjct  562   GNGGYYLGMFLGGAYEEALGGVHNLFGRPSVVRVSQSDGPQSFAVMDDAVPGASCGDVLR  621

Query  974   VMQHEPELMFETLKHRAEEFL  912
              M H PE+M +TLK R++EF+
Sbjct  622   AMNHNPEVMLKTLKARSDEFV  642



>ref|NP_001234649.1| arginine decarboxylase [Solanum lycopersicum]
 sp|P49726.1|SPE1_SOLLC RecName: Full=Arginine decarboxylase; Short=ADC; Short=ARGDC 
[Solanum lycopersicum]
 gb|AAA61347.1| arginine decarboxylase [Solanum lycopersicum]
Length=502

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/499 (83%), Positives = 457/499 (92%), Gaps = 2/499 (0%)
 Frame = -3

Query  2510  IVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFG  2331
             +VRFPDVLKNRLE+LQSAF+ A+ SQGY +HYQGVYPVKCNQDRFVVEDIVKFGS +RFG
Sbjct  4     VVRFPDVLKNRLETLQSAFDMAINSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSPYRFG  63

Query  2330  LEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVD  2151
             LEAGSKPELLLAM+CL KGS DALL+CNGFKD EYISLAL ARKLLLN+VIVLEQEEE+D
Sbjct  64    LEAGSKPELLLAMNCLSKGSADALLVCNGFKDTEYISLALVARKLLLNSVIVLEQEEELD  123

Query  2150  LIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMID  1971
             L+IDISRKM+VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVVKKL ES M+D
Sbjct  124   LVIDISRKMSVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVKKLDESGMLD  183

Query  1970  CLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSAD  1791
             CLQLLHFHIGSQIP+T LLADGVGEA QIY ELVRLGA MK IDIGGGLGIDYDGSKS++
Sbjct  184   CLQLLHFHIGSQIPTTELLADGVGEATQIYSELVRLGAGMKFIDIGGGLGIDYDGSKSSN  243

Query  1790  SEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDK  1611
             S+VSV Y+++EYASAVVQAV +VCDRKG  HPVICSESGRAIVSHHSILIFEAVS+S+  
Sbjct  244   SDVSVCYSIEEYASAVVQAVLYVCDRKGGKHPVICSESGRAIVSHHSILIFEAVSASTSH  303

Query  1610  LLQLPNP-GLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSL  1434
             +   P+  GLQS VE+L +DARADY+NLSAAA+RGEYDTC++Y+DQLKQRCV+QFK+GSL
Sbjct  304   VSTQPSSGGLQSLVETLNEDARADYRNLSAAAVRGEYDTCLIYSDQLKQRCVEQFKDGSL  363

Query  1433  SIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERP  1254
              IEQLAAVD ICD VSKAIG  DPV TY+VNLSVFTSIPDFW F QLFPIVPIHRLDE+P
Sbjct  364   DIEQLAAVDSICDWVSKAIGVADPVRTYHVNLSVFTSIPDFWGFSQLFPIVPIHRLDEKP  423

Query  1253  GARGILSDLTCDSDGKIDKFVGGESSLPLHELG-GNGGRYYLGMFLGGAYEEALGGFHNL  1077
               RGILSDLTCDSDGK+DKF+GGESSLPLHE+G G+GGRYYLGMFLGGAYEEALGG HNL
Sbjct  424   TMRGILSDLTCDSDGKVDKFIGGESSLPLHEIGSGDGGRYYLGMFLGGAYEEALGGLHNL  483

Query  1076  FGGPSVVRVSQSDGPHSFS  1020
             FGGPSVVRV QSD PHSF+
Sbjct  484   FGGPSVVRVMQSDSPHSFA  502



>emb|CDX69081.1| BnaC01g03720D [Brassica napus]
Length=649

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/632 (69%), Positives = 512/632 (81%), Gaps = 17/632 (3%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             W+PS+SA+LYRIDGWG PYFT NSSG+ISVRPHGS TL HQ+IDLLKVVK  +DPK   G
Sbjct  22    WNPSLSASLYRIDGWGAPYFTANSSGNISVRPHGSDTLPHQDIDLLKVVKNLTDPKASCG  81

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPLIVRFPDVLKNRLE LQSAF+ AV+SQGYGSHYQGVYPVKCNQDRF+VEDIV F
Sbjct  82    LGLQLPLIVRFPDVLKNRLECLQSAFDSAVKSQGYGSHYQGVYPVKCNQDRFIVEDIVNF  141

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAG KPE+LLAMSCLCKG+PDA LICNGFKD+EY+SLAL  RKL LNTVIVL
Sbjct  142   GSPFRFGLEAGCKPEVLLAMSCLCKGNPDAFLICNGFKDSEYVSLALLGRKLELNTVIVL  201

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQE E+DL+ID+S+KM VRPVIGLRAKLRTK + ++GS SGEKGKFGLT+ QI+RV  KL
Sbjct  202   EQEHELDLVIDLSKKMNVRPVIGLRAKLRTKQSNYYGSNSGEKGKFGLTSAQIVRVEAKL  261

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGS IP+T+LL+DGV EAA IYCELVRLGA M++ID+GGGLGIDY
Sbjct  262   RESGMLDCLQLLHFHIGSMIPTTSLLSDGVSEAALIYCELVRLGAHMRIIDVGGGLGIDY  321

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DGSKS + ++SV YTL+EYA AVV ++R VCDR+ V HPVICSESGRAIVSHHS+LIFEA
Sbjct  322   DGSKSGEGDISVAYTLEEYAEAVVASIRCVCDRRSVKHPVICSESGRAIVSHHSVLIFEA  381

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             V   + +    P P    F+   ++D       L AA +RG+ +  +LY +QLKQRCV+ 
Sbjct  382   VKPVAHQ----PKPDDIQFLLEGEED-------LYAAVMRGDQERSLLYVEQLKQRCVEG  430

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIH  1272
             FK+G LSIEQL ++DG+C+ V KAIG  DPV TYN+NLS+FTS    W  G LFPIVPIH
Sbjct  431   FKDGVLSIEQLGSIDGLCEWVLKAIGRSDPVQTYNINLSIFTSTSSHWGMGHLFPIVPIH  490

Query  1271  RLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALG  1092
             +LD++P A GILSD+TCDS+GKI KF+GGESSL LHE+  + GRY+LG+FLGGAYEE++G
Sbjct  491   KLDQKPKACGILSDITCDSEGKIVKFIGGESSLRLHEI-DSSGRYFLGLFLGGAYEESMG  549

Query  1091  GFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL  912
             G +NLFGG SVVRVSQSDGPHSF VTRA PG S +DVLR +QHEPELM +TLKHRAEE +
Sbjct  550   GVYNLFGGLSVVRVSQSDGPHSFVVTRAVPGQSSSDVLRAVQHEPELMLQTLKHRAEEVM  609

Query  911   HDEDNGGMafaslasslans-----FHNMPYL  831
             H +  G             +     FHNMPYL
Sbjct  610   HTKGGGEEKEEDDEYKNVAACLDRSFHNMPYL  641



>ref|NP_001056695.1| Os06g0131300 [Oryza sativa Japonica Group]
 sp|Q9SNN0.1|SPE1_ORYSJ RecName: Full=Arginine decarboxylase 1; Short=ARGDC1; Short=OsADC1 
[Oryza sativa Japonica Group]
 dbj|BAA84799.1| arginine decarboxylase [Oryza sativa Japonica Group]
 gb|AAT37534.1| arginine decarboxylase [Oryza sativa]
 dbj|BAF18609.1| Os06g0131300 [Oryza sativa Japonica Group]
 gb|EAY99523.1| hypothetical protein OsI_21492 [Oryza sativa Indica Group]
Length=702

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/603 (70%), Positives = 505/603 (84%), Gaps = 5/603 (1%)
 Frame = -3

Query  2723  DHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpk  2544
             D + WS  +S+ALY +DGWG PYF VN  GD++VRPHG+ATL  QEIDL KVV KA+ P+
Sbjct  42    DAAAWSADLSSALYNVDGWGAPYFFVNDDGDVAVRPHGAATLPGQEIDLAKVVAKAAGPR  101

Query  2543  plgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVED  2364
               GGLGL LPL+VRFPDVL++R+E+L +AF++AV S GYG  YQGVYPVKCNQDR VVED
Sbjct  102   SGGGLGLPLPLLVRFPDVLRHRVEALNAAFDYAVRSTGYGGRYQGVYPVKCNQDRHVVED  161

Query  2363  IVKFGSSFRFGLEAGSKPELLLAMSCLC-KGSPDALLICNGFKDAEYISLALAARKLLLN  2187
             IV+FG  FRFGLEAGSKPELLLAMSCL  +G+PDALLICNG+KD EY+SLAL AR + LN
Sbjct  162   IVEFGEPFRFGLEAGSKPELLLAMSCLAARGNPDALLICNGYKDDEYVSLALIARTMGLN  221

Query  2186  TVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILR  2007
             TVIVLEQEEE+D+++D SR++ VRPV+G+RAKLRTKHAGHFGSTSGEKGKFGL   QIL 
Sbjct  222   TVIVLEQEEELDIVVDASRRLGVRPVVGMRAKLRTKHAGHFGSTSGEKGKFGLNAAQILS  281

Query  2006  VVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggg  1827
             VV KL+   M+DCLQLLHFHIGSQIP+TALL DGVGEAAQIYCEL RLGA M+VID+GGG
Sbjct  282   VVAKLKTLGMLDCLQLLHFHIGSQIPTTALLGDGVGEAAQIYCELARLGAAMRVIDVGGG  341

Query  1826  lgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSI  1647
             LGIDYDGS SA +++SV Y+L+EYA+AVV AV  VCDRKGV+HP+ICSESGRA+VSHHS+
Sbjct  342   LGIDYDGSHSAQTDMSVAYSLEEYAAAVVAAVGRVCDRKGVAHPIICSESGRALVSHHSV  401

Query  1646  LIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQ  1467
             L+FEA S+S+   +   +P     ++ L DD  ADY+NL AAA+RG++DTC LYADQLK+
Sbjct  402   LVFEAFSASAPGRI---DPATGYLLDELTDDCHADYRNLMAAAVRGDFDTCALYADQLKR  458

Query  1466  RCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFP  1287
             RC DQFK+G L +E LAAVD +C++V++ +GA +P  TY++NLSVFTS+PD WA GQ+FP
Sbjct  459   RCADQFKDGVLGLEHLAAVDSLCEIVARGMGAAEPPRTYHINLSVFTSLPDMWAIGQMFP  518

Query  1286  IVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGA  1110
             I+PI RL ERP   G+LSDLTCDSDGK+D F+GG  SLPLHEL  +G R YYLGMFLGGA
Sbjct  519   IIPIQRLGERPAVDGVLSDLTCDSDGKVDHFIGGRHSLPLHELPVHGTRGYYLGMFLGGA  578

Query  1109  YEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKH  930
             Y+EALGG HNLFGGPSVVRVSQSDGPH F+VTRAA GPSCADVLR MQHEPE+MFE LK 
Sbjct  579   YQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAAGPSCADVLRSMQHEPEVMFEVLKQ  638

Query  929   RAE  921
             R +
Sbjct  639   RTD  641



>gb|ABY47890.1| arginine decarboxylase [Oryza sativa Japonica Group]
Length=702

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/603 (70%), Positives = 505/603 (84%), Gaps = 5/603 (1%)
 Frame = -3

Query  2723  DHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpk  2544
             D + WS  +S+ALY +DGWG PYF VN  GD++VRPHG+ATL  QEIDL KVV KA+ P+
Sbjct  42    DAAAWSADLSSALYNVDGWGAPYFFVNDDGDVAVRPHGAATLPGQEIDLAKVVAKAAGPR  101

Query  2543  plgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVED  2364
               GGLGL LPL+VRFPDVL++R+E+L +AF++AV S GYG  YQGVYPVKCNQDR VVED
Sbjct  102   SGGGLGLPLPLLVRFPDVLRHRVEALNAAFDYAVRSTGYGGRYQGVYPVKCNQDRHVVED  161

Query  2363  IVKFGSSFRFGLEAGSKPELLLAMSCLC-KGSPDALLICNGFKDAEYISLALAARKLLLN  2187
             IV+FG  FRFGLEAGSKPELLLAMSCL  +G+PDALLICNG+KD EY+SLAL AR + LN
Sbjct  162   IVEFGEPFRFGLEAGSKPELLLAMSCLAARGNPDALLICNGYKDDEYVSLALIARTMGLN  221

Query  2186  TVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILR  2007
             TVIVLEQEEE+D+++D SR++ VRPV+G+RAKLRTKHAGHFGSTSGEKGKFGL   QIL 
Sbjct  222   TVIVLEQEEELDIMVDASRRLGVRPVVGMRAKLRTKHAGHFGSTSGEKGKFGLNAAQILS  281

Query  2006  VVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggg  1827
             VV KL+   M+DCLQLLHFHIGSQIP+TALL DGVGEAAQIYCEL RLGA M+VID+GGG
Sbjct  282   VVAKLKTLGMLDCLQLLHFHIGSQIPTTALLGDGVGEAAQIYCELARLGAAMRVIDVGGG  341

Query  1826  lgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSI  1647
             LGIDYDGS SA +++SV Y+L+EYA+AVV AV  VCDRKGV+HP+ICSESGRA+VSHHS+
Sbjct  342   LGIDYDGSHSAQTDMSVAYSLEEYAAAVVAAVGRVCDRKGVAHPIICSESGRALVSHHSV  401

Query  1646  LIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQ  1467
             L+FEA S+S+   +   +P     ++ L DD  ADY+NL AAA+RG++DTC LYADQLK+
Sbjct  402   LVFEAFSASAPGRI---DPATGYLLDELTDDCHADYRNLMAAAVRGDFDTCALYADQLKR  458

Query  1466  RCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFP  1287
             RC DQFK+G L +E LAAVD +C++V++ +GA +P  TY++NLSVFTS+PD WA GQ+FP
Sbjct  459   RCADQFKDGVLGLEHLAAVDSLCEIVARGMGAAEPPRTYHINLSVFTSLPDMWAIGQMFP  518

Query  1286  IVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGA  1110
             I+PI RL ERP   G+LSDLTCDSDGK+D F+GG  SLPLHEL  +G R YYLGMFLGGA
Sbjct  519   IIPIQRLGERPAVDGVLSDLTCDSDGKVDHFIGGRHSLPLHELPVHGTRGYYLGMFLGGA  578

Query  1109  YEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKH  930
             Y+EALGG HNLFGGPSVVRVSQSDGPH F+VTRAA GPSCADVLR MQHEPE+MFE LK 
Sbjct  579   YQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAAGPSCADVLRSMQHEPEVMFEVLKQ  638

Query  929   RAE  921
             R +
Sbjct  639   RTD  641



>ref|XP_008659338.1| PREDICTED: arginine decarboxylase 1 [Zea mays]
 gb|AFW86010.1| hypothetical protein ZEAMMB73_526584 [Zea mays]
Length=694

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/638 (67%), Positives = 513/638 (80%), Gaps = 9/638 (1%)
 Frame = -3

Query  2819  AFAWDRSLPAPEALVSSDA---PLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFT  2649
             A A D + P   A  S DA   P P   V P A+ + + WS  +SAALY +DGWG PYF 
Sbjct  3     ALAVDAATPVAHAFASCDAARFPAPP-VVGPAAAAEAAPWSADLSAALYNVDGWGAPYFF  61

Query  2648  VNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLES  2469
             VN  GD++VRPHG+ATL  QEIDL KVV KA+ P+  GGLGL LPL+VRFPDVL++R+E+
Sbjct  62    VNDDGDVAVRPHGAATLPGQEIDLAKVVAKAAGPRAGGGLGLPLPLLVRFPDVLRHRVET  121

Query  2468  LQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMS  2289
             L +AF +AV S GYGS YQGVYPVKCNQDR+VVEDIV+FG+ F FGLEAGSKPELLLAMS
Sbjct  122   LNAAFGYAVRSTGYGSRYQGVYPVKCNQDRYVVEDIVEFGAPFGFGLEAGSKPELLLAMS  181

Query  2288  CLC-KGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRP  2112
             CL  +G  DALLICNG+KD  Y+SLAL AR + LNTVIVLEQEEE+D++++ SR++ VRP
Sbjct  182   CLAARGGLDALLICNGYKDDGYVSLALMARSMGLNTVIVLEQEEELDIVVEASRRLGVRP  241

Query  2111  VIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQI  1932
             V+G+RAKLRTKHAGHFGSTSGEKGKFGL+  QIL VV KL+   M+DCLQLLHFHIGSQI
Sbjct  242   VVGMRAKLRTKHAGHFGSTSGEKGKFGLSAAQILSVVTKLKAIGMLDCLQLLHFHIGSQI  301

Query  1931  PSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYA  1752
             P+TALL+DGVGEAAQIYCEL RLGA M+VID+GGGLGIDYDG+ SA +++SV Y+L+EYA
Sbjct  302   PTTALLSDGVGEAAQIYCELARLGADMRVIDVGGGLGIDYDGTHSAQTDMSVAYSLEEYA  361

Query  1751  SAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFV  1572
              AVV AV  VCDRKGV HP+ICSESGRA+VSHHS+L+FEA S+++   L   +      +
Sbjct  362   GAVVAAVGRVCDRKGVQHPIICSESGRALVSHHSVLVFEAFSATAPGRL---DAATAYLL  418

Query  1571  ESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDL  1392
             + L DD RADY+N+ AAA+RG+YDTC LYADQLK+R  +QFKEG L +E LAAVD  C+L
Sbjct  419   DELTDDCRADYRNVMAAAVRGDYDTCGLYADQLKRRSAEQFKEGVLGLEHLAAVDAFCEL  478

Query  1391  VSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             V++ +GA +P  TY++NLSVFTS+PD WA GQ FPI+PI RL ERP   G+LSDLTCDSD
Sbjct  479   VARGMGAPEPPRTYHINLSVFTSLPDMWAIGQQFPIIPIQRLQERPAVDGVLSDLTCDSD  538

Query  1211  GKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDG  1035
             GK+ +F+GG  SLPLHEL  +  R YYLGMFLGGAY+EALGG HNLFGGPSVVRVSQ DG
Sbjct  539   GKVSEFIGGRHSLPLHELPTHATRGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQCDG  598

Query  1034  PHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAE  921
             PH F+VTRAA GPSCADVLR MQHEPE+M+E LK R +
Sbjct  599   PHCFAVTRAAAGPSCADVLRAMQHEPEVMYEVLKQRTD  636



>emb|CDX75456.1| BnaA01g02460D [Brassica napus]
Length=648

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/633 (69%), Positives = 510/633 (81%), Gaps = 20/633 (3%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             W+PS+SA+LYRIDGWG PYFT NSSG+ISVRPHGS TL HQ+IDLLKVVK  + PK  GG
Sbjct  22    WNPSLSASLYRIDGWGAPYFTANSSGNISVRPHGSDTLPHQDIDLLKVVKHLTHPKASGG  81

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPLIVRFPDVLKNRLE LQSAF+ AV+SQGYGS+YQGVYPVKC+QDRF+VEDIV F
Sbjct  82    LGLQLPLIVRFPDVLKNRLECLQSAFDSAVKSQGYGSYYQGVYPVKCHQDRFIVEDIVNF  141

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAG KPE+LLAMSCLCK +P+A LICNGFKDAEY+SLAL  RKL LNTVIVL
Sbjct  142   GSPFRFGLEAGCKPEILLAMSCLCKSNPEAFLICNGFKDAEYVSLALLGRKLALNTVIVL  201

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQE E+DL+ID+S+KM VRPVIGLRAKLRTK   ++GS SGEKGKFGLT+ QI+ VV KL
Sbjct  202   EQEHELDLVIDLSKKMNVRPVIGLRAKLRTKQTNYYGSNSGEKGKFGLTSAQIVCVVAKL  261

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGS IP+T+LL+DGV EAA IYCELVRLGA M+VID+GGGLGIDY
Sbjct  262   RESGMLDCLQLLHFHIGSMIPTTSLLSDGVSEAALIYCELVRLGAHMRVIDVGGGLGIDY  321

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DGSKS + ++SV YTL+EYA AVV ++R+VCDR+ V HPVICSESGRAIVSHHS+LIFEA
Sbjct  322   DGSKSGEGDISVAYTLEEYAEAVVASIRYVCDRRSVKHPVICSESGRAIVSHHSVLIFEA  381

Query  1631  VSSSSDKLLQLPNP-GLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVD  1455
             V   + +    P P  +Q  +E  +D        L  A +RG+ +  +LY DQLKQRCV+
Sbjct  382   VKPMAHQ----PKPDDIQLLLEGEED--------LYTAVMRGDQEKSLLYVDQLKQRCVE  429

Query  1454  QFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPI  1275
              FK+G L+IEQL ++DG+C+ V KAIG  DPV TYN+NLS+FTS    W  G LFPI PI
Sbjct  430   GFKDGVLNIEQLGSIDGLCEWVLKAIGRSDPVQTYNINLSIFTSTSSHWGMGHLFPIAPI  489

Query  1274  HRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEAL  1095
             H+LD+ P A GILSD+TCDS+GKI KF+GGESSLPLHE+  + GRY+LG+FLGGAYEE++
Sbjct  490   HKLDQEPKACGILSDITCDSEGKIVKFIGGESSLPLHEI--DNGRYFLGLFLGGAYEESM  547

Query  1094  GGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEF  915
             GG +NLFGG SVVRVSQ+DGPHSF VTRA PG S +DVLR +QHEPELM +TLKHRAEE 
Sbjct  548   GGVYNLFGGLSVVRVSQNDGPHSFVVTRAVPGQSSSDVLRAVQHEPELMLQTLKHRAEEV  607

Query  914   LHDEDNGGMafaslasslans-----FHNMPYL  831
             +H +  G             +     FHNMPYL
Sbjct  608   MHTKRGGEEKEEDDEYKNVAACLDRSFHNMPYL  640



>dbj|BAJ94285.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/600 (70%), Positives = 503/600 (84%), Gaps = 3/600 (1%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WS  +S+ALY +DGWG PYF VN  GD++VRPHG+ATL  QEIDL KVV +A+  +  GG
Sbjct  50    WSADLSSALYNVDGWGAPYFFVNDDGDVAVRPHGAATLPGQEIDLAKVVARAAGARSGGG  109

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGL LPL+VRFPDVL++R+E+L +AF++AV S GY   YQGVYPVKCNQDR+VVEDIV+F
Sbjct  110   LGLALPLLVRFPDVLRHRVETLNAAFDYAVRSTGYAGRYQGVYPVKCNQDRYVVEDIVEF  169

Query  2351  GSSFRFGLEAGSKPELLLAMSCL-CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIV  2175
             G+ F FGLEAGSKPELLL MSCL  +GSPDALLICNG+KD EY+SLAL AR + LNTVIV
Sbjct  170   GAPFGFGLEAGSKPELLLTMSCLVARGSPDALLICNGYKDLEYVSLALIARTMGLNTVIV  229

Query  2174  LEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKK  1995
             LEQEEE+D++++ SR++ +RPV+G+RAKLRTKHAGHFG+TSGEKGKFGL   QIL VV K
Sbjct  230   LEQEEELDIVVEASRRLNIRPVVGMRAKLRTKHAGHFGATSGEKGKFGLNAAQILSVVAK  289

Query  1994  LQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgid  1815
             L+   M+DCLQLLHFHIGSQIP+TALLADGVGEAAQIYCEL RLGA M+VID+GGGLGID
Sbjct  290   LKALGMLDCLQLLHFHIGSQIPTTALLADGVGEAAQIYCELARLGAAMRVIDVGGGLGID  349

Query  1814  ydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFE  1635
             YDG+ SA++++SV Y+L+EYA+AVV AV  VCDRKGV HPVICSESGRA+VSHHS+LIFE
Sbjct  350   YDGTHSAETDMSVAYSLEEYAAAVVAAVGRVCDRKGVQHPVICSESGRALVSHHSVLIFE  409

Query  1634  AVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVD  1455
             A S+++     + +P     ++ L DD R DY+NL A+A+RG++DTC LYADQLK+RC +
Sbjct  410   AFSATAPA-SNMMDPATAYLLDELTDDCRNDYRNLMASAVRGDFDTCGLYADQLKRRCAE  468

Query  1454  QFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPI  1275
             QFKEG L +E LAAVDG+C++V++ +GA +    Y++NLSVFTS+PD WA  QLFPI+PI
Sbjct  469   QFKEGVLGLEHLAAVDGLCEIVARGMGAAEGPRRYHINLSVFTSLPDMWAIEQLFPIIPI  528

Query  1274  HRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGAYEEA  1098
              RL ERP   G+LSDLTCDSDGK+D+F+GG SSLPLHEL  +G R YYLGMFLGGAY+EA
Sbjct  529   QRLQERPAVDGVLSDLTCDSDGKVDQFIGGRSSLPLHELPSHGTRGYYLGMFLGGAYQEA  588

Query  1097  LGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEE  918
             LGG HNLFGGPSVVRVSQSDGPH F+VTRAAPGPSCADVLR MQHEPE+MFE LK R  +
Sbjct  589   LGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAPGPSCADVLRAMQHEPEVMFEVLKQRTTD  648



>ref|XP_004964433.1| PREDICTED: arginine decarboxylase 1-like [Setaria italica]
Length=704

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/644 (67%), Positives = 514/644 (80%), Gaps = 13/644 (2%)
 Frame = -3

Query  2819  AFAWDRSLPAPEALVSSDA---PLPTNAVPPTASVDHSH-----WSPSMSAALYRIDGWG  2664
             A A D + P   A  S DA   P P  AVP +A+          WS  +SAALY +DGWG
Sbjct  3     ALAVDAATPVAHAFASCDAARFPAPLMAVPTSATAAADKPEAAAWSADLSAALYNVDGWG  62

Query  2663  DPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLK  2484
              PYF VN  GD++VRPHG+ATL  QEIDL KVV KA+ P+  GGLGL LPL+VRFPDVL+
Sbjct  63    APYFFVNDDGDVAVRPHGAATLPGQEIDLAKVVAKAAGPRDGGGLGLPLPLLVRFPDVLR  122

Query  2483  NRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEL  2304
             +R+E+L +AF++AV S GYGS YQGVYPVKCNQDR+VVEDIV+FG  FRFGLEAGSKPEL
Sbjct  123   HRVETLNAAFDYAVRSTGYGSRYQGVYPVKCNQDRYVVEDIVEFGEPFRFGLEAGSKPEL  182

Query  2303  LLAMSCLC-KGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRK  2127
             LLAMSCL  +G+PDALL+CNG+KD  Y+SLAL AR + LNTVIVLEQEEE+D++++ SR+
Sbjct  183   LLAMSCLAARGNPDALLVCNGYKDDGYVSLALTARTMGLNTVIVLEQEEELDIVLEASRR  242

Query  2126  MAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFH  1947
             + VRPV+G+RAKLRTKHAGH GSTSGEKGKFGL   QIL VV KL+   M+DCLQLLHFH
Sbjct  243   LGVRPVVGMRAKLRTKHAGHLGSTSGEKGKFGLNAAQILSVVTKLKAVGMLDCLQLLHFH  302

Query  1946  IGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYT  1767
             IGSQIP+TALL+DGVGEAAQIYCEL RLGA M+VID+GGGLGIDYDG+ SA +++SV Y+
Sbjct  303   IGSQIPTTALLSDGVGEAAQIYCELARLGAGMRVIDVGGGLGIDYDGTHSAQTDMSVAYS  362

Query  1766  LQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPG  1587
             L+EYA AVV AV  VCDRKGV HP+ICSESGRA+VSHHS+L+FEA S+++   L   +  
Sbjct  363   LEEYAVAVVAAVGRVCDRKGVQHPIICSESGRALVSHHSVLVFEAFSATAPGQL---DAA  419

Query  1586  LQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVD  1407
                 ++ L DD RADY+N+ AAA+RG+YDTC LY DQLK+R  +QFKEG L +E LAAVD
Sbjct  420   TAYLLDELTDDCRADYRNVMAAAVRGDYDTCGLYVDQLKRRSAEQFKEGVLGLEHLAAVD  479

Query  1406  GICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDL  1227
               C++V++ +GA +   TY++NLSVFTS+PD WA GQ FPI+PI RL ERP   G+LSDL
Sbjct  480   AFCEIVARGMGAPEAPRTYHINLSVFTSLPDMWAIGQQFPIIPIQRLQERPAVDGVLSDL  539

Query  1226  TCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGAYEEALGGFHNLFGGPSVVRV  1050
             TCDSDGK+ +F+GG  SLPLHEL  +  R YYLGMFLGGAY+EALGG HNLFGGPSVVRV
Sbjct  540   TCDSDGKVCEFIGGRHSLPLHELPTHATRGYYLGMFLGGAYQEALGGLHNLFGGPSVVRV  599

Query  1049  SQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEE  918
             +QSDGPH F+VTRAA GPSCADVLR MQHEPE+MFE LK R ++
Sbjct  600   TQSDGPHCFAVTRAAAGPSCADVLRAMQHEPEVMFEVLKQRTDD  643



>ref|XP_003557137.1| PREDICTED: arginine decarboxylase 1 [Brachypodium distachyon]
Length=710

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/606 (70%), Positives = 502/606 (83%), Gaps = 12/606 (2%)
 Frame = -3

Query  2726  VDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDp  2547
             V  + WS  +S+ALY +DGWG PYF VN  GDI+VRPHG+ATL  QEIDL KVV +A+ P
Sbjct  49    VGAAAWSADLSSALYNVDGWGAPYFFVNDDGDIAVRPHGAATLPGQEIDLAKVVARAAGP  108

Query  2546  kplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVE  2367
                GGLGL LPL+VRFPDVL++R+ESL +AF++AV S GYG  YQGVYPVKCNQDR+VVE
Sbjct  109   SAGGGLGLPLPLLVRFPDVLRHRVESLNAAFDYAVRSTGYGGRYQGVYPVKCNQDRYVVE  168

Query  2366  DIVKFGSSFRFGLEAGSKPELLLAMSCL-CKGSPDALLICNGFKDAEYISLALAARKLLL  2190
             DIV+FG+ F FGLEAGSKPELLL MSCL  +GSPDALL+CNG+KD EY+SLAL AR + L
Sbjct  169   DIVEFGAPFGFGLEAGSKPELLLTMSCLVARGSPDALLVCNGYKDLEYVSLALIARTMGL  228

Query  2189  NTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQIL  2010
             NTVIVLEQEEE+D++++ SR++ +RPV+G+RAKLRTKHAGHFG+TSGEKGKFGL   QIL
Sbjct  229   NTVIVLEQEEELDIVVEASRRLDIRPVVGMRAKLRTKHAGHFGATSGEKGKFGLNAAQIL  288

Query  2009  RVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidigg  1830
              VV KL+   M+DCLQLLHFHIGSQIP+TALLADGVGEAAQIYCEL R+GA M+VID+GG
Sbjct  289   SVVSKLKALGMLDCLQLLHFHIGSQIPTTALLADGVGEAAQIYCELARMGAAMRVIDVGG  348

Query  1829  glgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHS  1650
             GLGIDYDG+ SA +++SV Y+L+EYA+AVV AV  VCDRKGV HPVICSESGRA+VSHHS
Sbjct  349   GLGIDYDGTHSAQTDMSVAYSLEEYAAAVVAAVGRVCDRKGVQHPVICSESGRALVSHHS  408

Query  1649  ILIFEAVSSSSDKLLQLPNPGLQS----FVESLKDDARADYQNLSAAAIRGEYDTCVLYA  1482
             +L+FEA S+S+      P   + S     ++ L DD R DY+NL AAA+RG+++TC LYA
Sbjct  409   VLVFEAFSASA------PAANIDSATAYLLDELTDDCRNDYRNLMAAAVRGDFETCALYA  462

Query  1481  DQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAF  1302
             DQLK+RC +QFKEG L +E LAAVDG+C++V++ +G  +   TYN+NLSVFTS+PD WA 
Sbjct  463   DQLKRRCAEQFKEGVLGLEHLAAVDGLCEIVARGMGVAERPRTYNINLSVFTSLPDMWAI  522

Query  1301  GQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGM  1125
              Q FPI+PI RL ERP   GILSDLTCDSDGK+D+F+GG  SLPLHEL  +G R YYLGM
Sbjct  523   EQQFPIIPIQRLQERPAIDGILSDLTCDSDGKVDQFIGGRHSLPLHELPSHGTRGYYLGM  582

Query  1124  FLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMF  945
             FLGGAY+EALGG HNLFGGPSVVRVSQSDGPH F+VTRAAPGPSCADVLR MQHEPE+MF
Sbjct  583   FLGGAYQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAPGPSCADVLRAMQHEPEVMF  642

Query  944   ETLKHR  927
             E LK R
Sbjct  643   EVLKQR  648



>ref|XP_002437758.1| hypothetical protein SORBIDRAFT_10g002070 [Sorghum bicolor]
 gb|EER89125.1| hypothetical protein SORBIDRAFT_10g002070 [Sorghum bicolor]
Length=701

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/640 (67%), Positives = 509/640 (80%), Gaps = 10/640 (2%)
 Frame = -3

Query  2819  AFAWDRSLPAPEALVSSDAP-----LPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPY  2655
             A A D + P   A+ S DA       P       A+ D   WS  +SAALY +DGWG PY
Sbjct  3     ALAVDATTPVAHAIASCDAAARFPAPPVVGPAAAAAADPVPWSADLSAALYNVDGWGAPY  62

Query  2654  FTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRL  2475
             F VN  GD++VRPHG ATL  QEIDL KVV KA+ P+  GGLGL LPL+VRFPDVL++R+
Sbjct  63    FFVNDDGDVAVRPHGPATLPGQEIDLAKVVAKAAGPREGGGLGLPLPLLVRFPDVLRHRV  122

Query  2474  ESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLA  2295
             E+L +AF +AV S GYGS YQGVYPVKCNQDR+VVEDIV+FG+ F FGLEAGSKPELLLA
Sbjct  123   ETLNAAFGYAVRSTGYGSRYQGVYPVKCNQDRYVVEDIVEFGAPFGFGLEAGSKPELLLA  182

Query  2294  MSCLC-KGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAV  2118
             MSCL  +G+PDALLICNG+KD  Y+SLAL AR + LNTVIVLEQEEE+D++++ SR++ V
Sbjct  183   MSCLAARGNPDALLICNGYKDDGYVSLALMARSMGLNTVIVLEQEEELDIVVEASRRLGV  242

Query  2117  RPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGS  1938
             RPV+G+RAKLRTKHAGHFGSTSGEKGKFGL   QIL VV KL+   M+DCLQLLHFHIGS
Sbjct  243   RPVVGMRAKLRTKHAGHFGSTSGEKGKFGLNAAQILSVVTKLKAIAMLDCLQLLHFHIGS  302

Query  1937  QIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQE  1758
             QIP+TALL+DGVGEAAQIYCEL RLGA M+VID+GGGLGIDYDG+ SA +++SV Y+L+E
Sbjct  303   QIPTTALLSDGVGEAAQIYCELARLGADMRVIDVGGGLGIDYDGTHSAQTDMSVAYSLEE  362

Query  1757  YASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQS  1578
             YA+AVV AV  VCDRK V HP+ICSESGRA+VSHHS+L+FEA S+++   L   +     
Sbjct  363   YATAVVAAVGRVCDRKVVQHPIICSESGRALVSHHSVLVFEAFSATAPGRL---DAATAY  419

Query  1577  FVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGIC  1398
              ++ L DD R DY+N+ AAA+RG+YDTC LYADQLK+R  +QFKEG L +E LAAVD  C
Sbjct  420   LLDELTDDCRGDYRNVMAAAVRGDYDTCALYADQLKRRSAEQFKEGVLGLEHLAAVDAFC  479

Query  1397  DLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCD  1218
             +LV++ +GA +P  TY++NLSVFTS+PD WA GQ FPI+PI RL ERP   G+LSDLTCD
Sbjct  480   ELVARGMGAPEPPRTYHINLSVFTSLPDMWAIGQQFPIIPIQRLQERPAVDGVLSDLTCD  539

Query  1217  SDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQS  1041
             SDGK+ +F+GG  SLPLHEL  +  R YYLGMFLGGAY+EALGG HNLFGGPSVVRVSQ 
Sbjct  540   SDGKVSEFIGGRHSLPLHELPTHATRGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQC  599

Query  1040  DGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAE  921
             DGPH F+VTRAA GPSCADVLR MQHEPE+M+E LK R +
Sbjct  600   DGPHCFAVTRAAAGPSCADVLRAMQHEPEVMYEVLKQRTD  639



>emb|CAE02645.1| arginine decarboxylase [Lotus japonicus]
Length=587

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/600 (72%), Positives = 503/600 (84%), Gaps = 35/600 (6%)
 Frame = -3

Query  2483  NRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEL  2304
             NRLESLQSAF++AV+S+GYGSHYQGVYPVKCNQDRFVVEDIV+FGSSFRFGLE+GSKPEL
Sbjct  20    NRLESLQSAFDYAVQSEGYGSHYQGVYPVKCNQDRFVVEDIVRFGSSFRFGLESGSKPEL  79

Query  2303  LLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKM  2124
             L+AMSCLCKG+ +ALLICNGFKDAEYISLALAARKL LN+VIVLEQEEEVDLIID+S KM
Sbjct  80    LMAMSCLCKGNAEALLICNGFKDAEYISLALAARKLALNSVIVLEQEEEVDLIIDLSNKM  139

Query  2123  AVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHI  1944
              +RPVIG+RAKLRTKH+GHFG TSGE+GKFGLTT QILRVVKKL+ + M+DCLQLLHFHI
Sbjct  140   HIRPVIGMRAKLRTKHSGHFGGTSGERGKFGLTTAQILRVVKKLEHAGMLDCLQLLHFHI  199

Query  1943  GSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTL  1764
             GSQIPSTALLADGVGEAAQIYCELVRLGA M+VIDIGGGLGIDYDG+KS+DS++SVGY L
Sbjct  200   GSQIPSTALLADGVGEAAQIYCELVRLGAQMRVIDIGGGLGIDYDGTKSSDSDISVGYGL  259

Query  1763  QEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPG  1587
             QEYA+AVV+AV+ VCDR+ + HPVICSESGRAIVSHHS+L+FEAV +SS        +  
Sbjct  260   QEYATAVVRAVQGVCDRRSIKHPVICSESGRAIVSHHSVLVFEAVGASSYGAPPAFSSLA  319

Query  1586  LQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVD  1407
             LQ  VE L ++ARADY NLS AAIRGE++TC+LY +++K+RCV++FK+G L +E+LA V+
Sbjct  320   LQYLVEGLSEEARADYCNLSDAAIRGEHETCLLYTEEMKRRCVEEFKQGLLGMEELAGVE  379

Query  1406  GICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDL  1227
             G+CDLV K +G  DPV  Y+VNLS+FTSIPD W+  Q+FPI+PIHRLDE+P  +GILSDL
Sbjct  380   GLCDLVRKTVGEADPVRRYHVNLSIFTSIPDVWSIDQVFPIIPIHRLDEKPTVKGILSDL  439

Query  1226  TCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVS  1047
             TCDSDGKIDKF+ GESSL +HEL G G +YYL MFLGGAYEEALGG+HNLFGGPSVVRV 
Sbjct  440   TCDSDGKIDKFINGESSLAMHELEG-GRKYYLRMFLGGAYEEALGGYHNLFGGPSVVRVL  498

Query  1046  QSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslas  867
             QS+GPHSF+VTRA PGPS  DVLRVMQH+PELMFETLKHRAEE +HD++   +  A+LA+
Sbjct  499   QSEGPHSFAVTRAMPGPSNGDVLRVMQHQPELMFETLKHRAEESVHDDE---LTAAALAT  555

Query  866   slansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSSPGEDEH--WSYCIA  693
             +LA SFHNMPYLV                             A    GEDEH  WSYCIA
Sbjct  556   ALARSFHNMPYLVT----------------------------AADHAGEDEHDQWSYCIA  587



>ref|XP_006854857.1| hypothetical protein AMTR_s00182p00026140 [Amborella trichopoda]
 gb|ERN16324.1| hypothetical protein AMTR_s00182p00026140 [Amborella trichopoda]
Length=697

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/633 (69%), Positives = 516/633 (82%), Gaps = 13/633 (2%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +SA+LYRI+GWG PYF++N SG++SVRPHG  TL  +EIDL+KVVKKA D +  GG
Sbjct  62    WSPELSASLYRINGWGAPYFSINGSGNLSVRPHGLETLLFEEIDLMKVVKKAVDSRSNGG  121

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPLIVR PDVLK+R++SLQSAF+ A+ SQ Y SHYQGVYPVKCNQDR +VEDIV F
Sbjct  122   LGLQLPLIVRLPDVLKHRIDSLQSAFDSAIRSQSYDSHYQGVYPVKCNQDRSIVEDIVAF  181

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             G S RFGLEAGSKPELLLAMS LCKGSP++ LICNG+KD EYISLAL ARK+ L+TVIVL
Sbjct  182   GRSHRFGLEAGSKPELLLAMSALCKGSPESYLICNGYKDEEYISLALMARKMGLDTVIVL  241

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEEVDL+I+IS+K++VRPVIG+RAKLRTKH+GHFGSTSGEKGKFGLTT +IL VV+KL
Sbjct  242   EQEEEVDLVIEISKKLSVRPVIGIRAKLRTKHSGHFGSTSGEKGKFGLTTLEILGVVRKL  301

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +   M+DCLQLLHFHIGSQIPS +LL DGVGEAAQIYCELVRLGA M+VIDIGGGLG+DY
Sbjct  302   RGVAMLDCLQLLHFHIGSQIPSVSLLGDGVGEAAQIYCELVRLGAGMRVIDIGGGLGVDY  361

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DGSKS+ S++S+GYTL+EYA+ VVQAVR+VCD+K V HPVICSESGRA+VSHHS+L+FEA
Sbjct  362   DGSKSSASDMSIGYTLEEYAATVVQAVRYVCDQKFVKHPVICSESGRALVSHHSVLVFEA  421

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
              ++   + +  P   L      L DDAR +Y NL  AA++GEY+ C+++A+QLKQRCV++
Sbjct  422   TAA---REVATPGLDLSYLTLGLSDDARTEYGNLMGAAMKGEYELCLVHAEQLKQRCVEE  478

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIH  1272
             FK GS ++EQLAAVD +CDL+S A    D V TY+VNLSVF+SIPDFWA  QLFPI+PIH
Sbjct  479   FKLGSFALEQLAAVDMLCDLLSHASQQADSVRTYHVNLSVFSSIPDFWAIEQLFPIMPIH  538

Query  1271  RLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALG  1092
             RLD+RP    ILSDLTCDSDGK+ KF+GG +SLPLHE    G  YYLGMFLGGAY+EALG
Sbjct  539   RLDQRPSINAILSDLTCDSDGKVTKFIGGATSLPLHE-SRPGEPYYLGMFLGGAYQEALG  597

Query  1091  GFHNLFGGPSVVRVSQSD-GPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEF  915
             G HNL G  SVVRV  SD G  +F+VT A PG SCADVLR M+HEP+ MFE LK RAE+ 
Sbjct  598   GLHNLLGSASVVRVVGSDGGGQAFAVTGAVPGQSCADVLRAMRHEPDSMFEALKCRAEDC  657

Query  914   LHDEDNGGMafaslasslansFHNMPYLVVGST  816
                E         +A +LA SF+ MPYL  G+T
Sbjct  658   FMGES--------VARTLAWSFNAMPYLRHGAT  682



>emb|CDX75457.1| BnaA01g02450D [Brassica napus]
Length=665

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/670 (67%), Positives = 528/670 (79%), Gaps = 27/670 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAPEALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTV  2646
             GY F+ D SLP      ++DA +P +   PT+S     WSPS+SA+LYRIDGWG PYF  
Sbjct  10    GYVFSDDGSLPT-----AADAFIPAS---PTSS----RWSPSLSASLYRIDGWGAPYFAA  57

Query  2645  NSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESL  2466
             NSSG+ISVRPHG  TL HQ+IDLLKVV   + PK  GGLGLQ PLIVRFPDVLKNRLE L
Sbjct  58    NSSGNISVRPHGDDTLPHQDIDLLKVVTNVTVPKSSGGLGLQFPLIVRFPDVLKNRLECL  117

Query  2465  QSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSC  2286
             QSAF+ AV+SQGYGSHYQGV+PVKCNQDRF+VEDIV FGS FRFGLEAGSKPE+LLAMSC
Sbjct  118   QSAFDSAVKSQGYGSHYQGVFPVKCNQDRFIVEDIVNFGSPFRFGLEAGSKPEILLAMSC  177

Query  2285  LCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVI  2106
             LCKG+PDA L+CNGFKDAEY+SLAL  RKL  NT+IVLEQE E+DL+I++S+KM VRP+I
Sbjct  178   LCKGNPDAFLVCNGFKDAEYVSLALLGRKLAFNTMIVLEQEHELDLVINLSKKMNVRPLI  237

Query  2105  GLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPS  1926
             GLRAKLRTK   H+GS SGEKGKFGLT+TQI+ VV KL ES M+DCLQLLHFHIGS IPS
Sbjct  238   GLRAKLRTKQTNHYGSYSGEKGKFGLTSTQIVSVVAKLSESGMLDCLQLLHFHIGSMIPS  297

Query  1925  TALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASA  1746
             ++LL+ GV EAAQIYCELVRLGA MK+ID+GGGLGIDYDGSKS + + SV YTL EYA A
Sbjct  298   SSLLSHGVSEAAQIYCELVRLGAHMKIIDVGGGLGIDYDGSKSGEPDQSVTYTLDEYAEA  357

Query  1745  VVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES  1566
             VV ++R+VCDR+ V HPVICSESGRAIVSH S+LIFEA +S    +   P P    F+  
Sbjct  358   VVSSIRYVCDRRSVKHPVICSESGRAIVSHQSVLIFEA-ASDVKPVAHQPKPDDIQFLLQ  416

Query  1565  LKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVS  1386
              ++D       L AA +RG+ ++ +LY +QLKQRC+++FKEG LSIEQL +VDG+C+ V 
Sbjct  417   REED-------LYAAVMRGDQESSLLYVEQLKQRCLEEFKEGVLSIEQLVSVDGLCEWVL  469

Query  1385  KAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGK  1206
             KAIG  DPV TYN+NLS+FTS PD W  GQLFPIVPIH+LD++PGARG+LSDLTCDSDGK
Sbjct  470   KAIGGSDPVQTYNMNLSIFTSTPDHWGMGQLFPIVPIHKLDQKPGARGVLSDLTCDSDGK  529

Query  1205  IDKFVGGESSLPLHELGG--NGGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGP  1032
             I KF+GGESSLPLHE+     GGRY LG+FLGG+YEE + G    FGGPSVVRVSQSDGP
Sbjct  530   IVKFIGGESSLPLHEIDSYGGGGRYLLGLFLGGSYEETMAGPD--FGGPSVVRVSQSDGP  587

Query  1031  HSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLHDEDNGGMafaslassla--  858
             HSF VTRA  G S +DVLR +QHEPE+M +TLKHRAEE +H +  G        +  A  
Sbjct  588   HSFVVTRAVSGQSSSDVLRAVQHEPEIMLQTLKHRAEEVMHTKGGGEEDENEYKNVAACL  647

Query  857   -nsFHNMPYL  831
               SFHNMPYL
Sbjct  648   DRSFHNMPYL  657



>gb|ABX80379.1| arginine decarboxylase [Triticum aestivum]
Length=712

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/672 (64%), Positives = 523/672 (78%), Gaps = 18/672 (3%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WS  +S+ALY +DGWG PYF VN  GD++VRPHG+ATL  QEIDL KVV +A+  +  GG
Sbjct  51    WSADLSSALYNVDGWGAPYFFVNDDGDVAVRPHGAATLPGQEIDLAKVVARAAGARAGGG  110

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGL LPL+VRFPDVL++R+E+L +AF +AV S GY   YQGVYPVKCNQDR+VVEDIV+F
Sbjct  111   LGLALPLLVRFPDVLRHRVETLNAAFAYAVRSTGYAGRYQGVYPVKCNQDRYVVEDIVEF  170

Query  2351  GSSFRFGLEAGSKPELLLAMSCL-CKGSPDALLICNGFKDAEYISLALAARKLLLNTVIV  2175
             G+ F FGLEAGSKPELLL MSCL  +GSPDALLICNG+KD EY+SLAL AR + LNTVIV
Sbjct  171   GAPFGFGLEAGSKPELLLTMSCLVARGSPDALLICNGYKDLEYVSLALIARTMGLNTVIV  230

Query  2174  LEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKK  1995
             LEQEEE+D++++ SR++ +RPV+G+RAKLRTKHAGHFG+TSGEKGKFGL   QIL VV K
Sbjct  231   LEQEEELDIVVEASRRLNIRPVVGMRAKLRTKHAGHFGATSGEKGKFGLNAAQILSVVAK  290

Query  1994  LQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgid  1815
             L+   M+DCLQLLHFHIGSQIP+TALLADGVGEAAQIYCEL RLGA M+VID+GGGLGID
Sbjct  291   LKALAMLDCLQLLHFHIGSQIPTTALLADGVGEAAQIYCELARLGAAMRVIDVGGGLGID  350

Query  1814  ydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFE  1635
             YDG+ SA +++SV Y+L+EYA+AVV AV  VCDRKGV HPVI  ES  A+VSHHS+LIFE
Sbjct  351   YDGTHSAQTDMSVAYSLEEYAAAVVAAVGRVCDRKGVQHPVILHESRPALVSHHSVLIFE  410

Query  1634  AVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVD  1455
             A S+++     + +P     ++ L DD R+DY+NL A+A+RG++DTC LYADQLK+RC +
Sbjct  411   AFSATAPA-SNMMDPATAYLLDELTDDCRSDYRNLMASAVRGDFDTCGLYADQLKRRCAE  469

Query  1454  QFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPI  1275
             QFKEG L +E LAAVDG+C++V++ +GA +    Y++NLSVFTS+PD WA  QLFPI+PI
Sbjct  470   QFKEGVLGLEHLAAVDGLCEIVARGMGAAEGPRRYHINLSVFTSLPDMWAIEQLFPIIPI  529

Query  1274  HRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGAYEEA  1098
              RL ERP   G+LSDLTCDSDGK+D+F+GG SSLPLHEL  +G R YYLGMFLGGAY+EA
Sbjct  530   QRLQERPAVDGVLSDLTCDSDGKVDQFIGGRSSLPLHELPTHGTRGYYLGMFLGGAYQEA  589

Query  1097  LGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEE  918
             LGG HNLFGGPSVVRVSQSDGPH F+VTRAAPGPSCADVLR MQHEPE+MFE LK R   
Sbjct  590   LGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAPGPSCADVLRAMQHEPEVMFEVLKQRT--  647

Query  917   FLHDEDNGGMafaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIA  738
                  D+G  A A   +       +MPYL   +      +    SG    ++ SAA    
Sbjct  648   ----TDDGATAAALARAFG-----SMPYLSFDAEEASAMSGAESSGMSSDSEGSAAGAAE  698

Query  737   DSSPGEDEHWSY  702
             D    +DE W +
Sbjct  699   D----DDEEWEF  706



>gb|ADK91572.1| arginine decarboxylase [Solanum lycopersicum]
Length=502

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/499 (81%), Positives = 448/499 (90%), Gaps = 2/499 (0%)
 Frame = -3

Query  2510  IVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFG  2331
             +VRFPDVLKNRLE+LQSAF+ A+ SQGY  HYQGVYPVKCNQDRFVVEDIVKFGS +RFG
Sbjct  4     VVRFPDVLKNRLETLQSAFDMAINSQGYEVHYQGVYPVKCNQDRFVVEDIVKFGSPYRFG  63

Query  2330  LEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVD  2151
             LEAGSK ELLLAM+CL KGS DALL+CNGFKD EYISLAL ARKLLLN+VIVLEQEEE+D
Sbjct  64    LEAGSKSELLLAMNCLSKGSADALLVCNGFKDTEYISLALVARKLLLNSVIVLEQEEELD  123

Query  2150  LIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMID  1971
             L+IDISRKM+VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRV+KKL ES M+D
Sbjct  124   LVIDISRKMSVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVLKKLDESGMLD  183

Query  1970  CLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSAD  1791
             CLQLLHFHIGSQIP++ LLADGVGEA QIY ELVRLGA MK IDIGGGLGIDYDGSKS++
Sbjct  184   CLQLLHFHIGSQIPTSELLADGVGEATQIYSELVRLGAGMKFIDIGGGLGIDYDGSKSSN  243

Query  1790  SEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDK  1611
             S+VS  Y++++ ASAVVQA  +VCDRKG  HPVICSESGRAIVSHHSILIFE  S+S+  
Sbjct  244   SDVSACYSIEKNASAVVQADLYVCDRKGGKHPVICSESGRAIVSHHSILIFETGSASTSH  303

Query  1610  LLQLPNP-GLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSL  1434
             +   P+  GLQS VE+L  DARAD +NLSAAA+RGEYDTC++Y+DQLKQRCV+QFK+GSL
Sbjct  304   VSTQPSSGGLQSLVETLNGDARADSRNLSAAAVRGEYDTCLIYSDQLKQRCVEQFKDGSL  363

Query  1433  SIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERP  1254
              IEQLAAVD ICD VSKAIG  DPV TY+VNLSVFTSIPDFW F QLFPIVPIHRLDE+P
Sbjct  364   DIEQLAAVDSICDWVSKAIGVADPVRTYHVNLSVFTSIPDFWGFSQLFPIVPIHRLDEKP  423

Query  1253  GARGILSDLTCDSDGKIDKFVGGESSLPLHELG-GNGGRYYLGMFLGGAYEEALGGFHNL  1077
               RGILSDLTCDSDGK+DKF+GGESSLPLHE+G G+GGRYYLGMFLGGAYEEALGG HNL
Sbjct  424   TMRGILSDLTCDSDGKVDKFIGGESSLPLHEIGSGDGGRYYLGMFLGGAYEEALGGLHNL  483

Query  1076  FGGPSVVRVSQSDGPHSFS  1020
             FGGPSVVRV QSD PHSF+
Sbjct  484   FGGPSVVRVMQSDSPHSFA  502



>ref|XP_007034347.1| Arginine decarboxylase [Theobroma cacao]
 gb|EOY05273.1| Arginine decarboxylase [Theobroma cacao]
Length=651

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/649 (67%), Positives = 515/649 (79%), Gaps = 6/649 (1%)
 Frame = -3

Query  2750  NAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHG-SATLSHQEIDLL  2574
              A P +  +D S W PS S+ LY+I+ WG PYF+VNSSG+IS+RP G +++ +H+EIDLL
Sbjct  5     QAKPSSNPMDCSRWFPSFSSLLYKIEKWGAPYFSVNSSGNISIRPKGLNSSSTHEEIDLL  64

Query  2573  KVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVK  2394
             KV+KK SD K  GGLGLQLPLI+R PDVLKNR+ESLQSAF  A+ S  YGS YQGVYPVK
Sbjct  65    KVLKKVSDHKSSGGLGLQLPLIIRLPDVLKNRMESLQSAFESAICSWNYGSRYQGVYPVK  124

Query  2393  CNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLA  2214
              NQ+RF+VEDIV+FG  FRFGLE GSKPELLLAM+CLCKG P+ALLICNGFKD +YI LA
Sbjct  125   SNQNRFIVEDIVRFGFPFRFGLEVGSKPELLLAMNCLCKGHPEALLICNGFKDKDYILLA  184

Query  2213  LAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKF  2034
             L ARKL  N V+VLEQ EE+DL+ID+S K+ V PVIGLRAKLRTKH GHFGSTSGE+GKF
Sbjct  185   LIARKLAFNVVVVLEQVEELDLVIDLSTKLCVSPVIGLRAKLRTKHGGHFGSTSGERGKF  244

Query  2033  GLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGAC  1854
             GLT  QIL VVKKL+++ M++CL LLHFHIGSQIPS  +LADG+GEA QIYCELVRLGAC
Sbjct  245   GLTPRQILSVVKKLEKAGMLNCLILLHFHIGSQIPSITMLADGIGEATQIYCELVRLGAC  304

Query  1853  MKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESG  1674
             ++ ID+GGGLGIDYDGSKS++S+VSVGY L+EYAS VVQ ++ VCD K V HPVICSESG
Sbjct  305   LQFIDVGGGLGIDYDGSKSSNSDVSVGYGLEEYASTVVQVIQQVCDSKSVKHPVICSESG  364

Query  1673  RAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTC  1494
             RAIVS+HSI+IFEA+SSS      L   GLQ FVE L +DARADY NLSAA I+GE+  C
Sbjct  365   RAIVSYHSIVIFEAISSSVSDSPGLNPEGLQHFVEGLTEDARADYSNLSAAVIKGEHTAC  424

Query  1493  VLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPD  1314
             + YA++LKQ C+DQFKEGSL+IEQLA VD +  +VSKA GA +P+ TY VNLS+F S+PD
Sbjct  425   LHYANKLKQYCLDQFKEGSLNIEQLAIVDELYGMVSKATGASEPIHTYLVNLSIFNSVPD  484

Query  1313  FWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHE-LGGNGGRY  1137
             FWA GQ++PIVPIHRLD++P  +GIL DLTCDSDGKID+F+GGESSLPLH+    +GG+Y
Sbjct  485   FWAIGQMYPIVPIHRLDQKPTVKGILLDLTCDSDGKIDRFIGGESSLPLHDHRESSGGQY  544

Query  1136  YLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDG-PHSFSVTRAAPGPSCADVLRVMQHE  960
             YLGMFLGGAYEEALGG HNL G PSVV+VS     P  F VT A PG SC DVLR MQHE
Sbjct  545   YLGMFLGGAYEEALGGSHNLLGSPSVVQVSSQSSEPEGFIVTMATPGQSCRDVLRTMQHE  604

Query  959   PELMFETLKHRAEEFLHDEDNGGMafaslasslansFHNMPYLVVGSTC  813
             PE +F+ LK R +         G A     S LA  F NMPYL  GS+C
Sbjct  605   PEAIFKELKQRIKAL---GQVNGTADGMFQSVLAGIFSNMPYLTRGSSC  650



>gb|EAZ35714.1| hypothetical protein OsJ_20004 [Oryza sativa Japonica Group]
Length=651

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/603 (65%), Positives = 462/603 (77%), Gaps = 56/603 (9%)
 Frame = -3

Query  2723  DHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpk  2544
             D + WS  +S+ALY +DGWG PYF VN  GD++                           
Sbjct  42    DAAAWSADLSSALYNVDGWGAPYFFVNDDGDVA---------------------------  74

Query  2543  plgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVED  2364
                                     +L +AF++AV S GYG  YQGVYPVKCNQDR VVED
Sbjct  75    ------------------------ALNAAFDYAVRSTGYGGRYQGVYPVKCNQDRHVVED  110

Query  2363  IVKFGSSFRFGLEAGSKPELLLAMSCLC-KGSPDALLICNGFKDAEYISLALAARKLLLN  2187
             IV+FG  FRFGLEAGSKPELLLAMSCL  +G+PDALLICNG+KD EY+SLAL AR + LN
Sbjct  111   IVEFGEPFRFGLEAGSKPELLLAMSCLAARGNPDALLICNGYKDDEYVSLALIARTMGLN  170

Query  2186  TVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILR  2007
             TVIVLEQEEE+D+++D SR++ VRPV+G+RAKLRTKHAGHFGSTSGEKGKFGL   QIL 
Sbjct  171   TVIVLEQEEELDIVVDASRRLGVRPVVGMRAKLRTKHAGHFGSTSGEKGKFGLNAAQILS  230

Query  2006  VVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggg  1827
             VV KL+   M+DCLQLLHFHIGSQIP+TALL DGVGEAAQIYCEL RLGA M+VID+GGG
Sbjct  231   VVAKLKTLGMLDCLQLLHFHIGSQIPTTALLGDGVGEAAQIYCELARLGAAMRVIDVGGG  290

Query  1826  lgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSI  1647
             LGIDYDGS SA +++SV Y+L+EYA+AVV AV  VCDRKGV+HP+ICSESGRA+VSHHS+
Sbjct  291   LGIDYDGSHSAQTDMSVAYSLEEYAAAVVAAVGRVCDRKGVAHPIICSESGRALVSHHSV  350

Query  1646  LIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQ  1467
             L+FEA S+S+   +   +P     ++ L DD  ADY+NL AAA+RG++DTC LYADQLK+
Sbjct  351   LVFEAFSASAPGRI---DPATGYLLDELTDDCHADYRNLMAAAVRGDFDTCALYADQLKR  407

Query  1466  RCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFP  1287
             RC DQFK+G L +E LAAVD +C++V++ +GA +P  TY++NLSVFTS+PD WA GQ+FP
Sbjct  408   RCADQFKDGVLGLEHLAAVDSLCEIVARGMGAAEPPRTYHINLSVFTSLPDMWAIGQMFP  467

Query  1286  IVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGGA  1110
             I+PI RL ERP   G+LSDLTCDSDGK+D F+GG  SLPLHEL  +G R YYLGMFLGGA
Sbjct  468   IIPIQRLGERPAVDGVLSDLTCDSDGKVDHFIGGRHSLPLHELPVHGTRGYYLGMFLGGA  527

Query  1109  YEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKH  930
             Y+EALGG HNLFGGPSVVRVSQSDGPH F+VTRAA GPSCADVLR MQHEPE+MFE LK 
Sbjct  528   YQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAAGPSCADVLRSMQHEPEVMFEVLKQ  587

Query  929   RAE  921
             R +
Sbjct  588   RTD  590



>ref|XP_006656600.1| PREDICTED: LOW QUALITY PROTEIN: arginine decarboxylase 1-like 
[Oryza brachyantha]
Length=658

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/623 (63%), Positives = 471/623 (76%), Gaps = 59/623 (9%)
 Frame = -3

Query  2765  APL--PTNAVPPTASVDHSHWSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSH  2592
             APL  PT A   T   D + WS  +S+ALY +DGWG P                      
Sbjct  26    APLMGPTAAATATEKPDAAAWSADLSSALYNVDGWGAPL---------------------  64

Query  2591  QEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQ  2412
                                        +VRFPDVL++R+E+L +AF++AV S GYG  YQ
Sbjct  65    ---------------------------LVRFPDVLRHRVEALNAAFDYAVRSTGYGGRYQ  97

Query  2411  GVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLC-KGSPDALLICNGFKD  2235
             GVYPVKCNQDR VVEDIV+FG  FRFGLEAGSKPELLLAMSCL  +G+PDALLICNG+KD
Sbjct  98    GVYPVKCNQDRHVVEDIVEFGEPFRFGLEAGSKPELLLAMSCLAARGNPDALLICNGYKD  157

Query  2234  AEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGST  2055
              EY+SLAL AR + LNTVIVLEQEEE+D++++ SR++ VRPV+G+RAKLRTKHAGHFGST
Sbjct  158   DEYVSLALIARTMGLNTVIVLEQEEELDIVVEASRRLGVRPVVGMRAKLRTKHAGHFGST  217

Query  2054  SGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCE  1875
             SGEKGKFGL   QIL VV KL+   M+DCLQLLHFHIGSQIP+T LLADGVGEAAQIYCE
Sbjct  218   SGEKGKFGLNAAQILSVVAKLKTLGMLDCLQLLHFHIGSQIPTTGLLADGVGEAAQIYCE  277

Query  1874  LVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHP  1695
             L RLGA M+VID+GGGLGIDYDGS SA +++SV Y+L+EYA+AVV AV  VCDRKGV+HP
Sbjct  278   LARLGAAMRVIDVGGGLGIDYDGSHSAQTDMSVAYSLEEYAAAVVAAVGRVCDRKGVAHP  337

Query  1694  VICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNL----S  1527
             +ICSESGRA+VSHHS+L+FEA S+S    +   +P     ++ L DD  ADY+NL     
Sbjct  338   IICSESGRALVSHHSVLVFEAFSASPPGRI---DPATGYLLDELTDDCHADYRNLMAAAG  394

Query  1526  AAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYN  1347
               A+RG++DTC LYADQLK+RC +QFKEG L +E LAAVD +C++V++ +GA +P  TY+
Sbjct  395   GGAVRGDFDTCALYADQLKRRCAEQFKEGVLGLEHLAAVDSLCEIVARGMGAAEPPRTYH  454

Query  1346  VNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPL  1167
             +NLSVFTS+PD WA GQ+FPI+PI RL ERP   G+LSDLTCDSDGK++ F+GG  SLPL
Sbjct  455   INLSVFTSLPDMWAIGQMFPIIPIQRLGERPAVDGVLSDLTCDSDGKVEHFIGGRHSLPL  514

Query  1166  HELGGNGGR-YYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSC  990
             HEL  +G R YYLGMFLGGAY+EALGG HNLFGGPSVVRVSQSDGPH F+VTRAA GPSC
Sbjct  515   HELPVHGTRGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAAGPSC  574

Query  989   ADVLRVMQHEPELMFETLKHRAE  921
             ADVLR MQHEPE+MFE LK R +
Sbjct  575   ADVLRSMQHEPEVMFEVLKQRTD  597



>gb|AAX56880.1| putative arginine decarboxylase [Solanum habrochaites]
 gb|ADV29031.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29034.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29035.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29036.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/447 (85%), Positives = 412/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWGDPYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGDPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29041.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29047.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29049.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29055.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/447 (85%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWGDPYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGDPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +C  VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCGFVSKAIGA  447



>gb|AEO52825.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGDLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56858.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|AAX56860.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|AAX56862.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|AAX56865.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56867.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56869.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56872.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56873.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21817.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21821.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21824.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21828.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21837.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21841.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21848.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21852.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21857.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21858.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21860.1| putative arginine decarboxylase [Solanum chilense]
 gb|ADV29068.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29069.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29070.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29071.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29072.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29073.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29074.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29075.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29077.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29078.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29079.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29082.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29084.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29103.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29105.1| arginine decarboxylase [Solanum arcanum]
 gb|AEO52750.1| putative arginine decarboxylase, partial [Solanum chilense]
 gb|AEO52827.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21795.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21796.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21797.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21798.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21799.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21801.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21802.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21803.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21804.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21805.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21806.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21807.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21811.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21813.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21815.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|AEO52818.1| putative arginine decarboxylase, partial [Solanum peruvianum]
 gb|AEO52819.1| putative arginine decarboxylase, partial [Solanum peruvianum]
 gb|AEO52820.1| putative arginine decarboxylase, partial [Solanum peruvianum]
 gb|AEO52822.1| putative arginine decarboxylase, partial [Solanum peruvianum]
 gb|AEO52824.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPIKTGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52752.1| putative arginine decarboxylase, partial [Solanum chilense]
 gb|AEO52755.1| putative arginine decarboxylase, partial [Solanum chilense]
Length=448

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF+FAV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDFAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL  NTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQFNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21820.1| putative arginine decarboxylase [Solanum peruvianum]
Length=448

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPIKTGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLA+VD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLASVDAVCDFVSKAIGA  447



>gb|ADV29091.1| arginine decarboxylase [Solanum arcanum]
Length=448

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS++IFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVMIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56878.1| putative arginine decarboxylase [Solanum habrochaites]
 gb|ADV29030.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29038.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29039.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29040.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29044.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29045.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29046.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29048.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29050.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29051.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29052.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29053.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29054.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29056.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29060.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29061.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29062.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29063.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29064.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29065.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29066.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29067.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCV+Q
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVEQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56874.1| putative arginine decarboxylase [Solanum habrochaites]
 gb|AAX56875.1| putative arginine decarboxylase [Solanum habrochaites]
 gb|AAX56877.1| putative arginine decarboxylase [Solanum habrochaites]
 gb|AAX56879.1| putative arginine decarboxylase [Solanum habrochaites]
 gb|AAX56881.1| putative arginine decarboxylase [Solanum habrochaites]
 gb|ADV29016.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29017.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29019.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29020.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29021.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29022.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29024.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29025.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29026.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29027.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29028.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29029.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29033.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA M  IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMNFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29087.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29089.1| arginine decarboxylase [Solanum arcanum]
Length=448

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LY+DQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYSDQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56857.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21800.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21808.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21809.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21810.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21814.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21816.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21822.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21842.1| putative arginine decarboxylase [Solanum chilense]
 gb|ADV29081.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29083.1| arginine decarboxylase [Solanum arcanum]
Length=448

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52751.1| putative arginine decarboxylase, partial [Solanum chilense]
Length=448

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLP++VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPIVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQ+VRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQSVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29032.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L  FVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHFFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52823.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPIKTGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DD+RADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDSRADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29042.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29043.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYF VNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFIVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56864.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56866.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56868.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56870.1| putative arginine decarboxylase [Solanum chilense]
 gb|AAX56871.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21829.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21830.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21832.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21834.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21838.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21840.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21843.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21849.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21851.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21856.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21859.1| putative arginine decarboxylase [Solanum chilense]
 gb|AEO52747.1| putative arginine decarboxylase, partial [Solanum chilense]
 gb|AEO52749.1| putative arginine decarboxylase, partial [Solanum chilense]
 gb|AEO52756.1| putative arginine decarboxylase, partial [Solanum chilense]
 gb|AEO52830.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56854.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|AAX56861.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|AAZ85226.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|ABW21812.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21819.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21823.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21825.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|ABW21827.1| putative arginine decarboxylase [Solanum peruvianum]
 gb|AEO52828.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21835.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 411/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + L++CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLVVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21818.1| putative arginine decarboxylase [Solanum peruvianum]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ T  HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTFPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52831.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPIKTGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS + +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSITTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21853.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSDFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21826.1| putative arginine decarboxylase [Solanum peruvianum]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASD    GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDSINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +E LAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEHLAAVDAVCDFVSKAIGA  447



>gb|ABW21847.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTARSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52754.1| putative arginine decarboxylase, partial [Solanum chilense]
Length=448

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VS ++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSLTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAZ85223.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|AAZ85224.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|AAZ85225.1| arginine decarboxylase [Solanum pimpinellifolium]
Length=448

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             G+ FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GTGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21831.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21833.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRV +KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVARKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21846.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21850.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQD FVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDLFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52753.1| putative arginine decarboxylase, partial [Solanum chilense]
Length=448

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             W+P +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WTPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21845.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+ Y +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSERYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56863.1| putative arginine decarboxylase [Solanum peruvianum]
Length=448

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSYLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21861.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMFDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAZ85211.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85212.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85213.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85214.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85215.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85216.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85217.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85218.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85219.1| arginine decarboxylase [Solanum chmielewskii]
 gb|AAZ85220.1| arginine decarboxylase [Solanum chmielewskii]
 gb|ADV29080.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29085.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29086.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29088.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29090.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29092.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29093.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29094.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29096.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29097.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29098.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29099.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29100.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29101.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29102.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29104.1| arginine decarboxylase [Solanum arcanum]
Length=448

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29106.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29107.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29108.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29109.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29110.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29111.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29112.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29113.1| arginine decarboxylase [Solanum arcanum]
 gb|ADV29114.1| arginine decarboxylase [Solanum arcanum]
Length=448

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGE GKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGETGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21854.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSK+IGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKSIGA  447



>gb|AAX56859.1| putative arginine decarboxylase [Solanum peruvianum]
Length=448

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+ Y +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEEYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29076.1| arginine decarboxylase [Solanum arcanum]
Length=448

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSECLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTDLLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21836.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21839.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQR VDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRYVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56855.1| putative arginine decarboxylase [Solanum peruvianum]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVC+RK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCNRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52821.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DD R DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDTRGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAZ85221.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|AAZ85222.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|AAZ85227.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|AAZ85228.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|AAZ85229.1| arginine decarboxylase [Solanum pimpinellifolium]
 gb|AAZ85230.1| arginine decarboxylase [Solanum pimpinellifolium]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS  RFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGLRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56876.1| putative arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRP+G+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPNGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA M  IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMNFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21844.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEY+TC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYETCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29018.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29023.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYF VNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFMVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKD EYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDVEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ABW21855.1| putative arginine decarboxylase [Solanum chilense]
 gb|ABW21862.1| putative arginine decarboxylase [Solanum chilense]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + +L+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGVLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29037.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVWKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA M  IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTQLLADGVGEAAQVYSELVRLGAGMNFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52748.1| putative arginine decarboxylase, partial [Solanum chilense]
Length=448

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLALAARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALAARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKM V+PVIGLRAKLRT H+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMEVQPVIGLRAKLRTNHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSK+IGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKSIGA  447



>gb|ADV29057.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29058.1| arginine decarboxylase [Solanum habrochaites]
 gb|ADV29059.1| arginine decarboxylase [Solanum habrochaites]
Length=448

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRI GWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIGGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+S +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCV+Q
Sbjct  361   VSSTSTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVEQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AEO52829.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 410/447 (92%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPIKTGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARK  LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKPQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDARADY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARADYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L +EQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDMEQLAAVDAVCDFVSKAIGA  447



>gb|AAX56856.1| putative arginine decarboxylase [Solanum peruvianum]
Length=448

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/447 (84%), Positives = 409/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPDLSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF+ AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDCAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVC+RK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCNRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|ADV29095.1| arginine decarboxylase [Solanum arcanum]
Length=448

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/447 (84%), Positives = 408/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
              SS++ +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   ASSTTTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD + D VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVGDFVSKAIGA  447



>gb|AEO52826.1| putative arginine decarboxylase, partial [Solanum peruvianum]
Length=448

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/447 (84%), Positives = 407/447 (91%), Gaps = 0/447 (0%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYRIDGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAV+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSV Y LQ+YAS VVQAVRFVCDRK V HPVI SESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVAYGLQDYASTVVQAVRFVCDRKNVKHPVISSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS+  +  +L +  L SFVE L DDAR DY+NLSAAAIRGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTVTRSQELSSMSLHSFVEKLNDDARGDYRNLSAAAIRGEYDTCMLYADQLKQRCVDQ  420

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  421   FKDGNLDIEQLAAVDAVCDFVSKAIGA  447



>gb|AAZ85210.1| arginine decarboxylase [Solanum ochranthum]
Length=444

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/447 (83%), Positives = 407/447 (91%), Gaps = 4/447 (1%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WSP +S+ LYR+DGWG PYFTVNSSGDISVRPHG+ TL HQEIDLLKVVKKASDP   GG
Sbjct  1     WSPELSSDLYRVDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLKVVKKASDPINSGG  60

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
             LGLQLPL+VRFPDVLKNRLESLQSAF++AV+S+GY +HYQGVYPVKCNQDRFVVEDIVKF
Sbjct  61    LGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKF  120

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             GS FRFGLEAGSKPELLLAMS LCKGS + LL+CNGFKDAEYISLAL ARKL LNTVIVL
Sbjct  121   GSGFRFGLEAGSKPELLLAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVL  180

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQEEE+DL+IDISRKMAVRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRVV+KL
Sbjct  181   EQEEELDLVIDISRKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVVRKL  240

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             +ES M+DCLQLLHFHIGSQIPST LLADGVGEAAQ+Y ELVRLGA MK IDIGGGLGIDY
Sbjct  241   KESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDY  300

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+KS+DS+VSVGY LQ+YAS VVQAVRFVCDRK V HPVICSESGRAIVSHHS+LIFEA
Sbjct  301   DGTKSSDSDVSVGYGLQDYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEA  360

Query  1631  VSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQ  1452
             VSS++    +L +  LQ     L DDARADY+NLSAAA+RGEYDTC+LYADQLKQRCVDQ
Sbjct  361   VSSTTTGSQELSSMSLQ----KLNDDARADYRNLSAAAVRGEYDTCMLYADQLKQRCVDQ  416

Query  1451  FKEGSLSIEQLAAVDGICDLVSKAIGA  1371
             FK+G+L IEQLAAVD +CD VSKAIGA
Sbjct  417   FKDGNLDIEQLAAVDAVCDFVSKAIGA  443



>gb|ADQ37299.1| putative arginine decarboxylase [Pinus sylvestris]
Length=712

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/653 (60%), Positives = 484/653 (74%), Gaps = 23/653 (4%)
 Frame = -3

Query  2825  GYAFAWDRSLPAP------EALVSSDAPLPTNAVPPTASVDHSHWSPSMSAALYRIDGWG  2664
             GY    + SLP P          S+   +  NAV P        WS + S+ALYR++GWG
Sbjct  20    GYGLPGEGSLPVPLVPKFPSPFFSNGGGVGANAVAPA-------WSVAHSSALYRVEGWG  72

Query  2663  DPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVRFPDVLK  2484
              PYF VN +G+++VRPHGS TL  +EID++KVVKK    K LGGLG+  PLI+RFPDVLK
Sbjct  73    APYFVVNENGNVAVRPHGSQTLPSEEIDVMKVVKKVVGSKSLGGLGMSAPLIIRFPDVLK  132

Query  2483  NRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEL  2304
             +RLESLQSAF+ A+  Q Y S++QGVYPVKCNQDR+VVE+IV+FG  + FGLEAGSKPEL
Sbjct  133   HRLESLQSAFDSAMRMQSYESYFQGVYPVKCNQDRYVVENIVEFGKPYAFGLEAGSKPEL  192

Query  2303  LLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKM  2124
             LLAM+ +CK SP ALL+CNG+KD EYISLAL AR+   N VIVLEQEEE+DL++++SRK+
Sbjct  193   LLAMASMCKASPKALLVCNGYKDEEYISLALTARRPNFNCVIVLEQEEELDLVLNVSRKL  252

Query  2123  AVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHI  1944
             +VRPVIG+RAKLRTKH GHFG+TSGEKGKFGLT+ +I+ +V+KLQ+  M+DCLQLLHFHI
Sbjct  253   SVRPVIGVRAKLRTKHGGHFGATSGEKGKFGLTSLEIVGIVRKLQKLGMLDCLQLLHFHI  312

Query  1943  GSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTL  1764
             GSQIP   +L DGV EAA IY EL +LGA MK+IDIGGGLGIDY+G+KS+ S++SV Y+L
Sbjct  313   GSQIPCVEVLNDGVSEAAYIYSELAKLGANMKIIDIGGGLGIDYEGTKSSCSDMSVSYSL  372

Query  1763  QEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDK---LLQLPN  1593
              EYA+AVV+AVR  C +KGV HP+ICSESGRA+VSHHS+LIF+ VS    K      +  
Sbjct  373   DEYAAAVVKAVRVACSQKGVKHPIICSESGRALVSHHSLLIFDVVSVHEKKDSVSAAVAG  432

Query  1592  PGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAA  1413
               L   V+ L ++   +YQ++ A    G+  +  + A+ +K RC+D FKEG L +EQLA 
Sbjct  433   MNLNPLVDGLPEELMGEYQSVMAYTAMGDCRSSQICAEHMKARCLDLFKEGRLGLEQLAT  492

Query  1412  VDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILS  1233
             VDG+CDLVS        VC  +VNLS+F SIPDFWA GQLFP++PIHRL+ERP  R ILS
Sbjct  493   VDGMCDLVSSPAADTPAVC--HVNLSIFKSIPDFWAIGQLFPVMPIHRLNERPTVRAILS  550

Query  1232  DLTCDSDGKIDKFV-----GGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHNLFGG  1068
             DLTCDSDGK+D F+     GG   LPLH   G    YYLGMFLGGAY+EALGG HNLFG 
Sbjct  551   DLTCDSDGKVDTFISGDDGGGSRGLPLHPFEGRSEPYYLGMFLGGAYQEALGGLHNLFGV  610

Query  1067  PSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFLH  909
             P+VV V QS GPH F++TRA PG + ADVLR+M HEP +MF +LK R E+ L 
Sbjct  611   PNVVHVVQSSGPHCFAITRALPGQTSADVLRLMMHEPNMMFTSLKCRIEDSLQ  663



>dbj|BAJ89348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/485 (71%), Positives = 410/485 (85%), Gaps = 3/485 (1%)
 Frame = -3

Query  2366  DIVKFGSSFRFGLEAGSKPELLLAMSCL-CKGSPDALLICNGFKDAEYISLALAARKLLL  2190
             DIV+FG+ F FGLEAGSKPELLL MSCL  +GSPDALLICNG+KD EY+SLAL AR + L
Sbjct  2     DIVEFGAPFGFGLEAGSKPELLLTMSCLVARGSPDALLICNGYKDLEYVSLALIARTMGL  61

Query  2189  NTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQIL  2010
             NTVIVLEQEEE+D++++ SR++ +RPV+G+RAKLRTKHAGHFG+TSGEKGKFGL   QIL
Sbjct  62    NTVIVLEQEEELDIVVEASRRLNIRPVVGMRAKLRTKHAGHFGATSGEKGKFGLNAAQIL  121

Query  2009  RVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidigg  1830
              VV KL+   M+DCLQLLHFHIGSQIP+TALLADGVGEAAQIYCEL RLGA M+VID+GG
Sbjct  122   SVVAKLKALGMLDCLQLLHFHIGSQIPTTALLADGVGEAAQIYCELARLGAAMRVIDVGG  181

Query  1829  glgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHS  1650
             GLGIDYDG+ SA++++SV Y+L+EYA+AVV AV  VCDRKGV HPVICSESGRA+VSHHS
Sbjct  182   GLGIDYDGTHSAETDMSVAYSLEEYAAAVVAAVGRVCDRKGVQHPVICSESGRALVSHHS  241

Query  1649  ILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLK  1470
             +LIFEA S+++     + +P     ++ L DD R DY+NL A+A+RG++DTC LYADQLK
Sbjct  242   VLIFEAFSATAPA-SNMMDPATAYLLDELTDDCRNDYRNLMASAVRGDFDTCGLYADQLK  300

Query  1469  QRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLF  1290
             +RC +QFKEG L +E LAAVDG+C++V++ +GA +    Y++NLSVFTS+PD WA  QLF
Sbjct  301   RRCAEQFKEGVLGLEHLAAVDGLCEIVARGMGAAEGPRRYHINLSVFTSLPDMWAIEQLF  360

Query  1289  PIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGR-YYLGMFLGG  1113
             PI+PI RL ERP   G+LSDLTCDSDGK+D+F+GG SSLPLHEL  +G R YYLGMFLGG
Sbjct  361   PIIPIQRLQERPAVDGVLSDLTCDSDGKVDQFIGGRSSLPLHELPSHGTRGYYLGMFLGG  420

Query  1112  AYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLK  933
             AY+EALGG HNLFGGPSVVRVSQSDGPH F+VTRAAPGPSCADVLR MQHEPE+MFE LK
Sbjct  421   AYQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAPGPSCADVLRAMQHEPEVMFEVLK  480

Query  932   HRAEE  918
              R  +
Sbjct  481   QRTTD  485



>gb|AAN77734.1| arginine decarboxylase [Capsicum annuum]
Length=409

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/405 (85%), Positives = 373/405 (92%), Gaps = 1/405 (0%)
 Frame = -3

Query  2423  SHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNG  2244
             SHYQGVYPVKCNQDRFVVEDIVKFGS +RFGLEAGSKPELLLAM+CL KGS DALL+CNG
Sbjct  2     SHYQGVYPVKCNQDRFVVEDIVKFGSPYRFGLEAGSKPELLLAMNCLSKGSADALLVCNG  61

Query  2243  FKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHF  2064
             FKD EYISLAL ARKLLLNTVIVLEQEEE+DL+IDISRKMAVRPVIGLRAKLRTKH+GHF
Sbjct  62    FKDTEYISLALIARKLLLNTVIVLEQEEELDLVIDISRKMAVRPVIGLRAKLRTKHSGHF  121

Query  2063  GSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQI  1884
             GSTSGEKGKFGLTTTQILRVVKKL+ S M+DCLQLLHFHIGSQIP+T LLADGVGEA QI
Sbjct  122   GSTSGEKGKFGLTTTQILRVVKKLEGSGMLDCLQLLHFHIGSQIPTTELLADGVGEATQI  181

Query  1883  YCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGV  1704
             Y ELVRLGA MK IDIGGGLGIDYDGSKS+DS+VSV Y ++EYASAVVQAV+FVCDRKGV
Sbjct  182   YSELVRLGAGMKFIDIGGGLGIDYDGSKSSDSDVSVAYGIEEYASAVVQAVQFVCDRKGV  241

Query  1703  SHPVICSESGRAIVSHHSILIFEAVSSSSDKLL-QLPNPGLQSFVESLKDDARADYQNLS  1527
              HPVICSESGRAIVSHHSI+IFEAVS+S+  +  QL + GLQS  E+L +DARADY+NLS
Sbjct  242   KHPVICSESGRAIVSHHSIMIFEAVSASTTNVSPQLSSGGLQSLTETLNEDARADYRNLS  301

Query  1526  AAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYN  1347
             AAA+RGEYDTC+LY+DQLKQRCV+QFK+GSL IEQLAAVD ICDLVSKAIG  DPV  Y+
Sbjct  302   AAAVRGEYDTCLLYSDQLKQRCVEQFKDGSLDIEQLAAVDSICDLVSKAIGVSDPVRAYH  361

Query  1346  VNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSD  1212
             VNLSVFTSIPDFWAFGQLFPIVPIHRLDE+P  RGILSDLTCDS+
Sbjct  362   VNLSVFTSIPDFWAFGQLFPIVPIHRLDEKPTMRGILSDLTCDSE  406



>dbj|BAD97829.1| arginine decarboxylase [Prunus persica]
Length=404

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/404 (81%), Positives = 364/404 (90%), Gaps = 1/404 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRFVVEDIV+FGS FRFGLEAGSKPELLLAMSCLCKG+P+ALLICNGFK
Sbjct  1     YQGVYPVKCNQDRFVVEDIVRFGSPFRFGLEAGSKPELLLAMSCLCKGNPEALLICNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D EYISLAL ARKL LNTVIVLEQEEE+D++ID+S+K+ VRPVIG RAKL+TKH+GHFGS
Sbjct  61    DFEYISLALFARKLALNTVIVLEQEEELDVVIDLSKKLGVRPVIGARAKLKTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQILRVVKKL +  ++DC QLLHFHIGSQIPSTALLADGV EAAQIYC
Sbjct  121   TSGEKGKFGLTTTQILRVVKKLDQLGLLDCFQLLHFHIGSQIPSTALLADGVSEAAQIYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MK IDIGGGLGIDYDGSKS+DSE+SV Y+L+EYA+AVV+AV  VCDRK V H
Sbjct  181   ELVRLGAHMKFIDIGGGLGIDYDGSKSSDSEISVSYSLEEYAAAVVRAVLNVCDRKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSS-DKLLQLPNPGLQSFVESLKDDARADYQNLSAA  1521
             PVICSESGRA+VSHHS++IFEA+SSS+ D +  +    LQ F+E L ++ARADY+NLSAA
Sbjct  241   PVICSESGRALVSHHSVMIFEAISSSACDDVPPMSAFALQYFIEGLTEEARADYRNLSAA  300

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
             AIRGEY+ C+ YADQLKQRC+DQFKEGSL IEQLA VDG+CD+VSKAIGA DPV TY+VN
Sbjct  301   AIRGEYEACLTYADQLKQRCIDQFKEGSLGIEQLATVDGLCDMVSKAIGASDPVRTYHVN  360

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             LSVFTSIPDFW  GQ FPIVPIHRLD+RP  RGILSDLTCDSDG
Sbjct  361   LSVFTSIPDFWGIGQTFPIVPIHRLDQRPAVRGILSDLTCDSDG  404



>gb|AAC68512.1| arginine decarboxylase [Carica papaya]
Length=408

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/408 (79%), Positives = 361/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDA L+CNGFK
Sbjct  1     YQGVYPVKSNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL ARKL LNTVIVLEQEEE+DL+ID+S+K++V+PVIG+RAKLRTKH+GHFGS
Sbjct  61    DAEYISLALFARKLALNTVIVLEQEEEIDLVIDLSQKLSVKPVIGVRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQILRVV KL+++ M+DCLQLLHFHIGSQIPSTALL+DGVGEAAQIYC
Sbjct  121   TSGEKGKFGLTTTQILRVVGKLKQAGMLDCLQLLHFHIGSQIPSTALLSDGVGEAAQIYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             EL RLGA M+V+DIGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV+ V FVCDRK V H
Sbjct  181   ELTRLGARMQVVDIGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVRTVAFVCDRKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEA+S +           LQ F +  KDDARA Y NL+ A 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAMSVTGPARRNEYPTDLQFFFDGFKDDARAAYLNLAIAD  300

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
              RG+YDTC  YADQLK+RCV+ FKEG+L IEQLAAVDG+CD VSK IGA +PV TY+VNL
Sbjct  301   ARGDYDTCWFYADQLKERCVEDFKEGTLCIEQLAAVDGLCDFVSKVIGASEPVRTYHVNL  360

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             S+FTSIPDFW+ GQ+FPIVPIHRLDERP  RG LSDLTCDSDGKIDKF
Sbjct  361   SIFTSIPDFWSIGQIFPIVPIHRLDERPEVRGTLSDLTCDSDGKIDKF  408



>gb|AAC68510.1| arginine decarboxylase [Aethionema grandiflorum]
Length=407

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/408 (78%), Positives = 364/408 (89%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGS FRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVKFGSPFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV+KL+++ M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVVRKLRQAGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCDRK V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYADAVVASVRFVCDRKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS++   +    NP    F+    ++ARADY++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAAK-PMAHHANPEDIQFLLEGNEEARADYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TY+VNL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVRTYHVNL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPDFW   QLFPIVPIH+LD+RPG RGILSDLTCDSDGKI+KF
Sbjct  360   SVFTSIPDFWGIEQLFPIVPIHKLDQRPGVRGILSDLTCDSDGKINKF  407



>gb|AAC68526.1| arginine decarboxylase [Barbarea vulgaris]
Length=405

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/409 (78%), Positives = 362/409 (89%), Gaps = 5/409 (1%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVEFGSKFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EYISLAL  +KL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYISLALLGKKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+KL++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRKLRQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA+AVV +VRFVCD+K V H
Sbjct  181   ELVRLGANMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAAAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPG-LQSFVESLKDDARADYQNLSAA  1521
             PVICSESGRAIVSHHS+LIFEAVS+      Q   P  +Q  +E   ++ RADY+NL  A
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAGQ----QHETPSDVQFMLEGYSEEVRADYENLYGA  296

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
             A+RG+ ++C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+C+ V KAIGA DPV TYN+N
Sbjct  297   AMRGDRESCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGLCESVIKAIGASDPVLTYNIN  356

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             LSVFTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGKIDKF
Sbjct  357   LSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTCDSDGKIDKF  405



>gb|AAC68535.1| arginine decarboxylase [Nasturtium officinale]
Length=405

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/409 (77%), Positives = 362/409 (89%), Gaps = 5/409 (1%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVEFGSKFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EYISLAL  +KL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYISLALLGKKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+KL++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRKLRQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVI+IGGGLGIDYDGSKS +S++SV YTL+EYA+AVV +VRFVCD+K V H
Sbjct  181   ELVRLGANMKVIEIGGGLGIDYDGSKSGESDLSVAYTLEEYAAAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPG-LQSFVESLKDDARADYQNLSAA  1521
             PVICSESGRAIVSHHS+LIFEAVS+      Q   P  +Q  +E   ++ RADY+NL  A
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAGQ----QHETPSDVQFMLEGYSEEVRADYENLYGA  296

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
             A+RG+ ++C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+C+ V KAIGA DPV TYN+N
Sbjct  297   AMRGDRESCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGLCESVIKAIGASDPVLTYNIN  356

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             LSVFTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGK+DKF
Sbjct  357   LSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTCDSDGKMDKF  405



>gb|AAC68519.1| arginine decarboxylase [Arabidopsis arenosa]
Length=407

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/408 (78%), Positives = 363/408 (89%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKGSPDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV+KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVVRKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VRFVCDR  V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRFVCDRSSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q  +E   ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQATPDDIQFLLEG-NEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF
Sbjct  360   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKF  407



>gb|AAC68514.1| arginine decarboxylase [Boechera stricta]
Length=407

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/408 (78%), Positives = 363/408 (89%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKGSPDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV+KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVVRKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VRFVCDR+ V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRFVCDRRSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q  +E   ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQATPDDIQFLLEG-DEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTCDSDGKI+KF
Sbjct  360   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTCDSDGKINKF  407



>gb|AAC68522.1| arginine decarboxylase [Thlaspi arvense]
Length=407

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/408 (78%), Positives = 362/408 (89%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGS FRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVKFGSPFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCDR+ V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDRRSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    +    NP    F+    ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAVK-PMAHHANPDDIQFLLEGNEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKIDKF
Sbjct  360   SVFTSIPDLWGIEQLFPIVPIHKLDQRPGARGILSDLTCDSDGKIDKF  407



>gb|AAC68524.1| arginine decarboxylase [Nasturtium officinale]
Length=407

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/408 (78%), Positives = 362/408 (89%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKGSPDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVRFGSPFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVVSKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VRFVCDR+ V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRFVCDRRSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q  +E   ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQATPDDIQFLLEG-NEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF
Sbjct  360   SVFTSIPDLWGIEQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKF  407



>gb|AAC68533.1| arginine decarboxylase [Thlaspi arvense]
 gb|AAC68534.1| arginine decarboxylase [Eutrema salsugineum]
Length=403

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/409 (78%), Positives = 363/409 (89%), Gaps = 7/409 (2%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYISLALLGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+ L+++ M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRNLRQAGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP-GLQSFVESLKDDARADYQNLSAA  1521
             PVICSESGRAIVSHHS+LIFEAVS+      Q  NP  +Q  +E   ++ RADY++L AA
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAVK----QHANPDDIQFLLEG--EEVRADYEDLYAA  294

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
              +RG+ ++C LY DQLKQRCV+ FK+GSLSIEQLA+VDG+C+ V KAIGA DPV TYN+N
Sbjct  295   VMRGDRESCFLYVDQLKQRCVEGFKDGSLSIEQLASVDGLCESVLKAIGASDPVHTYNIN  354

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             LSVFTSIPDFW   QLFPIVPIH+LD+RPGARGILSD TCDSDGKIDKF
Sbjct  355   LSVFTSIPDFWGIDQLFPIVPIHKLDQRPGARGILSDFTCDSDGKIDKF  403



>gb|AAC68529.1| arginine decarboxylase [Capsella bursa-pastoris]
Length=405

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/408 (77%), Positives = 361/408 (88%), Gaps = 3/408 (1%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYISLALFGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+KL++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRKLRQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+      + P   +Q  +E   ++ R DY+NL  AA
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAGQQH--ETPTD-VQFMLEGYSEEVRGDYENLYGAA  297

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG+ ++C+LY DQLKQRCV+ FKEGSL IEQLA VDG+C+ V KAIGA DPV TY+VNL
Sbjct  298   MRGDRESCLLYVDQLKQRCVEGFKEGSLGIEQLAGVDGLCESVIKAIGASDPVLTYHVNL  357

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGKIDKF
Sbjct  358   SVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTCDSDGKIDKF  405



>gb|AAC68523.1| arginine decarboxylase [Eutrema salsugineum]
Length=407

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/408 (77%), Positives = 362/408 (89%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGS FRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVKFGSPFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCDR+ V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDRRSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    +    NP    F+    ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAVK-PMAHHANPDDIQFLLEGNEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF
Sbjct  360   SVFTSIPDLWGIEQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKF  407



>gb|AAQ14538.1|AF306451_1 arginine decarboxylase [Pinus sylvestris]
Length=551

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/552 (63%), Positives = 428/552 (78%), Gaps = 10/552 (2%)
 Frame = -3

Query  2681  RIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgglglqlpLIVR  2502
             R++GWG PYF VN +G+++VRPHGS TL  +EID++KVVKK    K LGGLG+  PLI+R
Sbjct  1     RVEGWGAPYFVVNENGNVAVRPHGSQTLPSEEIDVMKVVKKVVGSKSLGGLGMSAPLIIR  60

Query  2501  FPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEA  2322
             FPDVLK+RLESLQSAF+ A+  Q Y S++QGVYPVKCNQDR+VVE+IV+FG  + FGLEA
Sbjct  61    FPDVLKHRLESLQSAFDSAMRMQSYESYFQGVYPVKCNQDRYVVENIVEFGKPYAFGLEA  120

Query  2321  GSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLII  2142
             GSKPELLLAM+ +CK SP ALL+CNG+KD EYISLAL AR+L  N VIVLEQEEE+DL++
Sbjct  121   GSKPELLLAMASMCKASPKALLVCNGYKDEEYISLALTARRLNFNCVIVLEQEEELDLVL  180

Query  2141  DISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQ  1962
             ++SRK++VRPVIG+RAKLRTKH GHFG+TSGEKGKFGLT+ +I+ +V+KLQ+  M+DCLQ
Sbjct  181   NVSRKLSVRPVIGVRAKLRTKHGGHFGATSGEKGKFGLTSLEIVGIVRKLQKLGMLDCLQ  240

Query  1961  LLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEV  1782
             LLHFHIGSQIP   +L DGV EAA IY EL +LGA MK+IDIGGGLGIDY+G+KS+ S++
Sbjct  241   LLHFHIGSQIPCVEVLNDGVSEAAYIYSELAKLGANMKIIDIGGGLGIDYEGTKSSCSDM  300

Query  1781  SVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDK---  1611
             SV Y+L EYA+AVV+AVR  C++KGV HP+ICSESGRA+VSHHS+LIF+ VS    K   
Sbjct  301   SVSYSLDEYAAAVVKAVRVACNQKGVKHPIICSESGRALVSHHSLLIFDVVSVHEKKDSV  360

Query  1610  LLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLS  1431
                +    L   V+ L ++   +YQ++ A    G+  +  + A+ +K RC+D FKEG L 
Sbjct  361   SAAVAGMNLNPLVDGLPEELMGEYQSVMAYTAMGDCRSSQICAEHMKARCLDLFKEGRLG  420

Query  1430  IEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPG  1251
             +EQLA VDG+CDLVS        VC  +VNLS+F SIPDFWA GQLFP++PIHRL+ERP 
Sbjct  421   LEQLATVDGMCDLVSSPAADTPAVC--HVNLSIFKSIPDFWAIGQLFPVMPIHRLNERPT  478

Query  1250  ARGILSDLTCDSDGKIDKFV-----GGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGF  1086
              R ILSDLTCDS GK+D F+     GG   LPLH   G    YYLGMFLGGAY+EALGG 
Sbjct  479   VRAILSDLTCDSHGKVDTFISGDDGGGSRGLPLHPFEGRSEPYYLGMFLGGAYQEALGGL  538

Query  1085  HNLFGGPSVVRV  1050
             HNLF  P+V+ V
Sbjct  539   HNLFIVPNVIHV  550



>gb|AAC68530.1| arginine decarboxylase [Arabidopsis arenosa]
Length=405

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/409 (78%), Positives = 360/409 (88%), Gaps = 5/409 (1%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYISLALFGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+KL +  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRKLSQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSF-VESLKDDARADYQNLSAA  1521
             PVICSESGRAIVSHHS+LIFEAVS+      Q   P    F +E   ++ R DY+NL  A
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAGQ----QHETPTDHQFMLEGYSEEVRGDYENLYGA  296

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
             A+RG+ ++C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+C+ V KAIGA DPV TY+VN
Sbjct  297   AMRGDRESCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGLCEWVIKAIGASDPVLTYHVN  356

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             LSVFTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGKIDKF
Sbjct  357   LSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTCDSDGKIDKF  405



>gb|AAC68520.1| arginine decarboxylase [Sisymbrium altissimum]
 gb|AAC68521.1| arginine decarboxylase [Stanleya pinnata]
Length=407

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/408 (77%), Positives = 361/408 (88%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVRFGSPFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCDR+ V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDRRSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+      Q  NP    F+    ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAVKPMAHQ-ANPDDIQFLLEGNEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTCDSDGKIDKF
Sbjct  360   SVFTSIPDLWGIEQLFPIVPIHKLDQRPGTRGILSDLTCDSDGKIDKF  407



>gb|AAC68525.1| arginine decarboxylase [Boechera stricta]
Length=405

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/409 (77%), Positives = 362/409 (89%), Gaps = 5/409 (1%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVEFGSSFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYISLALFGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+KL++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRKLRQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA+AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP-GLQSFVESLKDDARADYQNLSAA  1521
             PVICSESGRAIVSHHS+LIFEAVS+      Q   P  +Q  +E   ++ R DY+NL  A
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAGQ----QHDTPTDVQFMLEGYSEEVRGDYENLYGA  296

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
             A+RG+ ++C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+C+ V KAIGA DPV TY+VN
Sbjct  297   AMRGDRESCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGLCESVIKAIGASDPVLTYHVN  356

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             LSVFTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTCDSDGK+DKF
Sbjct  357   LSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTCDSDGKMDKF  405



>gb|AAC68515.1| arginine decarboxylase [Barbarea vulgaris]
Length=407

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/408 (77%), Positives = 361/408 (88%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKGSPDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVRFGSPFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV KL +S M+D LQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVVSKLSQSGMLDRLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VRFVCDR+ V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRFVCDRRSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q  +E   ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQATPDDIQFLLEG-NEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF
Sbjct  360   SVFTSIPDLWGIEQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKF  407



>gb|AAC68513.1| arginine decarboxylase [Polanisia dodecandra]
Length=408

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/408 (78%), Positives = 361/408 (88%), Gaps = 0/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIG+RAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGIRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGL T QI+RVV+KL +  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLNTIQIVRVVRKLCQVGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA M+VID+GGGLGIDYDGSKS +S++SV Y+L+EYA+AVV AV+FVC+RK V H
Sbjct  181   ELVRLGAQMRVIDVGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVAAVQFVCERKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS++      +    LQ  +E   ++ARADYQNL AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSATGPARHAVTPTDLQLMIEGYSEEARADYQNLYAAV  300

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RGEY++C+LY DQLKQRCV+ FKEG LSIEQLAA DG C+LV K IGA DPV TY+VNL
Sbjct  301   MRGEYESCLLYVDQLKQRCVEGFKEGFLSIEQLAAGDGFCELVLKVIGASDPVRTYHVNL  360

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPDFW  GQLFPIVPIHRLD+RPG RGILSDLTCDSDGKI+KF
Sbjct  361   SVFTSIPDFWGIGQLFPIVPIHRLDQRPGVRGILSDLTCDSDGKIEKF  408



>gb|AAC68518.1| arginine decarboxylase [Capsella bursa-pastoris]
Length=407

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/408 (77%), Positives = 360/408 (88%), Gaps = 1/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGSSFRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RVV+KL +S M+D LQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVVRKLSQSGMLDRLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+EYA AVV +VRFVCDR  V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRFVCDRSSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q  +E   ++ARA+Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSADKPMVHQATPDDIQFLLEG-DEEARANYEDLYAAV  299

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  300   MRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  359

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPG R ILSDLTCDSDGKI+KF
Sbjct  360   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRAILSDLTCDSDGKINKF  407



>gb|AAC68532.1| arginine decarboxylase [Stanleya pinnata]
Length=403

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/409 (76%), Positives = 358/409 (88%), Gaps = 7/409 (2%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGSSF FGLEAGSKPE+LLAMSC CKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVRFGSSFGFGLEAGSKPEILLAMSCFCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EY+S AL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYVSFALLGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+ L++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRNLRQLGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP-GLQSFVESLKDDARADYQNLSAA  1521
             PVICSESGRAIVSHHS+LIFEAVS+    + Q  NP  +Q  +E   ++ RA+Y++L AA
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSA----VKQHANPDDIQFLLEG--EEVRAEYEDLYAA  294

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
              +RG+ ++C LY DQLKQRCV+ FK+GSLSIEQL +VDG+C+ V KAIGA DPV TYN+N
Sbjct  295   VMRGDRESCFLYVDQLKQRCVEGFKDGSLSIEQLVSVDGLCESVLKAIGASDPVQTYNIN  354

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             LSVFTSIPDFW   QLFPIVPIH+ D+RPGARGILSD TCDSDGKIDKF
Sbjct  355   LSVFTSIPDFWGIDQLFPIVPIHKQDQRPGARGILSDFTCDSDGKIDKF  403



>gb|AAC68516.1| arginine decarboxylase [Brassica nigra]
 gb|AAC68517.1| arginine decarboxylase [Brassica oleracea]
Length=403

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/408 (76%), Positives = 354/408 (87%), Gaps = 5/408 (1%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIV+FGS FRFGLEAGSKPE+LLAMSCLCKG+PDA L+CNGFK
Sbjct  1     YQGVYPVKGNQDRFVVEDIVRFGSQFRFGLEAGSKPEILLAMSCLCKGNPDAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYI LAL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DAEYIFLALLGRKLALNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIGSQIPST+LL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCDR+ V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDRRSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+      Q     +Q  +E        +Y++L AA 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSAVKPMAHQANPDDIQFLLE-----GNEEYEDLYAAV  295

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG++++C+LY DQLKQRCV+ FK+G LSIEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  296   MRGDHESCLLYVDQLKQRCVEGFKDGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINL  355

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTCDSDGKI KF
Sbjct  356   SVFTSIPDLWGIEQLFPIVPIHKLDQRPGTRGILSDLTCDSDGKISKF  403



>gb|AAC68531.1| arginine decarboxylase [Sisymbrium altissimum]
Length=403

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/409 (76%), Positives = 358/409 (88%), Gaps = 7/409 (2%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGSSF FGLEAGSKPE+LLAMSC CKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVRFGSSFGFGLEAGSKPEILLAMSCFCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EY+S AL  RKL LNTVIVLEQEEE+DL+ID+S+KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYVSFALLGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+ L++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRNLRQLGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP-GLQSFVESLKDDARADYQNLSAA  1521
             PVICSESGRAIVSHHS+LIFEAVS+    + Q  NP  +Q  +E   ++ RA+Y++L AA
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSA----VKQHANPDDIQFLLEG--EEVRAEYEDLYAA  294

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
              +RG+ ++C LY DQLKQRCV+ FK+GSLSIEQL +VDG+C+ V KAIGA DPV TYN+N
Sbjct  295   VMRGDRESCFLYVDQLKQRCVEGFKDGSLSIEQLVSVDGLCESVLKAIGASDPVQTYNIN  354

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             LSVFTSIPDFW   QLFPIVPIH+ D+RPGARGILSD TCDSDGKIDKF
Sbjct  355   LSVFTSIPDFWGIDQLFPIVPIHKHDQRPGARGILSDFTCDSDGKIDKF  403



>gb|AAC68528.1| arginine decarboxylase [Brassica oleracea]
Length=401

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/408 (75%), Positives = 352/408 (86%), Gaps = 7/408 (2%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSC CKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVRFGSSFRFGLEAGSKPEILLAMSCFCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EY+S AL  RKL LNTVIVLEQEEE+DL+ID+S KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYVSFALLGRKLELNTVIVLEQEEELDLVIDLSPKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+ L++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+YC
Sbjct  121   TSGEKGKFGLTTIQILRVVRNLRQLGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYC  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q  NP    F   L +   A+Y++L  A 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSA----VKQHANPDDIQF---LLEGEEAEYEDLYGAV  293

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG+ ++C LY DQLKQRCV+ FK+GSLSIEQL +VDG+C+ V KAIGA DPV TYN+NL
Sbjct  294   MRGDRESCFLYVDQLKQRCVEGFKDGSLSIEQLVSVDGLCESVLKAIGASDPVQTYNINL  353

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPDFW    LFPIVPIH+ D+RPGARGILSD TCDSDGKIDKF
Sbjct  354   SVFTSIPDFWGIDHLFPIVPIHKQDQRPGARGILSDFTCDSDGKIDKF  401



>gb|AAC68527.1| arginine decarboxylase [Brassica nigra]
Length=401

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/408 (75%), Positives = 351/408 (86%), Gaps = 7/408 (2%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCNQDRF++EDIV+FGSSFRFGLEAGSKPE+LLAMSC CKG+P+A L+CNGFK
Sbjct  1     YQGVYPVKCNQDRFIIEDIVRFGSSFRFGLEAGSKPEILLAMSCFCKGNPEAFLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             D+EY+S AL  RKL LNTVIVLEQEEE+DL+ID+S KM VRPVIGLRAKLRTKH+GHFGS
Sbjct  61    DSEYVSFALLGRKLELNTVIVLEQEEELDLVIDLSPKMNVRPVIGLRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTT QILRVV+ L++  M+DCLQLLHFHIGSQIPSTALL+DGV EAAQ+Y 
Sbjct  121   TSGEKGKFGLTTIQILRVVRNLRQLGMLDCLQLLHFHIGSQIPSTALLSDGVAEAAQLYS  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+EYA AVV +VRFVCD+K V H
Sbjct  181   ELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLEEYAEAVVASVRFVCDQKSVKH  240

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHS+LIFEAVS+    + Q  NP    F   L +   A+Y++L  A 
Sbjct  241   PVICSESGRAIVSHHSVLIFEAVSA----VKQHANPDDIQF---LLEGEEAEYEDLYGAV  293

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +RG+ ++C LY DQLKQRCV+ FK+GSLSIEQL +VDG+C+ V KAIGA DPV TYN+NL
Sbjct  294   MRGDRESCFLYVDQLKQRCVEGFKDGSLSIEQLVSVDGLCESVLKAIGASDPVQTYNINL  353

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPDFW    LFPIVPIH+ D+RPGARGILSD TCDSDGKIDKF
Sbjct  354   SVFTSIPDFWGIDHLFPIVPIHKQDQRPGARGILSDFTCDSDGKIDKF  401



>ref|XP_001760311.1| predicted protein [Physcomitrella patens]
 gb|EDQ75067.1| predicted protein [Physcomitrella patens]
Length=659

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/613 (51%), Positives = 428/613 (70%), Gaps = 26/613 (4%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WS   SA LYR+DGWG P+F +NS G+++VRP+G+ T  + EIDL+  V K         
Sbjct  21    WSVQSSAQLYRVDGWGAPFFKINSRGNMAVRPYGAKTAPNDEIDLMDTVHK----IVASQ  76

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
               + +PLI+RFPD+LKNR+++LQ+AF+  +  Q Y   +QGV+PVKCN DR+++E+IV  
Sbjct  77    DNITMPLIIRFPDILKNRMDTLQAAFDRGITRQRYAGRFQGVFPVKCNPDRYLIEEIVSH  136

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             G    FGLEAGSKPELL+ M+ +C  S  A LICNG+KDAEY+ +ALAAR + LNTVIVL
Sbjct  137   GRRINFGLEAGSKPELLMVMAAMCNASTTAFLICNGYKDAEYVKMALAARSIGLNTVIVL  196

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQ EE+D++I +S+++ +RPVIG+RAKL TKHAGH+G TSGEKGKFGL+T++I++VVK+L
Sbjct  197   EQLEELDIVIKMSKQLQIRPVIGVRAKLSTKHAGHWGETSGEKGKFGLSTSEIVQVVKRL  256

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             ++ +M DCLQLLHFHIGSQIPS +++ +GV EAA I+CEL  +GA MKVIDIGGGLG+DY
Sbjct  257   RKVDMSDCLQLLHFHIGSQIPSLSIVREGVSEAAHIFCELALMGANMKVIDIGGGLGVDY  316

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+ S+ S++S+GY ++EYA  VV+A++    +K VS P +C ESGRA+VSHHS+L+F+ 
Sbjct  317   DGTHSSSSDMSIGYNMEEYAETVVEAIKEATIQKNVSQPTLCCESGRALVSHHSVLVFDV  376

Query  1631  VS------SSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLK  1470
             +S      S+ D+ +     GL   +  L+DD       L  +   G+++  +  A +LK
Sbjct  377   LSAHKNGGSACDRGVSYNIDGLPEALAYLRDD-------LVRSVDDGDHECILTCAKKLK  429

Query  1469  QRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLF  1290
                   FK+G L +E  AA+D + ++VS    + D   TY++NLS+F SIPD WA GQLF
Sbjct  430   YESTRLFKQGLLGLEARAAIDELFEIVS-VFASSDYYTTYHINLSIFKSIPDSWAIGQLF  488

Query  1289  PIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGE-------SSLPLHELGGNGGRYYL  1131
             PIVP+HRL+  P  R ILSDLTCDSDGK+  F+G +         LP+HEL G+   YY+
Sbjct  489   PIVPLHRLEAEPTERVILSDLTCDSDGKVTTFIGNDKPGAETAKHLPVHELEGDKP-YYM  547

Query  1130  GMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPEL  951
             GMFLGGAY+E LG  HNLFG P V+ V  S     F +++   G + A+VL  M HEP L
Sbjct  548   GMFLGGAYQEVLGSLHNLFGNPHVIHVVPSKSAGGFRISKFLRGQNLANVLCAMNHEPHL  607

Query  950   MFETLKHRAEEFL  912
             MFE LK R + +L
Sbjct  608   MFENLKERVDGYL  620



>sp|O81160.1|SPE2_THECC RecName: Full=Arginine decarboxylase; Short=ADC; Short=ARGDC, 
partial [Theobroma cacao]
 gb|AAC68511.1| arginine decarboxylase [Theobroma cacao]
Length=406

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/408 (78%), Positives = 352/408 (86%), Gaps = 2/408 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVK NQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKG+P+ALL+CNGFK
Sbjct  1     YQGVYPVKSNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGNPEALLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DAEYISLAL ARKL L  VIVLEQEEEVD++IDIS+K++VRPVIG+RAKLRTKH+GHFGS
Sbjct  61    DAEYISLALLARKLALKHVIVLEQEEEVDMVIDISQKLSVRPVIGVRAKLRTKHSGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQ+LRVVKKLQ+S M+DCLQLLHFHIGSQIPSTALL+DGVGEAAQIY 
Sbjct  121   TSGEKGKFGLTTTQVLRVVKKLQDSGMLDCLQLLHFHIGSQIPSTALLSDGVGEAAQIYS  180

Query  1877  ELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSH  1698
             ELVRLGA MKV+D GGGLGIDY+GSKS DS++SV Y LQEYA  VV A+RFVCDRK V H
Sbjct  181   ELVRLGARMKVVDFGGGLGIDYNGSKSGDSDLSVPYGLQEYAH-VVNAIRFVCDRKSVKH  239

Query  1697  PVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAA  1518
             PVICSESGRAIVSHHSILIFEA+  ++      P   +   +E L +DA ADY NL   A
Sbjct  240   PVICSESGRAIVSHHSILIFEAICLTAPATHNEP-INIPFIMEGLSEDACADYWNLRDTA  298

Query  1517  IRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNL  1338
             +R        YADQ KQRCV+QFKEG+L IEQLA+VDG+C+ V KAIGA DPV TYN+NL
Sbjct  299   MRTGDGAFWFYADQWKQRCVEQFKEGTLGIEQLASVDGLCEWVLKAIGASDPVHTYNINL  358

Query  1337  SVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKF  1194
             SVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTCDSDGKI+KF
Sbjct  359   SVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKF  406



>ref|XP_001754665.1| predicted protein [Physcomitrella patens]
 gb|EDQ80635.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/621 (49%), Positives = 424/621 (68%), Gaps = 31/621 (5%)
 Frame = -3

Query  2711  WSPSMSAALYRIDGWGDPYFTVNSSGDISVRPHGSATLSHQEIDLLKVVKKASDpkplgg  2532
             WS   S+ LYR+ GWG PY+ +NS G+++VRP G+ T  + EIDL+  +++         
Sbjct  21    WSVQKSSDLYRVGGWGAPYYKINSRGNMAVRPFGAKTAPNDEIDLMDTIREV----VASQ  76

Query  2531  lglqlpLIVRFPDVLKNRLESLQSAFNFAVESQGYGSHYQGVYPVKCNQDRFVVEDIVKF  2352
               + +PLI+RFPD++KNR+++LQSAF+  +    Y   +QGV+PVKCN DR+++E+IV  
Sbjct  77    DNITMPLIIRFPDIVKNRMDTLQSAFDRGIARHRYSGRFQGVFPVKCNPDRYLIEEIVSH  136

Query  2351  GSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVL  2172
             G    FGLEAGSKPELLL M+ +C+ S DA LICNG+KD EY+ +AL AR + LNT+IVL
Sbjct  137   GRYINFGLEAGSKPELLLVMAAMCRASNDAFLICNGYKDVEYVEMALVARTMGLNTMIVL  196

Query  2171  EQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKL  1992
             EQ EE+D++I +S ++ +RPVIG+RAKL TKHAGH+G TSGEKGKFGL+T++I++VVK+L
Sbjct  197   EQLEELDIVIKVSNQLQIRPVIGVRAKLSTKHAGHWGETSGEKGKFGLSTSEIVQVVKRL  256

Query  1991  QESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidy  1812
             ++ +M DCLQLLHFHIGSQIPS +++ +GV EAA I+CEL  +GA M VIDIGGGLG+DY
Sbjct  257   RKVDMSDCLQLLHFHIGSQIPSLSIVREGVSEAAHIFCELALMGANMNVIDIGGGLGVDY  316

Query  1811  dGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEA  1632
             DG+ S+ S++S+GY ++EYA  VV+A++    +K V  P++C ESGRA+VSHHS+L+F+ 
Sbjct  317   DGTHSSSSDMSIGYNMEEYAETVVEAIKDATVQKNVKQPILCCESGRALVSHHSVLVFDV  376

Query  1631  VS------SSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLK  1470
              S      + SD+ +     GL   ++ L+DD      N       G+ +  ++ A +LK
Sbjct  377   FSAHKNGGTGSDRGISYNIDGLPEELKYLRDDFARSLDN-------GDPECILMCAKKLK  429

Query  1469  QRCVDQFKEGSLSIEQLAAVDGICDLVSKAIG------AYDPVCTYNVNLSVFTSIPDFW  1308
                   FK+G L +E  AA+D + + VS  +G        D   TY++NLS+F SIPD W
Sbjct  430   NESTRLFKQGLLGLEVRAAIDELFETVSVYVGQQKNDTGSDSSATYHINLSIFKSIPDSW  489

Query  1307  AFGQLFPIVPIHRLDERPGARGILSDLTCDSDGKIDKFVGGE-------SSLPLHELGGN  1149
             A GQLFP VP+HRL+ +P  R ILSDLTCDSDGK+  F+G +       + LPLHEL  +
Sbjct  490   AIGQLFPFVPLHRLESQPTERVILSDLTCDSDGKVVTFIGNDKFGAETANHLPLHELEDD  549

Query  1148  GGRYYLGMFLGGAYEEALGGFHNLFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVM  969
                YY+GMFLGGAY+E LG  HNLFG P VV V  S       +T+  PG + A+VL  M
Sbjct  550   KP-YYMGMFLGGAYQEVLGSLHNLFGNPHVVHVVPSKSAGGVRITKFLPGQNLANVLCAM  608

Query  968   QHEPELMFETLKHRAEEFLHD  906
              H P+LM+E LK R + +L +
Sbjct  609   NHAPQLMYENLKERVDNYLRE  629



>ref|XP_003607076.1| Arginine decarboxylase [Medicago truncatula]
Length=432

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/434 (70%), Positives = 353/434 (81%), Gaps = 7/434 (2%)
 Frame = -3

Query  1979  MIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSK  1800
             M+DCLQLLHFHIGSQIP+T LLADGVGEAAQIYCEL+RLGA M+V+ IGGGLGIDYDGSK
Sbjct  1     MLDCLQLLHFHIGSQIPTTELLADGVGEAAQIYCELLRLGAQMRVLYIGGGLGIDYDGSK  60

Query  1799  SADSEVSVGYTLQEYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSS  1620
             S+DS++SV Y L+EYA+AVV AV++VCDR+ V HPVICSESGRAIVSHHS+LIFEA+ +S
Sbjct  61    SSDSDLSVAYGLEEYAAAVVHAVKYVCDRRNVKHPVICSESGRAIVSHHSVLIFEAIGAS  120

Query  1619  SDKLLQLPNPGLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEG  1440
             S     L + GLQ   E L ++A ADYQN+SAA + G+++ C+LY DQ K+ CV+QFK+G
Sbjct  121   SKSAPSLSSIGLQYLGEGLSEEALADYQNISAATLHGDHEACLLYTDQFKKHCVEQFKQG  180

Query  1439  SLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDE  1260
             +L IEQLAAVDG+CDL+++ IG  D V  Y++NLSVFTSIPDFW+  QLFPI+PIHRLDE
Sbjct  181   TLGIEQLAAVDGLCDLITETIGVKDQVRKYHMNLSVFTSIPDFWSIDQLFPIIPIHRLDE  240

Query  1259  RPGARGILSDLTCDSDGKIDKFVGGESSLPLHELGGNGGRYYLGMFLGGAYEEALGGFHN  1080
             +P ARGILSDLTCDSDGKIDKF+GGESSLPLHEL G+GG YYLGMFLGGAYEEALGG HN
Sbjct  241   KPTARGILSDLTCDSDGKIDKFIGGESSLPLHELEGHGGGYYLGMFLGGAYEEALGGLHN  300

Query  1079  LFGGPSVVRVSQSDGPHSFSVTRAAPGPSCADVLRVMQHEPELMFETLKHRAEEFL--HD  906
             LFGGPSVVRV QSDGPH F+VTRA  GPS ADVLRVMQHEP+LMFETLKHRA EF   HD
Sbjct  301   LFGGPSVVRVLQSDGPHGFAVTRAVAGPSSADVLRVMQHEPQLMFETLKHRALEFCGQHD  360

Query  905   EDNGGMafaslasslansFHNMPYLVVGSTCCLTAATTPGSGYYYGNDVSAANPIADSS-  729
             +D+  +  A LA+ LA SF NMPYLV  S CCL A T    G+YY +    +   A ++ 
Sbjct  361   DDS-VVGAAGLANCLARSFDNMPYLVSSSACCLNAVTN-NDGFYYCSGDDFSADSASAAT  418

Query  728   --PGEDEHWSYCIA  693
                GEDEHWSYC A
Sbjct  419   SVAGEDEHWSYCCA  432



>dbj|BAE72686.1| arginine decarboxylase [Vitis vinifera]
Length=403

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/404 (69%), Positives = 325/404 (80%), Gaps = 2/404 (0%)
 Frame = -3

Query  2417  YQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNGFK  2238
             YQGVYPVKCN DRF+VED+VKFGS+FRFGLEAGSKPE LLAMSCLCKG+P+ALL+CNGFK
Sbjct  1     YQGVYPVKCNHDRFIVEDVVKFGSAFRFGLEAGSKPEPLLAMSCLCKGNPEALLVCNGFK  60

Query  2237  DAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHFGS  2058
             DA+YI+LAL ARKL LNTVIVLEQEEE+DL+I++S+K++V PVIG+RAKLRTKHAGHFGS
Sbjct  61    DADYIALALVARKLALNTVIVLEQEEELDLVINLSQKLSVHPVIGVRAKLRTKHAGHFGS  120

Query  2057  TSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQIYC  1878
             TSGEKGKFGLTTTQILRVV+KL+++ M+D LQLLHFHIGSQI        G  +  +   
Sbjct  121   TSGEKGKFGLTTTQILRVVRKLEQAGMLDSLQLLHFHIGSQILLQTCSQMGSVKLLRFTV  180

Query  1877  EL-VRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGVS  1701
                V +  C  +   G  + I        +S++S GY L+E   A V+AV+ VCDRK V 
Sbjct  181   NWSVSVPICESLTLEGVSVLIMMGSKVRVESDISGGYGLEEXXMAXVRAVQHVCDRKSVK  240

Query  1700  HPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVESLKDDARADYQNLSAA  1521
             HPVICSESGRA+VSHHSILIFEAVS+S        +  LQ FVE L ++AR DYQNL+AA
Sbjct  241   HPVICSESGRALVSHHSILIFEAVSASVHD-SPATSLSLQRFVEGLSEEARVDYQNLAAA  299

Query  1520  AIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTYNVN  1341
             A+ GEY+TC+ +ADQLKQRCVDQFKEGSL IEQLA VDG+CDLVSK +GA DPV TY+VN
Sbjct  300   AVSGEYETCLRFADQLKQRCVDQFKEGSLGIEQLADVDGLCDLVSKEVGATDPVRTYHVN  359

Query  1340  LSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTCDSDG  1209
             LSVFT IPDFW  GQLFPIVPIHRLD+RPG RGI SDLTCDSDG
Sbjct  360   LSVFTCIPDFWGIGQLFPIVPIHRLDQRPGGRGIKSDLTCDSDG  403



>gb|AAV87173.1| arginine decarboxylase [Phaseolus vulgaris]
Length=386

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/392 (73%), Positives = 334/392 (85%), Gaps = 8/392 (2%)
 Frame = -3

Query  2423  SHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSPDALLICNG  2244
             SHYQGVYPVKCNQDRFVVEDIVKFGS FRFGLEAGSKPELLLAMSCLCKG+PDALLICNG
Sbjct  1     SHYQGVYPVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSCLCKGNPDALLICNG  60

Query  2243  FKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMAVRPVIGLRAKLRTKHAGHF  2064
             FKDAEYISLAL A KL LNTVIVLEQEEEVDLII++S+K+ ++PVIGLRAKLRTKH+GHF
Sbjct  61    FKDAEYISLALVANKLALNTVIVLEQEEEVDLIIELSKKLCIKPVIGLRAKLRTKHSGHF  120

Query  2063  GSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIGSQIPSTALLADGVGEAAQI  1884
             G     + KFGLTT QILRVVKKL  + M+DCLQLLHFHIGSQIPSTALLADGVGEAAQI
Sbjct  121   GGYFRRESKFGLTTAQILRVVKKLDLAGMLDCLQLLHFHIGSQIPSTALLADGVGEAAQI  180

Query  1883  YCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQEYASAVVQAVRFVCDRKGV  1704
             YCELVRLGA M+VIDIGGGLGIDYDGSKS DS++SVGY+L+EYASAVV A++ VCDR+ V
Sbjct  181   YCELVRLGANMRVIDIGGGLGIDYDGSKSCDSDISVGYSLEEYASAVVHAIQCVCDRRSV  240

Query  1703  SHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQSFVES--LKDDARADYQNL  1530
              +PVICSESGRAIVSH SIL+FEAV +S+         G+ S   +  +  D   DY+ L
Sbjct  241   KNPVICSESGRAIVSHQSILVFEAVGTST------TVGGVSSAFSAPYVAGDLSEDYRFL  294

Query  1529  SAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGICDLVSKAIGAYDPVCTY  1350
             S AA  G+Y++C+ Y ++LK+RCV+QFK+G++ +EQLAAVDG+C+LV KA+GA +PV  Y
Sbjct  295   SEAAFGGDYESCLAYTEELKERCVEQFKQGAVCMEQLAAVDGLCELVRKAVGAGEPVRRY  354

Query  1349  NVNLSVFTSIPDFWAFGQLFPIVPIHRLDERP  1254
             +VNLSVFTSIPD W   Q+FPI+PIHRLDE+P
Sbjct  355   HVNLSVFTSIPDAWGIEQVFPIIPIHRLDEKP  386



>gb|ADN93178.1| arginine decarboxylase 2 [Camelina microcarpa]
Length=364

 Score =   541 bits (1393),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 316/364 (87%), Gaps = 0/364 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEY+SLAL  RKL LNTVIVLEQEEE+DLII++S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLALNTVIVLEQEEELDLIIELSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV+KL ES M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLSESGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVRLGA MKV DIGGGLGIDYDGSKS DS++SV YTL+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVFDIGGGLGIDYDGSKSGDSDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS +   +     P   
Sbjct  181   EYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSVAKPTVHHQATPNDI  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
              F+    ++ARA+Y++L AA +RG+ ++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   QFLLEGDEEARANYEDLYAAVMRGDRESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  300

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARGI SDLTC
Sbjct  301   CEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGIFSDLTC  360

Query  1220  DSDG  1209
             DSDG
Sbjct  361   DSDG  364



>gb|ADN93156.1| arginine decarboxylase 2 [Dontostemon glandulosus]
 gb|ADN93157.1| arginine decarboxylase 2 [Sisymbriopsis yechengnica]
Length=362

 Score =   540 bits (1390),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 322/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLR+KLRTKH+GHFGSTSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRSKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S +SVGY+L+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRLGAHMQVIDIGGGLGIDYDGSKSGESGLSVGYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AV+ ++RFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVSS+   + Q    G+Q
Sbjct  181   EYAEAVIASIRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSSAKPVVHQTSPNGIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARADY++L AA +RG++ +C++Y DQLKQRCV+ FKEG +SIEQLA+VDG+
Sbjct  241   FLLES--EEARADYEDLFAAVMRGDHKSCLVYVDQLKQRCVEGFKEGVISIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93163.1| arginine decarboxylase 2 [Sterigmostemum violaceum]
Length=362

 Score =   540 bits (1390),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 319/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH+GHFG TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHSGHFGPTSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVR+GA MKVIDIGGGLGIDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRMGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AV+ ++RFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS++   + Q     +Q
Sbjct  181   EYAEAVIASIRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSATKPVVHQASPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  +DARADY++L AA +RG+ + C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   FLLES--EDARADYEDLYAAVMRGDNERCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTC
Sbjct  299   CEWVLKAIGASDPVSTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93159.1| arginine decarboxylase 2 [Neotorularia korolkowii]
Length=362

 Score =   540 bits (1390),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 321/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMRKLNQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SVGYTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRLGANMQVIDIGGGLGIDYDGSKSGESDLSVGYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AV+ ++RFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+S+  + Q     ++
Sbjct  181   EYAEAVIASIRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSASTPVVHQTSPNDIK  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARADY++L AA +RG++ +C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   FLLES--EEARADYEDLYAAVMRGDHKSCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RP  RGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPNVRGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93141.1| arginine decarboxylase 1, partial [Iberis amara]
Length=361

 Score =   538 bits (1385),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 315/364 (87%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGDPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSKKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL++  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQIIRVVRKLRQEGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELVRLGAHMQVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV +VRFVCD+K V HPVICSESGRAIVSHHS+L+FEAVS+      + P   LQ
Sbjct  181   EYATAVVASVRFVCDQKSVKHPVICSESGRAIVSHHSVLVFEAVSTGQHH--ETPTD-LQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++ R DY+NL  A +RG+ + C+LY DQLKQRCV+ FKEGSL IEQLAAVDG+
Sbjct  238   FLLEGYSEEVRGDYENLYEAVMRGDRERCLLYVDQLKQRCVEGFKEGSLRIEQLAAVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ VSKAIGA DPV TYNVNLSVFTSIPDFW   Q+FPIVPIHRLD+RP  RGILSDLTC
Sbjct  298   CEWVSKAIGAADPVLTYNVNLSVFTSIPDFWGINQMFPIVPIHRLDQRPMIRGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93168.1| arginine decarboxylase 2 [Clausia trichosepala]
Length=362

 Score =   537 bits (1384),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 319/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFK AEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKGAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKSA+S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRLGADMQVIDIGGGLGIDYDGSKSAESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++RFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVSS+   +    +  +Q
Sbjct  181   EYAEAVVASIRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSSAKPMVHPTSHDDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARADY+ L AA +RG++ +C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   FLLES--EEARADYEELYAAVMRGDHKSCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGNRGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93183.1| arginine decarboxylase 2 [Hedinia taxkargannica var. hejingensis]
Length=363

 Score =   537 bits (1383),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 318/364 (87%), Gaps = 1/364 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSC CKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCFCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV+KKL +  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMKKLSQFRMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q
Sbjct  181   EYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSAVKPMVHQATPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++ARA+YQ+L AA +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   FLLEG-DEEARANYQDLYAAVMRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  299

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  300   CEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  359

Query  1220  DSDG  1209
             DSDG
Sbjct  360   DSDG  363



>gb|ADN93181.1| arginine decarboxylase 2 [Erysimum sisymbrioides]
Length=363

 Score =   535 bits (1379),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 319/364 (88%), Gaps = 1/364 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT+QI+RVV+KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTSQIVRVVRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+    + Q   PG  
Sbjct  181   EYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSAVKPMVHQ-ATPGDI  239

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
              F+     +ARA+Y++L AA +RG++++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  240   QFLLEGDGEARANYEDLYAAVMRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  299

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  300   CEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  359

Query  1220  DSDG  1209
             DS+G
Sbjct  360   DSEG  363



>gb|ADN93164.1| arginine decarboxylase 2 [Matthiola chorassanica]
Length=362

 Score =   535 bits (1379),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 320/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLC+G+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCRGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH+GHFG TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHSGHFGPTSGEKGKFGLTTTQIVRVLRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVR+GA MKVIDIGGGLGIDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRMGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++RFVCD++ V HPVICSESGRAIVSHHS+LIFEAVS++  ++ Q     +Q
Sbjct  181   EYADAVVASIRFVCDQRSVKHPVICSESGRAIVSHHSVLIFEAVSAAKPEVHQTSPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARADYQ+L AA +RG+ ++C+LY DQLKQRCV+ FK+G LS+EQLAAVDG+
Sbjct  241   FLLES--EEARADYQDLYAAVMRGDNESCLLYVDQLKQRCVEGFKDGVLSVEQLAAVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93153.1| arginine decarboxylase 1, partial [Goldbachia laevigata]
Length=361

 Score =   535 bits (1379),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 278/365 (76%), Positives = 319/365 (87%), Gaps = 5/365 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKGSPDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGSPDAFLVCNGFKDAEYISLALLGRKLELNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGK GLTT QI+RVV+KL++  M+DCL+LLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKLGLTTIQIVRVVRKLRQVGMLDCLRLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL+RLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELIRLGARMEVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPG-L  1584
             EYA+AVV +VRFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS+S     Q   P  +
Sbjct  181   EYAAAVVASVRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSASQ----QHETPSDV  236

Query  1583  QSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDG  1404
             Q  +E   ++AR DY+NL AAA+RG+ ++C+LY DQLKQRCVD FKEGSLSIEQLA VDG
Sbjct  237   QFLLEGHSEEARGDYENLYAAAMRGDRESCLLYVDQLKQRCVDGFKEGSLSIEQLAGVDG  296

Query  1403  ICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLT  1224
             +C+ V KAIGA DPV TY+VNLSV TSIPDFW   QLFPIVPIHRL++RP ARGILSDLT
Sbjct  297   LCEWVVKAIGASDPVLTYDVNLSVSTSIPDFWGIDQLFPIVPIHRLEQRPAARGILSDLT  356

Query  1223  CDSDG  1209
             CDSDG
Sbjct  357   CDSDG  361



>gb|ADN93165.1| arginine decarboxylase 2 [Diptychocarpus strictus]
Length=362

 Score =   535 bits (1378),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 318/364 (87%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGE+GKFGLTTTQILRV++KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGERGKFGLTTTQILRVIRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EA Q+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEATQLYCELVRLGAHMEVIDIGGGLGIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++RFVCDR+ V HPVICSESGRA+VSHHS+LIFEAVSS+   + Q     +Q
Sbjct  181   EYAEAVVASIRFVCDRRSVKHPVICSESGRALVSHHSVLIFEAVSSTKPVVHQTSPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++ARADY++L AA +RG++++C++Y DQLKQRCV+ FKEG  SIEQLA+VDG+
Sbjct  241   FLLEG--EEARADYEDLYAAVMRGDHESCLVYVDQLKQRCVEGFKEGVFSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGNRGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93128.1| arginine decarboxylase 1, partial [Arabis hirsuta]
Length=361

 Score =   535 bits (1378),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 277/365 (76%), Positives = 316/365 (87%), Gaps = 5/365 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LN VIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLELNAVIVLEQEEELDLVIDLSKKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL +  M+DCL+LLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTVQIVRVVRKLCQVGMLDCLELLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL+RLGA M VIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELIRLGARMGVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNP-GL  1584
             EYA+AVV ++RFVCD+K V HPVICSESGRAIVSHHS+L+FEAVS+      Q   P  +
Sbjct  181   EYAAAVVASIRFVCDQKSVKHPVICSESGRAIVSHHSVLVFEAVSAGQ----QHETPIDI  236

Query  1583  QSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDG  1404
             Q  +E   ++AR DY+NL  AA+RG+ D+C+LY DQLKQRCV+ FKEGSLSIEQLA VDG
Sbjct  237   QFLLEGYSEEARGDYENLYGAAMRGDRDSCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDG  296

Query  1403  ICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLT  1224
             +C+ V KAIGA DPV TYNVNLSVFTSIPDFW   QLFPIVPIHRLDERP ARGILSDLT
Sbjct  297   LCEWVIKAIGASDPVLTYNVNLSVFTSIPDFWGIDQLFPIVPIHRLDERPVARGILSDLT  356

Query  1223  CDSDG  1209
             CDSDG
Sbjct  357   CDSDG  361



>gb|ADN93166.1| arginine decarboxylase 2 [Diptychocarpus strictus]
Length=362

 Score =   535 bits (1377),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 317/364 (87%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSC CKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCFCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQILRV++KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQILRVIRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EA Q+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEATQLYCELVRLGAHMEVIDIGGGLGIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++RFVCDR+ V HPVICSESGRA+VSHHS+LIFEAVSS+   + Q     +Q
Sbjct  181   EYAEAVVASIRFVCDRRSVKHPVICSESGRALVSHHSVLIFEAVSSTKPVVHQTSPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++ARADY++L AA +RG++++C++Y DQLKQRCV+ FKEG  SIEQLA+VDG+
Sbjct  241   FLLEG--EEARADYEDLYAAVMRGDHESCLVYVDQLKQRCVEGFKEGVFSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGNRGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93120.1| arginine decarboxylase 1, partial [Diptychocarpus strictus]
Length=361

 Score =   535 bits (1377),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 320/364 (88%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL++  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQIVRVVRKLRQMGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL+RLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELIRLGADMQVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV ++RFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS+  +   + P   +Q
Sbjct  181   EYAAAVVASIRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAGHNH--ETPTD-VQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++AR DY+NL  AA+RG+ ++C+LY DQLKQRC++ FKEGSLSIEQLA VDG+
Sbjct  238   FLLEGYSEEARGDYENLYGAAMRGDKESCLLYVDQLKQRCIEGFKEGSLSIEQLAGVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYNVNLS+FTSIPDFW   QLFPIVPIHRL++RP ARGILSDLTC
Sbjct  298   CEWVVKAIGASDPVLTYNVNLSLFTSIPDFWGTDQLFPIVPIHRLEQRPVARGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93124.1| arginine decarboxylase 1, partial [Dontostemon integrifolius]
Length=361

 Score =   534 bits (1376),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 319/364 (88%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV KL++  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQIVRVVGKLRQLGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL+RLGA M+VIDIGGGLGIDYDGSKS ++++SV Y+L+
Sbjct  121   SQIPSTALLSDGVSEAAQLYCELIRLGAHMQVIDIGGGLGIDYDGSKSGETDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV ++RFVCD+K V+HPVICSESGRAIVSHHS+LIFEAVS+  +   + P   +Q
Sbjct  181   EYAAAVVASIRFVCDQKSVNHPVICSESGRAIVSHHSVLIFEAVSAGHNH--ETPTD-VQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E    +AR DY+N+ +AA+RG+ ++C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+
Sbjct  238   FLLEGYSKEARGDYENVYSAAMRGDGESCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V+KAIG  DPV TYNVNLSVFTSIPDFW   Q FPIVPIHRLD+RPG RGILSDLTC
Sbjct  298   CEWVTKAIGKSDPVLTYNVNLSVFTSIPDFWGIDQQFPIVPIHRLDQRPGTRGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93121.1| arginine decarboxylase 1, partial [Diptychocarpus strictus]
Length=361

 Score =   534 bits (1376),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 319/364 (88%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSC CKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM 
Sbjct  1     LAMSCFCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL++  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQIVRVVQKLRQMGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL+RLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELIRLGADMQVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV ++RFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS+  +   + P   +Q
Sbjct  181   EYAAAVVASIRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAGHNH--ETPTD-VQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++AR DY+NL  AA+RG+ ++C+LY DQLKQRC++ FKEGSLSIEQLA VDG+
Sbjct  238   FLLEGYSEEARGDYENLYGAAMRGDKESCLLYVDQLKQRCIEGFKEGSLSIEQLAGVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYNVNLS+FTSIPDFW   QLFPIVPIHRL++RP ARGILSDLTC
Sbjct  298   CEWVVKAIGASDPVLTYNVNLSLFTSIPDFWGIDQLFPIVPIHRLEQRPAARGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93160.1| arginine decarboxylase 2 [Lachnoloma lehmannii]
Length=361

 Score =   534 bits (1376),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 317/364 (87%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+ V++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVHVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SVGYTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRLGAHMQVIDIGGGLGIDYDGSKSGESDLSVGYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AV+ ++RFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS +   + Q     +Q
Sbjct  181   EYAEAVIASIRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSGAKPVVHQTSPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES   +ARADY+ L AA +RG++ +C+LY DQLKQRCV+ FKEG +SIEQLA+VDG+
Sbjct  241   FLLES---EARADYEELYAAVMRGDHKSCLLYVDQLKQRCVEGFKEGVVSIEQLASVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RP ARGILSDLTC
Sbjct  298   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPSARGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93147.1| arginine decarboxylase 1, partial [Sinapis alba]
Length=361

 Score =   534 bits (1375),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 319/364 (88%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSC CKG+PDA L+CNGFKDAEY+SLAL  RKL LNTVIVLEQE+E+DL+ID+S+KM 
Sbjct  1     LAMSCFCKGNPDAFLVCNGFKDAEYVSLALLGRKLELNTVIVLEQEDELDLVIDLSKKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL+E  M+D LQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTVQIIRVVRKLREVGMLDSLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVSEAAQLYCELVRLGARMEVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV +VRFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS+   K  + P+  LQ
Sbjct  181   EYAAAVVASVRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAG--KQHETPSD-LQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++AR DY+NL  AA RG+ ++C+LY DQLKQRCV++FKEGSLSIEQLA VDG+
Sbjct  238   FLLEGYSEEARGDYENLYDAATRGDRESCLLYVDQLKQRCVEEFKEGSLSIEQLAGVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V+K IGA DPV TYNVNLSVFTS+PDFW   QLFPIVPIH+LD+RP ARGILSDLTC
Sbjct  298   CEWVTKEIGASDPVLTYNVNLSVFTSVPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93116.1| arginine decarboxylase 1, partial [Christolea crassifolia]
Length=361

 Score =   533 bits (1374),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 316/364 (87%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEY+SLAL  RKL  NT+IVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYVSLALLGRKLGFNTIIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL +  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQIVRVVRKLGQVGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL+RLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELIRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV ++RFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS+  +   + P   +Q
Sbjct  181   EYAAAVVASIRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAGHNH--ETPTD-VQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++AR DY+NL  AA+RG+   C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+
Sbjct  238   FLLEGYSEEARGDYENLYGAAMRGDNKNCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYNVNLSVFTSIPDFW   QLFPIVPIH+LD+RP ARG+LSDLTC
Sbjct  298   CEWVIKAIGASDPVLTYNVNLSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGVLSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93158.1| arginine decarboxylase 2 [Leptaleum filifolium]
Length=362

 Score =   533 bits (1374),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 269/364 (74%), Positives = 320/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+P+A L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S++M 
Sbjct  1     LAMSCLCKGNPEAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQRMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMRKLNQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SVGYTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRLGANMQVIDIGGGLGIDYDGSKSGESDLSVGYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AV+ ++RFVC+R+ V HPVICSESGRAIVSHHS+LIFEAVSSS+  + Q     + 
Sbjct  181   EYAEAVIASIRFVCNRRSVKHPVICSESGRAIVSHHSVLIFEAVSSSTPSVHQTSPNDIN  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++AR+DY++L AA +RG++ +C++Y DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   FLLES--EEARSDYEDLYAAVMRGDHKSCLVYVDQLKQRCVEGFKEGVLSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V  AIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RP ARG+LSDLTC
Sbjct  299   CEWVLNAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPSARGVLSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93184.1| arginine decarboxylase 2 [Descurainia sophia]
Length=363

 Score =   533 bits (1373),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 317/364 (87%), Gaps = 1/364 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+I++S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV+KKL +  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVIKKLSQFGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS DS++SV Y+L+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRLGAHMQVIDIGGGLGIDYDGSKSGDSDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q
Sbjct  181   EYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSAVKPMVHQASPDDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++ARA+Y++L AA +RG++ +C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   FLLEG-NEEARANYEDLYAAVVRGDHKSCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  299

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA D V TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  300   CEWVLKAIGASDAVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  359

Query  1220  DSDG  1209
             DSDG
Sbjct  360   DSDG  363



>gb|ADN93180.1| arginine decarboxylase 2 [Erysimum siliculosum]
Length=363

 Score =   533 bits (1372),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 316/364 (87%), Gaps = 1/364 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV+KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++S  Y+L+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSAAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV +VRFVCDR+ V HPVICSESGRA+VSHHS+LIFEAVS+    + Q   PG  
Sbjct  181   EYAEAVVASVRFVCDRRSVKHPVICSESGRAMVSHHSVLIFEAVSAVKPMVHQ-ATPGDI  239

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
              F+     +ARA+Y++L AA +RG+ ++C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  240   QFLLEGDGEARANYEDLYAAVMRGDQESCLLYVDQLKQRCVESFKEGVLSIEQLASVDGL  299

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA D V TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  300   CEWVLKAIGASDSVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  359

Query  1220  DSDG  1209
             DSDG
Sbjct  360   DSDG  363



>gb|ADN93129.1| arginine decarboxylase 1, partial [Turritis glabra]
Length=361

 Score =   533 bits (1372),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 277/364 (76%), Positives = 318/364 (87%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKD EYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDFEYISLALFGRKLELNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL++  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTMQIVRVVRKLRQVGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV +VRFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS+   K  + P   +Q
Sbjct  181   EYATAVVASVRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAG--KQHETPTD-VQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++ R  Y+NL  AA+RG++++C+LY DQLKQRCV+ FKEGSLSIEQLA VDG+
Sbjct  238   FMLEGYSEEVRNYYENLYGAAMRGDHESCLLYVDQLKQRCVEGFKEGSLSIEQLAGVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TY+VNLSVFTSIPDFW   QLFPIVPIHRLD+RP ARGILSDLTC
Sbjct  298   CEWVIKAIGASDPVLTYHVNLSVFTSIPDFWGIDQLFPIVPIHRLDQRPVARGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93177.1| arginine decarboxylase 2 [Turritis glabra]
Length=364

 Score =   533 bits (1372),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 271/364 (74%), Positives = 318/364 (87%), Gaps = 0/364 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL+LNTVIVLEQEEE+DL+I++S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLVLNTVIVLEQEEELDLVIELSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV+KL ++ M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLSQTGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVR GA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRPGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV +VRFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS++   +     P   
Sbjct  181   EYAEAVVASVRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSAAKPIVHHQATPNDI  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
              F+    ++ARA+Y++L AA +RG+++ C+LY +QLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   QFLLEGDEEARANYEDLYAAVMRGDHERCLLYVEQLKQRCVEGFKEGVLSIEQLASVDGL  300

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  301   CEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  360

Query  1220  DSDG  1209
             DSDG
Sbjct  361   DSDG  364



>gb|ADN93169.1| arginine decarboxylase 2 [Eutrema salsugineum]
Length=365

 Score =   533 bits (1372),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 274/367 (75%), Positives = 322/367 (88%), Gaps = 5/367 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNT+IVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTLIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT+QI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTSQIVRVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST LL DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTPLLTDGVAEAAQLYCELVRLGANMKVIDIGGGLGIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSD--KLLQLPNP-  1590
             EYA AVV ++RFVCDR+ V HP ICSESGRAIVSHHS+LIFEAVS+SS+   +    NP 
Sbjct  181   EYAEAVVASIRFVCDRRSVKHPAICSESGRAIVSHHSVLIFEAVSASSNVKPMAHRANPD  240

Query  1589  GLQSFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAV  1410
              +Q  +ES  ++ARA+Y++L AA +RG++ +C+LY D+LKQRCV+ FK+G LSIEQLA+V
Sbjct  241   DIQFLLES--EEARANYEDLYAAVMRGDHKSCLLYVDELKQRCVEGFKDGVLSIEQLASV  298

Query  1409  DGICDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSD  1230
             DG+C+ V KAIGA DPV TYN+NLS+FTSIPD W   QLFPIVPIH+LD+RPGARGILSD
Sbjct  299   DGLCEWVLKAIGASDPVQTYNINLSLFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSD  358

Query  1229  LTCDSDG  1209
             LTCDSDG
Sbjct  359   LTCDSDG  365



>gb|ADN93195.1| arginine decarboxylase 2 [Arabis hirsuta]
Length=362

 Score =   532 bits (1370),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 270/364 (74%), Positives = 319/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM+
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSKKMS  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH GHFGSTSGEKGKFGLTT+QI+RV++KL ++ M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHEGHFGSTSGEKGKFGLTTSQIVRVMRKLSQTGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++S+ YTL+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSIAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++RFVCDR+ V HPVICSESGRAIVSHHS+LIFEAVS+    + +     +Q
Sbjct  181   EYAEAVVASIRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVSAVKPSVHEASPDDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  D+ARA+Y++L AA +R ++++C+LY DQLKQRCV+ FK+G LSIEQL AVDG+
Sbjct  241   FLLES--DEARANYEDLYAAVMRRDHESCLLYVDQLKQRCVEGFKDGVLSIEQLVAVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAI A DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTC
Sbjct  299   CEWVLKAISASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93167.1| arginine decarboxylase 2 [Chorispora sibirica]
Length=362

 Score =   532 bits (1370),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 269/364 (74%), Positives = 319/364 (88%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSC CKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCFCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EA Q+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEATQLYCELVRLGAHMEVIDIGGGLGIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++R+VCDR+ V HPVICSESGRA+VSHHS+LIFEAVS+S+  + Q     +Q
Sbjct  181   EYAEAVVASIRYVCDRRSVKHPVICSESGRALVSHHSVLIFEAVSASNPTVHQTSPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E+  ++ARADY++L AA +RG++++C++Y DQLKQRCV+ FKEG  SIEQLA+V+G+
Sbjct  241   FLLEA--EEARADYEDLYAAVMRGDHESCLVYVDQLKQRCVEGFKEGVFSIEQLASVNGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGNRGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93117.1| arginine decarboxylase 1, partial [Leptaleum filifolium]
Length=361

 Score =   531 bits (1369),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 315/364 (87%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSC CKG+PDA L+CNGFKDAEYISLAL  RKL LNT+IVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCFCKGNPDAYLVCNGFKDAEYISLALLGRKLALNTIIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL +  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTIQIVRVVRKLGQVGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL+RLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVSEAAQLYCELIRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV ++RFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS+      + P   +Q
Sbjct  181   EYAAAVVASIRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAGHSH--ETPTD-VQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++AR DY+NL AAA+RG+   C++Y DQLKQRCV+ FKEGSLSIEQLA VDG+
Sbjct  238   FLLEGYSEEARGDYENLYAAAMRGDNQNCLVYVDQLKQRCVEGFKEGSLSIEQLAGVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYNVNLSVFTSIPDFW   QLFPIVPIH+LD+RP ARG LSDLTC
Sbjct  298   CEWVVKAIGASDPVLTYNVNLSVFTSIPDFWGIDQLFPIVPIHKLDQRPVARGRLSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93144.1| arginine decarboxylase 1, partial [Brassica nigra]
Length=362

 Score =   532 bits (1370),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 316/364 (87%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKGSP+A L+CNGFKDAEY+SLAL  RKL LNTVIVLEQEEE+DL+I +S+K+ 
Sbjct  1     LAMSCLCKGSPEAFLVCNGFKDAEYVSLALLGRKLQLNTVIVLEQEEELDLVIALSKKVN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT QI+RVV+KL++  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTVQIIRVVRKLRDVGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCELVRLGA M+VIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVSEAAQLYCELVRLGARMEVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV +VRFVCD+K V HPVICSESGRAIVSHHS+LIFEAVS    K  +     LQ
Sbjct  181   EYAAAVVASVRFVCDQKSVKHPVICSESGRAIVSHHSVLIFEAVSVG--KRHETTPSDLQ  238

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++AR DY+NL  A +RG+ ++C+LY DQLKQRCV++FKEGSLSIEQLA VDG+
Sbjct  239   FLLEGYSEEARGDYENLYDAVMRGDRESCLLYVDQLKQRCVEEFKEGSLSIEQLAGVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V+K IG  DPV TYNVNLSVFTSIPDFW   QLFPIVPIHRLD+RP ARGILSDLTC
Sbjct  299   CEWVTKEIGGSDPVLTYNVNLSVFTSIPDFWGIDQLFPIVPIHRLDQRPVARGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93182.1| arginine decarboxylase 2 [Smelowskia annua]
Length=363

 Score =   532 bits (1370),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 315/364 (87%), Gaps = 1/364 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTV+VLEQEEE+DLIID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLALNTVVVLEQEEELDLIIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RV+KKL +  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVMKKLGQFGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++RFVCDR  V HPVICSESGRAIVSHHS+LIFEAVS+    + Q     +Q
Sbjct  181   EYAEAVVASIRFVCDRSSVKHPVICSESGRAIVSHHSVLIFEAVSTDKPMVHQATPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++ARA+Y++L AA +RG+ ++C+LY DQLKQRCV+ FKEG L IEQLA+VDG+
Sbjct  241   FLLEG-DEEARANYEDLYAAVMRGDQESCLLYVDQLKQRCVEGFKEGVLGIEQLASVDGL  299

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  300   CEWVLKAIGASDPVQTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  359

Query  1220  DSDG  1209
             DSDG
Sbjct  360   DSDG  363



>gb|ADN93134.1| arginine decarboxylase 1, partial [Smelowskia annua]
Length=361

 Score =   531 bits (1369),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 319/364 (88%), Gaps = 3/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+P+A L+CNGFKD+EYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPEAFLVCNGFKDSEYISLALLGRKLELNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTT+QI+RVV+KL++  M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTSQIVRVVRKLRQVGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPSTALL+DGV EAAQ+YCEL RLGA MKVI IGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTALLSDGVAEAAQLYCELSRLGAHMKVIGIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA+AVV ++RF CD+K V HPVICSESGRAIVSHHS+LIFEAVS+   K  + P   +Q
Sbjct  181   EYAAAVVASIRFACDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAG--KQHETPTD-VQ  237

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +E   ++AR DY+NL  AA+RG+ ++C+LY D+LKQRCV+ FKEGSLSIEQLAAVDG+
Sbjct  238   FLLEGYSEEARGDYENLYGAAMRGDRESCLLYVDRLKQRCVEGFKEGSLSIEQLAAVDGL  297

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TY+VNLS+FTSIPDFW   QLFPIVPIH+LD+RP ARGILSDLTC
Sbjct  298   CESVIKAIGASDPVLTYHVNLSIFTSIPDFWGIDQLFPIVPIHKLDQRPVARGILSDLTC  357

Query  1220  DSDG  1209
             DSDG
Sbjct  358   DSDG  361



>gb|ADN93161.1| arginine decarboxylase 2 [Christolea crassifolia]
Length=362

 Score =   531 bits (1369),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 270/364 (74%), Positives = 317/364 (87%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDA L+CNGFKDAEYISLAL  RKL LNTVIVLEQE E+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDAFLVCNGFKDAEYISLALLGRKLTLNTVIVLEQEGELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH GHFG TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHTGHFGPTSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCEL+RLGA M+VIDIGGGLGIDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELMRLGAHMQVIDIGGGLGIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AV+ ++RFVCDR+ V HPVICSESGRAIVSHHS+LIFEAV+++   + Q     +Q
Sbjct  181   EYAEAVIASIRFVCDRRSVKHPVICSESGRAIVSHHSVLIFEAVTAAKPVIHQTSPNDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARADY++L AA +RG++ +C+LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  241   FLLES--EEARADYEDLYAAVMRGDHKSCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARGILSD TC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDFTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93162.1| arginine decarboxylase 2 [Cithareloma vernum]
Length=362

 Score =   531 bits (1369),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 271/364 (74%), Positives = 317/364 (87%), Gaps = 2/364 (1%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+ DA L+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNADAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             V+PVIGLRAKLRTKH+GHFG TSGEKGKFGLTTTQI+RV++KL +S M+DCLQLLHFHIG
Sbjct  61    VKPVIGLRAKLRTKHSGHFGPTSGEKGKFGLTTTQIVRVMRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL DGV EAAQ+YCELVR+GA M+VIDIGGGL IDYDGSKS +S++SV YTL+
Sbjct  121   SQIPSTSLLTDGVAEAAQLYCELVRMGAHMEVIDIGGGLEIDYDGSKSGESDLSVAYTLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV ++RFVCD++ V HPVICSESGRAIVSHHS+LIFEAVS+S   + Q     +Q
Sbjct  181   EYAEAVVASIRFVCDQRSVKHPVICSESGRAIVSHHSLLIFEAVSASKPVVHQTSPDDIQ  240

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
               +ES  ++ARADY++L AA +RG+ ++C+LY DQLKQRCV+ FKEG  SIEQLA+VDG+
Sbjct  241   FLLES--EEARADYEDLYAAVMRGDNESCLLYVDQLKQRCVEGFKEGVFSIEQLASVDGL  298

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPGARGILSDLTC
Sbjct  299   CEWVLKAIGASDPVRTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTC  358

Query  1220  DSDG  1209
             DSDG
Sbjct  359   DSDG  362



>gb|ADN93179.1| arginine decarboxylase 2 [Erysimum cheiranthoides]
Length=363

 Score =   531 bits (1369),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 275/363 (76%), Positives = 316/363 (87%), Gaps = 1/363 (0%)
 Frame = -3

Query  2300  LAMSCLCKGSPDALLICNGFKDAEYISLALAARKLLLNTVIVLEQEEEVDLIIDISRKMA  2121
             LAMSCLCKG+PDALL+CNGFKDAEYISLAL  RKL LNTVIVLEQEEE+DL+ID+S+KM 
Sbjct  1     LAMSCLCKGNPDALLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIDLSQKMN  60

Query  2120  VRPVIGLRAKLRTKHAGHFGSTSGEKGKFGLTTTQILRVVKKLQESEMIDCLQLLHFHIG  1941
             VRPVIGLRAKLRTKH+GHFGSTSGEKGKFGLTTTQI+RVV+KL +S M+DCLQLLHFHIG
Sbjct  61    VRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLSQSGMLDCLQLLHFHIG  120

Query  1940  SQIPSTALLADGVGEAAQIYCELVRLGACMKVidiggglgidydGSKSADSEVSVGYTLQ  1761
             SQIPST+LL+DGV EAAQ+YCELVRLGA MKVIDIGGGLGIDYDGSKS +S++SV Y+L+
Sbjct  121   SQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLE  180

Query  1760  EYASAVVQAVRFVCDRKGVSHPVICSESGRAIVSHHSILIFEAVSSSSDKLLQLPNPGLQ  1581
             EYA AVV +VRFVCD + V HPVICSESGRAIVSHHS+LIFEAVS+    + Q   PG  
Sbjct  181   EYAEAVVASVRFVCDGRSVKHPVICSESGRAIVSHHSVLIFEAVSTVKPMVHQ-ATPGDI  239

Query  1580  SFVESLKDDARADYQNLSAAAIRGEYDTCVLYADQLKQRCVDQFKEGSLSIEQLAAVDGI  1401
              F+     +ARA+Y++L AA +RG+ ++ +LY DQLKQRCV+ FKEG LSIEQLA+VDG+
Sbjct  240   QFLLEGDGEARANYEDLYAAVMRGDQESSLLYVDQLKQRCVESFKEGVLSIEQLASVDGL  299

Query  1400  CDLVSKAIGAYDPVCTYNVNLSVFTSIPDFWAFGQLFPIVPIHRLDERPGARGILSDLTC  1221
             C+ V KAIGA DPV TYN+NLSVFTSIPD W   QLFPIVPIH+LD+RPG RGILSDLTC
Sbjct  300   CEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGTRGILSDLTC  359

Query  1220  DSD  1212
             DSD
Sbjct  360   DSD  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11403136457132