BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26123_g1_i1 len=998 path=[1:0-997]

Length=998
                                                                      Score     E

ref|XP_002534445.1|  Minor allergen Alt a, putative                     345   1e-115   Ricinus communis
ref|NP_001237185.1|  uncharacterized protein LOC100499870               345   1e-115   
ref|XP_010267865.1|  PREDICTED: minor allergen Alt a 7-like             345   2e-115   
ref|NP_001237740.1|  uncharacterized protein LOC100305601               345   2e-115   
gb|KHG24319.1|  Flavoprotein wrbA                                       344   4e-115   
gb|ABN12321.1|  benzoquinone reductase                                  343   4e-115   Gossypium hirsutum [American cotton]
ref|XP_007021135.1|  Quinone reductase family protein                   342   2e-114   
gb|ACJ11729.1|  benzoquinone reductase                                  342   2e-114   Gossypium hirsutum [American cotton]
ref|XP_011012089.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    342   3e-114   
ref|XP_007149664.1|  hypothetical protein PHAVU_005G088900g             342   3e-114   
ref|XP_006452110.1|  hypothetical protein CICLE_v10009497mg             341   3e-114   
ref|XP_002283286.1|  PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1    341   4e-114   Vitis vinifera
ref|XP_004487638.1|  PREDICTED: flavoprotein WrbA-like                  341   4e-114   
ref|XP_010520884.1|  PREDICTED: minor allergen Alt a 7-like             340   8e-114   
gb|EPS61408.1|  hypothetical protein M569_13389                         340   9e-114   
ref|XP_004294313.1|  PREDICTED: flavoprotein WrbA-like                  340   9e-114   
ref|XP_008366222.1|  PREDICTED: minor allergen Alt a 7-like             340   9e-114   
emb|CDY48639.1|  BnaCnng16580D                                          340   1e-113   
emb|CDY61743.1|  BnaCnng38420D                                          340   1e-113   
ref|XP_006401566.1|  hypothetical protein EUTSA_v10014706mg             340   1e-113   
ref|XP_009764033.1|  PREDICTED: P25 protein-like                        340   1e-113   
ref|XP_010539259.1|  PREDICTED: minor allergen Alt a 7-like             340   2e-113   
gb|ABN12320.1|  benzoquinone reductase                                  339   2e-113   Gossypium hirsutum [American cotton]
ref|XP_003596543.1|  Flavoprotein wrbA                                  339   2e-113   
ref|XP_009377294.1|  PREDICTED: minor allergen Alt a 7-like             339   3e-113   
ref|XP_007133114.1|  hypothetical protein PHAVU_011G152500g             339   3e-113   
ref|XP_009132440.1|  PREDICTED: minor allergen Alt a 7-like             339   3e-113   
ref|XP_006370577.1|  FLAVODOXIN-LIKE QUINONE REDUCTASE 1 family p...    339   3e-113   
ref|XP_010062928.1|  PREDICTED: minor allergen Alt a 7                  338   4e-113   
gb|KDP38996.1|  hypothetical protein JCGZ_00753                         338   4e-113   
ref|XP_009127084.1|  PREDICTED: minor allergen Alt a 7-like             338   4e-113   
ref|XP_011030918.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    338   4e-113   
emb|CDY42457.1|  BnaA10g08330D                                          338   5e-113   
emb|CDY43038.1|  BnaA03g11850D                                          338   9e-113   
ref|XP_004150766.1|  PREDICTED: flavoprotein WrbA-like                  337   1e-112   
ref|XP_009355549.1|  PREDICTED: minor allergen Alt a 7-like             337   2e-112   
ref|XP_004248361.1|  PREDICTED: minor allergen Alt a 7-like             337   2e-112   
ref|XP_002864337.1|  hypothetical protein ARALYDRAFT_495531             337   2e-112   
ref|XP_006281120.1|  hypothetical protein CARUB_v10027151mg             337   2e-112   
ref|XP_008452342.1|  PREDICTED: minor allergen Alt a 7                  337   2e-112   
gb|ABK94567.1|  unknown                                                 337   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_002867516.1|  quinone reductase family protein                   337   2e-112   
ref|XP_010240992.1|  PREDICTED: minor allergen Alt a 7 isoform X1       337   2e-112   
ref|XP_006362921.1|  PREDICTED: minor allergen Alt a 7-like             336   3e-112   
gb|ACJ86051.1|  unknown                                                 336   3e-112   Medicago truncatula
ref|XP_009119977.1|  PREDICTED: minor allergen Alt a 7-like             336   3e-112   
ref|XP_009629263.1|  PREDICTED: P25 protein-like                        336   3e-112   
ref|XP_007212069.1|  hypothetical protein PRUPE_ppa011617mg             336   4e-112   
emb|CDY43826.1|  BnaC03g14590D                                          336   6e-112   
ref|XP_010443024.1|  PREDICTED: minor allergen Alt a 7-like             335   6e-112   
gb|AFK36853.1|  unknown                                                 336   7e-112   
ref|XP_008386042.1|  PREDICTED: minor allergen Alt a 7-like             335   7e-112   
gb|EYU27865.1|  hypothetical protein MIMGU_mgv1a013996mg                335   1e-111   
ref|XP_010112077.1|  Flavoprotein wrbA                                  335   1e-111   
ref|XP_010433387.1|  PREDICTED: minor allergen Alt a 7-like isofo...    335   2e-111   
ref|XP_010694306.1|  PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1    334   2e-111   
ref|XP_009605845.1|  PREDICTED: minor allergen Alt a 7-like             334   2e-111   
ref|XP_002316953.1|  FLAVODOXIN-LIKE QUINONE REDUCTASE 1 family p...    334   3e-111   Populus trichocarpa [western balsam poplar]
ref|XP_010438642.1|  PREDICTED: minor allergen Alt a 7-like             334   3e-111   
ref|XP_011095284.1|  PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1    334   3e-111   
ref|XP_010448159.1|  PREDICTED: minor allergen Alt a 7-like             334   3e-111   
ref|NP_200261.1|  flavodoxin-like quinone reductase 1                   333   4e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006591837.1|  PREDICTED: uncharacterized protein LOC100499...    333   8e-111   
ref|XP_009757565.1|  PREDICTED: minor allergen Alt a 7-like             334   9e-111   
ref|XP_004293489.1|  PREDICTED: flavoprotein WrbA-like                  332   1e-110   
ref|XP_002518592.1|  Flavoprotein wrbA, putative                        332   2e-110   Ricinus communis
ref|XP_006592527.1|  PREDICTED: minor allergen Alt a 7-like             332   2e-110   
ref|XP_006284522.1|  hypothetical protein CARUB_v10005724mg             332   3e-110   
ref|XP_003540116.1|  PREDICTED: minor allergen Alt a 7-like             331   3e-110   
gb|KEH19664.1|  quinone oxidoreductase                                  331   5e-110   
ref|XP_007212068.1|  hypothetical protein PRUPE_ppa011600mg             331   5e-110   
gb|AFK43904.1|  unknown                                                 330   5e-110   
gb|ACU13760.1|  unknown                                                 330   6e-110   Glycine max [soybeans]
ref|NP_194457.2|  Quinone reductase family protein                      330   8e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237954.1|  uncharacterized protein LOC100499662               330   2e-109   
ref|XP_009785191.1|  PREDICTED: minor allergen Alt a 7-like             329   2e-109   
ref|XP_011097952.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    329   2e-109   
ref|XP_006851210.1|  hypothetical protein AMTR_s00043p00212880          329   2e-109   
gb|EYU19180.1|  hypothetical protein MIMGU_mgv1a014007mg                328   3e-109   
gb|KHN45736.1|  Flavoprotein wrbA                                       328   4e-109   
ref|XP_006593333.1|  PREDICTED: uncharacterized protein LOC100305...    328   4e-109   
ref|XP_008793624.1|  PREDICTED: minor allergen Alt a 7-like             328   4e-109   
ref|XP_010665765.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    328   4e-109   
ref|XP_009799122.1|  PREDICTED: minor allergen Alt a 7-like             328   6e-109   
ref|XP_008810245.1|  PREDICTED: minor allergen Alt a 7-like             328   6e-109   
emb|CDP05833.1|  unnamed protein product                                328   8e-109   
dbj|BAK53859.1|  quinone reductase                                      327   9e-109   
ref|XP_006452109.1|  hypothetical protein CICLE_v10009497mg             327   1e-108   
ref|XP_004485679.1|  PREDICTED: minor allergen Alt a 7-like isofo...    326   3e-108   
ref|XP_003635180.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    326   4e-108   
ref|XP_009591839.1|  PREDICTED: minor allergen Alt a 7-like             326   4e-108   
ref|XP_008789775.1|  PREDICTED: minor allergen Alt a 7-like             325   7e-108   
ref|XP_009420536.1|  PREDICTED: minor allergen Alt a 7-like             325   1e-107   
ref|XP_007149665.1|  hypothetical protein PHAVU_005G088900g             324   1e-107   
ref|XP_010909518.1|  PREDICTED: NAD(P)H dehydrogenase (quinone) F...    324   2e-107   
ref|XP_003635185.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    324   2e-107   
gb|AFK34293.1|  unknown                                                 324   2e-107   
ref|NP_001241601.1|  uncharacterized protein LOC100805113               324   2e-107   
ref|XP_008777137.1|  PREDICTED: minor allergen Alt a 7-like             324   2e-107   
ref|XP_007025885.1|  Quinone reductase family protein                   324   3e-107   
gb|KDP20841.1|  hypothetical protein JCGZ_21312                         324   3e-107   
gb|AFK48201.1|  unknown                                                 323   3e-107   
ref|XP_003545793.1|  PREDICTED: minor allergen Alt a 7 isoform X1       323   4e-107   
ref|XP_010928688.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    323   4e-107   
gb|KHN27997.1|  Flavoprotein wrbA                                       323   4e-107   
gb|KDO74383.1|  hypothetical protein CISIN_1g028841mg                   322   7e-107   
gb|KHG07419.1|  Flavoprotein wrbA                                       323   7e-107   
ref|XP_006467937.1|  PREDICTED: minor allergen Alt a 7-like             322   8e-107   
ref|XP_009402585.1|  PREDICTED: minor allergen Alt a 7-like             322   9e-107   
gb|KHN36755.1|  Flavoprotein wrbA                                       322   1e-106   
ref|NP_001237941.1|  uncharacterized protein LOC100500685               322   1e-106   
ref|XP_010931880.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    322   2e-106   
ref|XP_010646712.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    321   3e-106   
ref|NP_001266148.1|  flavoprotein WrbA-like                             321   4e-106   
ref|XP_006413096.1|  hypothetical protein EUTSA_v10026307mg             320   6e-106   
ref|XP_006449164.1|  hypothetical protein CICLE_v10016752mg             320   7e-106   
ref|XP_002316697.1|  hypothetical protein POPTR_0011s03570g             320   1e-105   Populus trichocarpa [western balsam poplar]
ref|XP_010924018.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    319   2e-105   
ref|XP_009408670.1|  PREDICTED: minor allergen Alt a 7-like             318   3e-105   
emb|CDO99681.1|  unnamed protein product                                318   3e-105   
ref|XP_011009497.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    318   5e-105   
ref|XP_006281121.1|  hypothetical protein CARUB_v10027151mg             317   6e-105   
ref|XP_010240993.1|  PREDICTED: minor allergen Alt a 7 isoform X2       317   8e-105   
ref|XP_002304974.2|  hypothetical protein POPTR_0004s02850g             319   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011003378.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    316   4e-104   
ref|XP_007148277.1|  hypothetical protein PHAVU_006G194800g             315   5e-104   
ref|XP_011096173.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    315   6e-104   
gb|ABR18269.1|  unknown                                                 315   6e-104   Picea sitchensis
gb|AAG53945.1|AF304462_1  quinone-oxidoreductase QR2                    315   6e-104   Triphysaria versicolor
ref|XP_002973189.1|  hypothetical protein SELMODRAFT_232063             315   7e-104   
gb|AFK46852.1|  unknown                                                 314   1e-103   
ref|XP_007159225.1|  hypothetical protein PHAVU_002G219700g             314   1e-103   
gb|ABD66515.1|  quinone oxidoreductase                                  313   4e-103   Gymnadenia conopsea
gb|ABK21008.1|  unknown                                                 313   4e-103   Picea sitchensis
ref|XP_004485680.1|  PREDICTED: minor allergen Alt a 7-like isofo...    311   1e-102   
ref|XP_008439934.1|  PREDICTED: minor allergen Alt a 7-like             311   3e-102   
gb|ABK24022.1|  unknown                                                 311   3e-102   Picea sitchensis
ref|XP_010909517.1|  PREDICTED: NAD(P)H dehydrogenase (quinone) F...    310   5e-102   
ref|XP_006659104.1|  PREDICTED: minor allergen Alt a 7-like             310   5e-102   
gb|AFK39740.1|  unknown                                                 310   1e-101   
ref|XP_004134743.1|  PREDICTED: flavoprotein WrbA-like                  309   1e-101   
gb|ABD98056.1|  quinone-oxidoreductase QR2                              309   1e-101   Striga asiatica [witchweed]
ref|XP_008383962.1|  PREDICTED: minor allergen Alt a 7-like             309   1e-101   
gb|KHN33624.1|  Flavoprotein wrbA                                       309   2e-101   
ref|NP_001060966.1|  Os08g0139200                                       308   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001758337.1|  predicted protein                                  308   3e-101   
gb|KEH31167.1|  NAD(P)H:quinone oxidoreductase, type IV protein         308   4e-101   
emb|CAA19721.1|  putative protein                                       308   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001762556.1|  predicted protein                                  307   7e-101   
gb|KHN19077.1|  Flavoprotein wrbA                                       307   7e-101   
emb|CBI18660.3|  unnamed protein product                                307   7e-101   
gb|KHN28607.1|  Flavoprotein wrbA                                       306   1e-100   
ref|XP_003568165.2|  PREDICTED: minor allergen Alt a 7-like             306   8e-100   
ref|XP_010052473.1|  PREDICTED: minor allergen Alt a 7-like             305   9e-100   
gb|KDO75644.1|  hypothetical protein CISIN_1g028847mg                   303   2e-99    
ref|XP_009405009.1|  PREDICTED: minor allergen Alt a 7-like             303   3e-99    
emb|CDP09951.1|  unnamed protein product                                305   3e-99    
ref|XP_006654606.1|  PREDICTED: minor allergen Alt a 7-like             302   6e-99    
ref|XP_009369578.1|  PREDICTED: minor allergen Alt a 7-like             302   7e-99    
ref|XP_010111015.1|  Flavoprotein wrbA                                  301   1e-98    
dbj|BAJ92406.1|  predicted protein                                      301   2e-98    
gb|AFW82422.1|  flavoprotein wrbA                                       301   2e-98    
ref|XP_004961598.1|  PREDICTED: minor allergen Alt a 7-like             300   5e-98    
ref|XP_004248390.1|  PREDICTED: minor allergen Alt a 7-like             299   1e-97    
ref|XP_008371222.1|  PREDICTED: minor allergen Alt a 7-like             298   2e-97    
ref|NP_001055969.1|  Os05g0501300                                       296   1e-96    Oryza sativa Japonica Group [Japonica rice]
emb|CAN63722.1|  hypothetical protein VITISV_002080                     297   1e-96    Vitis vinifera
ref|XP_010232442.1|  PREDICTED: minor allergen Alt a 7-like             296   3e-96    
gb|EMT27724.1|  Flavoprotein wrbA                                       295   6e-96    
gb|AAW78582.1|  quinone reductase 2                                     294   1e-95    Triticum monococcum [einkorn wheat]
gb|EAY76084.1|  hypothetical protein OsI_04011                          293   2e-95    Oryza sativa Indica Group [Indian rice]
gb|ACF86423.1|  unknown                                                 293   3e-95    Zea mays [maize]
gb|KEH31166.1|  NAD(P)H:quinone oxidoreductase, type IV protein         292   4e-95    
ref|XP_003543098.1|  PREDICTED: flavoprotein wrbA-like                  293   4e-95    
ref|XP_004485678.1|  PREDICTED: flavoprotein WrbA-like                  293   5e-95    
ref|NP_001149575.1|  LOC100283201                                       292   5e-95    Zea mays [maize]
ref|XP_004972886.1|  PREDICTED: minor allergen Alt a 7-like             292   5e-95    
ref|NP_001044464.1|  Os01g0784800                                       292   6e-95    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99599.1|  predicted protein                                      291   1e-94    
gb|ACV52589.1|  benzoquinone reductase                                  290   2e-94    Nicotiana benthamiana
ref|XP_006644813.1|  PREDICTED: minor allergen Alt a 7-like isofo...    290   5e-94    
ref|NP_001151729.1|  LOC100285365                                       290   7e-94    Zea mays [maize]
gb|ABK23874.1|  unknown                                                 288   4e-93    Picea sitchensis
ref|XP_006582217.1|  PREDICTED: minor allergen Alt a 7-like             285   4e-92    
ref|XP_003526150.1|  PREDICTED: minor allergen Alt a 7-like             285   4e-92    
gb|KDP46513.1|  hypothetical protein JCGZ_08485                         285   5e-92    
ref|XP_004970204.1|  PREDICTED: minor allergen Alt a 7-like             285   5e-92    
ref|XP_002525624.1|  Flavoprotein wrbA, putative                        284   8e-92    Ricinus communis
gb|EMT26661.1|  Flavoprotein wrbA                                       284   1e-91    
ref|XP_007148279.1|  hypothetical protein PHAVU_006G1949000g            284   1e-91    
ref|XP_011082387.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    284   3e-91    
ref|XP_011082388.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    282   5e-91    
ref|XP_003526149.1|  PREDICTED: minor allergen Alt a 7-like             282   1e-90    
gb|EYU45736.1|  hypothetical protein MIMGU_mgv1a013995mg                281   1e-90    
gb|AAO12869.1|  putative quinone reductase                              280   1e-90    Vitis vinifera
ref|XP_006425049.1|  hypothetical protein CICLE_v10029300mg             281   1e-90    
ref|XP_001783083.1|  predicted protein                                  281   2e-90    
ref|XP_006488499.1|  PREDICTED: minor allergen Alt a 7-like             281   2e-90    
ref|XP_006452111.1|  hypothetical protein CICLE_v10009497mg             278   5e-90    
ref|XP_003593404.1|  Flavoprotein wrbA                                  279   7e-90    
gb|AFK34525.1|  unknown                                                 279   1e-89    
ref|XP_004241169.1|  PREDICTED: flavoprotein-like protein YCP4          278   3e-89    
ref|XP_010256587.1|  PREDICTED: minor allergen Alt a 7                  278   4e-89    
ref|XP_006350831.1|  PREDICTED: flavoprotein-like protein YCP4-like     277   5e-89    
emb|CDP09176.1|  unnamed protein product                                277   6e-89    
ref|XP_007016129.1|  Quinone reductase family protein isoform 1         280   7e-89    
ref|XP_007142219.1|  hypothetical protein PHAVU_008G262200g             276   1e-88    
ref|XP_009783879.1|  PREDICTED: minor allergen Alt a 7                  276   1e-88    
gb|KHN25008.1|  Flavoprotein wrbA                                       275   1e-88    
ref|XP_002314113.1|  quinone reductase family protein                   275   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_009626863.1|  PREDICTED: minor allergen Alt a 7 isoform X1       275   3e-88    
gb|AGV54245.1|  flavoprotein wrbA                                       274   1e-87    
ref|XP_006644814.1|  PREDICTED: minor allergen Alt a 7-like isofo...    273   1e-87    
ref|XP_011032134.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    273   2e-87    
ref|XP_004143152.1|  PREDICTED: flavoprotein WrbA-like                  273   3e-87    
ref|XP_003544877.1|  PREDICTED: flavoprotein wrbA-like isoform X1       273   3e-87    
ref|XP_010043444.1|  PREDICTED: minor allergen Alt a 7                  273   3e-87    
ref|XP_007133118.1|  hypothetical protein PHAVU_011G152900g             273   4e-87    
gb|EYU45735.1|  hypothetical protein MIMGU_mgv1a013995mg                272   7e-87    
ref|XP_002279668.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    271   9e-87    Vitis vinifera
gb|AFK37691.1|  unknown                                                 271   1e-86    
ref|XP_003615608.1|  Flavoprotein wrbA                                  270   2e-86    
ref|XP_008464047.1|  PREDICTED: minor allergen Alt a 7                  270   3e-86    
ref|XP_002461308.1|  hypothetical protein SORBIDRAFT_02g000630          270   6e-86    Sorghum bicolor [broomcorn]
ref|XP_009374262.1|  PREDICTED: minor allergen Alt a 7                  269   8e-86    
dbj|BAA22940.1|  LEDI-3 protein                                         268   2e-85    Lithospermum erythrorhizon
ref|XP_007205924.1|  hypothetical protein PRUPE_ppa011625mg             268   2e-85    
ref|XP_008220577.1|  PREDICTED: minor allergen Alt a 7 isoform X1       268   2e-85    
ref|XP_004294274.1|  PREDICTED: flavoprotein WrbA-like                  268   3e-85    
ref|XP_010104650.1|  Flavoprotein-like protein YCP4                     269   3e-85    
ref|XP_004490586.1|  PREDICTED: flavoprotein WrbA-like isoform X1       267   4e-85    
ref|XP_006354298.1|  PREDICTED: minor allergen Alt a 7-like             268   4e-85    
ref|XP_007016130.1|  Quinone reductase family protein isoform 2         268   1e-84    
ref|XP_004955301.1|  PREDICTED: minor allergen Alt a 7-like             266   2e-84    
gb|KEH36477.1|  NAD(P)H:quinone oxidoreductase, type IV protein         265   2e-84    
dbj|BAK01428.1|  predicted protein                                      265   3e-84    
gb|EMT29400.1|  Flavoprotein wrbA                                       265   3e-84    
ref|XP_003557696.1|  PREDICTED: flavoprotein-like protein YCP4          265   5e-84    
ref|NP_001151964.1|  LOC100285601                                       263   6e-84    Zea mays [maize]
ref|XP_006354301.1|  PREDICTED: minor allergen Alt a 7-like             268   7e-84    
dbj|BAJ98367.1|  predicted protein                                      263   3e-83    
gb|EMT23536.1|  Flavoprotein wrbA                                       262   3e-83    
ref|XP_003527289.1|  PREDICTED: P25 protein-like                        263   4e-83    
gb|EMS46699.1|  Flavoprotein wrbA                                       262   5e-83    
gb|EMT23327.1|  Flavoprotein wrbA                                       261   7e-83    
ref|XP_007149666.1|  hypothetical protein PHAVU_005G088900g             259   9e-83    
ref|XP_011097213.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    263   2e-82    
ref|XP_006844791.1|  hypothetical protein AMTR_s00016p00260310          259   4e-82    
ref|NP_001190538.1|  flavodoxin-like quinone reductase 1                260   8e-82    
ref|XP_008649359.1|  PREDICTED: flavoprotein-like protein YCP4          259   1e-81    
emb|CDP02809.1|  unnamed protein product                                258   3e-81    
emb|CDY62652.1|  BnaAnng18230D                                          259   6e-81    
ref|XP_010535392.1|  PREDICTED: minor allergen Alt a 7                  256   7e-81    
emb|CDX72602.1|  BnaC07g46240D                                          258   8e-81    
dbj|BAJ93858.1|  predicted protein                                      256   1e-80    
ref|NP_001146036.1|  flavoprotein wrbA                                  256   1e-80    Zea mays [maize]
ref|XP_004300607.1|  PREDICTED: flavoprotein WrbA-like                  257   2e-80    
emb|CDX69243.1|  BnaC01g02100D                                          256   2e-80    
ref|XP_002947514.1|  hypothetical protein VOLCADRAFT_108932             254   3e-80    
gb|EYU28574.1|  hypothetical protein MIMGU_mgv1a011919mg                256   5e-80    
ref|XP_010531179.1|  PREDICTED: minor allergen Alt a 7                  256   7e-80    
ref|XP_010685579.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    253   1e-79    
ref|XP_008805501.1|  PREDICTED: minor allergen Alt a 7                  254   2e-79    
ref|XP_009138449.1|  PREDICTED: minor allergen Alt a 7                  255   2e-79    
ref|XP_003561515.1|  PREDICTED: flavoprotein-like protein YCP4          253   2e-79    
gb|KHN08363.1|  Flavoprotein wrbA                                       253   2e-79    
ref|XP_002273030.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    254   2e-79    Vitis vinifera
gb|ABR16990.1|  unknown                                                 254   3e-79    Picea sitchensis
ref|XP_004512012.1|  PREDICTED: flavoprotein WrbA-like                  253   5e-79    
ref|XP_010932671.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    253   6e-79    
ref|XP_004507411.1|  PREDICTED: minor allergen Alt a 7-like             253   8e-79    
ref|NP_195393.1|  Quinone reductase family protein                      253   1e-78    Arabidopsis thaliana [mouse-ear cress]
gb|AAM64959.1|  minor allergen                                          253   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285754.1|  hypothetical protein CARUB_v10007228mg             252   3e-78    
ref|XP_010437309.1|  PREDICTED: minor allergen Alt a 7-like             252   3e-78    
gb|EPS66788.1|  hypothetical protein M569_07988                         251   3e-78    
ref|XP_010432140.1|  PREDICTED: minor allergen Alt a 7-like             252   4e-78    
ref|XP_006411965.1|  hypothetical protein EUTSA_v10025964mg             251   4e-78    
gb|KCW85458.1|  hypothetical protein EUGRSUZ_B02266                     249   4e-78    
ref|XP_007047004.1|  Quinone reductase family protein isoform 1         251   7e-78    
emb|CDX75594.1|  BnaA01g01080D                                          251   8e-78    
ref|XP_010446747.1|  PREDICTED: minor allergen Alt a 7-like             251   9e-78    
gb|KDP31800.1|  hypothetical protein JCGZ_12261                         250   1e-77    
ref|XP_002862630.1|  quinone reductase family protein                   248   1e-77    
gb|KFK30294.1|  hypothetical protein AALP_AA7G243100                    250   1e-77    
ref|XP_002869025.1|  minor allergen                                     250   2e-77    
ref|XP_006281108.1|  hypothetical protein CARUB_v10027138mg             248   2e-77    
ref|XP_006365515.1|  PREDICTED: minor allergen Alt a 7-like             249   3e-77    
ref|XP_009803602.1|  PREDICTED: minor allergen Alt a 7-like             249   3e-77    
ref|XP_004230953.1|  PREDICTED: minor allergen Alt a 7-like             249   3e-77    
gb|KHG07035.1|  Flavoprotein wrbA                                       249   3e-77    
ref|XP_002461673.1|  hypothetical protein SORBIDRAFT_02g006210          247   4e-77    
ref|XP_010099827.1|  Minor allergen Alt a 7                             249   4e-77    
ref|NP_200688.2|  quinone reductase-like protein                        246   5e-77    
ref|XP_009629249.1|  PREDICTED: minor allergen Alt a 7-like             248   5e-77    
ref|XP_009389434.1|  PREDICTED: minor allergen Alt a 7-like             248   7e-77    
ref|XP_003537894.1|  PREDICTED: minor allergen Alt a 7-like             248   7e-77    
ref|XP_006365511.1|  PREDICTED: minor allergen Alt a 7-like             248   8e-77    
ref|XP_010443633.1|  PREDICTED: minor allergen Alt a 7                  246   8e-77    
ref|XP_009788417.1|  PREDICTED: minor allergen Alt a 7-like             248   1e-76    
ref|XP_006366993.1|  PREDICTED: flavoprotein-like protein YCP4-like     247   1e-76    
gb|KHG00989.1|  Flavoprotein wrbA                                       247   1e-76    
ref|XP_007131856.1|  hypothetical protein PHAVU_011G047200g             247   1e-76    
ref|XP_006401037.1|  hypothetical protein EUTSA_v10014688mg             245   2e-76    
ref|XP_006425729.1|  hypothetical protein CICLE_v10026310mg             247   2e-76    
ref|XP_009412330.1|  PREDICTED: minor allergen Alt a 7-like             247   2e-76    
ref|XP_010244327.1|  PREDICTED: minor allergen Alt a 7-like             247   2e-76    
ref|XP_010454306.1|  PREDICTED: minor allergen Alt a 7-like             245   2e-76    
ref|XP_009395664.1|  PREDICTED: minor allergen Alt a 7-like             246   2e-76    
ref|XP_002525103.1|  Minor allergen Alt a, putative                     247   2e-76    
ref|XP_008241634.1|  PREDICTED: minor allergen Alt a 7                  247   3e-76    
ref|XP_001785483.1|  predicted protein                                  248   3e-76    
ref|XP_010483487.1|  PREDICTED: minor allergen Alt a 7-like             244   3e-76    
gb|KEH30410.1|  NAD(P)H:quinone oxidoreductase, type IV protein         246   4e-76    
ref|XP_011092773.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    246   4e-76    
ref|XP_003517248.1|  PREDICTED: minor allergen Alt a 7-like isofo...    246   8e-76    
ref|XP_009402260.1|  PREDICTED: minor allergen Alt a 7-like             245   8e-76    
ref|XP_009126734.1|  PREDICTED: minor allergen Alt a 7                  243   1e-75    
gb|AFW82419.1|  hypothetical protein ZEAMMB73_214558                    242   1e-75    
ref|XP_010254933.1|  PREDICTED: minor allergen Alt a 7 isoform X1       244   1e-75    
ref|XP_005644126.1|  LEDI-3 protein                                     244   2e-75    
ref|XP_006826314.1|  hypothetical protein AMTR_s00004p00083710          244   2e-75    
gb|ACJ85377.1|  unknown                                                 243   2e-75    
ref|XP_008440685.1|  PREDICTED: minor allergen Alt a 7                  244   2e-75    
ref|XP_009789852.1|  PREDICTED: minor allergen Alt a 7-like             244   2e-75    
ref|XP_010667694.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    244   2e-75    
gb|ACU23836.1|  unknown                                                 244   2e-75    
ref|XP_011025723.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    244   3e-75    
emb|CDY02838.1|  BnaC02g10510D                                          244   3e-75    
emb|CDY32682.1|  BnaA02g07440D                                          243   3e-75    
ref|XP_009593390.1|  PREDICTED: minor allergen Alt a 7-like             243   3e-75    
ref|XP_006383238.1|  quinone reductase family protein                   243   4e-75    
ref|XP_010999951.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    243   4e-75    
ref|XP_010028569.1|  PREDICTED: minor allergen Alt a 7                  243   4e-75    
ref|XP_008387358.1|  PREDICTED: minor allergen Alt a 7                  244   5e-75    
ref|XP_005848972.1|  hypothetical protein CHLNCDRAFT_30702              241   5e-75    
ref|XP_004234563.1|  PREDICTED: minor allergen Alt a 7-like             242   5e-75    
ref|XP_003537563.1|  PREDICTED: minor allergen Alt a 7-like             243   6e-75    
ref|XP_010096211.1|  Flavoprotein wrbA                                  243   6e-75    
ref|XP_009143255.1|  PREDICTED: LOW QUALITY PROTEIN: minor allerg...    239   8e-75    
ref|XP_004230955.1|  PREDICTED: minor allergen Alt a 7-like             242   8e-75    
ref|XP_002310794.1|  quinone reductase family protein                   242   9e-75    
ref|XP_004143499.1|  PREDICTED: flavoprotein-like protein YCP4-like     243   9e-75    
ref|XP_002519089.1|  Minor allergen Alt a, putative                     242   1e-74    
ref|XP_003611943.1|  Flavoprotein wrbA                                  242   2e-74    
ref|XP_008363122.1|  PREDICTED: LOW QUALITY PROTEIN: minor allerg...    242   2e-74    
ref|XP_009375618.1|  PREDICTED: minor allergen Alt a 7-like             243   2e-74    
ref|XP_006449163.1|  hypothetical protein CICLE_v10016752mg             238   2e-74    
gb|KDP46223.1|  hypothetical protein JCGZ_10063                         242   2e-74    
ref|XP_009374231.1|  PREDICTED: minor allergen Alt a 7 isoform X1       242   2e-74    
ref|XP_003541075.1|  PREDICTED: flavoprotein-like protein YCP4-like     241   3e-74    
gb|EYU42632.1|  hypothetical protein MIMGU_mgv1a026744mg                240   7e-74    
ref|XP_002280986.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    240   8e-74    
ref|XP_001698551.1|  flagellar flavodoxin                               238   8e-74    
ref|XP_004289623.1|  PREDICTED: flavoprotein WrbA-like                  239   2e-73    
ref|XP_007042732.1|  Minor allergen Alt a, putative                     239   3e-73    
ref|XP_007202453.1|  hypothetical protein PRUPE_ppa010049mg             239   4e-73    
gb|AFK41075.1|  unknown                                                 238   4e-73    
ref|XP_004983050.1|  PREDICTED: minor allergen Alt a 7-like isofo...    238   4e-73    
ref|XP_008338161.1|  PREDICTED: minor allergen Alt a 7-like             238   6e-73    
ref|XP_001698552.1|  flagellar flavodoxin                               236   6e-73    
gb|KHG20367.1|  Flavoprotein wrbA                                       237   1e-72    
ref|XP_007156906.1|  hypothetical protein PHAVU_002G027100g             236   2e-72    
ref|XP_008236788.1|  PREDICTED: minor allergen Alt a 7-like             237   2e-72    
emb|CDO97081.1|  unnamed protein product                                236   5e-72    
ref|XP_002452306.1|  hypothetical protein SORBIDRAFT_04g023400          234   8e-72    
ref|XP_011037573.1|  PREDICTED: probable NAD(P)H dehydrogenase (q...    234   2e-71    
ref|XP_002306085.1|  hypothetical protein POPTR_0004s15830g             234   2e-71    
gb|EMT27114.1|  Minor allergen Alt a 7                                  234   2e-71    
dbj|BAJ95905.1|  predicted protein                                      231   3e-71    
ref|XP_002967376.1|  hypothetical protein SELMODRAFT_231000             231   4e-71    
ref|XP_010234751.1|  PREDICTED: minor allergen Alt a 7                  232   8e-71    
ref|NP_001147306.1|  flavoprotein wrbA                                  231   2e-70    
ref|XP_002960336.1|  hypothetical protein SELMODRAFT_229897             229   3e-70    
ref|XP_006423209.1|  hypothetical protein CICLE_v10029120mg             230   7e-70    
ref|XP_007200534.1|  hypothetical protein PRUPE_ppa011578mg             227   1e-69    
ref|XP_007205923.1|  hypothetical protein PRUPE_ppa011625mg             221   3e-67    
ref|XP_003527300.1|  PREDICTED: minor allergen Alt a 7-like             221   3e-67    
ref|XP_008220585.1|  PREDICTED: minor allergen Alt a 7 isoform X2       221   4e-67    
ref|XP_010317733.1|  PREDICTED: protoplast secreted protein 2-like      217   1e-66    
ref|XP_004145343.1|  PREDICTED: minor allergen Alt a 7-like             220   4e-66    
ref|XP_007133120.1|  hypothetical protein PHAVU_011G153100g             218   5e-66    
dbj|BAK00562.1|  predicted protein                                      218   8e-66    
gb|EEC79475.1|  hypothetical protein OsI_20505                          217   1e-65    
gb|ETI51712.1|  NAD(P)H:quinone oxidoreductase, type IV                 217   1e-65    
ref|NP_001051269.1|  Os03g0748500                                       218   4e-65    
ref|XP_005702960.1|  Trp repressor binding protein                      214   3e-64    
ref|XP_001698550.1|  flagellar associated protein, quinone reduct...    216   4e-64    
ref|XP_008459249.1|  PREDICTED: minor allergen Alt a 7-like isofo...    215   4e-64    
ref|XP_002899456.1|  protoplast secreted protein 2 precursor            213   5e-64    
gb|KDD75456.1|  hypothetical protein H632_c676p1                        213   8e-64    
ref|XP_008902386.1|  NAD(P)H:quinone oxidoreductase, type IV            212   8e-64    
ref|XP_003559422.1|  PREDICTED: minor allergen Alt a 7-like             216   9e-64    
gb|ETL44951.1|  NAD(P)H:quinone oxidoreductase, type IV                 212   1e-63    
gb|ETK91540.1|  NAD(P)H:quinone oxidoreductase, type IV                 212   1e-63    
ref|XP_009526896.1|  hypothetical protein PHYSODRAFT_501475             211   2e-63    
ref|XP_008902415.1|  NAD(P)H:quinone oxidoreductase, type IV            211   2e-63    
gb|ETI51621.1|  NAD(P)H:quinone oxidoreductase, type IV                 211   2e-63    
ref|XP_002899458.1|  flavodoxin-like protein                            211   2e-63    
gb|EIE76757.1|  NAD(P)H:quinone oxidoreductase, type IV                 211   3e-63    
emb|CDS05288.1|  Putative NAD(P)H:quinone oxidoreductase, typeIV        211   3e-63    
ref|XP_009526860.1|  hypothetical protein PHYSODRAFT_500108             211   3e-63    
gb|KDO66854.1|  hypothetical protein CISIN_1g028917mg                   209   4e-63    
ref|XP_009526873.1|  hypothetical protein PHYSODRAFT_503540             210   5e-63    
emb|CDH53637.1|  protoplast secreted protein 2 precursor                210   9e-63    
ref|XP_002899435.1|  protoplast secreted protein 2 precursor            208   2e-62    
gb|EPB87411.1|  NAD(P)H:quinone oxidoreductase, type IV                 208   3e-62    
gb|ETP33195.1|  NAD(P)H:quinone oxidoreductase, type IV                 209   4e-62    
ref|XP_005704550.1|  Trp repressor binding protein                      208   5e-62    
gb|ETP05048.1|  NAD(P)H:quinone oxidoreductase, type IV                 207   1e-61    
gb|ETM39692.1|  NAD(P)H:quinone oxidoreductase, type IV                 206   2e-61    
gb|EIE77389.1|  NAD(P)H:quinone oxidoreductase, type IV                 206   2e-61    
gb|KHN00056.1|  P25 protein                                             213   2e-61    
ref|XP_008913082.1|  NAD(P)H:quinone oxidoreductase, type IV            205   6e-61    
ref|XP_006487190.1|  PREDICTED: flavoprotein-like protein YCP4-li...    206   6e-61    
ref|XP_008913083.1|  NAD(P)H:quinone oxidoreductase, type IV            204   8e-61    
ref|XP_003593405.1|  Flavoprotein wrbA                                  202   1e-60    
emb|CEG69449.1|  Putative NAD(P)H:quinone oxidoreductase, type IV       204   2e-60    
emb|CEG75605.1|  Putative NAD(P)H:quinone oxidoreductase, type IV       203   4e-60    
gb|ETP37649.1|  NAD(P)H:quinone oxidoreductase, type IV                 202   4e-60    
ref|XP_008459250.1|  PREDICTED: minor allergen Alt a 7-like isofo...    202   1e-59    
gb|ACU24424.1|  unknown                                                 198   8e-59    
ref|XP_009526865.1|  hypothetical protein PHYSODRAFT_285972             199   8e-59    
emb|CBN78047.1|  flagellar associated protein, quinone reductase-...    199   2e-58    
gb|EPB88636.1|  NAD(P)H:quinone oxidoreductase, type IV                 199   2e-58    
ref|XP_001698549.1|  flavodoxin                                         201   2e-58    
gb|ETO68418.1|  NAD(P)H:quinone oxidoreductase, type IV                 199   3e-58    
ref|XP_008917278.1|  NAD(P)H:quinone oxidoreductase, type IV            198   3e-58    
gb|ETP21396.1|  NAD(P)H:quinone oxidoreductase, type IV                 198   3e-58    
gb|KFM22584.1|  NAD(P)H dehydrogenase (quinone)                         207   4e-58    
emb|CDS11749.1|  hypothetical protein LRAMOSA04012                      198   9e-58    
gb|ETP37648.1|  NAD(P)H:quinone oxidoreductase, type IV                 197   1e-57    
gb|EEC67018.1|  hypothetical protein OsI_33738                          197   2e-57    
gb|KHN06047.1|  Flavoprotein wrbA                                       195   3e-57    
emb|CDS05064.1|  Putative NAD(P)H:quinone oxidoreductase, typeIV        195   3e-57    
gb|EDK40124.2|  hypothetical protein PGUG_04222                         194   8e-57    
gb|KHN45509.1|  P25 protein                                             192   1e-56    
emb|CBI17562.3|  unnamed protein product                                192   1e-56    
emb|CDH50761.1|  protoplast secreted protein 2 precursor                196   1e-56    
ref|XP_008890189.1|  NAD(P)H:quinone oxidoreductase, type IV            194   1e-56    
gb|ETL50105.1|  NAD(P)H:quinone oxidoreductase, type IV                 194   1e-56    
gb|KDQ27868.1|  hypothetical protein PLEOSDRAFT_1056411                 194   2e-56    
ref|XP_001483493.1|  hypothetical protein PGUG_04222                    193   2e-56    
ref|XP_005707448.1|  Trp repressor binding protein                      195   4e-56    
gb|ETP21496.1|  NAD(P)H:quinone oxidoreductase, type IV                 192   4e-56    
emb|CCI42280.1|  unnamed protein product                                192   4e-56    
gb|EPB87410.1|  Trp repressor binding protein                           196   7e-56    
ref|XP_007263587.1|  flavo protein WrbA                                 193   8e-56    
ref|XP_008893932.1|  NAD(P)H:quinone oxidoreductase, type IV            191   2e-55    
emb|CEI89100.1|  Putative Trp repressor binding protein                 194   2e-55    
gb|EPZ34916.1|  Flavoprotein WrbA domain-containing protein             191   2e-55    
emb|CDH51488.1|  nad h:quinone type iv                                  196   2e-55    
emb|CEG75599.1|  Putative Trp repressor binding protein                 194   3e-55    
emb|CEI93972.1|  Putative Trp repressor binding protein                 194   3e-55    
ref|XP_002899457.1|  flavodoxin-like protein                            190   3e-55    
gb|KDQ60437.1|  benzoquinone reductase                                  192   3e-55    
gb|AAD21025.1|  1,4-benzoquinone reductase                              189   5e-55    
emb|CEG69445.1|  Putative Trp repressor binding protein                 192   1e-54    
ref|XP_001386485.1|  hypothetical protein PICST_85539                   188   1e-54    
gb|AAK97728.1|  C7A10_610/C7A10_610                                     186   2e-54    
gb|EIE77387.1|  hypothetical protein RO3G_02091                         190   2e-54    
emb|CCA15845.1|  protoplast secreted protein 2 precursor putative       188   2e-54    
emb|CCX10857.1|  Similar to Protoplast secreted protein 2; acc. n...    187   3e-54    
gb|AFW82421.1|  hypothetical protein ZEAMMB73_214558                    185   3e-54    
ref|XP_007871146.1|  flavo protein WrbA                                 187   3e-54    
ref|XP_007871147.1|  NADH-quinone oxidoreductase                        189   4e-54    
gb|AAQ24592.1|  NADH-quinone oxidoreductase                             189   4e-54    
gb|AAQ24590.1|  NADH-quinone oxidoreductase                             189   4e-54    
ref|XP_002490107.1|  Protein with similarity to members of a fami...    187   4e-54    
ref|XP_004345558.1|  flavoprotein wrbA                                  187   5e-54    
ref|XP_002422080.1|  flavodoxin, putative                               187   5e-54    
ref|XP_710366.1|  hypothetical protein CaO19.5285                       187   6e-54    
ref|XP_005538242.1|  probable 1,4-benzoquinone reductase                186   8e-54    
gb|KDQ60440.1|  benzoquinone reductase                                  188   9e-54    
gb|KDQ60439.1|  benzoquinone reductase                                  188   1e-53    
ref|XP_007373796.1|  hypothetical protein SPAPADRAFT_59645              186   1e-53    
ref|XP_001839649.1|  NADH-quinone oxidoreductase                        186   2e-53    
gb|EGO03154.1|  hypothetical protein SERLA73DRAFT_174594                185   3e-53    
gb|KEH19667.1|  benzoquinone reductase                                  182   4e-53    
ref|XP_007133117.1|  hypothetical protein PHAVU_011G152800g             184   5e-53    
ref|XP_001525385.1|  protoplast secreted protein 2 precursor            184   7e-53    
gb|ACZ59451.1|  hypothetical protein                                    186   8e-53    
gb|KEQ78940.1|  flavo protein WrbA                                      184   9e-53    
ref|XP_007314319.1|  putative quinone reductase                         185   1e-52    
gb|EXX58216.1|  Ycp4p                                                   185   1e-52    
gb|KEQ98866.1|  benzoquinone reductase                                  184   1e-52    
gb|KFY50367.1|  hypothetical protein V496_09390                         183   1e-52    
ref|XP_009522443.1|  hypothetical protein PHYSODRAFT_492858             183   1e-52    
ref|XP_002545791.1|  protoplast secreted protein 2 precursor            183   2e-52    
ref|XP_009526866.1|  hypothetical protein PHYSODRAFT_285974             183   2e-52    
gb|KFZ09314.1|  hypothetical protein V501_05628                         183   2e-52    
ref|XP_007384029.1|  NADH:quinone oxidoreductase                        185   2e-52    
emb|CDS07386.1|  hypothetical protein LRAMOSA01335                      183   2e-52    
gb|EIE76756.1|  hypothetical protein RO3G_01460                         185   2e-52    
gb|KDQ22144.1|  hypothetical protein PLEOSDRAFT_41896                   182   3e-52    
emb|CDX89262.1|  BnaA01g16310D                                          185   3e-52    
emb|CCA67952.1|  probable 1,4-benzoquinone reductase                    182   3e-52    
ref|XP_461100.1|  DEHA2F17006p                                          182   4e-52    
ref|XP_006686745.1|  hypothetical protein CANTEDRAFT_114280             184   4e-52    
ref|XP_005644127.1|  flavo protein WrbA                                 181   4e-52    



>ref|XP_002534445.1| Minor allergen Alt a, putative [Ricinus communis]
 gb|EEF27937.1| Minor allergen Alt a, putative [Ricinus communis]
Length=203

 Score =   345 bits (885),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKY A ITKKLK GSA
Sbjct  181  ELEQAFHQGKYFAGITKKLK-GSA  203



>ref|NP_001237185.1| uncharacterized protein LOC100499870 [Glycine max]
 gb|ACU13985.1| unknown [Glycine max]
Length=203

 Score =   345 bits (885),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL DE+LGK+SAPPKSDV
Sbjct  1    MAVKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLQDEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PN+L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PVITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIF+PIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFIPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            EL+QAFHQGKYIA ITKKLK  +
Sbjct  181  ELQQAFHQGKYIAGITKKLKQAA  203



>ref|XP_010267865.1| PREDICTED: minor allergen Alt a 7-like [Nelumbo nucifera]
Length=204

 Score =   345 bits (884),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPAELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRTQKLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFE+EKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFELEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA I KKLK G+A
Sbjct  181  ELEQAFHQGKYIAGIAKKLKKGAA  204



>ref|NP_001237740.1| uncharacterized protein LOC100305601 [Glycine max]
 gb|ACU13364.1| unknown [Glycine max]
Length=203

 Score =   345 bits (884),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL DE+LGK+SAPPKSDV
Sbjct  1    MAVKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLLDEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PN+L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAGLFYSTGSQG
Sbjct  61   PVITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
             GQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  DGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            EL+QAFHQG+YIA ITKKLK  +
Sbjct  181  ELQQAFHQGRYIAGITKKLKQAA  203



>gb|KHG24319.1| Flavoprotein wrbA [Gossypium arboreum]
Length=203

 Score =   344 bits (882),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QV ETLS+E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVSETLSEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PNDL EADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PVITPNDLAEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDGSR PS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRMPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            EL QAFHQGKYIA ITKKLK+ +
Sbjct  181  ELAQAFHQGKYIAGITKKLKAAA  203



>gb|ABN12321.1| benzoquinone reductase [Gossypium hirsutum]
Length=203

 Score =   343 bits (881),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QV ETLS+E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVSETLSEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PNDL EADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PVITPNDLAEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDGSR PS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRMPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            EL QAFHQGKYIA ITKKLK+ +
Sbjct  181  ELAQAFHQGKYIAGITKKLKTAA  203



>ref|XP_007021135.1| Quinone reductase family protein [Theobroma cacao]
 gb|EOY12660.1| Quinone reductase family protein [Theobroma cacao]
Length=203

 Score =   342 bits (877),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+EILGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEEILGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P+DL+EADGF+FGFPTRFGMMSAQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPHDLSEADGFIFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDG+R PS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGTRMPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            EL QAFHQGKYIA I KKLK+ +
Sbjct  181  ELAQAFHQGKYIAGIAKKLKAAA  203



>gb|ACJ11729.1| benzoquinone reductase [Gossypium hirsutum]
Length=203

 Score =   342 bits (877),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATKLYIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLSDEILGK+SAPPKSDV
Sbjct  1    MATKLYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSDEILGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P+DL EADGF+FGFPTRFGMMSAQFKAF+DATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPHDLAEADGFIFGFPTRFGMMSAQFKAFMDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGYSFGAGMFEME+VKGGSPYGAGTYAGDG+R PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYSFGAGMFEMEQVKGGSPYGAGTYAGDGTRMPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            +L QAFHQGKYIA ITKKLK+ +
Sbjct  181  KLAQAFHQGKYIAGITKKLKTAA  203



>ref|XP_011012089.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Populus euphratica]
Length=203

 Score =   342 bits (876),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEA+L+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEARLWQVPETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+F+STGSQG
Sbjct  61   PIITPSELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIAAITKKLK
Sbjct  181  ELEQAFHQGKYIAAITKKLK  200



>ref|XP_007149664.1| hypothetical protein PHAVU_005G088900g [Phaseolus vulgaris]
 gb|ESW21658.1| hypothetical protein PHAVU_005G088900g [Phaseolus vulgaris]
Length=203

 Score =   342 bits (876),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL  E+LGK+SAPPKSDV
Sbjct  1    MAVKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPKEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITPDELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIAAITKKLK  +
Sbjct  181  ELEQAFHQGKYIAAITKKLKQAA  203



>ref|XP_006452110.1| hypothetical protein CICLE_v10009497mg [Citrus clementina]
 ref|XP_006475251.1| PREDICTED: minor allergen Alt a 7-like [Citrus sinensis]
 gb|ESR65350.1| hypothetical protein CICLE_v10009497mg [Citrus clementina]
 gb|KDO74382.1| hypothetical protein CISIN_1g028841mg [Citrus sinensis]
Length=203

 Score =   341 bits (875),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGK+IA I KKLK GSA
Sbjct  181  ELEQAFHQGKHIAGIAKKLK-GSA  203



>ref|XP_002283286.1| PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1 [Vitis vinifera]
 emb|CAN78237.1| hypothetical protein VITISV_016391 [Vitis vinifera]
 emb|CBI20462.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   341 bits (875),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M TK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSD 
Sbjct  1    MVTKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPEEVLGKMSAPPKSDT  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P DL EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPTDLAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIA ITKKLK  +
Sbjct  181  ELEQAFHQGKYIAGITKKLKEAA  203



>ref|XP_004487638.1| PREDICTED: flavoprotein WrbA-like [Cicer arietinum]
Length=203

 Score =   341 bits (875),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL+ E+LGK+SAPPKSDV
Sbjct  1    MAVKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLAGEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
             II+PN+L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   AIITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDGSRQPS L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIA ITKKLK  +
Sbjct  181  ELEQAFHQGKYIATITKKLKEAA  203



>ref|XP_010520884.1| PREDICTED: minor allergen Alt a 7-like [Tarenaya hassleriana]
Length=204

 Score =   340 bits (873),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIVFYS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +++L K+SAPPKSDV
Sbjct  1    MATKVYIVFYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLPEDVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMVFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKS  229
            ELEQAFHQGKY+A I+KKLK+
Sbjct  181  ELEQAFHQGKYLATISKKLKA  201



>gb|EPS61408.1| hypothetical protein M569_13389 [Genlisea aurea]
Length=203

 Score =   340 bits (872),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YS YGH+E+LA EIKKGADSVEGVEAKL+QVPETLS +ILGK+ APPKS+V
Sbjct  1    MAIKLYIVYYSLYGHIERLAEEIKKGADSVEGVEAKLWQVPETLSPDILGKMGAPPKSNV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PVITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEM++VKGGSPYG+GTYAGDG+RQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMKEVKGGSPYGSGTYAGDGTRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKS  229
            EL QAFHQGKYIAAI KKLKS
Sbjct  181  ELGQAFHQGKYIAAIAKKLKS  201



>ref|XP_004294313.1| PREDICTED: flavoprotein WrbA-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   340 bits (873),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEA L+QVPETL DE+LGK+SAPPKSD 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEATLWQVPETLQDEVLGKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L +ADGFVFGFPTRFGMM+AQFKAF+DATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELADADGFVFGFPTRFGMMAAQFKAFMDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME +KGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENIKGGSPYGAGTFAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA ITKKLK  +A
Sbjct  181  ELEQAFHQGKYIATITKKLKGAAA  204



>ref|XP_008366222.1| PREDICTED: minor allergen Alt a 7-like [Malus domestica]
Length=203

 Score =   340 bits (872),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV +LA EIKKGA SVEGVEA L+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVGRLAEEIKKGASSVEGVEAALWQVPETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PIISPN+L +ADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIISPNELADADGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME +KGGSPYGAGTYAGDGSRQPSQL
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENIKGGSPYGAGTYAGDGSRQPSQL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA ITKKLK
Sbjct  181  ELEQAFHQGKYIATITKKLK  200



>emb|CDY48639.1| BnaCnng16580D [Brassica napus]
Length=204

 Score =   340 bits (872),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDLTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL QAFHQGKYIA ITKKLK  +A
Sbjct  181  ELAQAFHQGKYIATITKKLKGSTA  204



>emb|CDY61743.1| BnaCnng38420D [Brassica napus]
Length=204

 Score =   340 bits (872),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS  
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALLKMSAPPKSGS  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDLTEADGFV GFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLTEADGFVLGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP+QL
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTQL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA ITKKLK  +A
Sbjct  181  ELEQAFHQGKYIATITKKLKVSTA  204



>ref|XP_006401566.1| hypothetical protein EUTSA_v10014706mg [Eutrema salsugineum]
 gb|ESQ43019.1| hypothetical protein EUTSA_v10014706mg [Eutrema salsugineum]
Length=204

 Score =   340 bits (872),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMVFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA ITKKLK  +A
Sbjct  181  ELEQAFHQGKYIANITKKLKGSTA  204



>ref|XP_009764033.1| PREDICTED: P25 protein-like [Nicotiana sylvestris]
Length=203

 Score =   340 bits (871),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+ AP K D 
Sbjct  1    MATKVYIVYYSTYGHVEKLAQEIKKGAASVEGVEAKLWQVPETLSEEVLGKMGAPAKGDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDL EADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PIITPNDLAEADGFLFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FG GMFEME +KGGSPYG+GTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGGGMFEMENIKGGSPYGSGTYAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            E+EQAFHQGKYIA ITKKLK GSA
Sbjct  181  EMEQAFHQGKYIATITKKLK-GSA  203



>ref|XP_010539259.1| PREDICTED: minor allergen Alt a 7-like [Tarenaya hassleriana]
Length=204

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIVFYS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E++ K+SAPPKSDV
Sbjct  1    MATKVYIVFYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPEEVIAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADG +FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMI+VPIGY+FGAGMFEM KVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIYVPIGYTFGAGMFEMGKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA I KKLK  SA
Sbjct  181  ELEQAFHQGKYIATIAKKLKVASA  204



>gb|ABN12320.1| benzoquinone reductase [Gossypium hirsutum]
 gb|KHG22919.1| Flavoprotein wrbA [Gossypium arboreum]
Length=203

 Score =   339 bits (870),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLSDEILGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSDEILGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P+DL EADGF+FGFPTRFGMMSAQFKAF+DATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPHDLPEADGFIFGFPTRFGMMSAQFKAFMDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGYSFGAGMFEME+VKGGSPYGAGTYAGDG+R PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYSFGAGMFEMEQVKGGSPYGAGTYAGDGTRMPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            E  QAFHQGKYIA ITKKLK+ +
Sbjct  181  EFAQAFHQGKYIAGITKKLKTAA  203



>ref|XP_003596543.1| Flavoprotein wrbA [Medicago truncatula]
 gb|AES66794.1| quinone oxidoreductase [Medicago truncatula]
 gb|AFK35750.1| unknown [Medicago truncatula]
Length=203

 Score =   339 bits (870),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MAVKLYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLQEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PN+L+E DGFVFGFPTRFGMM+AQFKAFLDATGGLW+ Q+LAGKPAG+FYSTGSQG
Sbjct  61   PLITPNELSEGDGFVFGFPTRFGMMAAQFKAFLDATGGLWKAQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            EL+QAFHQGKY+A ITKKLK  +
Sbjct  181  ELQQAFHQGKYLATITKKLKEAA  203



>ref|XP_009377294.1| PREDICTED: minor allergen Alt a 7-like [Pyrus x bretschneideri]
Length=203

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV +LA EIKKGA S+EGVEA L+QVPETL +E+LGK+SAPPKSD 
Sbjct  1    MATKVYIVYYSMYGHVRRLAEEIKKGASSIEGVEATLWQVPETLPEEVLGKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PIISPN+L +ADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIISPNELADADGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME +KGGSPYGAGTYAGDGSRQPSQL
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENIKGGSPYGAGTYAGDGSRQPSQL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA ITKKLK
Sbjct  181  ELEQAFHQGKYIATITKKLK  200



>ref|XP_007133114.1| hypothetical protein PHAVU_011G152500g [Phaseolus vulgaris]
 gb|ESW05108.1| hypothetical protein PHAVU_011G152500g [Phaseolus vulgaris]
Length=203

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA ++YIV+YS YGHVE LA EIKKGADSV+GVEAKL+QVPETL+DE+LGK+ APPKSDV
Sbjct  1    MAVQVYIVYYSMYGHVETLAEEIKKGADSVDGVEAKLWQVPETLADEVLGKMRAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LAGKPAG+FYST SQG
Sbjct  61   PIITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGIFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME++KGGSPYG+GTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEELKGGSPYGSGTYAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIA+ITKKLK  +
Sbjct  181  ELEQAFHQGKYIASITKKLKEAA  203



>ref|XP_009132440.1| PREDICTED: minor allergen Alt a 7-like [Brassica rapa]
Length=205

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATKLYIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E+L K+SAPPKS+ 
Sbjct  1    MATKLYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEVLSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMVFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYIA ITKKLK
Sbjct  181  ELQQAFHQGKYIATITKKLK  200



>ref|XP_006370577.1| FLAVODOXIN-LIKE QUINONE REDUCTASE 1 family protein [Populus trichocarpa]
 gb|ERP67146.1| FLAVODOXIN-LIKE QUINONE REDUCTASE 1 family protein [Populus trichocarpa]
Length=203

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEA+L+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAQLWQVPETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LAGKPAG+F+STGSQG
Sbjct  61   PIITPGELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIAAITKKLK
Sbjct  181  ELEQAFHQGKYIAAITKKLK  200



>ref|XP_010062928.1| PREDICTED: minor allergen Alt a 7 [Eucalyptus grandis]
 gb|KCW70078.1| hypothetical protein EUGRSUZ_F03383 [Eucalyptus grandis]
Length=205

 Score =   338 bits (868),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YS YGHVE+LA EIKKGA SVEGVEA+L+QV ETL +E+L K+SAPPKSDVPI
Sbjct  5    TKVYIVYYSMYGHVERLAEEIKKGAASVEGVEAQLWQVAETLPEEVLAKMSAPPKSDVPI  64

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PNDL EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQGGG
Sbjct  65   ITPNDLAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQKLAGKPAGIFYSTGSQGGG  124

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQPS+LEL
Sbjct  125  QETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSELEL  184

Query  285  EQAFHQGKYIAAITKKLKSGS  223
            EQAFHQGKYIAAITKKLK  +
Sbjct  185  EQAFHQGKYIAAITKKLKGAA  205



>gb|KDP38996.1| hypothetical protein JCGZ_00753 [Jatropha curcas]
Length=203

 Score =   338 bits (868),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVE LA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVETLAEEIKKGATSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELPEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHG+IFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGLIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQA+HQGKYIA ITKKLK
Sbjct  181  ELEQAYHQGKYIATITKKLK  200



>ref|XP_009127084.1| PREDICTED: minor allergen Alt a 7-like [Brassica rapa]
 emb|CDY28766.1| BnaA02g09580D [Brassica napus]
Length=204

 Score =   338 bits (868),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDLTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP+ L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTDL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL QAFHQGKYIA ITKKLK  +A
Sbjct  181  ELAQAFHQGKYIATITKKLKGSTA  204



>ref|XP_011030918.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Populus euphratica]
Length=203

 Score =   338 bits (868),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QV ETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVSETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LAGKPAG+F+STGSQG
Sbjct  61   PIITPSELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIAAITKKLK
Sbjct  181  ELEQAFHQGKYIAAITKKLK  200



>emb|CDY42457.1| BnaA10g08330D [Brassica napus]
Length=204

 Score =   338 bits (868),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS  
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALLKMSAPPKSGS  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDLTEADGFV GFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLTEADGFVLGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP+QL
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTQL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA ITKKLK
Sbjct  181  ELEQAFHQGKYIATITKKLK  200



>emb|CDY43038.1| BnaA03g11850D [Brassica napus]
Length=205

 Score =   338 bits (866),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E+L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEVLSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMVFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYIA ITKKLK
Sbjct  181  ELQQAFHQGKYIATITKKLK  200



>ref|XP_004150766.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus]
 ref|XP_004171077.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus]
 gb|KGN56168.1| Minor allergen Alt a [Cucumis sativus]
Length=203

 Score =   337 bits (865),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL++++LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAQSVEGVEAKLWQVPETLTEDVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPSELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDGSR+P+ L
Sbjct  121  GGQETTALTAITQLTHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGSRKPTTL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKY+A ITKKLK GSA
Sbjct  181  ELEQAFHQGKYLATITKKLK-GSA  203



>ref|XP_009355549.1| PREDICTED: minor allergen Alt a 7-like [Pyrus x bretschneideri]
Length=204

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV +LA EIKKGA SVEGVEA L+QVPETL +E+LGK+SAPPKSD 
Sbjct  1    MATKVYIVYYSMYGHVGRLAEEIKKGASSVEGVEATLWQVPETLPEEVLGKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PIIS N+L +ADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYST SQG
Sbjct  61   PIISQNELADADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FG GMFEME +KGGSPYGAGTYAGDGSRQPSQL
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGVGMFEMENIKGGSPYGAGTYAGDGSRQPSQL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA ITKKLK  +A
Sbjct  181  ELEQAFHQGKYIATITKKLKGAAA  204



>ref|XP_004248361.1| PREDICTED: minor allergen Alt a 7-like [Solanum lycopersicum]
Length=203

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVEKLA EIK+GA SVEGVEAKL+QVPETLS+E+L K+SAPPKSDV
Sbjct  1    MATKIYIVYYSTYGHVEKLAEEIKEGAASVEGVEAKLWQVPETLSEEVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPQELAEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QA HQGKYIAAI KKLK
Sbjct  181  ELQQAHHQGKYIAAIAKKLK  200



>ref|XP_002864337.1| hypothetical protein ARALYDRAFT_495531 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40596.1| hypothetical protein ARALYDRAFT_495531 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLHEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQGKYIA ITKKLK  +A
Sbjct  181  ELQQAFHQGKYIATITKKLKGSTA  204



>ref|XP_006281120.1| hypothetical protein CARUB_v10027151mg [Capsella rubella]
 ref|XP_010448224.1| PREDICTED: minor allergen Alt a 7 [Camelina sativa]
 ref|XP_010482855.1| PREDICTED: minor allergen Alt a 7-like [Camelina sativa]
 gb|EOA14018.1| hypothetical protein CARUB_v10027151mg [Capsella rubella]
Length=204

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQGKYIA ITKKLK  +A
Sbjct  181  ELQQAFHQGKYIATITKKLKGSTA  204



>ref|XP_008452342.1| PREDICTED: minor allergen Alt a 7 [Cucumis melo]
Length=203

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +++LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAQSVEGVEAKLWQVPETLPEDVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPSELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDGSR+PS L
Sbjct  121  GGQETTALTAITQLTHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGSRKPSTL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKY+A ITKKLK GSA
Sbjct  181  ELEQAFHQGKYLATITKKLK-GSA  203



>gb|ABK94567.1| unknown [Populus trichocarpa]
Length=203

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEA+L+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAQLWQVPETLPEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LA KPAG+F+STGSQG
Sbjct  61   PIITPGELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLASKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIAAITKKLK
Sbjct  181  ELEQAFHQGKYIAAITKKLK  200



>ref|XP_002867516.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43775.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SV+GVEAKL+QVPETL +++L K+SAPPKSD 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIRKGAASVDGVEAKLWQVPETLQEDVLSKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIAAI+KKLK  +A
Sbjct  181  ELEQAFHQGKYIAAISKKLKGPAA  204



>ref|XP_010240992.1| PREDICTED: minor allergen Alt a 7 isoform X1 [Nelumbo nucifera]
Length=203

 Score =   337 bits (863),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+SAP KSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEEVLGKMSAPSKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L EADG +FGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PVITPAELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLAHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKYIA I KKLK
Sbjct  181  ELAQAFHQGKYIAGIAKKLK  200



>ref|XP_006362921.1| PREDICTED: minor allergen Alt a 7-like [Solanum tuberosum]
Length=203

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+L K+SAPPKSDV
Sbjct  1    MATKIYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEEVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PIITPQELAEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QA HQGKYIAAI KKLK
Sbjct  181  ELQQAHHQGKYIAAIAKKLK  200



>gb|ACJ86051.1| unknown [Medicago truncatula]
Length=203

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+ S YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MAVKLYIVYCSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLQEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PN+L+E DGFVFGFPTRFGMM+AQFKAFLDATGGLW+ Q+LAGKPAG+FYSTGSQG
Sbjct  61   PLITPNELSEGDGFVFGFPTRFGMMAAQFKAFLDATGGLWKAQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            EL+QAFHQGKY+A ITKKLK  +
Sbjct  181  ELQQAFHQGKYLATITKKLKEAA  203



>ref|XP_009119977.1| PREDICTED: minor allergen Alt a 7-like [Brassica rapa]
Length=204

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS  
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALLKMSAPPKSGS  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDLTEADGFV GFPTRFGMM+AQ KAFLDATGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLTEADGFVLGFPTRFGMMAAQVKAFLDATGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP+QL
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTQL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA ITKKLK
Sbjct  181  ELEQAFHQGKYIATITKKLK  200



>ref|XP_009629263.1| PREDICTED: P25 protein-like [Nicotiana tomentosiformis]
Length=203

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+ AP K D 
Sbjct  1    MATKVYIVYYSTYGHVEKLAQEIKKGAASVEGVEAKLWQVPETLSEEVLGKMGAPAKGDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+ NDL EADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PIITANDLAEADGFLFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FG GMFEME +KGGSPYGAGTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGGGMFEMENIKGGSPYGAGTYAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            E+EQAFHQGKYIA I KKLK GSA
Sbjct  181  EMEQAFHQGKYIATIAKKLK-GSA  203



>ref|XP_007212069.1| hypothetical protein PRUPE_ppa011617mg [Prunus persica]
 ref|XP_008226755.1| PREDICTED: minor allergen Alt a 7 [Prunus mume]
 gb|EMJ13268.1| hypothetical protein PRUPE_ppa011617mg [Prunus persica]
Length=203

 Score =   336 bits (861),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV +LA EIKKGA SVEGVEA L+QVPETLS+++LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVGRLAEEIKKGASSVEGVEATLWQVPETLSEDVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
             IISPN+L +ADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   AIISPNELADADGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME +KGGSPYGAGT+AGDGSRQP+QL
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENIKGGSPYGAGTFAGDGSRQPTQL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA ITKKLK
Sbjct  181  ELEQAFHQGKYIATITKKLK  200



>emb|CDY43826.1| BnaC03g14590D [Brassica napus]
Length=205

 Score =   336 bits (861),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVE LA EI+KGA SVEGVEAKL+QVPETL +E+L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVETLAEEIRKGAASVEGVEAKLWQVPETLPEEVLSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMVFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYIA ITKKLK
Sbjct  181  ELQQAFHQGKYIATITKKLK  200



>ref|XP_010443024.1| PREDICTED: minor allergen Alt a 7-like [Camelina sativa]
Length=204

 Score =   335 bits (860),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEYVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQGKYIA ITKKLK  +A
Sbjct  181  ELQQAFHQGKYIATITKKLKGSTA  204



>gb|AFK36853.1| unknown [Medicago truncatula]
Length=222

 Score =   336 bits (862),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 201/221 (91%), Gaps = 2/221 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDV
Sbjct  1    MAVKLYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLQEEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PN+L+E DGFVFGFPTRFGMM+AQFKAFLDATGGLW+ Q+LAGKPAG+FYSTGSQG
Sbjct  61   PLITPNELSEGDGFVFGFPTRFGMMAAQFKAFLDATGGLWKAQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA*LISFNSI-YTLHCSEI  172
            EL+QAFHQGKY+A   + L+S    LIS+  I Y L+ +EI
Sbjct  181  ELQQAFHQGKYLAPSQRSLRS-CIMLISYIDIYYILNYTEI  220



>ref|XP_008386042.1| PREDICTED: minor allergen Alt a 7-like [Malus domestica]
Length=203

 Score =   335 bits (860),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M TK+YIV+YS YGHV +LA EIKKGA SVEGVEA L+QVPETL +E+LGK+SAPPKSD 
Sbjct  1    MTTKVYIVYYSMYGHVGRLAEEIKKGASSVEGVEATLWQVPETLPEEVLGKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PIISPN+L +ADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIISPNELADADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FG GMFEME +KGGSPYGAGTYAGDGSRQPSQL
Sbjct  121  GGQETTALTAITQLVHHGMVFVPIGYTFGVGMFEMENIKGGSPYGAGTYAGDGSRQPSQL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA ITKKLK
Sbjct  181  ELEQAFHQGKYIATITKKLK  200



>gb|EYU27865.1| hypothetical protein MIMGU_mgv1a013996mg [Erythranthe guttata]
Length=204

 Score =   335 bits (859),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVE+LA EIKKGA+SVEGVEAKL+QVPETLSDEIL K+  PPKSDV
Sbjct  1    MATKVYIVYYSTYGHVERLAKEIKKGAESVEGVEAKLWQVPETLSDEILSKMGGPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADG +FGFPTRFGMM+AQFKAF+D+TGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELVEADGILFGFPTRFGMMAAQFKAFIDSTGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGMIFVPIGY+FGAGMFEM ++KGGSPYGAGTYAGDGSRQPS L
Sbjct  121  GGQETTPLTAITQLTHHGMIFVPIGYTFGAGMFEMGEIKGGSPYGAGTYAGDGSRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL QAFHQGKYIA ITKKLK+ +A
Sbjct  181  ELAQAFHQGKYIAGITKKLKTSAA  204



>ref|XP_010112077.1| Flavoprotein wrbA [Morus notabilis]
 gb|EXC32537.1| Flavoprotein wrbA [Morus notabilis]
Length=203

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA +I++GA S+EGVEAKL+QVPETL DE+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEKIREGAASIEGVEAKLWQVPETLPDEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+PN+L EADGFVFGFPTR+GMM+AQFKAFLDATG LWRTQ LAGKP G+FYSTGSQG
Sbjct  61   PKITPNELAEADGFVFGFPTRYGMMAAQFKAFLDATGSLWRTQQLAGKPTGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA ITK+LK
Sbjct  181  ELEQAFHQGKYIATITKRLK  200



>ref|XP_010433387.1| PREDICTED: minor allergen Alt a 7-like isoform X1 [Camelina sativa]
 ref|XP_010433388.1| PREDICTED: minor allergen Alt a 7-like isoform X2 [Camelina sativa]
Length=205

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SV+GVEA L+QVPETL +++L K+SAPPKSD 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIRKGAASVDGVEAILWQVPETLQEDVLSKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDL EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYIAAITKKLK
Sbjct  181  ELKQAFHQGKYIAAITKKLK  200



>ref|XP_010694306.1| PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1 [Beta vulgaris 
subsp. vulgaris]
Length=203

 Score =   334 bits (857),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 193/204 (95%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV KLA EI+KGA SVEGVEAKL+QVPETL+DE+LGK+SAPPK+D 
Sbjct  1    MATKVYIVYYSMYGHVHKLAEEIQKGAASVEGVEAKLWQVPETLTDEVLGKMSAPPKTDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L +ADGF+FGFPTRFGMM+AQFKAFLD+TGGLWRTQ LAGKPAGLF+STGSQG
Sbjct  61   PIITPNELADADGFIFGFPTRFGMMAAQFKAFLDSTGGLWRTQQLAGKPAGLFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLTHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA ITKKLK GSA
Sbjct  181  ELEQAFHQGKYIATITKKLK-GSA  203



>ref|XP_009605845.1| PREDICTED: minor allergen Alt a 7-like [Nicotiana tomentosiformis]
Length=203

 Score =   334 bits (857),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+L K+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEEVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+P +L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PAITPQELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQPS L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYIA I KKLK
Sbjct  181  ELQQAFHQGKYIAGIAKKLK  200



>ref|XP_002316953.1| FLAVODOXIN-LIKE QUINONE REDUCTASE 1 family protein [Populus trichocarpa]
 gb|EEE97565.1| FLAVODOXIN-LIKE QUINONE REDUCTASE 1 family protein [Populus trichocarpa]
Length=203

 Score =   334 bits (856),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPE L +E+LG +SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGASSVEGVEAKLWQVPEILPEEVLGMMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LAGKPAG+F+STGSQG
Sbjct  61   PIITPSELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGMFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGK+IAAITKKLK
Sbjct  181  ELEQAFHQGKHIAAITKKLK  200



>ref|XP_010438642.1| PREDICTED: minor allergen Alt a 7-like [Camelina sativa]
Length=205

 Score =   334 bits (856),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SV+GVEA L+QVPETL +++L K+SAP KSD 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIRKGAASVDGVEAILWQVPETLQEDVLSKMSAPSKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDL EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIAAITKKLK
Sbjct  181  ELEQAFHQGKYIAAITKKLK  200



>ref|XP_011095284.1| PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1 [Sesamum indicum]
Length=203

 Score =   334 bits (856),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA S+EGVEAKL+QVPETL DE+L K+SAPPKS++
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSIEGVEAKLWQVPETLPDEVLTKMSAPPKSEI  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I P++L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PVIMPSELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHG+IFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS L
Sbjct  121  GGQETTALTAITQLVHHGVIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYIA I KKLK
Sbjct  181  ELQQAFHQGKYIATIAKKLK  200



>ref|XP_010448159.1| PREDICTED: minor allergen Alt a 7-like [Camelina sativa]
Length=205

 Score =   334 bits (856),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SV+GVEA L+QVPETL +++L K+SAPPKSD 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIRKGAASVDGVEAILWQVPETLQEDVLSKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDL +ADGFVFGFPTRFGMM+AQ KAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNDLADADGFVFGFPTRFGMMAAQLKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIAAITKKLK  +A
Sbjct  181  ELEQAFHQGKYIAAITKKLKGPAA  204



>ref|NP_200261.1| flavodoxin-like quinone reductase 1 [Arabidopsis thaliana]
 sp|Q9LSQ5.1|FQR1_ARATH RecName: Full=NAD(P)H dehydrogenase (quinone) FQR1; AltName: 
Full=Flavodoxin-like quinone reductase 1 [Arabidopsis thaliana]
 dbj|BAA97523.1| 1,4-benzoquinone reductase-like; Trp repressor binding protein-like 
[Arabidopsis thaliana]
 gb|AAM53293.1| 1,4-benzoquinone reductase-like protein [Arabidopsis thaliana]
 gb|AAN72205.1| 1,4-benzoquinone reductase-like protein [Arabidopsis thaliana]
 gb|AED96502.1| flavodoxin-like quinone reductase 1 [Arabidopsis thaliana]
Length=204

 Score =   333 bits (855),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLHEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR QALAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQG+YIA+ITKKLK  +A
Sbjct  181  ELQQAFHQGQYIASITKKLKGSTA  204



>ref|XP_006591837.1| PREDICTED: uncharacterized protein LOC100499870 isoform X1 [Glycine 
max]
Length=199

 Score =   333 bits (853),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL DE+LGK+SAPPKSDVP+I+PN+L
Sbjct  5    YYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLQDEVLGKMSAPPKSDVPVITPNEL  64

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
            +EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQGGGQETTAL
Sbjct  65   SEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQGGGQETTAL  124

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            TAITQLVHHGMIF+PIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+LEL+QAFHQ
Sbjct  125  TAITQLVHHGMIFIPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELQQAFHQ  184

Query  267  GKYIAAITKKLKSGS  223
            GKYIA ITKKLK  +
Sbjct  185  GKYIAGITKKLKQAA  199



>ref|XP_009757565.1| PREDICTED: minor allergen Alt a 7-like [Nicotiana sylvestris]
Length=236

 Score =   334 bits (856),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 199/226 (88%), Gaps = 2/226 (1%)
 Frame = -3

Query  897  CFNVSFIHLPPFFTHKTIQDPPMATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLF  718
             ++ SFIHLP F   K    PPMATK+YIV+Y+ YGHVEKLA EIKKGA SVEGVEAKL+
Sbjct  13   LYSDSFIHLP-FPPKKQQSIPPMATKVYIVYYTMYGHVEKLAQEIKKGAASVEGVEAKLW  71

Query  717  QVPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGG  538
            QVPE LS+++L K+ APPK D PII+ ++L E DGFVFGFPTRFGMM AQFKAFLD+TGG
Sbjct  72   QVPEILSEDVLAKMHAPPKGDTPIITADELAEGDGFVFGFPTRFGMMPAQFKAFLDSTGG  131

Query  537  LWRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKV  358
            LWRTQ LAGKPAG+F STGSQGGGQETTALTAITQLVHHGMIFVP GYSFGAGMFEMEK+
Sbjct  132  LWRTQQLAGKPAGIFLSTGSQGGGQETTALTAITQLVHHGMIFVPTGYSFGAGMFEMEKI  191

Query  357  KGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLKSGSA  220
            KGGSPYG+GTYAGDGSRQP++LELEQAFHQGKYIA ITKKLK GSA
Sbjct  192  KGGSPYGSGTYAGDGSRQPTELELEQAFHQGKYIATITKKLK-GSA  236



>ref|XP_004293489.1| PREDICTED: flavoprotein WrbA-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEA+L+QVPETL DE+LGK+ APPKS+V
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAQLYQVPETLQDEVLGKMGAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDL++ADG +FGFPTRFGMM+AQFKAFLDATGGLWR+Q LAGKPAG+FYSTGSQG
Sbjct  61   PIIAPNDLSDADGLLFGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME++KGGSPYGAGT+AGDG+RQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEQIKGGSPYGAGTFAGDGTRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQGKY A+I KKLK  +A
Sbjct  181  ELQQAFHQGKYFASIAKKLKGTTA  204



>ref|XP_002518592.1| Flavoprotein wrbA, putative [Ricinus communis]
 gb|EEF43979.1| Flavoprotein wrbA, putative [Ricinus communis]
Length=203

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+Y+V+YSTYGHVEKLA EIKKGA+SVEGVE KL+QVPETLS+E+LGK+ APPKSDV
Sbjct  1    MATKVYVVYYSTYGHVEKLAEEIKKGAESVEGVEVKLWQVPETLSEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADG +FGFPTRFGMM+AQFKAF+DATGGLWRTQALAGKPAG+FYSTG+QG
Sbjct  61   PIITPNELAEADGLLFGFPTRFGMMAAQFKAFMDATGGLWRTQALAGKPAGIFYSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGM+FVPIGYSFGAGMFEME+VKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMVFVPIGYSFGAGMFEMEQVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QA HQGKY A I KK K
Sbjct  181  ELAQALHQGKYFAGIAKKFK  200



>ref|XP_006592527.1| PREDICTED: minor allergen Alt a 7-like [Glycine max]
Length=203

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA ++YIV+YS YGHVE+LA EIKKGADSVEGVEAKL+QV E L +E+LGK+ APPKSDV
Sbjct  1    MAVQVYIVYYSMYGHVERLAEEIKKGADSVEGVEAKLWQVAEILPEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L+EADGFVFGFPTRFGMM+AQFKAF+DATGGLW+TQ LAGKPAG+FYST SQG
Sbjct  61   PIITPNELSEADGFVFGFPTRFGMMAAQFKAFIDATGGLWKTQQLAGKPAGIFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME++KGGSPYG+GTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEELKGGSPYGSGTYAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIA ITKKLK  +
Sbjct  181  ELEQAFHQGKYIAGITKKLKEAA  203



>ref|XP_006284522.1| hypothetical protein CARUB_v10005724mg, partial [Capsella rubella]
 gb|EOA17420.1| hypothetical protein CARUB_v10005724mg, partial [Capsella rubella]
Length=212

 Score =   332 bits (850),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  828  ATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVP  649
            ATK+YIV+YS YGHVEKLA EI+KGA SV+GV+A+L+QVPETL +++L K+SAPPKSD P
Sbjct  9    ATKVYIVYYSMYGHVEKLAQEIRKGAASVDGVDARLWQVPETLQEDVLSKMSAPPKSDAP  68

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
            II+PNDL EA GFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQGG
Sbjct  69   IITPNDLAEAYGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQGG  128

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++LE
Sbjct  129  GQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTELE  188

Query  288  LEQAFHQGKYIAAITKKLKSGSA  220
            LEQAFHQGKYIA+ITKKLK  +A
Sbjct  189  LEQAFHQGKYIASITKKLKGTAA  211



>ref|XP_003540116.1| PREDICTED: minor allergen Alt a 7-like [Glycine max]
Length=203

 Score =   331 bits (849),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA ++YIV+YS Y HV++LA EIKKG DSVEGVEAKL+QVPETL +E+LGK+ APPKSDV
Sbjct  1    MAVQVYIVYYSMYRHVDRLAEEIKKGVDSVEGVEAKLWQVPETLPEEVLGKMRAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LAGKPAG+FYST SQG
Sbjct  61   PIITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGIFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMF+ME++KGGSPYG+GTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFDMEELKGGSPYGSGTYAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIA+ITKKLK  +
Sbjct  181  ELEQAFHQGKYIASITKKLKEAA  203



>gb|KEH19664.1| quinone oxidoreductase [Medicago truncatula]
Length=203

 Score =   331 bits (848),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVE+LA EIKKGA+SVEGVEAKL+QVPE L +E+LGK+ APPKSDV
Sbjct  1    MAVKVYIVYYSMYGHVERLAEEIKKGAESVEGVEAKLWQVPEILPEEVLGKMRAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTE DGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LAGKPAG+FYST SQG
Sbjct  61   PIITPNELTEGDGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGIFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEM +VKGGSPYG+GTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMGEVKGGSPYGSGTYAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQG YIA ITKKLK  +
Sbjct  181  ELEQAFHQGMYIATITKKLKEAA  203



>ref|XP_007212068.1| hypothetical protein PRUPE_ppa011600mg [Prunus persica]
 ref|XP_008224897.1| PREDICTED: minor allergen Alt a 7-like [Prunus mume]
 gb|AAD38143.1|AF139496_1 unknown [Prunus armeniaca]
 gb|EMJ13267.1| hypothetical protein PRUPE_ppa011600mg [Prunus persica]
Length=204

 Score =   331 bits (848),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI KGA SVEGVEAKL+QV ETL D++LGK+ APPKS+V
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEILKGAASVEGVEAKLWQVAETLQDDVLGKMGAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PIISPNDL+EADG +FGFPTRFGMM+AQFKAF D+TGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIISPNDLSEADGLLFGFPTRFGMMAAQFKAFFDSTGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGYSFGAGMFEME++KGGSPYGAGTYAGDG+RQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMVFVPIGYSFGAGMFEMEQIKGGSPYGAGTYAGDGTRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKY A I KKLK
Sbjct  181  ELQQAFHQGKYFAGIAKKLK  200



>gb|AFK43904.1| unknown [Medicago truncatula]
Length=203

 Score =   330 bits (847),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVE+LA EIKKGA+SVEGVEAKL+QVPE L +E+LGK+ APPKSDV
Sbjct  1    MAVKVYIVYYSMYGHVERLAEEIKKGAESVEGVEAKLWQVPEILPEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTE DGFVFGFPTRFGMM+AQFKAFLDATGGLW+TQ LAGKPAG+FYST SQG
Sbjct  61   PIITPNELTEGDGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGIFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEM +VKGGSPYG+GTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMGEVKGGSPYGSGTYAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQG YIA ITKKLK  +
Sbjct  181  ELEQAFHQGMYIATITKKLKEAA  203



>gb|ACU13760.1| unknown [Glycine max]
Length=199

 Score =   330 bits (847),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL DE+LGK+SAPPKSDVP+I+PN+L
Sbjct  5    YYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLQDEVLGKMSAPPKSDVPVITPNEL  64

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
            +EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQGGGQETTAL
Sbjct  65   SEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQGGGQETTAL  124

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            TAITQLVHHGMIF+PIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+LEL+QAFHQ
Sbjct  125  TAITQLVHHGMIFIPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELQQAFHQ  184

Query  267  GKYIAAITKKLKSGS  223
             KYIA ITKKLK  +
Sbjct  185  SKYIAGITKKLKQAA  199



>ref|NP_194457.2| Quinone reductase family protein [Arabidopsis thaliana]
 sp|Q6NQE2.1|FQRL1_ARATH RecName: Full=Probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Arabidopsis thaliana]
 gb|AAQ65137.1| At4g27270 [Arabidopsis thaliana]
 dbj|BAD95300.1| putative protein [Arabidopsis thaliana]
 gb|AEE85319.1| Quinone reductase family protein [Arabidopsis thaliana]
Length=205

 Score =   330 bits (847),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SV+GVEA L+QVPETL +++L K+SAPPKSD 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIRKGAASVDGVEAILWQVPETLQEDVLSKMSAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL QAFHQGKYIAAI+KKLK  +A
Sbjct  181  ELGQAFHQGKYIAAISKKLKGPAA  204



>ref|NP_001237954.1| uncharacterized protein LOC100499662 [Glycine max]
 gb|ACU13157.1| unknown [Glycine max]
Length=205

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YSTYGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+ APPKSDVPI
Sbjct  4    TKVYIVYYSTYGHVEKLAEEIKKGAGSVEGVEAKLWQVPETLSEEVLGKMGAPPKSDVPI  63

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PN+L EADG + GFPTRFG M+AQFKAF+DATGGLWRTQALAGKPAG+FYSTGSQGGG
Sbjct  64   ITPNELPEADGLLLGFPTRFGQMAAQFKAFMDATGGLWRTQALAGKPAGIFYSTGSQGGG  123

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGTYAGDGSRQP++LEL
Sbjct  124  QETTPLTSITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTYAGDGSRQPTELEL  183

Query  285  EQAFHQGKYIAAITKKLKSGS  223
             QAFHQGKY A ITKKLK  S
Sbjct  184  AQAFHQGKYFAGITKKLKGSS  204



>ref|XP_009785191.1| PREDICTED: minor allergen Alt a 7-like [Nicotiana sylvestris]
Length=203

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+++L K+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEDVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
             +I+P +L EADG +FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   AVITPQELAEADGIIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQPS L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYIA I KKLK
Sbjct  181  ELQQAFHQGKYIAGIAKKLK  200



>ref|XP_011097952.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Sesamum indicum]
Length=204

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL DE+L K+SAPPKSD+
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPDEVLTKMSAPPKSDI  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+PN+L EADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PVITPNELAEADGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFE+EKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEIEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAI  247
            EL+QAFHQGKYIA I
Sbjct  181  ELQQAFHQGKYIAGI  195



>ref|XP_006851210.1| hypothetical protein AMTR_s00043p00212880 [Amborella trichopoda]
 gb|ERN12791.1| hypothetical protein AMTR_s00043p00212880 [Amborella trichopoda]
Length=203

 Score =   329 bits (843),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEA L+QVPETL DE+LGK+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEATLWQVPETLPDEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII P+ L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR+Q LAGKPAG+FYSTGSQG
Sbjct  61   PIIQPHQLAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMI+VPIGY+FGAGMFEME+VKGGSPYGAGT+AGDG RQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMIYVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGLRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKY+A I KKLK
Sbjct  181  ELQQAFHQGKYVAGIAKKLK  200



>gb|EYU19180.1| hypothetical protein MIMGU_mgv1a014007mg [Erythranthe guttata]
Length=203

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +++L K+SAPPKS+V
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLQEDVLTKMSAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L E DGF+FGFPTRFGMM+AQFKAF DATGGLWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITPSELAEGDGFIFGFPTRFGMMAAQFKAFFDATGGLWRAQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDG RQPS L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGLRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKYIA ITKKLK GSA
Sbjct  181  ELEQAFHQGKYIATITKKLK-GSA  203



>gb|KHN45736.1| Flavoprotein wrbA [Glycine soja]
Length=205

 Score =   328 bits (842),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YSTYGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+ APPKSDVPI
Sbjct  4    TKVYIVYYSTYGHVEKLAEEIKKGAGSVEGVEAKLWQVPETLSEEVLGKMGAPPKSDVPI  63

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PN+L EADG + GFPTRFG+M+AQFKAF+DATGGLWRTQALAGKPAG+FYSTGSQGGG
Sbjct  64   ITPNELPEADGLLLGFPTRFGLMAAQFKAFMDATGGLWRTQALAGKPAGIFYSTGSQGGG  123

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGTYAGDGSRQP++LEL
Sbjct  124  QETTPLTSITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTYAGDGSRQPTELEL  183

Query  285  EQAFHQGKYIAAITKKLKSGS  223
             QAFHQGKY A I KKLK  S
Sbjct  184  AQAFHQGKYFAGIAKKLKGSS  204



>ref|XP_006593333.1| PREDICTED: uncharacterized protein LOC100305601 isoform X1 [Glycine 
max]
Length=192

 Score =   328 bits (841),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EIKKGA SVEGVEAKL+QVPETL DE+LGK+SAPPKSDVP+I+PN+L+EAD
Sbjct  2    YGHVEKLAEEIKKGASSVEGVEAKLWQVPETLLDEVLGKMSAPPKSDVPVITPNELSEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            GFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAGLFYSTGSQGGGQETTALTAIT
Sbjct  62   GFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGLFYSTGSQGGGQETTALTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+LEL+QAFHQGKYI
Sbjct  122  QLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELQQAFHQGKYI  181

Query  255  AAITKKLKSGS  223
            A ITKKLK  +
Sbjct  182  AGITKKLKQAA  192



>ref|XP_008793624.1| PREDICTED: minor allergen Alt a 7-like [Phoenix dactylifera]
Length=203

 Score =   328 bits (841),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA +VEGVEA+++QVPETL DE+LGK+SAPPKSDV
Sbjct  1    MATKIYIVYYSMYGHVEKLAEEIKKGASTVEGVEAEMWQVPETLPDEVLGKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+PN+L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PTITPNELAEADGIIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSR PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRFPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY A I KK KS S
Sbjct  181  ELEQAFHQGKYFAGIAKKFKSSS  203



>ref|XP_010665765.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Beta vulgaris subsp. vulgaris]
Length=203

 Score =   328 bits (841),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M+TK+YIV+YS YGHVEKLA EI KGA SVEGVEAKL+QVPETL D++L K+SAPPK+DV
Sbjct  1    MSTKIYIVYYSMYGHVEKLAEEILKGAASVEGVEAKLWQVPETLHDDVLAKMSAPPKTDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGF+FGFPTRFGMM+AQFKAF+DATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFLFGFPTRFGMMAAQFKAFMDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGMIFVPIGY+FGAGMFEMEK+KGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLTHHGMIFVPIGYTFGAGMFEMEKIKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY A I KKLK+ +
Sbjct  181  ELEQAFHQGKYFATIAKKLKAAA  203



>ref|XP_009799122.1| PREDICTED: minor allergen Alt a 7-like [Nicotiana sylvestris]
Length=203

 Score =   328 bits (841),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+L K+SAP K D 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIKKGAASVEGVEAKLWQVPETLSEEVLAKMSAPGKGDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P++L EADGFVFGFPTRFGMM AQFKAFLDATGGLW+TQ LAGKPAG+FYSTGSQG
Sbjct  61   PMITPDELAEADGFVFGFPTRFGMMPAQFKAFLDATGGLWKTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FG GMFEMEK+KGGSPYGAGT+ GDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGGGMFEMEKIKGGSPYGAGTFVGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKS  229
            ELEQAFHQGKYIA ITKKLK+
Sbjct  181  ELEQAFHQGKYIATITKKLKA  201



>ref|XP_008810245.1| PREDICTED: minor allergen Alt a 7-like [Phoenix dactylifera]
Length=203

 Score =   328 bits (841),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA +VEGVEAK++QVPETL +E+LGK+ APPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASTVEGVEAKMWQVPETLPEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+F+STGSQG
Sbjct  61   PIITPNELAEADGIIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSR PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRFPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY A I KK KS S
Sbjct  181  ELEQAFHQGKYFAGIAKKFKSSS  203



>emb|CDP05833.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   328 bits (840),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA  IKKGA SVEGVEAK++QV ETL  E+L K+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEAIKKGASSVEGVEAKMWQVAETLPQEVLSKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PIISP+ L+EADGFVFGFPTRFGMM+AQFKAFLDATGG WRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIISPHQLSEADGFVFGFPTRFGMMAAQFKAFLDATGGQWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKYIA I KKLK
Sbjct  181  ELEQAFHQGKYIATIAKKLK  200



>dbj|BAK53859.1| quinone reductase [Nicotiana benthamiana]
Length=199

 Score =   327 bits (839),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = -3

Query  819  LYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIIS  640
            +YIV+YSTYGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+ AP K D PII+
Sbjct  1    VYIVYYSTYGHVEKLAQEIKKGAASVEGVEAKLWQVPETLSEEVLGKMGAPAKGDAPIIT  60

Query  639  PNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqe  460
            PNDL EADGF+FGFPTRFGMM+ QFKAFLDATGGLWRTQ LAGKPAGLFYSTGSQGGGQE
Sbjct  61   PNDLAEADGFLFGFPTRFGMMAVQFKAFLDATGGLWRTQQLAGKPAGLFYSTGSQGGGQE  120

Query  459  tTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQ  280
            TT LTAITQLVHHGMIFVPIGY+FG GMFEME +KGGSPYG+GTYAGDGSRQP++LE+EQ
Sbjct  121  TTPLTAITQLVHHGMIFVPIGYTFGGGMFEMENIKGGSPYGSGTYAGDGSRQPTELEMEQ  180

Query  279  AFHQGKYIAAITKKLKSGSA  220
            AFHQGKYIA ITKKLK GSA
Sbjct  181  AFHQGKYIATITKKLK-GSA  199



>ref|XP_006452109.1| hypothetical protein CICLE_v10009497mg [Citrus clementina]
 gb|ESR65349.1| hypothetical protein CICLE_v10009497mg [Citrus clementina]
Length=207

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 189/202 (94%), Gaps = 1/202 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            T L   +YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDVPI
Sbjct  7    TLLTWEYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPI  66

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PN+L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQGGG
Sbjct  67   ITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGG  126

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++LEL
Sbjct  127  QETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELEL  186

Query  285  EQAFHQGKYIAAITKKLKSGSA  220
            EQAFHQGK+IA I KKLK GSA
Sbjct  187  EQAFHQGKHIAGIAKKLK-GSA  207



>ref|XP_004485679.1| PREDICTED: minor allergen Alt a 7-like isoform X1 [Cicer arietinum]
Length=203

 Score =   326 bits (836),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV KLA EIKKGADSVEGVEAKL+QVPE L++E+LGK+ APPKSDV
Sbjct  1    MATKVYIVYYSMYGHVGKLAEEIKKGADSVEGVEAKLWQVPEILAEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+LTEADG +FGFPTRFGMM+AQFK+FLDATGGLW  Q+LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELTEADGLLFGFPTRFGMMAAQFKSFLDATGGLWNKQSLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LT+ITQLVHHGMIFVP+GY+FGAGMFEMEKVKGGSPYG+GTYAGDGSRQPS+L
Sbjct  121  GGQETTPLTSITQLVHHGMIFVPVGYTFGAGMFEMEKVKGGSPYGSGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KKLK
Sbjct  181  ELAQAFHQGKYFAGIAKKLK  200



>ref|XP_003635180.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Vitis vinifera]
 emb|CBI41011.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   326 bits (835),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YS YGHVEKLA EIKKGA+SVEGVE KL+QVPETL +++LG + APPKSDV
Sbjct  1    MAAKLYIVYYSMYGHVEKLAQEIKKGAESVEGVEVKLWQVPETLPEDVLGLMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I PN+L+EADGF+FGFPTRFGMM+ QFKAFLDATG LWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PVIKPNELSEADGFIFGFPTRFGMMAGQFKAFLDATGALWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGTYAGDGSRQPS++
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRQPSEI  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQG YIA ITKKLK
Sbjct  181  ELAQAFHQGMYIAGITKKLK  200



>ref|XP_009591839.1| PREDICTED: minor allergen Alt a 7-like [Nicotiana tomentosiformis]
Length=203

 Score =   326 bits (835),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+++L K+SAP K D 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIKKGAASVEGVEAKLWQVPETLSEDVLAKMSAPGKGDT  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADGF+FGFPTRFGMM AQFKAFLDATGGLW+TQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPDELAEADGFIFGFPTRFGMMPAQFKAFLDATGGLWKTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FG GMFEMEK+KGGSPYGAGT+AGDGSRQP+++
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGGGMFEMEKIKGGSPYGAGTFAGDGSRQPTEI  180

Query  291  ELEQAFHQGKYIAAITKKLKS  229
            ELEQAFHQGKYIA I KKLK+
Sbjct  181  ELEQAFHQGKYIANIAKKLKA  201



>ref|XP_008789775.1| PREDICTED: minor allergen Alt a 7-like [Phoenix dactylifera]
Length=203

 Score =   325 bits (834),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 188/204 (92%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+L K+SAPPKSDV
Sbjct  1    MAAKVYIVYYSMYGHVEKLAEEIKKGATSVEGVEAKLWQVPETLPEEVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+F+STGSQG
Sbjct  61   PIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRMQQLAGKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSR P++L
Sbjct  121  GGQETTALTAITQLTHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRCPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKY A I KKLK GSA
Sbjct  181  ELEQAFHQGKYFAIIAKKLK-GSA  203



>ref|XP_009420536.1| PREDICTED: minor allergen Alt a 7-like [Musa acuminata subsp. 
malaccensis]
Length=203

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV KLA EIKKG+ SVEGVE KL+QVPETL +E+L K+ APPKSD 
Sbjct  1    MATKIYIVYYSMYGHVAKLAEEIKKGSSSVEGVEVKLWQVPETLPEEVLVKMGAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PNDL EADG +FGFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAGLF+STGSQG
Sbjct  61   PIITPNDLAEADGILFGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGLFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSR PS+L
Sbjct  121  GGQETTPLTAITQLAHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRFPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY A+I KKLKS S
Sbjct  181  ELEQAFHQGKYFASIAKKLKSSS  203



>ref|XP_007149665.1| hypothetical protein PHAVU_005G088900g [Phaseolus vulgaris]
 gb|ESW21659.1| hypothetical protein PHAVU_005G088900g [Phaseolus vulgaris]
Length=192

 Score =   324 bits (830),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EIKKGA SVEGVEAKL+QVPETL  E+LGK+SAPPKSDVPII+P++L+EAD
Sbjct  2    YGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPKEVLGKMSAPPKSDVPIITPDELSEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            GFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQGGGQETTALTAIT
Sbjct  62   GFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQGGGQETTALTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQPS+LELEQAFHQGKYI
Sbjct  122  QLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSELELEQAFHQGKYI  181

Query  255  AAITKKLKSGS  223
            AAITKKLK  +
Sbjct  182  AAITKKLKQAA  192



>ref|XP_010909518.1| PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1-like isoform 
X2 [Elaeis guineensis]
Length=203

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIK+GA +V GVEAK++QVPETL +E+LGK+ APPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKRGASTVGGVEAKMWQVPETLPEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGIIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSR PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRFPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY A I KK KS S
Sbjct  181  ELEQAFHQGKYFAGIVKKFKSSS  203



>ref|XP_003635185.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Vitis vinifera]
 emb|CBI18659.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YS YGHVEKLA EIKKGA+SVEGVE KL+QVPETL +++LG + APPKSDV
Sbjct  1    MAAKLYIVYYSMYGHVEKLAQEIKKGAESVEGVEVKLWQVPETLPEDVLGLMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I PN+L+EADGF+FGFPTRFGMM+ QFKAFLDATG LWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PVIKPNELSEADGFIFGFPTRFGMMAGQFKAFLDATGALWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFE+E+VKGGSPYGAGTYAGDGSRQPS++
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEIEQVKGGSPYGAGTYAGDGSRQPSEI  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQG YIA ITKKLK
Sbjct  181  ELAQAFHQGMYIAGITKKLK  200



>gb|AFK34293.1| unknown [Lotus japonicus]
Length=203

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS Y HVE LA EIKKGADSVEGVEA L+QVPE L +E+LGK+ APPKSDV
Sbjct  1    MAVKVYIVYYSMYRHVEGLAKEIKKGADSVEGVEATLWQVPEILPEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L+E DGFVFGFPTRFGMM+AQFKAFLD+TGGLW+TQ LAGKPAGLFYSTGSQG
Sbjct  61   PIITPHELSEGDGFVFGFPTRFGMMAAQFKAFLDSTGGLWKTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME++KGGSPYG+GTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEELKGGSPYGSGTYAGDGSRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIA ITKKLK  +
Sbjct  181  ELEQAFHQGKYIATITKKLKEAA  203



>ref|NP_001241601.1| uncharacterized protein LOC100805113 [Glycine max]
 gb|ACU19740.1| unknown [Glycine max]
 gb|KHN07691.1| Flavoprotein wrbA [Glycine soja]
Length=207

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL  E+LGK+ APPKSDVPI
Sbjct  6    TKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPQEVLGKMGAPPKSDVPI  65

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PN+L EADG + GFPTRFG+M+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQGGG
Sbjct  66   ITPNELPEADGLLLGFPTRFGLMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQGGG  125

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGTYAGDGSRQP++LEL
Sbjct  126  QETTPLTSITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTYAGDGSRQPTELEL  185

Query  285  EQAFHQGKYIAAITKKLKSGS  223
             QAFHQGKY A I KKLK  S
Sbjct  186  AQAFHQGKYFAGIAKKLKGSS  206



>ref|XP_008777137.1| PREDICTED: minor allergen Alt a 7-like [Phoenix dactylifera]
Length=203

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 188/204 (92%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+L K+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADG +FGFPTR+GMM+AQFKAFLDATG LWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGLIFGFPTRYGMMAAQFKAFLDATGSLWRMQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGM+FVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDGSR P++L
Sbjct  121  GGQETTPLTAITQLVHHGMLFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGSRCPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKY A I KKLK GSA
Sbjct  181  ELEQAFHQGKYFAVIAKKLK-GSA  203



>ref|XP_007025885.1| Quinone reductase family protein [Theobroma cacao]
 gb|EOY28507.1| Quinone reductase family protein [Theobroma cacao]
Length=209

 Score =   324 bits (830),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVE KL+QVPETL +E+LGK+ APPK+D 
Sbjct  1    MATKVYIVYYSMYGHVEKLAQEIKKGAASVEGVEVKLWQVPETLPEEVLGKMGAPPKTDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+PN+L EADG +FGFPTRFGMM+AQFKAF+DATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PCITPNELAEADGVLFGFPTRFGMMAAQFKAFMDATGGLWRTQDLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME +KGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMENLKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA*LISFN  202
            EL QAFHQGKY A I KKLK G+A L+S  
Sbjct  181  ELAQAFHQGKYFAGIAKKLK-GTASLVSIE  209



>gb|KDP20841.1| hypothetical protein JCGZ_21312 [Jatropha curcas]
Length=203

 Score =   324 bits (830),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA+K+Y+++YS YGHV KLA EI+KGA SVEGVE KL+QVPETL +++LGK+ APPKSDV
Sbjct  1    MASKIYVIYYSMYGHVAKLAEEIRKGAASVEGVEVKLWQVPETLPEDVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PIISP++L EADG +FGFPTRFGMM+AQFKAF+DATGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIISPSELAEADGVLFGFPTRFGMMAAQFKAFMDATGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYG+GTYAGDGSRQPSQL
Sbjct  121  GGQETTPLTAITQLVHHGMVFVPIGYTFGAGMFEMETVKGGSPYGSGTYAGDGSRQPSQL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKY A ITKK K
Sbjct  181  ELEQAFHQGKYFAGITKKFK  200



>gb|AFK48201.1| unknown [Lotus japonicus]
Length=204

 Score =   323 bits (829),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+ APP+SDVPI
Sbjct  4    TKVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEEVLGKMGAPPRSDVPI  63

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PN+L EADG + GFPTRFGMM+AQFKAF+DATGGLWRTQALAGKPAG+FYSTGSQGGG
Sbjct  64   ITPNELPEADGLLLGFPTRFGMMAAQFKAFMDATGGLWRTQALAGKPAGIFYSTGSQGGG  123

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGTYAGDGSRQP++LEL
Sbjct  124  QETTPLTSITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTYAGDGSRQPTELEL  183

Query  285  EQAFHQGKYIAAITKKLK  232
             QAFHQGK+ A I KKLK
Sbjct  184  AQAFHQGKHFAVIAKKLK  201



>ref|XP_003545793.1| PREDICTED: minor allergen Alt a 7 isoform X1 [Glycine max]
 ref|XP_006597382.1| PREDICTED: minor allergen Alt a 7 isoform X2 [Glycine max]
Length=203

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E+L KL APPKSD 
Sbjct  1    MATKVYIVYYSTYGHVEKLAREIEKGAASVEGVEAKLWQVPETLPEEVLAKLGAPPKSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGF+FGFPTRFG M+AQFKAF DATGGLWRTQ+LAGKPAG FYST SQG
Sbjct  61   PIITPNELPEADGFLFGFPTRFGSMAAQFKAFFDATGGLWRTQSLAGKPAGFFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LT+ITQLVHHG+IFVPIGY+FG GMFEMEKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTPLTSITQLVHHGLIFVPIGYTFGGGMFEMEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KKLK
Sbjct  181  ELAQAFHQGKYFAGIAKKLK  200



>ref|XP_010928688.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Elaeis guineensis]
Length=203

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+L K+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+F+STGSQG
Sbjct  61   PIITPHELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRMQQLAGKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMF+ME VKGGSPYGAGT+AGDGSR P++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFDMENVKGGSPYGAGTFAGDGSRCPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKY A I KKLK GSA
Sbjct  181  ELEQAFHQGKYFAIIAKKLK-GSA  203



>gb|KHN27997.1| Flavoprotein wrbA [Glycine soja]
Length=194

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 2/193 (1%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQ--VPETLSDEILGKLSAPPKSDVPIISPNDLTE  622
            YGHVEKLA EIKKGA SVEGVEAKL+Q  VPETL DE+LGK+SAPPKSDVP+I+PN+L+E
Sbjct  2    YGHVEKLAEEIKKGASSVEGVEAKLWQACVPETLQDEVLGKMSAPPKSDVPVITPNELSE  61

Query  621  ADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTA  442
            ADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQGGGQETTALTA
Sbjct  62   ADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQGGGQETTALTA  121

Query  441  ITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGK  262
            ITQLVHHGMIF+PIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+LEL+QAFHQGK
Sbjct  122  ITQLVHHGMIFIPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELQQAFHQGK  181

Query  261  YIAAITKKLKSGS  223
            YIA ITKKLK  +
Sbjct  182  YIAGITKKLKQAA  194



>gb|KDO74383.1| hypothetical protein CISIN_1g028841mg [Citrus sinensis]
Length=192

 Score =   322 bits (826),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 184/192 (96%), Gaps = 1/192 (1%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EIKKGA SVEGVEAKL+QVPETL +E+LGK+SAPPKSDVPII+PN+L EAD
Sbjct  2    YGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            GFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQGGGQETTALTAIT
Sbjct  62   GFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++LELEQAFHQGK+I
Sbjct  122  QLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHI  181

Query  255  AAITKKLKSGSA  220
            A I KKLK GSA
Sbjct  182  AGIAKKLK-GSA  192



>gb|KHG07419.1| Flavoprotein wrbA [Gossypium arboreum]
Length=204

 Score =   323 bits (827),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M TK+YIV+YS YGHVEKLA E+KKGA+SVEGVE KL+QV ETL +E+LGK+ APPK+D 
Sbjct  1    MVTKVYIVYYSMYGHVEKLAQEMKKGAESVEGVEVKLWQVAETLPEEVLGKMGAPPKTDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++LTEADG +FGFPTRFGMM+AQFKAF+DATGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIITPDELTEADGVLFGFPTRFGMMAAQFKAFMDATGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGM+FVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMLFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL QAFHQGKY A I KKLK  +A
Sbjct  181  ELGQAFHQGKYFAGIAKKLKGTTA  204



>ref|XP_006467937.1| PREDICTED: minor allergen Alt a 7-like [Citrus sinensis]
 gb|KDO75643.1| hypothetical protein CISIN_1g028847mg [Citrus sinensis]
Length=203

 Score =   322 bits (826),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 188/204 (92%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETLS+++LGK+ A PKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+PN+L EADG + GFPTRFGMM+AQFKAFLDATGGLWR+Q LAGKPAG+FYSTGSQG
Sbjct  61   PTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGM EMEKVKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL QAFHQGKY A ITKKLK GSA
Sbjct  181  ELAQAFHQGKYFAGITKKLK-GSA  203



>ref|XP_009402585.1| PREDICTED: minor allergen Alt a 7-like [Musa acuminata subsp. 
malaccensis]
Length=203

 Score =   322 bits (826),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA S+EGVE KL+QVPETL +E+LGK+ APPK+D 
Sbjct  1    MAAKIYVVYYSMYGHVAKLAEEIKKGASSIEGVEVKLWQVPETLPEEVLGKMGAPPKTDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P+DL EADG +FGFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PIITPDDLAEADGILFGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSR PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRFPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            E++QAFHQGKY A I KK KS S
Sbjct  181  EMQQAFHQGKYFAGIAKKFKSSS  203



>gb|KHN36755.1| Flavoprotein wrbA [Glycine soja]
Length=196

 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 183/195 (94%), Gaps = 4/195 (2%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQ----VPETLSDEILGKLSAPPKSDVPIISPNDL  628
            YGHVEKLA EIKKGA SVEGVEAKL+Q    VPETL DE+LGK+SAPPKSDVP+I+PN+L
Sbjct  2    YGHVEKLAEEIKKGASSVEGVEAKLWQACIYVPETLLDEVLGKMSAPPKSDVPVITPNEL  61

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
            +EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAGLFYSTGSQGGGQETTAL
Sbjct  62   SEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGLFYSTGSQGGGQETTAL  121

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            TAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+LEL+QAFHQ
Sbjct  122  TAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELQQAFHQ  181

Query  267  GKYIAAITKKLKSGS  223
            GKYIA ITKKLK  +
Sbjct  182  GKYIAGITKKLKQAA  196



>ref|NP_001237941.1| uncharacterized protein LOC100500685 [Glycine max]
 gb|ACU15826.1| unknown [Glycine max]
Length=203

 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E+L KL APPKSDV
Sbjct  1    MATKVYIVYYSTYGHVEKLAREIEKGAASVEGVEAKLWQVPETLPEEVLAKLGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGF+FGFPTRFG M+AQFKAF DATGGLWRTQALAGK AG FYST SQG
Sbjct  61   PIITPNELPEADGFLFGFPTRFGSMAAQFKAFFDATGGLWRTQALAGKAAGFFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LT+ITQLVHHG+IFVPIGY+FG GMFE+EKVKGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTPLTSITQLVHHGLIFVPIGYTFGGGMFELEKVKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KKLK
Sbjct  181  ELAQAFHQGKYFAGIAKKLK  200



>ref|XP_010931880.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Elaeis guineensis]
Length=203

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA +VEGVEA L+QVPETL DE+LGK+ APPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASTVEGVEAILWQVPETLPDEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITPHELAEADGVIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEM +VKGGSPYGAGTYAGDGSR PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMGQVKGGSPYGAGTYAGDGSRFPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY A I KK KS S
Sbjct  181  ELEQAFHQGKYFAGIAKKFKSSS  203



>ref|XP_010646712.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Vitis vinifera]
Length=203

 Score =   321 bits (823),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YSTYGHVEKLA EIKKGA+SVEGVE KL+QVPETL +++LG + APPKSDV
Sbjct  1    MAAKLYIVYYSTYGHVEKLAQEIKKGAESVEGVEVKLWQVPETLPEDVLGLMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L+EADGF+FGFPTRFGMM+ QFKAFLDATG LWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PVITPAELSEADGFIFGFPTRFGMMAGQFKAFLDATGALWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFE+E+VKGGSPYGAGTYAGDGSRQP+++
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEIEQVKGGSPYGAGTYAGDGSRQPTEI  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQG Y A ITKKLK
Sbjct  181  ELAQAFHQGMYTAGITKKLK  200



>ref|NP_001266148.1| flavoprotein WrbA-like [Cicer arietinum]
 emb|CAD31838.1| putative quinone oxidoreductase [Cicer arietinum]
Length=204

 Score =   321 bits (822),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YSTYGHV KLA EI+KGA SVEGVEAKL+QVPETL +++LGK+ APPKSDVPI
Sbjct  4    TKVYIVYYSTYGHVHKLAEEIQKGAASVEGVEAKLWQVPETLPEDVLGKMGAPPKSDVPI  63

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PN+L EADG +FGFPTRFGMM+AQFKAF+DATGGLWRTQALAGKPAG+FYSTGSQGGG
Sbjct  64   ITPNELPEADGLLFGFPTRFGMMAAQFKAFMDATGGLWRTQALAGKPAGIFYSTGSQGGG  123

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQLVHHG+IFVPIGY+FGAGMFE+EKVKGGSPYGAGTYAGDGSRQP++LEL
Sbjct  124  QETTPLTSITQLVHHGLIFVPIGYTFGAGMFEIEKVKGGSPYGAGTYAGDGSRQPTELEL  183

Query  285  EQAFHQGKYIAAITKKLK  232
             QAFHQGKY A I KKLK
Sbjct  184  AQAFHQGKYFAGIAKKLK  201



>ref|XP_006413096.1| hypothetical protein EUTSA_v10026307mg [Eutrema salsugineum]
 gb|ESQ54549.1| hypothetical protein EUTSA_v10026307mg [Eutrema salsugineum]
Length=194

 Score =   320 bits (820),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +++L K+SAPPKSD PII+PN+L EAD
Sbjct  2    YGHVEKLAQEIRKGAASVEGVEAKLWQVPETLQEDVLSKMSAPPKSDAPIITPNELAEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            GFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQGGGQETTALTAIT
Sbjct  62   GFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQGGGQETTALTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSRQP++LELEQAFHQGKYI
Sbjct  122  QLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKYI  181

Query  255  AAITKKLKSGSA  220
            A I+KKLK  SA
Sbjct  182  AVISKKLKGPSA  193



>ref|XP_006449164.1| hypothetical protein CICLE_v10016752mg [Citrus clementina]
 gb|ESR62404.1| hypothetical protein CICLE_v10016752mg [Citrus clementina]
Length=203

 Score =   320 bits (820),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 187/204 (92%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETLS+++LGK+ A PKSDV
Sbjct  1    MAAKVYIVYYSMYGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+PN+L EADG + GFPTRFGMM+AQFKAFLDATGGLWR+Q LAGKPAG+FYSTGSQG
Sbjct  61   PTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGM EMEKVKGGSPYGAGT+AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL QAFHQGKY A ITKKLK GSA
Sbjct  181  ELAQAFHQGKYFAGITKKLK-GSA  203



>ref|XP_002316697.1| hypothetical protein POPTR_0011s03570g [Populus trichocarpa]
 gb|EEE97309.1| hypothetical protein POPTR_0011s03570g [Populus trichocarpa]
Length=203

 Score =   320 bits (819),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YI++YS YGHV +LA EIKKGAD+VEGVE KL+QVPETL +E+LGK+ APPKSDV
Sbjct  1    MAVKIYIIYYSMYGHVARLAEEIKKGADTVEGVEIKLWQVPETLPEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII PNDLTEADG +FGFPTRFGMM+AQFKAFLDATGGLW TQ LAGKPAG+F+ST SQG
Sbjct  61   PIIKPNDLTEADGVLFGFPTRFGMMAAQFKAFLDATGGLWGTQQLAGKPAGIFFSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDG+RQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGTRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KK K
Sbjct  181  ELGQAFHQGKYFAGIAKKFK  200



>ref|XP_010924018.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Elaeis guineensis]
Length=203

 Score =   319 bits (818),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 185/204 (91%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGA SVEGVE KL+QV ETL +E+L K+SAPPKSDV
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGASSVEGVEVKLWQVSETLPEEVLAKMSAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQFKAFLDATG LWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITPKELAEADGLIFGFPTRFGMMAAQFKAFLDATGSLWRMQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDGSR P++L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMERVKGGSPYGAGTFAGDGSRCPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQAFHQGKY A I KKLK GSA
Sbjct  181  ELEQAFHQGKYFAVIAKKLK-GSA  203



>ref|XP_009408670.1| PREDICTED: minor allergen Alt a 7-like [Musa acuminata subsp. 
malaccensis]
Length=203

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK++IV+YS YGHVE+LA EIKKGA S+EGVEAK++QVPE L DE+L K+SAPPKS+V
Sbjct  1    MATKVFIVYYSMYGHVERLAEEIKKGASSIEGVEAKMWQVPEILPDEVLVKMSAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+ N L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR+Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITANQLAEADGVLFGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDG+R PS+L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGTRVPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQG+Y A + KKLK+ +
Sbjct  181  ELEQAFHQGRYFAVMAKKLKTSA  203



>emb|CDO99681.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVEKLAHEIKKGAD VEGVEAKL+QVPETLS EILGK+ AP KSDV
Sbjct  1    MATKVYIVYYSTYGHVEKLAHEIKKGADCVEGVEAKLWQVPETLSAEILGKMGAPQKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EAD F+FGFPTRFGMM+AQFKAF+DATG LW  Q LAGKPAG+F+STGSQG
Sbjct  61   PIITPHELPEADAFIFGFPTRFGMMAAQFKAFMDATGSLWGAQKLAGKPAGMFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+ GAGMFEMEKVKGGSPYGAGT+AGDGSRQP++L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTAGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+ AFHQGKYIA I KKLK
Sbjct  181  ELQIAFHQGKYIAGIAKKLK  200



>ref|XP_011009497.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Populus euphratica]
Length=203

 Score =   318 bits (814),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YI++YS YGHV +LA EIKKGAD+VEGVE KL+QVPETL +E+LGK+ APPKSDV
Sbjct  1    MAVKIYIIYYSMYGHVARLAEEIKKGADTVEGVEIKLWQVPETLPEEVLGKMGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII PNDLTEADG +FGFPTRFGMM+AQFKAFLDATGGLW TQ LAGKPAG+F+ST SQG
Sbjct  61   PIIKPNDLTEADGVLFGFPTRFGMMAAQFKAFLDATGGLWGTQQLAGKPAGIFFSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDG+RQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGTRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QA HQGKY A I KK K
Sbjct  181  ELGQALHQGKYFAGIAKKFK  200



>ref|XP_006281121.1| hypothetical protein CARUB_v10027151mg [Capsella rubella]
 gb|EOA14019.1| hypothetical protein CARUB_v10027151mg [Capsella rubella]
Length=193

 Score =   317 bits (813),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ PII+PN+LTEAD
Sbjct  2    YGHVEKLAEEIRKGAASVEGVEAKLWQVPETLPEEALSKMSAPPKSESPIITPNELTEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            GFVFGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQGGGQETTALTAIT
Sbjct  62   GFVFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQGGGQETTALTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QLVHHGM+FVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGSRQP++LEL+QAFHQGKYI
Sbjct  122  QLVHHGMLFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTELELQQAFHQGKYI  181

Query  255  AAITKKLKSGSA  220
            A ITKKLK  +A
Sbjct  182  ATITKKLKGSTA  193



>ref|XP_010240993.1| PREDICTED: minor allergen Alt a 7 isoform X2 [Nelumbo nucifera]
Length=192

 Score =   317 bits (812),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+SAP KSDVP+I+P +L EAD
Sbjct  2    YGHVEKLAEEIKKGAASVEGVEAKLWQVPETLSEEVLGKMSAPSKSDVPVITPAELAEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            G +FGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+FYSTGSQGGGQETTALTAIT
Sbjct  62   GLIFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFYSTGSQGGGQETTALTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QL HHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGTYAGDGSRQPS+LEL QAFHQGKYI
Sbjct  122  QLAHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELAQAFHQGKYI  181

Query  255  AAITKKLK  232
            A I KKLK
Sbjct  182  AGIAKKLK  189



>ref|XP_002304974.2| hypothetical protein POPTR_0004s02850g [Populus trichocarpa]
 gb|EEE85485.2| hypothetical protein POPTR_0004s02850g [Populus trichocarpa]
Length=272

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YI++YS YGHV +LA EIKKGADSVEGVE KL+QVPETL +E+LGK+ APPKSDV
Sbjct  70   MAVKIYIIYYSMYGHVARLAEEIKKGADSVEGVEVKLWQVPETLPEEVLGKMGAPPKSDV  129

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P+DL EADGF+ GFPTRFGMM+AQFKAF+D+TGGLW TQ LAGKPAG+FYST SQG
Sbjct  130  PIITPSDLAEADGFLLGFPTRFGMMAAQFKAFMDSTGGLWGTQQLAGKPAGIFYSTASQG  189

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFE+EKVKGGSPYGAGTYAGDG+RQP++L
Sbjct  190  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEIEKVKGGSPYGAGTYAGDGTRQPTEL  249

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QA HQGKY A I KK K
Sbjct  250  ELGQALHQGKYFAGIAKKFK  269



>ref|XP_011003378.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Populus euphratica]
Length=203

 Score =   316 bits (809),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YI++YS YGHV +LA EIKKGADSVEGVE KL+QVPETL +E+LGK+ APPK DV
Sbjct  1    MAVKIYIIYYSMYGHVARLAEEIKKGADSVEGVEVKLWQVPETLPEEVLGKMGAPPKGDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P+DL EADGF+ GFPTRFGMM+AQFKAF+D+TGGLW TQ LAGKPAG+FYST SQG
Sbjct  61   PIITPSDLAEADGFLLGFPTRFGMMAAQFKAFMDSTGGLWGTQQLAGKPAGIFYSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FGAGMFE+EKVKGGSPYGAGTYAGDG+RQP++L
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEIEKVKGGSPYGAGTYAGDGTRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QA HQGKY A I KK K
Sbjct  181  ELGQALHQGKYFAGIAKKFK  200



>ref|XP_007148277.1| hypothetical protein PHAVU_006G194800g [Phaseolus vulgaris]
 gb|ESW20271.1| hypothetical protein PHAVU_006G194800g [Phaseolus vulgaris]
Length=203

 Score =   315 bits (808),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YI++YSTYGHVEKLA EI+KGA SVEG+EAKL+QVPETL +E+L KL APPKSDV
Sbjct  1    MATKVYIIYYSTYGHVEKLAREIEKGAASVEGIEAKLWQVPETLPEEVLQKLGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P++L EADGF+FGFPTRFG M+AQFKAF DATGGLWR+Q+L+GKPAG FYST SQG
Sbjct  61   PVITPHELPEADGFLFGFPTRFGSMAAQFKAFFDATGGLWRSQSLSGKPAGFFYSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LT+ITQLVHHGMI+VPIGY+FGAGMFE+E +KGGSPYGAGTYAGDGSRQPS+L
Sbjct  121  GGQETTPLTSITQLVHHGMIYVPIGYTFGAGMFELENLKGGSPYGAGTYAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KKLK
Sbjct  181  ELAQAFHQGKYFAGIAKKLK  200



>ref|XP_011096173.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Sesamum indicum]
Length=203

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVE+LA EIKKGA+SVEGVEAKL+QVPETLS EILGK+ APPK+D 
Sbjct  1    MATKVYIVYYSMYGHVERLAQEIKKGAESVEGVEAKLWQVPETLSHEILGKMGAPPKTDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+P++L +ADGFVFGFPTRFGMM+AQFKAFLD+TGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PEITPSELAKADGFVFGFPTRFGMMAAQFKAFLDSTGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME+VKGGSPYGAGT+AGDGSRQP+ L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGSRQPTDL  180

Query  291  ELEQAFHQGKYI  256
            EL QAFHQGKYI
Sbjct  181  ELGQAFHQGKYI  192



>gb|ABR18269.1| unknown [Picea sitchensis]
Length=203

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EIKKGA SVEGVEA L+QVPETL +E+L K++APPK+ V
Sbjct  1    MAVKIYIVYYSMYGHVEKLAEEIKKGAASVEGVEATLWQVPETLPEEVLIKMNAPPKTKV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I P  L +ADG +FGFPTR+GMM+AQFKAFLDATGGLWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PTIEPQQLADADGLLFGFPTRYGMMAAQFKAFLDATGGLWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVP+GY+FGAGMFEME+VKGGSPYG+GT+AGDGSRQPS+L
Sbjct  121  GGQETTALTAITQLVHHGMLFVPVGYTFGAGMFEMEQVKGGSPYGSGTFAGDGSRQPSKL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGKY+A I KKLK
Sbjct  181  ELEQAFHQGKYLAGIAKKLK  200



>gb|AAG53945.1|AF304462_1 quinone-oxidoreductase QR2 [Triphysaria versicolor]
Length=205

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 187/205 (91%), Gaps = 1/205 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVE+LA EIKKGA+SV  VE KL+QVPE LSDE+LGK+ APPKSDV
Sbjct  1    MATKVYIVYYSTYGHVERLAQEIKKGAESVGNVEVKLWQVPEILSDEVLGKMWAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P++L EADG +FGFPTRFGMM+AQFKAF D+TGGLW+TQALAGKPAG+F+STG+QG
Sbjct  61   PVITPDELVEADGIIFGFPTRFGMMAAQFKAFFDSTGGLWKTQALAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPSQ  295
            GGQETTALTAITQL HHGMI+VPIGY+FGA MF MEK+KGGSPYGAGT+AG DGSRQPS 
Sbjct  121  GGQETTALTAITQLTHHGMIYVPIGYTFGADMFNMEKIKGGSPYGAGTFAGADGSRQPSD  180

Query  294  LELEQAFHQGKYIAAITKKLKSGSA  220
            +EL+QAFHQG YIA ITKK+K  SA
Sbjct  181  IELKQAFHQGMYIAGITKKIKQTSA  205



>ref|XP_002973189.1| hypothetical protein SELMODRAFT_232063 [Selaginella moellendorffii]
 ref|XP_002976663.1| hypothetical protein SELMODRAFT_151339 [Selaginella moellendorffii]
 gb|EFJ22332.1| hypothetical protein SELMODRAFT_151339 [Selaginella moellendorffii]
 gb|EFJ25563.1| hypothetical protein SELMODRAFT_232063 [Selaginella moellendorffii]
Length=204

 Score =   315 bits (807),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EI KGA+SVEGVEA L+QVPETLS+++LGK+ APPKS+V
Sbjct  1    MAVKVYIVYYSMYGHVEKLAQEITKGANSVEGVEASLWQVPETLSEDVLGKMGAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII P  L +ADG +FGFPTRFGMM+AQFKAF+DATGGLWR Q LAGKPAG+FYSTGSQG
Sbjct  61   PIIQPGQLADADGLIFGFPTRFGMMAAQFKAFMDATGGLWRAQTLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMIFVPIGY+ GAGMFEM +VKGGSPYGAGT AGDG+RQPS+L
Sbjct  121  GGQETTALTAITQLAHHGMIFVPIGYTSGAGMFEMVQVKGGSPYGAGTLAGDGTRQPSKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELE AFHQGKYIAAITK+L + S
Sbjct  181  ELETAFHQGKYIAAITKRLATKS  203



>gb|AFK46852.1| unknown [Lotus japonicus]
Length=203

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 186/204 (91%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EI+KGA S++ VEAKL+QVPETLSDE+LGK+ APPK+DV
Sbjct  1    MAVKVYIVYYSMYGHVEKLAEEIRKGAASIKDVEAKLWQVPETLSDEVLGKMMAPPKTDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMM+AQFKAF D+TGGLW+ Q LAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELPEADGFVFGFPTRFGMMAAQFKAFFDSTGGLWKKQELAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+F PIGY+F   MFEME+VKGGSPYGAGTYAGDGSRQP++L
Sbjct  121  GGQETTALTAITQLVHHGMLFAPIGYTFNR-MFEMEEVKGGSPYGAGTYAGDGSRQPTEL  179

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQGKYIA ITKKLK   A
Sbjct  180  ELKQAFHQGKYIAFITKKLKQAPA  203



>ref|XP_007159225.1| hypothetical protein PHAVU_002G219700g [Phaseolus vulgaris]
 gb|ESW31219.1| hypothetical protein PHAVU_002G219700g [Phaseolus vulgaris]
Length=205

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YS YGHVE LA EIKKGA SVEGVEA L+QVPETL +E+LGK+ APPKSDVPI
Sbjct  4    TKVYIVYYSMYGHVEMLAEEIKKGAASVEGVEATLWQVPETLPEEVLGKMGAPPKSDVPI  63

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+PN+L EADG + GFPTRFG+M+AQFKAF+DATG LWRTQALAGKPAG+FYSTGSQGGG
Sbjct  64   ITPNELPEADGLLLGFPTRFGLMAAQFKAFMDATGSLWRTQALAGKPAGIFYSTGSQGGG  123

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQLVHHGMIFVPIGY+FG+GMFEME VKGGSPYGAGTYAGDGSR+P++LEL
Sbjct  124  QETTPLTSITQLVHHGMIFVPIGYTFGSGMFEMENVKGGSPYGAGTYAGDGSRKPTELEL  183

Query  285  EQAFHQGKYIAAITKKLKSGS  223
             QAFHQGKY A I K+LK+ S
Sbjct  184  AQAFHQGKYFAGIAKRLKASS  204



>gb|ABD66515.1| quinone oxidoreductase [Gymnadenia conopsea]
Length=203

 Score =   313 bits (802),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHVEKLAHEI KGA +VEGVE KL+QVPETL +E+LGKL APPKSDV
Sbjct  1    MATKIYIVYYSTYGHVEKLAHEILKGASTVEGVEVKLWQVPETLPEEVLGKLGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+ ++L EADGF+FGFPTRFGMM++QFKAFLD+TGGLWRTQ LAGKPAGLF+STGSQG
Sbjct  61   PIITAHELAEADGFIFGFPTRFGMMASQFKAFLDSTGGLWRTQQLAGKPAGLFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTA+TQLVHH +I+VPIGY+ GAGMFE+EKVKGGSPYGAGT+AGDG+RQPS++
Sbjct  121  GGQETTALTAVTQLVHHEIIYVPIGYTAGAGMFEIEKVKGGSPYGAGTFAGDGTRQPSEI  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+ AFHQG+Y A I KKLK GSA
Sbjct  181  ELQVAFHQGQYFAGIAKKLK-GSA  203



>gb|ABK21008.1| unknown [Picea sitchensis]
Length=203

 Score =   313 bits (802),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVEKLA EIKKGA SVEGVEA L+QVPE L +E+L K++APPK++V
Sbjct  1    MAVKIYIVYYSMYGHVEKLAEEIKKGAASVEGVEATLWQVPEILPEEVLIKMNAPPKTEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I P  L +ADG +FGFPTR+GMM+AQFKAFLDATGGLWRTQ LAGKPAGLFYSTGSQG
Sbjct  61   PTIEPQQLADADGLLFGFPTRYGMMAAQFKAFLDATGGLWRTQQLAGKPAGLFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTA+TQLVH GM++VPIGY+FGAGMFEME+VKGGSPYG+GT+AGDGSRQPS+L
Sbjct  121  GGQETTALTAVTQLVHQGMLYVPIGYTFGAGMFEMEQVKGGSPYGSGTFAGDGSRQPSKL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY+A I KKLK G+
Sbjct  181  ELEQAFHQGKYLAGIAKKLKGGA  203



>ref|XP_004485680.1| PREDICTED: minor allergen Alt a 7-like isoform X2 [Cicer arietinum]
Length=198

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YS YGHV KLA EIKKGADSVEGVEAKL+QVPE L++E+LGK+ APPKSDVPII+PN+L
Sbjct  4    YYSMYGHVGKLAEEIKKGADSVEGVEAKLWQVPEILAEEVLGKMGAPPKSDVPIITPNEL  63

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
            TEADG +FGFPTRFGMM+AQFK+FLDATGGLW  Q+LAGKPAG+FYSTGSQGGGQETT L
Sbjct  64   TEADGLLFGFPTRFGMMAAQFKSFLDATGGLWNKQSLAGKPAGIFYSTGSQGGGQETTPL  123

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            T+ITQLVHHGMIFVP+GY+FGAGMFEMEKVKGGSPYG+GTYAGDGSRQPS+LEL QAFHQ
Sbjct  124  TSITQLVHHGMIFVPVGYTFGAGMFEMEKVKGGSPYGSGTYAGDGSRQPSELELAQAFHQ  183

Query  267  GKYIAAITKKLK  232
            GKY A I KKLK
Sbjct  184  GKYFAGIAKKLK  195



>ref|XP_008439934.1| PREDICTED: minor allergen Alt a 7-like [Cucumis melo]
Length=202

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHV +LA EI+KGA SVEGVE KL+QVPETL  E+L K+ APPK + 
Sbjct  1    MATKVYIVYYSTYGHVLRLAEEIQKGAASVEGVEVKLWQVPETLPSEVLEKMQAPPKGEA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADG +FGFPTRFGMM AQFKAF+DATG LWRTQ+LAGKPAG+FYST SQG
Sbjct  61   PIITPSELAEADGLLFGFPTRFGMMCAQFKAFMDATGSLWRTQSLAGKPAGIFYSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGM+FVPIGYSFGAGMFEME +KGGSPYGAGT AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMLFVPIGYSFGAGMFEMENIKGGSPYGAGTLAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKY A I KKLK
Sbjct  181  ELQQAFHQGKYFAGIAKKLK  200



>gb|ABK24022.1| unknown [Picea sitchensis]
Length=203

 Score =   311 bits (796),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EIKKGADSVEGVEA L+QVPETLS+++L K++ PPKS+V
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIKKGADSVEGVEATLWQVPETLSEDVLIKMNTPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII P  L +AD  + GFPTR+GMM+AQFKAFLDATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIIEPRQLADADALILGFPTRYGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHG+I+VPIGY+FG GMFEME+VKGGSPYGAGT+AGDG+RQP++L
Sbjct  121  GGQETTPLTAITQLVHHGLIYVPIGYTFGPGMFEMEQVKGGSPYGAGTFAGDGTRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKYI+ I KKLK
Sbjct  181  ELDQAFHQGKYISGIAKKLK  200



>ref|XP_010909517.1| PREDICTED: NAD(P)H dehydrogenase (quinone) FQR1-like isoform 
X1 [Elaeis guineensis]
Length=209

 Score =   310 bits (795),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YS YGHVEKLA EIK+GA +V GVEAK++QVPETL +E+LGK+ APPKSDVPII+PN+L
Sbjct  15   YYSMYGHVEKLAEEIKRGASTVGGVEAKMWQVPETLPEEVLGKMGAPPKSDVPIITPNEL  74

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
             EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG+FYSTGSQGGGQETT L
Sbjct  75   AEADGIIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFYSTGSQGGGQETTPL  134

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            TAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AGDGSR PS+LELEQAFHQ
Sbjct  135  TAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRFPSELELEQAFHQ  194

Query  267  GKYIAAITKKLKSGS  223
            GKY A I KK KS S
Sbjct  195  GKYFAGIVKKFKSSS  209



>ref|XP_006659104.1| PREDICTED: minor allergen Alt a 7-like [Oryza brachyantha]
Length=203

 Score =   310 bits (795),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHV KLA EI+KGA SVEGVE KL+QVPETLSD++L K+ APPK DV
Sbjct  1    MAAKIYIVYYSMYGHVAKLAEEIEKGAASVEGVEVKLWQVPETLSDDVLTKMGAPPKKDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQFKAF+DATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPTELAEADGVIFGFPTRFGMMAAQFKAFMDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVP+GY+FGAGMFEME+VKGG+PYG+GT+AGDGSR  ++L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPVGYTFGAGMFEMEQVKGGTPYGSGTFAGDGSRVATEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQGKY A I KKLK GSA
Sbjct  181  ELQQAFHQGKYFAGIAKKLK-GSA  203



>gb|AFK39740.1| unknown [Medicago truncatula]
Length=204

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YS YGHVEKLA EI KGA SVEGVEAKL+QVPETL  E++GK+  PPKSDVPI
Sbjct  4    TKVYIVYYSMYGHVEKLAEEILKGAASVEGVEAKLWQVPETLPAEVVGKMGGPPKSDVPI  63

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+P+ L EADG + GFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQGGG
Sbjct  64   ITPDALPEADGLLLGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQGGG  123

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQLVHHGMIFVPIGY+FGAGMFEME +KGGSPYG+GT+AGDG+RQP++LEL
Sbjct  124  QETTPLTSITQLVHHGMIFVPIGYTFGAGMFEMENIKGGSPYGSGTFAGDGTRQPTELEL  183

Query  285  EQAFHQGKYIAAITKKLK  232
             QAFHQGKY A I KKLK
Sbjct  184  AQAFHQGKYFAGIAKKLK  201



>ref|XP_004134743.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus]
 ref|XP_004169146.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus]
 gb|KGN49166.1| hypothetical protein Csa_6G516740 [Cucumis sativus]
Length=202

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHV +LA EI+KG  SVEGVE KL+QVPETL  E+L K+ APPK + 
Sbjct  1    MATKVYIVYYSTYGHVLRLAEEIQKGVASVEGVEVKLWQVPETLPSEVLEKMQAPPKGEA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADG +FGFPTRFGMM AQFKAF+DATG LWRTQ+LAGKPAG+FYST SQG
Sbjct  61   PIITPSELAEADGLLFGFPTRFGMMCAQFKAFMDATGSLWRTQSLAGKPAGIFYSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGM+FVPIGYSFGAGMFEME +KGGSPYGAGT AGDGSRQPS+L
Sbjct  121  GGQETTPLTAITQLVHHGMLFVPIGYSFGAGMFEMENIKGGSPYGAGTLAGDGSRQPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAFHQGKY A I KKLK
Sbjct  181  ELQQAFHQGKYFAGIAKKLK  200



>gb|ABD98056.1| quinone-oxidoreductase QR2 [Striga asiatica]
Length=204

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 186/201 (93%), Gaps = 1/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-  655
            MA K+YIV+YSTYGHVE+LA EIKKG +S+  VEAKL+QVPETL+++IL K+ APPK++ 
Sbjct  1    MAAKVYIVYYSTYGHVERLAQEIKKGVESIPEVEAKLWQVPETLTNDILTKMGAPPKNNN  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
            VP+ISPN+L +ADG +FGFPTRFGMM+AQFKAF D+TGGLWRTQALAGKPAG+FYSTGSQ
Sbjct  61   VPVISPNELVDADGIIFGFPTRFGMMAAQFKAFFDSTGGLWRTQALAGKPAGIFYSTGSQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQETT LTA+TQL HHGMIFVPIGY+FGAGMFEM ++KGGSPYGAGT+AGDGSRQPS 
Sbjct  121  GGGQETTPLTALTQLTHHGMIFVPIGYTFGAGMFEMGEIKGGSPYGAGTFAGDGSRQPSG  180

Query  294  LELEQAFHQGKYIAAITKKLK  232
            +ELEQAFHQGK+IAAITKKLK
Sbjct  181  IELEQAFHQGKHIAAITKKLK  201



>ref|XP_008383962.1| PREDICTED: minor allergen Alt a 7-like [Malus domestica]
Length=203

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 181/204 (89%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHV +LA EI KG  SVEGVEAKL+QVPETL  E+LGK+ APPKS+V
Sbjct  1    MATKVYIVYYSMYGHVARLAEEILKGVQSVEGVEAKLWQVPETLPAEVLGKMGAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+ISP +L EADG +FGFPTRFGMM+AQFKAF D+TGGLWRTQALAGKPAG+FYSTGSQG
Sbjct  61   PVISPEELVEADGIIFGFPTRFGMMAAQFKAFFDSTGGLWRTQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LT ITQLVHHGM+FVPIGY+ GAGMFEME+VKGGSPYGAGTYAGDG+RQPS L
Sbjct  121  GGQETTPLTTITQLVHHGMLFVPIGYTSGAGMFEMEQVKGGSPYGAGTYAGDGTRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE A HQGKY A I KKLK GSA
Sbjct  181  ELETASHQGKYFAGIAKKLK-GSA  203



>gb|KHN33624.1| Flavoprotein wrbA [Glycine soja]
Length=207

 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YSTYGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E+L KL APPKSD PII+PN+L
Sbjct  13   YYSTYGHVEKLAREIEKGAASVEGVEAKLWQVPETLPEEVLAKLGAPPKSDAPIITPNEL  72

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
             EADGF+FGFPTRFG M+AQFKAF DATGGLWRTQ+LAGKPAG FYST SQGGGQETT L
Sbjct  73   PEADGFLFGFPTRFGSMAAQFKAFFDATGGLWRTQSLAGKPAGFFYSTSSQGGGQETTPL  132

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            T+ITQLVHHG+IFVPIGY+FG GMFEMEKVKGGSPYGAGTYAGDGSRQPS+LEL QAFHQ
Sbjct  133  TSITQLVHHGLIFVPIGYTFGGGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELAQAFHQ  192

Query  267  GKYIAAITKKLK  232
            GKY A I KKLK
Sbjct  193  GKYFAGIAKKLK  204



>ref|NP_001060966.1| Os08g0139200 [Oryza sativa Japonica Group]
 dbj|BAD03019.1| putative quinone-oxidoreductase QR2 [Oryza sativa Japonica Group]
 dbj|BAF22880.1| Os08g0139200 [Oryza sativa Japonica Group]
 dbj|BAG91898.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82877.1| hypothetical protein OsI_27757 [Oryza sativa Indica Group]
 gb|EEE68017.1| hypothetical protein OsJ_25988 [Oryza sativa Japonica Group]
Length=203

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 183/204 (90%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHV KLA EI+KGA SVEGVE KL+QVPETLSD++L K+ AP K DV
Sbjct  1    MAAKIYIVYYSMYGHVAKLAEEIEKGASSVEGVEVKLWQVPETLSDDVLTKMGAPSKKDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQFKAF+DATGGLWRTQ LAGKPAG+FYSTGSQG
Sbjct  61   PIITPAELAEADGVIFGFPTRFGMMAAQFKAFMDATGGLWRTQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVP+GY+FGAGMFEME+VKGGSPYG+GT+AGDGSR  ++L
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPVGYTFGAGMFEMEQVKGGSPYGSGTFAGDGSRVATEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            EL+QAFHQGKY A I KKLK GSA
Sbjct  181  ELQQAFHQGKYFAGIAKKLK-GSA  203



>ref|XP_001758337.1| predicted protein [Physcomitrella patens]
 gb|EDQ76739.1| predicted protein [Physcomitrella patens]
Length=201

 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGH+E LA EIKKGA+SVEGVEA L+QVPETL +E+LGK+ AP KS+V
Sbjct  1    MAVKVYIVYYSMYGHIETLAKEIKKGAESVEGVEASLYQVPETLPEEVLGKMGAPQKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P ISP DL  ADGF+FGFPTR+GMM+AQFKAFLDATGGLWRTQ+LAGKPAG+F STGSQG
Sbjct  61   PHISPADLPNADGFLFGFPTRYGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFISTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMIFVPIGY+FGAGMFE+ +VKGGSPYGAGT AGDG+RQP++L
Sbjct  121  GGQETTALTAITQLTHHGMIFVPIGYTFGAGMFEINEVKGGSPYGAGTLAGDGTRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAF+QGKY A ITKKLK
Sbjct  181  ELEQAFYQGKYTAEITKKLK  200



>gb|KEH31167.1| NAD(P)H:quinone oxidoreductase, type IV protein [Medicago truncatula]
Length=204

 Score =   308 bits (789),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPI  646
            TK+YIV+YS YGHVEKLA EI KGA SVEGVEAKL+QVPETL  E++GK+  PPKSDVPI
Sbjct  4    TKVYIVYYSMYGHVEKLAEEILKGAASVEGVEAKLWQVPETLPAEVVGKMGGPPKSDVPI  63

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I+P+ L EADG + GFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQGGG
Sbjct  64   ITPDALPEADGLLLGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQGGG  123

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QETT LT+ITQL HHGMIFVPIGY+FGAGMFEME +KGGSPYG+GT+AGDG+RQP++LEL
Sbjct  124  QETTPLTSITQLAHHGMIFVPIGYTFGAGMFEMENIKGGSPYGSGTFAGDGTRQPTELEL  183

Query  285  EQAFHQGKYIAAITKKLK  232
             QAFHQGKY A I KKLK
Sbjct  184  AQAFHQGKYFAGIAKKLK  201



>emb|CAA19721.1| putative protein [Arabidopsis thaliana]
 emb|CAB79582.1| putative protein [Arabidopsis thaliana]
Length=211

 Score =   308 bits (789),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 6/210 (3%)
 Frame = -3

Query  831  MATKLYIVF----YSTYGHVE--KLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSA  670
            MATK+YIV+    +   G ++  KLA EI+KGA SV+GVEA L+QVPETL +++L K+SA
Sbjct  1    MATKVYIVYVKIIFCLSGAIDNLKLAQEIRKGAASVDGVEAILWQVPETLQEDVLSKMSA  60

Query  669  PPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFY  490
            PPKSD PII+PN+L EADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAG+FY
Sbjct  61   PPKSDAPIITPNELAEADGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFY  120

Query  489  stgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGS  310
            STGSQGGGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME VKGGSPYGAGT+AGDGS
Sbjct  121  STGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGS  180

Query  309  RQPSQLELEQAFHQGKYIAAITKKLKSGSA  220
            RQP++LEL QAFHQGKYIAAI+KKLK  +A
Sbjct  181  RQPTELELGQAFHQGKYIAAISKKLKGPAA  210



>ref|XP_001762556.1| predicted protein [Physcomitrella patens]
 gb|EDQ72679.1| predicted protein [Physcomitrella patens]
Length=201

 Score =   307 bits (787),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGH+E LA EIK+GA+SVEGVE  L+QVPETL  E+LGK+ AP KSDV
Sbjct  1    MATKVYIVYYSMYGHIETLAKEIKRGAESVEGVEVTLYQVPETLPAEVLGKMGAPAKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P ISP  L +ADGF+FGFPTRFGMM+AQFKAFLDATGGLWRTQ+LAGKPAG+F+STGSQG
Sbjct  61   PPISPAQLPDADGFLFGFPTRFGMMAAQFKAFLDATGGLWRTQSLAGKPAGIFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGMI+VPIGY+FGAGMFEM +VKGGSPYGAGT AGDG+RQP++L
Sbjct  121  GGQETTALTAITQLTHHGMIYVPIGYTFGAGMFEMNEVKGGSPYGAGTLAGDGTRQPTKL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELEQAFHQGK  A IT+KLK
Sbjct  181  ELEQAFHQGKLTAEITRKLK  200



>gb|KHN19077.1| Flavoprotein wrbA [Glycine soja]
Length=198

 Score =   307 bits (787),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YSTYGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E+L KL APPKSDVPII+PN+L
Sbjct  4    YYSTYGHVEKLAREIEKGAASVEGVEAKLWQVPETLPEEVLAKLGAPPKSDVPIITPNEL  63

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
             EADGF+FGFPTRFG M+AQFKAF DATGGLWRTQALAGK AG FYST SQGGGQETT L
Sbjct  64   PEADGFLFGFPTRFGSMAAQFKAFFDATGGLWRTQALAGKAAGFFYSTSSQGGGQETTPL  123

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            T+ITQLVHHG+IFVPIGY+FG GMFE+EKVKGGSPYGAGTYAGDGSRQPS+LEL QAFHQ
Sbjct  124  TSITQLVHHGLIFVPIGYTFGGGMFELEKVKGGSPYGAGTYAGDGSRQPSELELAQAFHQ  183

Query  267  GKYIAAITKKLK  232
            GKY A I KKLK
Sbjct  184  GKYFAGIAKKLK  195



>emb|CBI18660.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   307 bits (787),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YSTYGHVEKLA EIKKGA+SVEGVE KL+QVPETL +++LG + APPKSDVP+I+P +L
Sbjct  8    YYSTYGHVEKLAQEIKKGAESVEGVEVKLWQVPETLPEDVLGLMGAPPKSDVPVITPAEL  67

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
            +EADGF+FGFPTRFGMM+ QFKAFLDATG LWRTQ LAGKPAGLFYSTGSQGGGQETT L
Sbjct  68   SEADGFIFGFPTRFGMMAGQFKAFLDATGALWRTQQLAGKPAGLFYSTGSQGGGQETTPL  127

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            TAITQLVHHGMIFVPIGY+FGAGMFE+E+VKGGSPYGAGTYAGDGSRQP+++EL QAFHQ
Sbjct  128  TAITQLVHHGMIFVPIGYTFGAGMFEIEQVKGGSPYGAGTYAGDGSRQPTEIELAQAFHQ  187

Query  267  GKYIAAITKKLK  232
            G Y A ITKKLK
Sbjct  188  GMYTAGITKKLK  199



>gb|KHN28607.1| Flavoprotein wrbA [Glycine soja]
Length=193

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 181/203 (89%), Gaps = 10/203 (5%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA ++YIV+YS YGHVE+LA EIKKGADSV           E L +E+LGK+ APPKSDV
Sbjct  1    MAVQVYIVYYSMYGHVERLAEEIKKGADSV----------AEILPEEVLGKMGAPPKSDV  50

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L+EADGFVFGFPTRFGMM+AQFKAF+DATGGLW+TQ LAGKPAG+FYST SQG
Sbjct  51   PIITPNELSEADGFVFGFPTRFGMMAAQFKAFIDATGGLWKTQQLAGKPAGIFYSTSSQG  110

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME++KGGSPYG+GTYAGDGSRQP++L
Sbjct  111  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMEELKGGSPYGSGTYAGDGSRQPTKL  170

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKYIA ITKKLK  +
Sbjct  171  ELEQAFHQGKYIAGITKKLKEAA  193



>ref|XP_003568165.2| PREDICTED: minor allergen Alt a 7-like [Brachypodium distachyon]
Length=252

 Score =   306 bits (785),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 187/223 (84%), Gaps = 6/223 (3%)
 Frame = -3

Query  870  PPFFTHKTIQDP------PMATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVP  709
            PP  +   I DP      PMA K+Y+V+YS YGHV KLA EIKKGA SVEGVE K++QVP
Sbjct  30   PPSSSSDQISDPRSSGAPPMAVKVYVVYYSMYGHVAKLADEIKKGASSVEGVEVKVWQVP  89

Query  708  ETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWR  529
            E LS+E+LGK+ APPK+DVP I+P +L EADG +FGFPTRFGMM++Q KAF DATGGLWR
Sbjct  90   EILSEEVLGKMGAPPKTDVPTITPQELAEADGVLFGFPTRFGMMASQMKAFFDATGGLWR  149

Query  528  TQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGG  349
             Q+LAGKPAG+FYSTG+QGGGQETT LTA+TQL HHGM+FVP+GY+FGA +F+M+KV+GG
Sbjct  150  EQSLAGKPAGVFYSTGTQGGGQETTPLTAVTQLTHHGMVFVPVGYTFGAKLFDMDKVQGG  209

Query  348  SPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLKSGSA  220
            SPYGAGT+AGDGSR P+++ELE AFHQGKY A ITKKLK  SA
Sbjct  210  SPYGAGTFAGDGSRWPTEMELEHAFHQGKYFAGITKKLKGSSA  252



>ref|XP_010052473.1| PREDICTED: minor allergen Alt a 7-like [Eucalyptus grandis]
 gb|KCW76494.1| hypothetical protein EUGRSUZ_D00882 [Eucalyptus grandis]
Length=204

 Score =   305 bits (780),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SD  655
            MA K+YIV+YS YGHVEKLA EIKKGADSVEGVEA L+QVPETL +E+LGK+ APPK SD
Sbjct  1    MAAKVYIVYYSMYGHVEKLAEEIKKGADSVEGVEATLWQVPETLPEEVLGKMGAPPKKSD  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
            VPII+ N+L EADG +FGFPTR+GMM+AQFKAF+D+TGGLW +Q LAGKPAG+F STGSQ
Sbjct  61   VPIITANELAEADGIIFGFPTRYGMMAAQFKAFMDSTGGLWGSQKLAGKPAGIFLSTGSQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQETTALTAITQL HHGMIFVP+GY+FGAGMFEMEKVKGGSPYGAGT+AGDGSR P++
Sbjct  121  GGGQETTALTAITQLTHHGMIFVPVGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRLPTE  180

Query  294  LELEQAFHQGKYIAAITKKLK  232
            LEL  AFHQGKY A I KKLK
Sbjct  181  LELGLAFHQGKYFADIAKKLK  201



>gb|KDO75644.1| hypothetical protein CISIN_1g028847mg [Citrus sinensis]
Length=192

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 1/192 (1%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EI+KGA SVEGVEAKL+QVPETLS+++LGK+ A PKSDVP I+PN+L EAD
Sbjct  2    YGHVEKLAEEIQKGAASVEGVEAKLWQVPETLSEDVLGKMGAGPKSDVPTITPNELAEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            G + GFPTRFGMM+AQFKAFLDATGGLWR+Q LAGKPAG+FYSTGSQGGGQETT LTAIT
Sbjct  62   GILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QLVHHGMIFVPIGY+FGAGM EMEKVKGGSPYGAGT+AGDGSRQPS+LEL QAFHQGKY 
Sbjct  122  QLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYF  181

Query  255  AAITKKLKSGSA  220
            A ITKKLK GSA
Sbjct  182  AGITKKLK-GSA  192



>ref|XP_009405009.1| PREDICTED: minor allergen Alt a 7-like [Musa acuminata subsp. 
malaccensis]
Length=203

 Score =   303 bits (776),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M T++YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E+L K+ APPK + 
Sbjct  1    MVTEIYIVYYSMYGHVEKLAEEIQKGASSVEGVEAKLWQVPETLPEEVLAKMGAPPKGNA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQFKAFLDATGGLWR Q LA KPAG+FYSTG+QG
Sbjct  61   PIITPKELAEADGLLFGFPTRFGMMAAQFKAFLDATGGLWRAQQLASKPAGIFYSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQLVHHGMIFVPIGY+FGA MF+M K+KGGSPYGAGT AGDGSR PS++
Sbjct  121  GGQETTPLTAITQLVHHGMIFVPIGYTFGAKMFDMGKIKGGSPYGAGTLAGDGSRYPSEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGS  223
            ELEQAFHQGKY A I +KLK  S
Sbjct  181  ELEQAFHQGKYFAGIARKLKGSS  203



>emb|CDP09951.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   305 bits (780),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YSTYGHVEKLAHEIKKGADSVEGVEAKL+QVPETLS+EILGKL APPKSDVP+I+P++L
Sbjct  51   YYSTYGHVEKLAHEIKKGADSVEGVEAKLWQVPETLSEEILGKLGAPPKSDVPVITPHEL  110

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
             EAD F+FGFPTRFGMM+AQFKAF+D+TG LW  Q LAGKPAG+FYST SQGGGQETT L
Sbjct  111  PEADAFIFGFPTRFGMMAAQFKAFMDSTGFLWGAQKLAGKPAGIFYSTASQGGGQETTPL  170

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            TA+TQLVHHG+IFVPIGY+ GAGMFE+EKVKGGSPYGAGT+AGDGSRQP++LEL+ AFHQ
Sbjct  171  TAVTQLVHHGLIFVPIGYTAGAGMFEVEKVKGGSPYGAGTFAGDGSRQPTELELQIAFHQ  230

Query  267  GKYIAAITKKLKSGSA  220
            GKYIA I KK K GSA
Sbjct  231  GKYIAGIAKKFK-GSA  245



>ref|XP_006654606.1| PREDICTED: minor allergen Alt a 7-like [Oryza brachyantha]
Length=204

 Score =   302 bits (774),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA SVEGVE KL+QVPETLS+E+LGK+ APP+SD 
Sbjct  1    MAVKVYVVYYSMYGHVAKLAEEIKKGASSVEGVEVKLWQVPETLSEEVLGKMGAPPRSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+ISP +L EADG +FGFPTRFGMM+AQ KAF D TGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PVISPQELAEADGVLFGFPTRFGMMAAQMKAFFDGTGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTA+TQL HHGM+FVP+GY+FGA MF+ME+V GGSPYGAGT+AGDGSR PS++
Sbjct  121  GGQETTPLTAVTQLTHHGMVFVPVGYTFGAKMFDMEQVHGGSPYGAGTFAGDGSRWPSEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK  SA
Sbjct  181  ELEHAFHQGKYFAGIAKKLKGASA  204



>ref|XP_009369578.1| PREDICTED: minor allergen Alt a 7-like [Pyrus x bretschneideri]
Length=203

 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHV KLA EI KGA SVEGVEAKL+QVPETL  EIL K+ APPKS+V
Sbjct  1    MATKIYIVYYSTYGHVAKLAQEILKGAQSVEGVEAKLWQVPETLPAEILAKMGAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+ISP  L EADG +FGFPTRFGMM+AQFKAF DATGGLW   ALAGKPAGLFY TGSQG
Sbjct  61   PVISPEQLAEADGIIFGFPTRFGMMAAQFKAFFDATGGLWHKGALAGKPAGLFYCTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQ  HHGMIFVPIGY+ GAGMFEME+VKGGSPYGAGT+AGDG+RQPS L
Sbjct  121  GGQETTPLTAITQFTHHGMIFVPIGYTAGAGMFEMEQVKGGSPYGAGTFAGDGTRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE A HQGKY A I KKLK GSA
Sbjct  181  ELEIACHQGKYFAGIAKKLK-GSA  203



>ref|XP_010111015.1| Flavoprotein wrbA [Morus notabilis]
 gb|EXC29543.1| Flavoprotein wrbA [Morus notabilis]
Length=192

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHV KLA EI+KGA SVEGVEAKL+QVPETL DE+LGK+ AP KSDVPII+PN+L EAD
Sbjct  2    YGHVAKLAEEIQKGAASVEGVEAKLWQVPETLPDEVLGKMGAPSKSDVPIITPNELAEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            G +FGFPTRFGMM+AQFKAF DATGGLWRTQ LAGKPAG+FYSTGSQGGGQETT LTAIT
Sbjct  62   GLLFGFPTRFGMMAAQFKAFFDATGGLWRTQQLAGKPAGIFYSTGSQGGGQETTPLTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QLVHHG+IFVPIGY+FGAGMFEME +KGGSPYGAGT+AGDG+RQPS+LEL+QAFHQGKY 
Sbjct  122  QLVHHGLIFVPIGYTFGAGMFEMENIKGGSPYGAGTFAGDGTRQPSELELQQAFHQGKYF  181

Query  255  AAITKKLK  232
            A + KKLK
Sbjct  182  AGVAKKLK  189



>dbj|BAJ92406.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS58032.1| Flavoprotein wrbA [Triticum urartu]
Length=204

 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA SVEGVE K++QVPE L++E+LGK+ APPK+DV
Sbjct  1    MAVKVYVVYYSMYGHVAKLADEIKKGASSVEGVEVKVWQVPEILNEEVLGKMGAPPKTDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+ISP +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PVISPQELAEADGVLFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGVFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTA+TQL HHGM+FVP+GY+FGA MF+M+KV+GGSPYGAGT+AGDGSR PS++
Sbjct  121  GGQETTPLTAVTQLTHHGMVFVPVGYTFGAKMFDMDKVQGGSPYGAGTFAGDGSRWPSEM  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK  SA
Sbjct  181  ELEHAFHQGKYFAGIAKKLKGSSA  204



>gb|AFW82422.1| flavoprotein wrbA [Zea mays]
Length=204

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+VFYSTYGHV KLA E+KKGA SVEGVE K++QVPE LS+E+LGK+ APPK+D 
Sbjct  1    MAVKVYVVFYSTYGHVAKLAEEMKKGAASVEGVEVKVWQVPEILSEEVLGKMGAPPKTDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAGLF+STGSQG
Sbjct  61   PVITPQELAEADGVLFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGLFFSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTA+TQL HHGM+FVP+GY+FGA +F+ME V GGSPYGAGT+AGDGSR P++L
Sbjct  121  GGQETTPLTAVTQLTHHGMVFVPVGYTFGAKIFDMESVHGGSPYGAGTFAGDGSRWPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I K+LK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKRLKGGSA  204



>ref|XP_004961598.1| PREDICTED: minor allergen Alt a 7-like [Setaria italica]
Length=204

 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+VFYS YGHV KLA EIKKGA SVEGVE K++QV ETLS+E+LGK+ APPK+D 
Sbjct  1    MAVKVYVVFYSMYGHVSKLAEEIKKGAASVEGVEVKIWQVSETLSEEVLGKMGAPPKTDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PIITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTA+TQL HHGM+FVP+GY+FGA MF ME V+GGSPYGAGT+AGDGSR P+++
Sbjct  121  GGQETTPLTAVTQLTHHGMVFVPVGYTFGAKMFGMESVQGGSPYGAGTFAGDGSRWPTEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I K+LK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKRLKGGSA  204



>ref|XP_004248390.1| PREDICTED: minor allergen Alt a 7-like [Solanum lycopersicum]
Length=204

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MAT L+IV+YS YGHVEKLA E++KGA S+EGVE KL+QV ETL  EIL K+ APPK + 
Sbjct  1    MATILFIVYYSMYGHVEKLAREMQKGAASIEGVEVKLWQVAETLPAEILAKMGAPPKGNA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P+DL EADGF FGFPTRFGMM AQFKAF DATG +W+ Q LAGKPAG+FYSTGSQG
Sbjct  61   PIIAPDDLVEADGFAFGFPTRFGMMPAQFKAFFDATGAIWKNQQLAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQLVHHGMIFVPIGY+FG  MF+ME +KGGSPYGAGT+AGDGS+QP+++
Sbjct  121  GGQETTALTAITQLVHHGMIFVPIGYTFGVDMFDMEDIKGGSPYGAGTFAGDGSKQPTEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELEQA++QG+YIA ITKKLK  SA
Sbjct  181  ELEQAYYQGQYIATITKKLKGSSA  204



>ref|XP_008371222.1| PREDICTED: minor allergen Alt a 7-like [Malus domestica]
Length=203

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YSTYGHV KLA EI KGA SVEGVEAKL+QVPETL  E+L K+ APPKS+V
Sbjct  1    MATKIYIVYYSTYGHVAKLAQEILKGAQSVEGVEAKLWQVPETLPAEVLAKMGAPPKSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+ISP  L EADG +FGFPTRFGMM+AQFKAF D+TG LW   ALAGKPAGLFY TGSQG
Sbjct  61   PVISPEQLAEADGIIFGFPTRFGMMAAQFKAFFDSTGSLWHKGALAGKPAGLFYCTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQ  HHGMIFVPIGY+ GAGMFEME+VKGGSPYGAGT+AGDG+RQPS L
Sbjct  121  GGQETTPLTAITQFTHHGMIFVPIGYTAGAGMFEMEQVKGGSPYGAGTFAGDGTRQPSDL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE A HQGKY A I KKLK GSA
Sbjct  181  ELEIACHQGKYFAGIAKKLK-GSA  203



>ref|NP_001055969.1| Os05g0501300 [Oryza sativa Japonica Group]
 gb|AAU90228.1| putative 1,4-benzoquinone reductase [Oryza sativa Japonica Group]
 dbj|BAF17883.1| Os05g0501300 [Oryza sativa Japonica Group]
 gb|EAY98593.1| hypothetical protein OsI_20508 [Oryza sativa Indica Group]
 dbj|BAG87193.1| unnamed protein product [Oryza sativa Japonica Group]
Length=205

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA SVEGVE K++QVPETLS+E+LGK+ APP+SD 
Sbjct  1    MAVKVYVVYYSMYGHVAKLAEEIKKGASSVEGVEVKIWQVPETLSEEVLGKMGAPPRSDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PVIAPQELAEADGVLFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGVFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTA+TQL HHGM+FVP+GY+FGA MF+M  V GGSPYGAGT+AGDGSR PS+ 
Sbjct  121  GGQETTPLTAVTQLAHHGMVFVPVGYTFGAKMFDMAAVHGGSPYGAGTFAGDGSRWPSEA  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK  S+
Sbjct  181  ELEHAFHQGKYFAGIAKKLKGASS  204



>emb|CAN63722.1| hypothetical protein VITISV_002080 [Vitis vinifera]
Length=223

 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 181/221 (82%), Gaps = 22/221 (10%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQ---------------------  715
            MA KLYIV+YSTYGHVEKLA EIKKGA+SVEGVE KL+Q                     
Sbjct  1    MAAKLYIVYYSTYGHVEKLAQEIKKGAESVEGVEVKLWQELXMPSFQXLDTTAIFMTXKY  60

Query  714  VPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGL  535
            +  +L D +LG + APPKSDVP+I+P +L+EADGF+FGFPTRFGMM+ QFKAFLDATG L
Sbjct  61   LKHSLKD-VLGLMGAPPKSDVPVITPAELSEADGFIFGFPTRFGMMAGQFKAFLDATGAL  119

Query  534  WRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVK  355
            WRTQ LAGKPAGLFYSTGSQGGGQETT LTAITQLVHHGMIFVPIGY+FGAGMFE E+VK
Sbjct  120  WRTQQLAGKPAGLFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEXEQVK  179

Query  354  GGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLK  232
            GGSPYGAGTYAGDGSRQP+++EL QAFHQG Y A ITKKLK
Sbjct  180  GGSPYGAGTYAGDGSRQPTEIELAQAFHQGMYTAGITKKLK  220



>ref|XP_010232442.1| PREDICTED: minor allergen Alt a 7-like [Brachypodium distachyon]
Length=203

 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EI+KG  SVEGVEAK++QVPETL++E+LGK+ APPK DV
Sbjct  1    MAVKVYVVYYSMYGHVAKLAEEIQKGVSSVEGVEAKIWQVPETLTEEVLGKMGAPPKPDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PIITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALT +TQL HHGM+FVP+GY+FGA +F+M+KV+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGQETTALTTVTQLTHHGMVFVPVGYTFGAKLFDMDKVQGGSPYGAGTFASDGSRWPSEM  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            ELE AFHQGKY A I KKLK
Sbjct  181  ELEHAFHQGKYFAGIAKKLK  200



>gb|EMT27724.1| Flavoprotein wrbA [Aegilops tauschii]
Length=203

 Score =   295 bits (755),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 180/204 (88%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA SVEGVEAK++QVPETL +E+LGK+ APPK D 
Sbjct  1    MAVKVYVVYYSMYGHVAKLADEIKKGATSVEGVEAKIWQVPETLPEEVLGKMGAPPKLDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PIITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALT +TQL HHGM+FVP+GY+FGA +F+M+KV+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGQETTALTTVTQLTHHGMVFVPVGYTFGAKLFDMDKVQGGSPYGAGTFAADGSRWPSEM  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQG+Y A+I KKLK GSA
Sbjct  181  ELEHAFHQGQYFASIAKKLK-GSA  203



>gb|AAW78582.1| quinone reductase 2 [Triticum monococcum]
 emb|CDM84515.1| unnamed protein product [Triticum aestivum]
Length=203

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKG  SVEGVEAK++QVPETL +E+LGK+ APPK D 
Sbjct  1    MAVKVYVVYYSMYGHVAKLADEIKKGVSSVEGVEAKIWQVPETLPEEVLGKMGAPPKLDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PIITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALT +TQL HHGM+FVP+GY+FGA +F+M+KV+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGQETTALTTVTQLTHHGMVFVPVGYTFGAKLFDMDKVQGGSPYGAGTFAADGSRWPSEM  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQG+Y A+I KKLK GSA
Sbjct  181  ELEHAFHQGQYFASIAKKLK-GSA  203



>gb|EAY76084.1| hypothetical protein OsI_04011 [Oryza sativa Indica Group]
Length=203

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA S+EGVEAK++QVPETL +E+LGK+ APPK DV
Sbjct  1    MAVKVYVVYYSMYGHVAKLAEEIKKGASSIEGVEAKIWQVPETLHEEVLGKMGAPPKPDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+P +LTEADG +FGFPTRFGMM+AQ KAF DATGGLW  Q+LAGKPAG+F+STG+QG
Sbjct  61   PTITPQELTEADGILFGFPTRFGMMAAQMKAFFDATGGLWSEQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGM+FVP+GY+FGA MF M++V+GGSPYGAGT+A DGSR P+++
Sbjct  121  GGQETTPLTAITQLTHHGMVFVPVGYTFGAKMFNMDEVQGGSPYGAGTFAADGSRWPTEM  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKKLK-GSA  203



>gb|ACF86423.1| unknown [Zea mays]
 gb|AFW84879.1| minor allergen Alt a 7 [Zea mays]
Length=203

 Score =   293 bits (750),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EI+KGA SVEGVEAK +QVPETL +E+LGK+ APPK DV
Sbjct  1    MAVKVYVVYYSMYGHVGKLAEEIQKGASSVEGVEAKTWQVPETLPEEVLGKMGAPPKPDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+ TGSQG
Sbjct  61   PVITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGVFFCTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALTAITQL HHGM+FVP+GY+FGA +F M++V+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGQETTALTAITQLTHHGMVFVPVGYTFGAKLFGMDQVQGGSPYGAGTFAADGSRWPSEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKKLK-GSA  203



>gb|KEH31166.1| NAD(P)H:quinone oxidoreductase, type IV protein [Medicago truncatula]
Length=192

 Score =   292 bits (748),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHVEKLA EI KGA SVEGVEAKL+QVPETL  E++GK+  PPKSDVPII+P+ L EAD
Sbjct  2    YGHVEKLAEEILKGAASVEGVEAKLWQVPETLPAEVVGKMGGPPKSDVPIITPDALPEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            G + GFPTRFGMM+AQFKAFLDATGGLWRTQALAGKPAG+FYSTGSQGGGQETT LT+IT
Sbjct  62   GLLLGFPTRFGMMAAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQGGGQETTPLTSIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QL HHGMIFVPIGY+FGAGMFEME +KGGSPYG+GT+AGDG+RQP++LEL QAFHQGKY 
Sbjct  122  QLAHHGMIFVPIGYTFGAGMFEMENIKGGSPYGSGTFAGDGTRQPTELELAQAFHQGKYF  181

Query  255  AAITKKLK  232
            A I KKLK
Sbjct  182  AGIAKKLK  189



>ref|XP_003543098.1| PREDICTED: flavoprotein wrbA-like [Glycine max]
Length=202

 Score =   293 bits (749),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-  655
            M TK+YIV+YSTYGH+EKLA EI+KGA SVEGVEAKL+QVPETLS+E+L K  APPKSD 
Sbjct  1    MVTKVYIVYYSTYGHIEKLAREIEKGAASVEGVEAKLWQVPETLSEEVLVKKGAPPKSDD  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
            VPII P +L +ADGF+FGFPT FG M++QFKAFL+ T GLW TQALAGKPAG F ST SQ
Sbjct  61   VPIIKPRELADADGFLFGFPTTFGTMASQFKAFLEGTIGLWHTQALAGKPAGFFSSTSSQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQE T LT++TQLVHHGMIFVP+GY+FG GM+EMEKVKGGSPYG+GT  GDGSRQPS 
Sbjct  121  GGGQEETPLTSVTQLVHHGMIFVPVGYTFGDGMYEMEKVKGGSPYGSGTVVGDGSRQPSD  180

Query  294  LELEQAFHQGKYIAAITKKLK  232
            LEL QAFHQGKY AAI KKLK
Sbjct  181  LELAQAFHQGKYFAAIAKKLK  201



>ref|XP_004485678.1| PREDICTED: flavoprotein WrbA-like [Cicer arietinum]
Length=203

 Score =   293 bits (749),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV++S YGHVEKLA EIKKGA SVEGVEAKL+QVPETLS+ +L K+ APP+SDV
Sbjct  1    MATKVYIVYHSMYGHVEKLAEEIKKGATSVEGVEAKLWQVPETLSEVVLRKMKAPPRSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P ISP +L EADG +FGFP+RFGMMSAQFKAF+DATGGLW  QALAGKPAG F+ST SQG
Sbjct  61   PDISPKELPEADGLLFGFPSRFGMMSAQFKAFMDATGGLWNKQALAGKPAGFFFSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
             GQE T  T+ITQLVHHGMIFVPIGY+FG GM+EMEKVKGGSPYGAGT+   G  +P++L
Sbjct  121  SGQEETPFTSITQLVHHGMIFVPIGYTFGDGMYEMEKVKGGSPYGAGTFGDHGVGEPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KKLK
Sbjct  181  ELAQAFHQGKYFAGIAKKLK  200



>ref|NP_001149575.1| LOC100283201 [Zea mays]
 gb|ACG35914.1| minor allergen Alt a 7 [Zea mays]
 gb|ACN29092.1| unknown [Zea mays]
 tpg|DAA57330.1| TPA: minor allergen Alt a 7 [Zea mays]
Length=203

 Score =   292 bits (748),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA SVEGVEAK++QVPE LS+E+LGK+ APPK DV
Sbjct  1    MAVKIYVVYYSMYGHVGKLAEEIKKGALSVEGVEAKIWQVPEILSEEVLGKMGAPPKPDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PVITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGMFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGM+FVP+GY+FGA +F M++V+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGQETTPLTAITQLTHHGMVFVPVGYTFGAKLFGMDQVQGGSPYGAGTFAADGSRWPSEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKKLK-GSA  203



>ref|XP_004972886.1| PREDICTED: minor allergen Alt a 7-like [Setaria italica]
Length=205

 Score =   292 bits (748),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPP-KSD  655
            MATK+YIV+YSTYGHV  LA EIKKGA SV+GVE KL+QVPETLS E L K+SAPP + D
Sbjct  1    MATKIYIVYYSTYGHVATLAEEIKKGAASVDGVEVKLWQVPETLSGEALAKMSAPPMRED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
            VP+I+P +L +ADG +FGFPTRFGM+ AQFKAF+D T  LW  Q LAGKPAG+F STG Q
Sbjct  61   VPVITPAELVDADGLLFGFPTRFGMLPAQFKAFMDGTSDLWCEQRLAGKPAGIFCSTGCQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQETTALTAITQLVHHGMIFVP+GY+FGAGMFEM +VKGGSPYGAGT AGDGSR P+Q
Sbjct  121  GGGQETTALTAITQLVHHGMIFVPVGYTFGAGMFEMGEVKGGSPYGAGTVAGDGSRVPTQ  180

Query  294  LELEQAFHQGKYIAAITKKLKSGSA  220
            LEL+QAFHQGKY A I KKLK  SA
Sbjct  181  LELQQAFHQGKYFAGIAKKLKGSSA  205



>ref|NP_001044464.1| Os01g0784800 [Oryza sativa Japonica Group]
 dbj|BAB92583.1| putative quinone-oxidoreductase QR2 [Oryza sativa Japonica Group]
 dbj|BAF06378.1| Os01g0784800 [Oryza sativa Japonica Group]
 gb|EAZ13780.1| hypothetical protein OsJ_03705 [Oryza sativa Japonica Group]
 dbj|BAG96805.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87148.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACU78066.1| putative quinone-oxidoreductase [Oryza sativa Japonica Group]
Length=203

 Score =   292 bits (748),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA S+EGVEAK++QVPETL +E+LGK+ APPK DV
Sbjct  1    MAVKVYVVYYSMYGHVAKLAEEIKKGASSIEGVEAKIWQVPETLHEEVLGKMGAPPKPDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+P +LTEADG +FGFPTRFGMM+AQ KAF DATGGLW  Q+LAGKPAG+F+STG+QG
Sbjct  61   PTITPQELTEADGILFGFPTRFGMMAAQMKAFFDATGGLWSEQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGM+FVP+GY+FGA MF M +V+GGSPYGAGT+A DGSR P+++
Sbjct  121  GGQETTPLTAITQLTHHGMVFVPVGYTFGAKMFNMGEVQGGSPYGAGTFAADGSRWPTEM  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKKLK-GSA  203



>dbj|BAJ99599.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=203

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKG  SVEGVEAK++QVPETL +E+LGK+ APPK D 
Sbjct  1    MAVKVYVVYYSMYGHVAKLADEIKKGVSSVEGVEAKIWQVPETLPEEVLGKMGAPPKLDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P +L +ADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PIITPQELADADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETTALT +TQL HHGM+FVP+GY+FGA +F+M+KV+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGQETTALTTVTQLTHHGMVFVPVGYTFGAKLFDMDKVQGGSPYGAGTFAADGSRWPSEM  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQG+Y A I KKLK GSA
Sbjct  181  ELEHAFHQGQYFAGIAKKLK-GSA  203



>gb|ACV52589.1| benzoquinone reductase [Nicotiana benthamiana]
Length=175

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  789  HVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEADGF  610
            HVEKLA EIKKGA SVEGVEAKL+QVPETLS+E+LGK+ AP K D PII+PNDL EADGF
Sbjct  1    HVEKLAQEIKKGAASVEGVEAKLWQVPETLSEEVLGKMGAPAKGDAPIITPNDLAEADGF  60

Query  609  VFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAITQL  430
            +FGFPTRFGMM+AQFKAFLDATGGLWRTQ LAGKPAGLFYSTGSQGGGQETT LTAITQL
Sbjct  61   LFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGLFYSTGSQGGGQETTPLTAITQL  120

Query  429  VHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQG  265
            VHHGMIFVPIGY+FG GMFEME +KGGSPYG+GTYAGDGSRQP++LE+EQAFHQG
Sbjct  121  VHHGMIFVPIGYTFGGGMFEMENIKGGSPYGSGTYAGDGSRQPTELEMEQAFHQG  175



>ref|XP_006644813.1| PREDICTED: minor allergen Alt a 7-like isoform X1 [Oryza brachyantha]
Length=203

 Score =   290 bits (742),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EIKKGA SVEGVEAK++QVPE L +E+LGK+ APPK D 
Sbjct  1    MAVKVYVVYYSMYGHVAKLAEEIKKGASSVEGVEAKIWQVPEILPEEVLGKMGAPPKLDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P I+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PTITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGM+FVP+GY+FGA MF M++V+GGSPYGAGT+A DGSR P+++
Sbjct  121  GGQETTPLTAITQLTHHGMVFVPVGYTFGAKMFNMDEVQGGSPYGAGTFAADGSRWPTEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKKLK-GSA  203



>ref|NP_001151729.1| LOC100285365 [Zea mays]
 gb|ACG44157.1| minor allergen Alt a 7 [Zea mays]
Length=203

 Score =   290 bits (741),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA EI+KGA SVEGVEAK + VPETL +E+LGK+ APPK DV
Sbjct  1    MAVKVYVVYYSMYGHVGKLAEEIQKGASSVEGVEAKTWLVPETLPEEVLGKMGAPPKPDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+ TGSQG
Sbjct  61   PVITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGVFFCTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GG ETTALTAITQL HHGM+FVP+GY+FGA +F M++V+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGHETTALTAITQLTHHGMVFVPVGYTFGAKLFGMDQVQGGSPYGAGTFAADGSRWPSEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE AFHQGKY A I KKLK GSA
Sbjct  181  ELEHAFHQGKYFAGIAKKLK-GSA  203



>gb|ABK23874.1| unknown [Picea sitchensis]
Length=203

 Score =   288 bits (736),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YSTYGHVE +A EI +GA S+EGVEA L+QVPETL D++L K+ APP+ +V
Sbjct  1    MAVKLYIVYYSTYGHVETMAQEIYRGASSLEGVEATLWQVPETLPDKVLEKMQAPPRKEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P  L EADGF+FGFP+RFGMM+AQFKAF D+   +WR+Q LAGKPAG+F+STG  G
Sbjct  61   PIITPEQLVEADGFIFGFPSRFGMMAAQFKAFFDSADDVWRSQKLAGKPAGIFWSTGFHG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQE TALTAITQL HHG++FVP+GY+F A MFE+ +VKGGS YG+GTYAGDGSRQP+ L
Sbjct  121  GGQENTALTAITQLAHHGIVFVPMGYTFEADMFEVNEVKGGSTYGSGTYAGDGSRQPTSL  180

Query  291  ELEQAFHQGKYIAAITKKLKS  229
            ELE+AF+QGKYIA+ITKKLKS
Sbjct  181  ELEKAFYQGKYIASITKKLKS  201



>ref|XP_006582217.1| PREDICTED: minor allergen Alt a 7-like [Glycine max]
Length=214

 Score =   285 bits (730),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M  K+YIV+YS YGHVE LA EI +GA+SVEGVEAKL+Q+PETL  E L +L APPKSDV
Sbjct  1    MPAKVYIVYYSMYGHVETLAREILRGANSVEGVEAKLWQIPETLPPEELVRLRAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P  L  ADGFVFGFPTR GMM+AQFKAFLD+T  LW+ Q LA KPAG+FYST  QG
Sbjct  61   PIINPFKLPVADGFVFGFPTRLGMMAAQFKAFLDSTQYLWKAQMLACKPAGIFYSTSCQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
             GQET   TAITQLVHHGMIFVPIGY+FG GMFEM++ KGGSPYGAGTY GDGSRQP++L
Sbjct  121  VGQETAPFTAITQLVHHGMIFVPIGYTFGPGMFEMKEPKGGSPYGAGTYTGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA*LISFNSIYTLH  184
            EL+QAFHQG +IA I KK K  +      + I+TLH
Sbjct  181  ELQQAFHQGNHIATIIKKFKEDA------HPIFTLH  210



>ref|XP_003526150.1| PREDICTED: minor allergen Alt a 7-like [Glycine max]
Length=214

 Score =   285 bits (730),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M  K+YIV+YS YGHVE LA EI +GA+SVEGVEAKL+Q+PETL  E L +L APPKSDV
Sbjct  1    MPAKVYIVYYSMYGHVEALAREILRGANSVEGVEAKLWQIPETLPPEELVRLRAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P  L  ADGFVFGFPTR GMM+AQFKAFLD+T  LW+ Q LA KPAG+FYST  QG
Sbjct  61   PIINPFKLPVADGFVFGFPTRLGMMAAQFKAFLDSTQYLWKAQMLACKPAGIFYSTSCQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
             GQET   TAITQLVHHGMIFVPIGY+FG GMFEM++ KGGSPYGAGTY GDGSRQP++L
Sbjct  121  VGQETAPFTAITQLVHHGMIFVPIGYTFGPGMFEMKEPKGGSPYGAGTYTGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA*LISFNSIYTLH  184
            EL+QAFHQG +IA I KK K  +      + I+TLH
Sbjct  181  ELQQAFHQGNHIATIIKKFKEDA------HPIFTLH  210



>gb|KDP46513.1| hypothetical protein JCGZ_08485 [Jatropha curcas]
Length=203

 Score =   285 bits (729),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIV+YS YGHVE +A E+++GA+SV+GVEA L+QVPETLS+ I+ K+ APPK+D VP
Sbjct  4    TKIYIVYYSLYGHVETMAREVQRGANSVQGVEATLWQVPETLSNVIMQKVKAPPKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
            +I P  L EADGF+FGFP+RFG+M+AQFKAF DATG LW +QALAGKPAG+F+STG  GG
Sbjct  64   VIQPEQLLEADGFLFGFPSRFGVMAAQFKAFFDATGELWASQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTAITQL HHGM+FVP+GY+FG+GMFEM +VKGGS YGAGTYA DG+RQP++LE
Sbjct  124  GQELTALTAITQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTYAADGTRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L QAFHQG+Y+A I KKLK
Sbjct  184  LSQAFHQGRYVAEIAKKLK  202



>ref|XP_004970204.1| PREDICTED: minor allergen Alt a 7-like [Setaria italica]
Length=203

 Score =   285 bits (728),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+Y+V+YS YGHV KLA +IK GA SVEGVE K++ VPETLS+E+LGK+ APPK D+
Sbjct  1    MAVKVYVVYYSMYGHVGKLAEQIKIGASSVEGVEVKIWMVPETLSEEVLGKMGAPPKPDL  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P+I+P +L EADG +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QG
Sbjct  61   PVITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQETT LTAITQL HHGM+FVP+GY+FGA +F M++V+GGSPYGAGT+A DGSR PS++
Sbjct  121  GGQETTPLTAITQLTHHGMVFVPVGYTFGAKLFGMDQVQGGSPYGAGTFAADGSRWPSEV  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA  220
            ELE A HQGKY A I KKLK GSA
Sbjct  181  ELEHALHQGKYFAGIAKKLK-GSA  203



>ref|XP_002525624.1| Flavoprotein wrbA, putative [Ricinus communis]
 gb|EEF36742.1| Flavoprotein wrbA, putative [Ricinus communis]
Length=203

 Score =   284 bits (727),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 175/199 (88%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIV+YS YGHVE +A E+++GA+SV+GVEA ++QVPETLS+ I+ K+ APPK+D VP
Sbjct  4    TKVYIVYYSLYGHVETMAREVQRGANSVQGVEATIWQVPETLSNLIVEKMKAPPKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
            +I P  L EADGF+FGFP+RFG+M+AQFKAF DATG LW +QALAGKPAG+F+STG  GG
Sbjct  64   VIQPEQLLEADGFIFGFPSRFGVMAAQFKAFFDATGELWASQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTAITQL HHGM+FVP+GY+FG+GMFEM +VKGGS YGAGTYA DG+R+P++LE
Sbjct  124  GQELTALTAITQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTYAADGTREPTELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAFHQGKY+A I KKLK
Sbjct  184  LQQAFHQGKYVAEIAKKLK  202



>gb|EMT26661.1| Flavoprotein wrbA [Aegilops tauschii]
Length=204

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 170/201 (85%), Gaps = 1/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SD  655
            MA K+YIV+YSTYGHV KLA EI+KG  SV+GV+ KL+QVPETLSDE L K+ APPK  D
Sbjct  1    MAAKIYIVYYSTYGHVAKLADEIQKGVSSVQGVDVKLWQVPETLSDEALAKMGAPPKRDD  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
            VP+ISP +L +ADG +FGFPTRFGMM  QFKAF+D T  LW  Q LAGKPA LF+S+G Q
Sbjct  61   VPVISPAELADADGLIFGFPTRFGMMPTQFKAFMDGTSELWCPQRLAGKPAALFFSSGCQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQETTALTAITQLVHHGM+FVP+GY+FGAGMFEM +VKGGSPYG GT AGDGSR P++
Sbjct  121  GGGQETTALTAITQLVHHGMLFVPVGYTFGAGMFEMGQVKGGSPYGCGTIAGDGSRVPTE  180

Query  294  LELEQAFHQGKYIAAITKKLK  232
            LEL+QAFHQGKY A I KKLK
Sbjct  181  LELQQAFHQGKYFAGIAKKLK  201



>ref|XP_007148279.1| hypothetical protein PHAVU_006G1949000g, partial [Phaseolus vulgaris]
 gb|ESW20273.1| hypothetical protein PHAVU_006G1949000g, partial [Phaseolus vulgaris]
Length=196

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 1/193 (1%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            +YST+GHVEKLA EI+KGA SVEGVEAKL+QVPETLS+E+L K+ +PPKSDVPII P +L
Sbjct  1    YYSTHGHVEKLAKEIEKGAASVEGVEAKLWQVPETLSEEVLRKIGSPPKSDVPIIKPREL  60

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
             EADGF+FGFPT +G M+AQFK F DAT  LWRTQAL GKPAG F+S+ SQGGGQETTAL
Sbjct  61   VEADGFLFGFPTTYGAMAAQFKTFFDATVSLWRTQALTGKPAGFFFSSSSQGGGQETTAL  120

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPSQLELEQAFH  271
            T+ITQLVHHGMIFVP+GY+FG  MFEME +KGGSPYGAGTYAG D SRQPS+LEL QAFH
Sbjct  121  TSITQLVHHGMIFVPVGYTFGDAMFEMENLKGGSPYGAGTYAGDDNSRQPSELELAQAFH  180

Query  270  QGKYIAAITKKLK  232
            QGKY A I KKLK
Sbjct  181  QGKYFAGIAKKLK  193



>ref|XP_011082387.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
3 isoform X1 [Sesamum indicum]
Length=246

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIV+YS YGHVE +A EI+KGA+SV GVEA L+QVPETL D +L K+ AP K+D VP
Sbjct  47   TKVYIVYYSLYGHVENMAREIQKGANSVPGVEALLWQVPETLPDRVLEKMKAPEKADDVP  106

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQFKAF DAT  +W TQALAGKPAG+F+STG  GG
Sbjct  107  EIRPEQLVEADGFIFGFPSRFGVMAAQFKAFFDATYEIWATQALAGKPAGIFWSTGFHGG  166

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTAITQL HHGMIFVP+GY+FG GMFEME+VKGGS YGAGTYA DGSR+P++LE
Sbjct  167  GQELTALTAITQLAHHGMIFVPLGYTFGNGMFEMEQVKGGSSYGAGTYAADGSREPTELE  226

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAFHQGKY+A IT+KLK+
Sbjct  227  LQQAFHQGKYVAEITRKLKT  246



>ref|XP_011082388.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
3 isoform X2 [Sesamum indicum]
 ref|XP_011082389.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
3 isoform X2 [Sesamum indicum]
 ref|XP_011082390.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
3 isoform X2 [Sesamum indicum]
 ref|XP_011082391.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
3 isoform X2 [Sesamum indicum]
Length=203

 Score =   282 bits (722),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIV+YS YGHVE +A EI+KGA+SV GVEA L+QVPETL D +L K+ AP K+D VP
Sbjct  4    TKVYIVYYSLYGHVENMAREIQKGANSVPGVEALLWQVPETLPDRVLEKMKAPEKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQFKAF DAT  +W TQALAGKPAG+F+STG  GG
Sbjct  64   EIRPEQLVEADGFIFGFPSRFGVMAAQFKAFFDATYEIWATQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTAITQL HHGMIFVP+GY+FG GMFEME+VKGGS YGAGTYA DGSR+P++LE
Sbjct  124  GQELTALTAITQLAHHGMIFVPLGYTFGNGMFEMEQVKGGSSYGAGTYAADGSREPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAFHQGKY+A IT+KLK+
Sbjct  184  LQQAFHQGKYVAEITRKLKT  203



>ref|XP_003526149.1| PREDICTED: minor allergen Alt a 7-like [Glycine max]
Length=214

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M  K+YIV+YS YGH E LA EI +GA+SVEGVEAKL+Q+PETL  E L +L APPKSDV
Sbjct  1    MPAKVYIVYYSMYGHAETLAREILRGANSVEGVEAKLWQIPETLPPEELVRLRAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P  L  ADGFVFGFPTR G+M+AQFKAFLD+T  LW+ Q LA KPAG+FYST  QG
Sbjct  61   PIINPFKLPVADGFVFGFPTRLGIMAAQFKAFLDSTQYLWKAQMLACKPAGIFYSTSCQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
             GQET   TAITQLVHHGMIFVPIGY+FG GMFEM++ KGGSPYGAGTY GDGSRQP++L
Sbjct  121  VGQETAPFTAITQLVHHGMIFVPIGYTFGPGMFEMKEPKGGSPYGAGTYIGDGSRQPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA*LISFNSIYTLH  184
            EL+QAFHQG +IA I KK K  +      + I+TLH
Sbjct  181  ELQQAFHQGNHIATIIKKFKEDA------HPIFTLH  210



>gb|EYU45736.1| hypothetical protein MIMGU_mgv1a013995mg [Erythranthe guttata]
Length=203

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YI++YS YGHVE +A EI++GA+SV  VEA L+Q+PETL   IL K+ AP K+D V 
Sbjct  4    TKVYIIYYSLYGHVENMAREIQRGANSVPDVEATLWQIPETLPSRILEKMKAPEKADDVA  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQ KAF DATGG+W TQALAGKPAG+F+STG  GG
Sbjct  64   EIRPEQLLEADGFIFGFPSRFGVMAAQCKAFFDATGGIWATQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTAITQL HHGMI+VP+GY+FG+GM+EME+VKGGSPYGAGTYA DGSRQP+QLE
Sbjct  124  GQELTALTAITQLAHHGMIYVPLGYTFGSGMYEMEQVKGGSPYGAGTYAADGSRQPTQLE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAFHQGKY+A ITKKLK
Sbjct  184  LDQAFHQGKYVAQITKKLK  202



>gb|AAO12869.1| putative quinone reductase, partial [Vitis vinifera]
Length=166

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  720  FQVPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATG  541
            +QVPETL +E+LGK+SAPPKSD PII+P DL EADGFVFGFPTRFGMM+AQFKAFLDATG
Sbjct  1    WQVPETLPEEVLGKMSAPPKSDTPIITPTDLAEADGFVFGFPTRFGMMAAQFKAFLDATG  60

Query  540  GLWRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEK  361
            GLWRTQ LAGKPAG+FYSTGSQGGGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEK
Sbjct  61   GLWRTQQLAGKPAGIFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEK  120

Query  360  VKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLKSGS  223
            VKGGSPYGAGT+AGDGSRQPS+LELEQAFHQGKYIA ITKKLK  +
Sbjct  121  VKGGSPYGAGTFAGDGSRQPSELELEQAFHQGKYIAGITKKLKEAA  166



>ref|XP_006425049.1| hypothetical protein CICLE_v10029300mg [Citrus clementina]
 gb|ESR38289.1| hypothetical protein CICLE_v10029300mg [Citrus clementina]
 gb|KDO66853.1| hypothetical protein CISIN_1g028917mg [Citrus sinensis]
Length=202

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 173/201 (86%), Gaps = 1/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKS-D  655
            MATK+YIV+YS YGHVE +A E+++GA+SV GVEA L+QVPETLS  IL K+ APPK+ D
Sbjct  1    MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTND  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
            VP+I P+ L EADGF+FGFP+RFG+M+AQ KAF DAT  LW +QALAGKPAG+F+STG  
Sbjct  61   VPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFH  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQE TALTA+TQL HHGM+FVP+GY+FG+GMFEM +VKGGS YGAGT+A DGSRQP+ 
Sbjct  121  GGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSSYGAGTFAADGSRQPTD  180

Query  294  LELEQAFHQGKYIAAITKKLK  232
            LEL+QAFHQGKY+A I KKLK
Sbjct  181  LELQQAFHQGKYVAEIAKKLK  201



>ref|XP_001783083.1| predicted protein [Physcomitrella patens]
 gb|EDQ52086.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 173/201 (86%), Gaps = 1/201 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKS-DVP  649
            TKLYIV+YS YGHV K+A EIKKGA +V+GVEA LFQVPETL  E+L K+ AP K+ + P
Sbjct  4    TKLYIVYYSMYGHVAKMAEEIKKGASTVDGVEASLFQVPETLPPEVLHKMGAPAKNAEHP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
            II    LTEADGF+FGFPTR+GMM AQFK F+DATGGLWRTQALAGKPAGLF STG+QGG
Sbjct  64   IIPIAQLTEADGFLFGFPTRYGMMCAQFKTFMDATGGLWRTQALAGKPAGLFVSTGTQGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQET+ALTAITQL HHGMIFVP GY+ G+GMF + + KGGS YG+GT+AGDG+RQPS+LE
Sbjct  124  GQETSALTAITQLAHHGMIFVPTGYTGGSGMFNLAEPKGGSAYGSGTFAGDGTRQPSKLE  183

Query  288  LEQAFHQGKYIAAITKKLKSG  226
            LEQAFHQGKY+A++ KKLK G
Sbjct  184  LEQAFHQGKYVASVAKKLKHG  204



>ref|XP_006488499.1| PREDICTED: minor allergen Alt a 7-like [Citrus sinensis]
Length=202

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 173/201 (86%), Gaps = 1/201 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKS-D  655
            MATK+YIV+YS YGHVE +A E+++GA+SV GVEA L+QVPETLS  IL K+ APPK+ D
Sbjct  1    MATKIYIVYYSLYGHVETMAREVQRGANSVLGVEATLWQVPETLSSVILQKMKAPPKTND  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
            VP+I P+ L EADGF+FGFP+RFG+M+AQ KAF DAT  LW +QALAGKPAG+F+STG  
Sbjct  61   VPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFH  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQE TALTA+TQL HHGM+FVP+GY+FG+GMFEM +VKGGS YGAGT+A DGSRQP+ 
Sbjct  121  GGGQELTALTAVTQLAHHGMLFVPLGYTFGSGMFEMNEVKGGSCYGAGTFAADGSRQPTD  180

Query  294  LELEQAFHQGKYIAAITKKLK  232
            LEL+QAFHQGKY+A I KKLK
Sbjct  181  LELQQAFHQGKYVAEIAKKLK  201



>ref|XP_006452111.1| hypothetical protein CICLE_v10009497mg [Citrus clementina]
 gb|ESR65351.1| hypothetical protein CICLE_v10009497mg [Citrus clementina]
 gb|KDO74384.1| hypothetical protein CISIN_1g028841mg [Citrus sinensis]
Length=167

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = -3

Query  723  LFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDAT  544
            + QVPETL +E+LGK+SAPPKSDVPII+PN+L EADGFVFGFPTRFGMM+AQFKAFLDAT
Sbjct  1    MVQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDAT  60

Query  543  GGLWRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEME  364
            GGLWRTQ LAGKPAG+FYSTGSQGGGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEME
Sbjct  61   GGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEME  120

Query  363  KVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLKSGSA  220
            KVKGGSPYGAGT+AGDGSRQP++LELEQAFHQGK+IA I KKLK GSA
Sbjct  121  KVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLK-GSA  167



>ref|XP_003593404.1| Flavoprotein wrbA [Medicago truncatula]
 gb|AES63655.1| NAD(P)H:quinone oxidoreductase, type IV protein [Medicago truncatula]
 gb|AFK36515.1| unknown [Medicago truncatula]
 gb|AFK38234.1| unknown [Medicago truncatula]
Length=203

 Score =   279 bits (714),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV++S YGHVEKLA EI KGA SVEGVEAKL+QVPE LS+E+L K+ APP+S+V
Sbjct  1    MATKVYIVYHSVYGHVEKLAEEILKGAASVEGVEAKLWQVPEILSEEVLRKMKAPPRSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P ISP  L +ADGF+FGFP R+GMMSAQFK F DATG LW  Q LAGKPAG F+ST SQG
Sbjct  61   PDISPKQLADADGFLFGFPARYGMMSAQFKVFFDATGSLWNKQTLAGKPAGFFFSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
             GQE T  T+ITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYG+GT+      +PS+L
Sbjct  121  SGQEETPFTSITQLVHHGMLFVPIGYTFGAGMFEMENVKGGSPYGSGTFGEHEIGEPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KKLK
Sbjct  181  ELAQAFHQGKYFAGIAKKLK  200



>gb|AFK34525.1| unknown [Medicago truncatula]
Length=203

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV++S YGHVEKLA EI KGA SVEGVEAKL+QVPE LS+E+L K+ APP+S+V
Sbjct  1    MATKVYIVYHSVYGHVEKLAEEILKGAASVEGVEAKLWQVPEILSEEVLRKMKAPPRSEV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            P ISP  L +ADGF+FGFP R+GMMSAQFK F DATG LW  Q LAGKPAG F+ST SQG
Sbjct  61   PDISPKQLADADGFLFGFPARYGMMSAQFKVFFDATGSLWNKQTLAGKPAGFFFSTASQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
             GQE T  T+ITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYG+GT+      +PS+L
Sbjct  121  SGQEETPFTSITQLVHHGMLFVPIGYTFGAGMFEMENVKGGSPYGSGTFGEHEIGEPSEL  180

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL QAFHQGKY A I KKLK
Sbjct  181  ELAQAFHQGKYFAEIAKKLK  200



>ref|XP_004241169.1| PREDICTED: flavoprotein-like protein YCP4 [Solanum lycopersicum]
Length=202

 Score =   278 bits (710),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+Y+V+YS YGHVE +A EI++G +SVEGVEA L+QVPETL + IL K+ AP K  DVP
Sbjct  4    TKVYVVYYSLYGHVETMAREIQRGVNSVEGVEATLWQVPETLPERILEKMKAPKKPDDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I+P  L EADGF+FGFP+RFG+M+AQFKAF DA+  +W TQALAGKPAG+F+STG  GG
Sbjct  64   EITPEQLLEADGFIFGFPSRFGVMAAQFKAFFDASDEIWATQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALTA+TQL HHGMIFVP+GY+ G GMFEM++VKGGS YGAGTYA DGSRQP++LE
Sbjct  124  GQELSALTAVTQLAHHGMIFVPLGYTLGKGMFEMDEVKGGSSYGAGTYAADGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAFHQGKYIA +TKKLK
Sbjct  184  LKQAFHQGKYIAEVTKKLK  202



>ref|XP_010256587.1| PREDICTED: minor allergen Alt a 7 [Nelumbo nucifera]
Length=209

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKS-DVP  649
            TK+YIV+YS YGHV  +A E+ +GA+S+EGVEA L+QVPETL D +L K+ APPK  DVP
Sbjct  4    TKVYIVYYSLYGHVVTMAREVHRGANSIEGVEATLWQVPETLPDRVLEKMKAPPKEGDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
            II P  LTEADGF+FGFP+RFGMM AQ KAF DA+  LW  QALAGKPAG+F+STG  GG
Sbjct  64   IIRPEQLTEADGFLFGFPSRFGMMPAQLKAFFDASNELWACQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALTAITQL HHGMI+VP+GY+FG+GMFEM +VKGGS YGAGT+AGDGSRQP++LE
Sbjct  124  GQELSALTAITQLAHHGMIYVPLGYTFGSGMFEMNEVKGGSSYGAGTFAGDGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKY++ I KKLK 
Sbjct  184  LQQAFYQGKYVSEIAKKLKD  203



>ref|XP_006350831.1| PREDICTED: flavoprotein-like protein YCP4-like [Solanum tuberosum]
Length=202

 Score =   277 bits (709),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+Y+V+YS YGHVE +A EI++G +SV+GVEA L+QVPETL ++IL K+ AP K  DVP
Sbjct  4    TKIYVVYYSLYGHVETMAREIQRGVNSVKGVEATLWQVPETLPEKILEKMKAPKKPDDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I+P  L EADGF+FGFP+RFG+M+AQFKAF DA+  +W TQALAGKPAG+F+STG  GG
Sbjct  64   EITPEQLLEADGFIFGFPSRFGVMAAQFKAFFDASDEIWATQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALTA+TQL HHGMIFVP+GY+FG GMFEM++VKGGS YGAGTYA DGSRQP++LE
Sbjct  124  GQELSALTAVTQLAHHGMIFVPLGYTFGKGMFEMDEVKGGSSYGAGTYAADGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAFHQGKY A ITKKLK
Sbjct  184  LQQAFHQGKYTAEITKKLK  202



>emb|CDP09176.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   277 bits (709),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 171/202 (85%), Gaps = 1/202 (0%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+Y+V+YS YGHV+ +A EI+KGA+SVEGVEA L+QVPETL ++IL K+ AP K+D VP
Sbjct  4    TKVYVVYYSLYGHVDSMAREIQKGANSVEGVEATLWQVPETLPEKILEKMKAPAKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FG P+RFGMM+AQ KAF DAT  +W TQALAG+PAG+F+STG  GG
Sbjct  64   EIRPEQLVEADGFLFGSPSRFGMMAAQVKAFFDATHEIWATQALAGRPAGVFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALT ITQL HHGMIFVP+GY+FG+GMFEM +VKGGS YGAGTYA DGSRQP++LE
Sbjct  124  GQELTALTFITQLAHHGMIFVPLGYTFGSGMFEMNEVKGGSSYGAGTYAADGSRQPTKLE  183

Query  288  LEQAFHQGKYIAAITKKLKSGS  223
            L+QAFHQGKY+A ITKKLK  S
Sbjct  184  LQQAFHQGKYVAEITKKLKKSS  205



>ref|XP_007016129.1| Quinone reductase family protein isoform 1 [Theobroma cacao]
 gb|EOY33748.1| Quinone reductase family protein isoform 1 [Theobroma cacao]
Length=284

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 181/237 (76%), Gaps = 13/237 (5%)
 Frame = -3

Query  900  FCFNVSF---------IHLPPFFTHKTIQDPPMA---TKLYIVFYSTYGHVEKLAHEIKK  757
            FC  VSF         I          +  P  A   TKLYIV+YS YGHVE +A E+++
Sbjct  43   FCNKVSFNIRRVIEISIQHKQLVNRDQMSSPVAAMATTKLYIVYYSLYGHVETMAREVQR  102

Query  756  GADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVPIISPNDLTEADGFVFGFPTRFGM  580
            GA++V+GVEA L+QVPETLS  IL K+ AP K +DVP I P  L +ADGF+FGFP+RFG+
Sbjct  103  GANAVQGVEATLWQVPETLSSVILQKMKAPGKANDVPEIRPEQLIDADGFLFGFPSRFGV  162

Query  579  MSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPI  400
            M+AQFKAF DA+  LW  QALAGKPAG+F+STG  GGGQE TALTA+TQL HHGMIFVP+
Sbjct  163  MAAQFKAFFDASHELWECQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMIFVPL  222

Query  399  GYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLKS  229
            GY+FG+GMFEM +VKGGS YGAGTYA DGSR+P++LEL+QAFHQGKY+A ITKKLK+
Sbjct  223  GYTFGSGMFEMNEVKGGSSYGAGTYAADGSREPTELELQQAFHQGKYVAEITKKLKN  279



>ref|XP_007142219.1| hypothetical protein PHAVU_008G262200g [Phaseolus vulgaris]
 gb|ESW14213.1| hypothetical protein PHAVU_008G262200g [Phaseolus vulgaris]
Length=203

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+YIV+YS YGHV+ +A E+ +GA +VEGVEA L+QVPE LSD IL KL AP K +DVP
Sbjct  4    TKVYIVYYSLYGHVDTMAREVLRGASAVEGVEATLWQVPEMLSDLILQKLKAPSKPNDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADG +FGFP+RFGMM +Q KAF DAT GLW +QALAGKPAG+F+STG  GG
Sbjct  64   DIRPEQLVEADGLIFGFPSRFGMMPSQLKAFFDATTGLWASQALAGKPAGIFWSTGFYGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALT ITQL HHGM+FVP+GY+FG GMFEM++VKGGSPYGAGT+AGDGSRQP++LE
Sbjct  124  GQELSALTTITQLAHHGMLFVPLGYTFGKGMFEMDEVKGGSPYGAGTFAGDGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAF+QGKY+A +TKKLK
Sbjct  184  LQQAFYQGKYLAEVTKKLK  202



>ref|XP_009783879.1| PREDICTED: minor allergen Alt a 7 [Nicotiana sylvestris]
Length=217

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+Y+V+YS YGHVE +A EI++G +SV+GVEA L+QVPETL + IL K+ AP K  DVP
Sbjct  4    TKVYVVYYSLYGHVETMAREIQRGVNSVQGVEATLWQVPETLPERILEKMKAPKKPDDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQFKAF DA+  +W TQALAGKPAG+F+STG  GG
Sbjct  64   EIRPEQLVEADGFIFGFPSRFGVMAAQFKAFFDASSEIWATQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALTAITQL HHGMIFVP+GY+FG GMFEM++VKGGS YGAGTYA DGSRQP++LE
Sbjct  124  GQELSALTAITQLAHHGMIFVPLGYTFGKGMFEMDEVKGGSCYGAGTYAADGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKL  235
             +QAFHQGKYIA ITK+L
Sbjct  184  FQQAFHQGKYIAEITKRL  201



>gb|KHN25008.1| Flavoprotein wrbA [Glycine soja]
Length=170

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = -3

Query  717  QVPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGG  538
            QVPETL +E+LGK+ APPKSDVPII+PN+L+EADGFVFGFPTRFGMM+AQFKAFLDATGG
Sbjct  6    QVPETLPEEVLGKMRAPPKSDVPIITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGG  65

Query  537  LWRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKV  358
            LW+TQ LAGKPAG+FYST SQGGGQETTALTAITQLVHHGM+FVPIGY+FGAGMF+ME++
Sbjct  66   LWKTQQLAGKPAGIFYSTSSQGGGQETTALTAITQLVHHGMLFVPIGYTFGAGMFDMEEL  125

Query  357  KGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLKSGS  223
            KGGSPYG+GTYAGDGSRQP++LELEQAFHQGKYIA+ITKKLK  +
Sbjct  126  KGGSPYGSGTYAGDGSRQPTKLELEQAFHQGKYIASITKKLKEAA  170



>ref|XP_002314113.1| quinone reductase family protein [Populus trichocarpa]
 gb|EEE88068.1| quinone reductase family protein [Populus trichocarpa]
Length=203

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIVFYS +GHVE +A EI++GA++V+GVEA L+QVPETLS+ IL K+ A PK+D VP
Sbjct  4    TKIYIVFYSLHGHVEIMAREIQRGANTVQGVEATLWQVPETLSNSILNKVKANPKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
            +I P  L EADGF+FGFP+RFG+M++QFKAF DAT  LW TQALAGKPAG F+STG  GG
Sbjct  64   VILPEQLLEADGFLFGFPSRFGVMASQFKAFFDATHELWATQALAGKPAGFFWSTGFYGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE  A TAITQL HHGM+FVP+GY+FG+GMFEM +VKGGS YGAGT+A DGSRQPS+LE
Sbjct  124  GQELAAFTAITQLAHHGMLFVPLGYTFGSGMFEMGEVKGGSSYGAGTFAADGSRQPSELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAF+QGKY++ ITKKLK
Sbjct  184  LQQAFYQGKYVSEITKKLK  202



>ref|XP_009626863.1| PREDICTED: minor allergen Alt a 7 isoform X1 [Nicotiana tomentosiformis]
Length=203

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+Y+V+YS YGHVE +A EI++G +SV+GVEA L+QVPETL + IL K+ AP K  DVP
Sbjct  4    TKVYVVYYSLYGHVETMAREIQRGVNSVQGVEATLWQVPETLPERILEKMKAPKKPDDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQFKAF DA+  +W TQALAGKPAG+F+STG  GG
Sbjct  64   EIRPEQLLEADGFIFGFPSRFGVMAAQFKAFFDASSEIWATQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALTAITQL HHGMIFVP+GY+FG GMFEM++VKGGS YGAGTYA DGSRQP++LE
Sbjct  124  GQELSALTAITQLAHHGMIFVPLGYTFGKGMFEMDEVKGGSCYGAGTYAADGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
             +QAFHQGKYIA IT++L +
Sbjct  184  FQQAFHQGKYIAEITRRLSN  203



>gb|AGV54245.1| flavoprotein wrbA [Phaseolus vulgaris]
Length=203

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+YIV+YS YGHV+ +A E+ +GA +VEGVEA L++VPE LSD IL KL AP K +DVP
Sbjct  4    TKVYIVYYSLYGHVDTMAREVLRGASAVEGVEATLWRVPEMLSDLILQKLKAPSKPNDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADG +FGFP+RFGMM +Q KAF DAT GLW +Q+LAGKPAG+F+STG  GG
Sbjct  64   DIRPEQLVEADGLIFGFPSRFGMMPSQLKAFFDATTGLWASQSLAGKPAGIFWSTGFYGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALT ITQL HHGM+FVP+GY+FG GMFEM++VKGGSPYGAGT+AGDGSRQP++LE
Sbjct  124  GQELSALTTITQLAHHGMLFVPLGYTFGKGMFEMDEVKGGSPYGAGTFAGDGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAF+QGKY+A +TKKLK
Sbjct  184  LQQAFYQGKYLAEVTKKLK  202



>ref|XP_006644814.1| PREDICTED: minor allergen Alt a 7-like isoform X2 [Oryza brachyantha]
Length=192

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = -3

Query  795  YGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEAD  616
            YGHV KLA EIKKGA SVEGVEAK++QVPE L +E+LGK+ APPK D P I+P +L EAD
Sbjct  2    YGHVAKLAEEIKKGASSVEGVEAKIWQVPEILPEEVLGKMGAPPKLDAPTITPQELAEAD  61

Query  615  GFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAIT  436
            G +FGFPTRFGMM+AQ KAF DATGGLWR Q+LAGKPAG+F+STG+QGGGQETT LTAIT
Sbjct  62   GILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQGGGQETTPLTAIT  121

Query  435  QLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYI  256
            QL HHGM+FVP+GY+FGA MF M++V+GGSPYGAGT+A DGSR P+++ELE AFHQGKY 
Sbjct  122  QLTHHGMVFVPVGYTFGAKMFNMDEVQGGSPYGAGTFAADGSRWPTEVELEHAFHQGKYF  181

Query  255  AAITKKLKSGSA  220
            A I KKLK GSA
Sbjct  182  AGIAKKLK-GSA  192



>ref|XP_011032134.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
3 [Populus euphratica]
Length=203

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIVFYS +GHVE +A EI++GA++V GVEA L+QVPETLS+ IL K+ A PK+D VP
Sbjct  4    TKIYIVFYSLHGHVEIMAREIQRGANTVPGVEATLWQVPETLSNSILNKVKANPKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
            +I P  L EADGF+FGFP+RFG+M++QFKAF DAT  LW TQALAGKPAG F+STG  GG
Sbjct  64   VILPEQLLEADGFLFGFPSRFGVMASQFKAFFDATHELWATQALAGKPAGFFWSTGFYGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +A TAITQL HHGM+FVP+GY+FG+GMFEM +VKGGS YGAGT+A DGSRQPS+LE
Sbjct  124  GQELSAFTAITQLAHHGMLFVPLGYTFGSGMFEMGEVKGGSSYGAGTFAADGSRQPSELE  183

Query  288  LEQAFHQGKYIAAITKKLK  232
            L+QAF+QGKY++ ITKKLK
Sbjct  184  LQQAFYQGKYVSEITKKLK  202



>ref|XP_004143152.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus]
 ref|XP_004167353.1| PREDICTED: flavoprotein WrbA-like [Cucumis sativus]
 gb|KGN47091.1| Flavoprotein wrbA [Cucumis sativus]
Length=203

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIV+YS +GHV  +A  I++GA+SV+GVEA L+QVPETLSD IL K+ APPK+D V 
Sbjct  4    TKIYIVYYSLHGHVGTMARRIQQGANSVQGVEATLWQVPETLSDVILKKIKAPPKADDVQ  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQFKAF DAT  +W++QALAGKPAG+F+STG  GG
Sbjct  64   EIHPEQLVEADGFLFGFPSRFGVMAAQFKAFFDATSEIWQSQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTAITQL HHGMIFVP+GY+FG+ M EM +VKGGSPYGAGT+A DG+RQP++LE
Sbjct  124  GQELTALTAITQLAHHGMIFVPLGYTFGSKMMEMNEVKGGSPYGAGTFAADGTRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            LEQAF+QGKY+A +TKKLK+
Sbjct  184  LEQAFYQGKYVAELTKKLKN  203



>ref|XP_003544877.1| PREDICTED: flavoprotein wrbA-like isoform X1 [Glycine max]
 ref|XP_006596420.1| PREDICTED: flavoprotein wrbA-like isoform X2 [Glycine max]
 gb|KHN40060.1| Flavoprotein wrbA [Glycine soja]
Length=203

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 171/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+YIV+YS YGHV+ +A E+ +GA +VEGVEA L++VPE LS+ IL KL APPK +DVP
Sbjct  4    TKVYIVYYSLYGHVDTMAREVHRGAATVEGVEATLWRVPEMLSELILDKLKAPPKPNDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADG +FGFP+RFGMM +Q KAF DAT  LW +QALAGKPAG+F+STG  GG
Sbjct  64   DIMPEQLVEADGLIFGFPSRFGMMPSQLKAFFDATSELWASQALAGKPAGIFWSTGFYGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALTAITQL HHGM+FVP+GY+FG+GMFE+++VKGGS YGAGT+AGDGSRQP++LE
Sbjct  124  GQELSALTAITQLAHHGMLFVPLGYTFGSGMFEIDEVKGGSAYGAGTFAGDGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKY+A +TKKLKS
Sbjct  184  LQQAFYQGKYLAEVTKKLKS  203



>ref|XP_010043444.1| PREDICTED: minor allergen Alt a 7 [Eucalyptus grandis]
 ref|XP_010043445.1| PREDICTED: minor allergen Alt a 7 [Eucalyptus grandis]
 ref|XP_010043446.1| PREDICTED: minor allergen Alt a 7 [Eucalyptus grandis]
 gb|KCW85455.1| hypothetical protein EUGRSUZ_B02266 [Eucalyptus grandis]
 gb|KCW85456.1| hypothetical protein EUGRSUZ_B02266 [Eucalyptus grandis]
 gb|KCW85457.1| hypothetical protein EUGRSUZ_B02266 [Eucalyptus grandis]
Length=208

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = -3

Query  822  KLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VPI  646
            K+YIV+YS YGHVE +A E+++GA++V+GVEA L+QVPETLSD IL K+ AP K+D V  
Sbjct  5    KIYIVYYSLYGHVEIMAREVQRGANTVQGVEATLWQVPETLSDVILQKMKAPAKADDVSE  64

Query  645  ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqggg  466
            I P  L EADGF+FGFP+RFG+M+AQ KAF DAT  +W+TQALAGKPAG+F+STG  GGG
Sbjct  65   IRPEQLLEADGFIFGFPSRFGVMAAQCKAFFDATHEIWKTQALAGKPAGIFWSTGFHGGG  124

Query  465  qetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLEL  286
            QE TALTA+TQL HHGMI+VP+GY+FG GMFEM +VKGGS YGAGTYA DGSRQP++LEL
Sbjct  125  QELTALTAVTQLAHHGMIYVPLGYTFGTGMFEMNEVKGGSCYGAGTYAADGSRQPTELEL  184

Query  285  EQAFHQGKYIAAITKKLK  232
            +QAFHQGKY+A I +KLK
Sbjct  185  KQAFHQGKYVAEIARKLK  202



>ref|XP_007133118.1| hypothetical protein PHAVU_011G152900g [Phaseolus vulgaris]
 gb|ESW05112.1| hypothetical protein PHAVU_011G152900g [Phaseolus vulgaris]
Length=214

 Score =   273 bits (697),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA K+YIV+YS YGHVE+LA EI  GA+SV GVEA ++QVPETL++E L ++ APPKSDV
Sbjct  1    MAVKVYIVYYSMYGHVERLACEIFLGANSVNGVEATMWQVPETLTEEELVRVGAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+   L EADGF+FGFP+R GMM++QF AFLD+T  LW  Q LA KPAG+FYST SQG
Sbjct  61   PIINQMKLPEADGFIFGFPSRCGMMASQFMAFLDSTQFLWIAQMLARKPAGIFYSTSSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQET  LTAITQL HHGMIFVP+GY+FG  MFEM +VKGGSPYGAGTY GDGSR+P++L
Sbjct  121  GGQETAPLTAITQLAHHGMIFVPMGYTFGPDMFEMSEVKGGSPYGAGTYTGDGSRKPTEL  180

Query  291  ELEQAFHQGKYIAAITKKLKSGSA*LISFNS  199
            ELEQAFH GKYIA ITKK K  +  + + ++
Sbjct  181  ELEQAFHHGKYIANITKKFKEDTHPIFNLDN  211



>gb|EYU45735.1| hypothetical protein MIMGU_mgv1a013995mg [Erythranthe guttata]
Length=204

 Score =   272 bits (695),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VPIISPND  631
            +YS YGHVE +A EI++GA+SV  VEA L+Q+PETL   IL K+ AP K+D V  I P  
Sbjct  11   YYSLYGHVENMAREIQRGANSVPDVEATLWQIPETLPSRILEKMKAPEKADDVAEIRPEQ  70

Query  630  LTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTA  451
            L EADGF+FGFP+RFG+M+AQ KAF DATGG+W TQALAGKPAG+F+STG  GGGQE TA
Sbjct  71   LLEADGFIFGFPSRFGVMAAQCKAFFDATGGIWATQALAGKPAGIFWSTGFHGGGQELTA  130

Query  450  LTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFH  271
            LTAITQL HHGMI+VP+GY+FG+GM+EME+VKGGSPYGAGTYA DGSRQP+QLEL+QAFH
Sbjct  131  LTAITQLAHHGMIYVPLGYTFGSGMYEMEQVKGGSPYGAGTYAADGSRQPTQLELDQAFH  190

Query  270  QGKYIAAITKKLK  232
            QGKY+A ITKKLK
Sbjct  191  QGKYVAQITKKLK  203



>ref|XP_002279668.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
3 [Vitis vinifera]
 emb|CBI15977.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   271 bits (694),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  828  ATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDV  652
            ATK+YIV+YS YGHVE +A E+++GA++V GVEA L+Q+PETL D +L K+ APPK +DV
Sbjct  3    ATKVYIVYYSLYGHVEIVAREVQRGANTVHGVEATLWQIPETLPDRVLEKMKAPPKANDV  62

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
              I P  L+EADGF+FGFP+RFGMM AQF AF DAT  LW +QALAGKPAG+F+STG  G
Sbjct  63   AEIKPEQLSEADGFLFGFPSRFGMMPAQFLAFFDATDELWASQALAGKPAGIFWSTGFHG  122

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQL  292
            GGQE +ALT IT+L HHGMI+VP+GY+FG GMFEM +VKGGS YGAGTYAGDGSRQP++L
Sbjct  123  GGQENSALTTITKLAHHGMIYVPLGYTFGKGMFEMNEVKGGSSYGAGTYAGDGSRQPTEL  182

Query  291  ELEQAFHQGKYIAAITKKLK  232
            EL+QAF+QGKY+A I KKLK
Sbjct  183  ELQQAFYQGKYVAEIVKKLK  202



>gb|AFK37691.1| unknown [Lotus japonicus]
Length=204

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 167/200 (84%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+YIV+YS YGHV+ +A E+ +GA +VEGVEA L+QVPETLSD IL K  AP +  DVP
Sbjct  5    TKVYIVYYSLYGHVDTMAREVHRGAAAVEGVEATLWQVPETLSDRILEKTKAPSRPDDVP  64

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADG +FGFP+RFGMM +Q KAF DA+ GLW +QALAGKPAG+F+STG  GG
Sbjct  65   DIRPEQLPEADGIIFGFPSRFGMMPSQLKAFFDASSGLWASQALAGKPAGVFWSTGFYGG  124

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +ALT ITQL HHGM+FVP+GY+FG GMFEM++VKGGS YGAGT+AGDGSRQP++LE
Sbjct  125  GQELSALTTITQLAHHGMLFVPLGYTFGTGMFEMDEVKGGSAYGAGTFAGDGSRQPTELE  184

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKYIA I +KLK+
Sbjct  185  LQQAFYQGKYIAEIARKLKN  204



>ref|XP_003615608.1| Flavoprotein wrbA [Medicago truncatula]
 gb|AES98566.1| NAD(P)H:quinone oxidoreductase, type IV protein [Medicago truncatula]
 gb|AFK39687.1| unknown [Medicago truncatula]
Length=203

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 166/200 (83%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+YIV+YS YGHV  +A E+ KGA S+EGVEA L++VPE LSD IL K+ APPK  DV 
Sbjct  4    TKVYIVYYSLYGHVNTMAREVHKGAASIEGVEATLWRVPEILSDRILEKMKAPPKPDDVA  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EAD  +FGFP+RFGMM +Q KAF DATG LW +QALAGKPAG+F+STG  GG
Sbjct  64   DIKPEQLVEADALIFGFPSRFGMMPSQLKAFFDATGELWASQALAGKPAGIFWSTGFNGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +A TAITQL HHGM++VP+GY+FG+GMFEM++VKGGS YGAGT+AGDG+RQP++LE
Sbjct  124  GQELSAWTAITQLAHHGMLYVPLGYTFGSGMFEMDEVKGGSAYGAGTFAGDGTRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKYIA I KKLKS
Sbjct  184  LQQAFYQGKYIAEIAKKLKS  203



>ref|XP_008464047.1| PREDICTED: minor allergen Alt a 7 [Cucumis melo]
Length=203

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIV+YS +GHV  +A  I++GA+SV+GVEA L+QVPETLSD IL K++APPK+D V 
Sbjct  4    TKIYIVYYSLHGHVGTMARRIQQGANSVQGVEATLWQVPETLSDMILKKINAPPKADDVQ  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M++QFKAF DAT  +W++QALAGKPAG+F+STG  GG
Sbjct  64   EIHPEQLVEADGFLFGFPSRFGVMASQFKAFFDATSEIWQSQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTAITQL HHGMIFVP+GY+FG+ M EM +VKGGSPYGAGT+A DG+R P++LE
Sbjct  124  GQELTALTAITQLAHHGMIFVPLGYTFGSKMMEMNEVKGGSPYGAGTFAADGTRHPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            LEQAF+QGKY+A +TKKLK+
Sbjct  184  LEQAFYQGKYVAELTKKLKN  203



>ref|XP_002461308.1| hypothetical protein SORBIDRAFT_02g000630 [Sorghum bicolor]
 gb|EER97829.1| hypothetical protein SORBIDRAFT_02g000630 [Sorghum bicolor]
Length=216

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA EIKKGAD+V GVEA +++V ETL +++LGK+ +AP   D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEIKKGADAVPGVEATVWRVVETLPEDVLGKMGAAPAHED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+ISP DL +ADG + GFPTRFGMM+AQ KAF+DATGGLW++QALAGKPAG+F STG+Q
Sbjct  61   HPVISPRDLADADGVLLGFPTRFGMMAAQMKAFIDATGGLWQSQALAGKPAGVFLSTGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPS  298
            GGGQETTALTA+TQLVHHGM+FVP+GY+FGAGMF +++V+GGSPYGAGT+AG DGSR PS
Sbjct  121  GGGQETTALTAVTQLVHHGMLFVPLGYTFGAGMFGVDEVRGGSPYGAGTFAGADGSRTPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKSG  226
            ++EL  A HQG Y A I KKLK G
Sbjct  181  EVELAVARHQGTYFAGIAKKLKVG  204



>ref|XP_009374262.1| PREDICTED: minor allergen Alt a 7 [Pyrus x bretschneideri]
 ref|XP_009374263.1| PREDICTED: minor allergen Alt a 7 [Pyrus x bretschneideri]
 ref|XP_009374264.1| PREDICTED: minor allergen Alt a 7 [Pyrus x bretschneideri]
 ref|XP_009374265.1| PREDICTED: minor allergen Alt a 7 [Pyrus x bretschneideri]
Length=203

 Score =   269 bits (687),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+YIV+YS +GHVE +A EI +G +SVEGVEA L+QVPETLS  IL K+ APPK+D VP
Sbjct  4    TKIYIVYYSLHGHVEIMAREIHRGVNSVEGVEATLWQVPETLSSVILQKVKAPPKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FG P+RFG+M++QFKAF DAT  +W+ QALAGKPAG+F+STG  GG
Sbjct  64   EIRPEQLVEADGFLFGSPSRFGVMASQFKAFFDATDEIWKKQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALT +TQL HHGMIFVP+GY+FG+GMFEM+ VKGGS YG+GT+A DGSRQP++LE
Sbjct  124  GQELTALTTVTQLAHHGMIFVPLGYTFGSGMFEMDAVKGGSAYGSGTFAADGSRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKY+A I KKLK+
Sbjct  184  LQQAFYQGKYVAQIAKKLKN  203



>dbj|BAA22940.1| LEDI-3 protein [Lithospermum erythrorhizon]
Length=201

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MA KLYIV+YSTYGHV KLA E+KKGA+SV+GVE KL+QV ETL +++LGK+ APPK D 
Sbjct  1    MAVKLYIVYYSTYGHVLKLAEEMKKGAESVDGVEVKLWQVAETLPEDVLGKMYAPPKGDA  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+P++L EADG++FGFPTRFGMM AQFKAF D+TGGLW++  L GKPAG F S+GSQG
Sbjct  61   PIITPDELAEADGYLFGFPTRFGMMPAQFKAFFDSTGGLWQSGGLVGKPAGFFISSGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPSQ  295
            GGQETTALTAITQLVHHGMI+VP G +FGAG+ + E ++GG+ YGAGT+AG DG+RQP++
Sbjct  121  GGQETTALTAITQLVHHGMIYVPTGGTFGAGLHKNE-IRGGTLYGAGTFAGPDGARQPTE  179

Query  294  LELEQAFHQGKYIAAITKKLKS  229
            LELE AFHQGKY A I K+LK+
Sbjct  180  LELELAFHQGKYTAGIVKRLKA  201



>ref|XP_007205924.1| hypothetical protein PRUPE_ppa011625mg [Prunus persica]
 gb|EMJ07123.1| hypothetical protein PRUPE_ppa011625mg [Prunus persica]
Length=203

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+Y+V+YS +GHVE +A E+++G ++VEGVEA L+QVPETL   IL K+ APPK+D VP
Sbjct  4    TKIYVVYYSLHGHVETMAREVQRGVNAVEGVEATLWQVPETLPSIILQKVKAPPKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQFKAF DAT  +W  QALAGKPAG+F+STG  GG
Sbjct  64   EIRPEQLVEADGFLFGFPSRFGVMAAQFKAFFDATHEIWEKQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTA+TQL HHGMIFVP+GY+FG+GMFEM +VKGGS YG+GT+A DGSRQP+++E
Sbjct  124  GQELTALTAVTQLAHHGMIFVPLGYTFGSGMFEMSEVKGGSSYGSGTFAADGSRQPTEIE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKY+A   KKLKS
Sbjct  184  LQQAFYQGKYVAQFAKKLKS  203



>ref|XP_008220577.1| PREDICTED: minor allergen Alt a 7 isoform X1 [Prunus mume]
Length=203

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSD-VP  649
            TK+Y+V+YS +GHVE +A E+++G ++VEGVEA L+QVPETL   IL K+ APPK+D VP
Sbjct  4    TKIYVVYYSLHGHVETMAREVQRGVNAVEGVEATLWQVPETLPSIILQKVKAPPKADDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EADGF+FGFP+RFG+M+AQFKAF DAT  +W  QALAGKPAG+F+STG  GG
Sbjct  64   EIRPEQLEEADGFLFGFPSRFGVMAAQFKAFFDATHEIWEKQALAGKPAGIFWSTGFHGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE TALTA+TQL HHGMIFVP+GY+FG+GMFEM +VKGGS YG+GT+A DGSRQP+++E
Sbjct  124  GQELTALTAVTQLAHHGMIFVPLGYTFGSGMFEMSEVKGGSSYGSGTFAADGSRQPTEIE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKY+A   KKLKS
Sbjct  184  LQQAFYQGKYVAQFAKKLKS  203



>ref|XP_004294274.1| PREDICTED: flavoprotein WrbA-like [Fragaria vesca subsp. vesca]
Length=222

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 171/207 (83%), Gaps = 2/207 (1%)
 Frame = -3

Query  843  QDPPMAT-KLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAP  667
            Q   MAT K+YIV+YS +GHVE +A E+++G ++VEGVE  L+QVPETLSD IL K+ A 
Sbjct  16   QSTAMATTKIYIVYYSLHGHVETMAREVQRGVNAVEGVEGTLWQVPETLSDVILQKMKAL  75

Query  666  PKSD-VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFY  490
            PK+D VP I P  L EADGF+FGFP+RFG+MSAQ KAF D+T  +W TQALAGKPAG+F+
Sbjct  76   PKADDVPEIRPEQLLEADGFLFGFPSRFGVMSAQCKAFFDSTHEIWETQALAGKPAGIFW  135

Query  489  stgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGS  310
            STG  GGGQE TALTA+TQL HHGMIFVP+GY+FG GM+EM +VKGGS YGAGT+A DGS
Sbjct  136  STGFHGGGQELTALTAVTQLAHHGMIFVPLGYTFGKGMYEMNEVKGGSSYGAGTFAADGS  195

Query  309  RQPSQLELEQAFHQGKYIAAITKKLKS  229
            RQP++LEL+QAF+QGKY+A   KKLK+
Sbjct  196  RQPTELELQQAFYQGKYLAGFAKKLKN  222



>ref|XP_010104650.1| Flavoprotein-like protein YCP4 [Morus notabilis]
 gb|EXC01456.1| Flavoprotein-like protein YCP4 [Morus notabilis]
Length=242

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVPIISPND  631
            +YS +GHVE +A EI++GA+ V+G EA L+QVPETLSD+IL K+ AP K +DVP I P  
Sbjct  44   YYSLHGHVETMAREIQRGANEVQGAEATLWQVPETLSDKILQKMKAPSKPTDVPEIRPEQ  103

Query  630  LTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTA  451
            L EADGF+FGFP+RFG+M+AQ KAF DAT  LW  QALAGKPAG+F+STG  GGGQE TA
Sbjct  104  LLEADGFLFGFPSRFGVMAAQCKAFFDATHELWGRQALAGKPAGIFWSTGFHGGGQELTA  163

Query  450  LTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFH  271
            LTA+TQL HHGMIFVP+GY+FG+GMFEM++VKGGSPYGAGTYA DGSRQP++LELEQAFH
Sbjct  164  LTAVTQLAHHGMIFVPLGYTFGSGMFEMKEVKGGSPYGAGTYAADGSRQPTELELEQAFH  223

Query  270  QGKYIAAITKKLK  232
            QGKY+A I KKLK
Sbjct  224  QGKYVAEIAKKLK  236



>ref|XP_004490586.1| PREDICTED: flavoprotein WrbA-like isoform X1 [Cicer arietinum]
 ref|XP_004490587.1| PREDICTED: flavoprotein WrbA-like isoform X2 [Cicer arietinum]
 ref|XP_004490588.1| PREDICTED: flavoprotein WrbA-like isoform X3 [Cicer arietinum]
Length=203

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 167/200 (84%), Gaps = 1/200 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVP  649
            TK+YI++YS YGHV+ +A E+ KGA ++EGVEA L++VPE LSD IL K+ APPK  D+ 
Sbjct  4    TKVYIIYYSLYGHVDTMAREVHKGAAAIEGVEATLWRVPEVLSDRILEKMKAPPKPDDIA  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgg  469
             I P  L EAD  +FGFP+RFGMM +Q  AF DATG LW++QALAGKPAG+F+STG  GG
Sbjct  64   DIKPEQLVEADAIIFGFPSRFGMMPSQLMAFFDATGELWQSQALAGKPAGIFWSTGFYGG  123

Query  468  gqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLE  289
            GQE +A TAITQL HHGM+FVP+GY+FG+GMFEM++VKGGS YGAGT+AGDG+RQP++LE
Sbjct  124  GQELSAWTAITQLAHHGMLFVPLGYTFGSGMFEMDEVKGGSAYGAGTFAGDGTRQPTELE  183

Query  288  LEQAFHQGKYIAAITKKLKS  229
            L+QAF+QGKYIA I +KLKS
Sbjct  184  LQQAFYQGKYIAEIARKLKS  203



>ref|XP_006354298.1| PREDICTED: minor allergen Alt a 7-like [Solanum tuberosum]
Length=214

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  714  VPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGL  535
            VPETLS+E+L K+SAPPKSDVPII+P +L EADGFVFGFPTRFG++SAQFKAFLDATGGL
Sbjct  51   VPETLSEEVLAKMSAPPKSDVPIITPQELAEADGFVFGFPTRFGILSAQFKAFLDATGGL  110

Query  534  WRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVK  355
            WRTQ LAGKPAG+FYSTGSQGGGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME VK
Sbjct  111  WRTQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEMENVK  170

Query  354  GGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLK  232
            GGSPYGAGT+ GDGSRQPS+LEL+QA HQGKYIAAI KKLK
Sbjct  171  GGSPYGAGTFTGDGSRQPSELELQQAHHQGKYIAAIAKKLK  211



>ref|XP_007016130.1| Quinone reductase family protein isoform 2 [Theobroma cacao]
 gb|EOY33749.1| Quinone reductase family protein isoform 2 [Theobroma cacao]
Length=251

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -3

Query  813  IVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPK-SDVPIISP  637
            I +YS YGHVE +A E+++GA++V+GVEA L+QVPETLS  IL K+ AP K +DVP I P
Sbjct  51   IRYYSLYGHVETMAREVQRGANAVQGVEATLWQVPETLSSVILQKMKAPGKANDVPEIRP  110

Query  636  NDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqet  457
              L +ADGF+FGFP+RFG+M+AQFKAF DA+  LW  QALAGKPAG+F+STG  GGGQE 
Sbjct  111  EQLIDADGFLFGFPSRFGVMAAQFKAFFDASHELWECQALAGKPAGIFWSTGFHGGGQEL  170

Query  456  TALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQA  277
            TALTA+TQL HHGMIFVP+GY+FG+GMFEM +VKGGS YGAGTYA DGSR+P++LEL+QA
Sbjct  171  TALTAVTQLAHHGMIFVPLGYTFGSGMFEMNEVKGGSSYGAGTYAADGSREPTELELQQA  230

Query  276  FHQGKYIAAITKKLKS  229
            FHQGKY+A ITKKLK+
Sbjct  231  FHQGKYVAEITKKLKN  246



>ref|XP_004955301.1| PREDICTED: minor allergen Alt a 7-like [Setaria italica]
Length=211

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 176/207 (85%), Gaps = 3/207 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA EIKKGA+SV+GVEA +++VPETL +E+LGK+ +AP + +
Sbjct  1    MATKIYIVYYSTWGHVATLAEEIKKGAESVDGVEATVWRVPETLPEEVLGKMHAAPVREE  60

Query  654  VPI-ISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgs  478
             P+ ++   L EADG + GFPTRFGMM+AQ KAFLD+TGGLW+ QALAGKPAGLF++TG+
Sbjct  61   HPVMVAAGQLAEADGLLLGFPTRFGMMAAQMKAFLDSTGGLWQAQALAGKPAGLFFATGT  120

Query  477  qgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQP  301
            QGGGQETTALTA+TQL HHGM+FVPIG +FGAGMF M++V+GGSPYGAGT+AG DGSR P
Sbjct  121  QGGGQETTALTAVTQLAHHGMLFVPIGATFGAGMFGMDEVRGGSPYGAGTFAGADGSRTP  180

Query  300  SQLELEQAFHQGKYIAAITKKLKSGSA  220
            S  EL  A HQGK++A I K LK+G++
Sbjct  181  SDTELAMAQHQGKHLATIAKNLKAGAS  207



>gb|KEH36477.1| NAD(P)H:quinone oxidoreductase, type IV protein [Medicago truncatula]
Length=198

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -3

Query  807  FYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDL  628
            ++S YGHVEKLA EI KGA SVEGVEAKL+QVPE LS+E+L K+ APP+S+VP ISP  L
Sbjct  4    YHSVYGHVEKLAEEILKGAASVEGVEAKLWQVPEILSEEVLRKMKAPPRSEVPDISPKQL  63

Query  627  TEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTAL  448
             +ADGF+FGFP R+GMMSAQFK F DATG LW  Q LAGKPAG F+ST SQG GQE T  
Sbjct  64   ADADGFLFGFPARYGMMSAQFKVFFDATGSLWNKQTLAGKPAGFFFSTASQGSGQEETPF  123

Query  447  TAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQ  268
            T+ITQLVHHGM+FVPIGY+FGAGMFEME VKGGSPYG+GT+      +PS+LEL QAFHQ
Sbjct  124  TSITQLVHHGMLFVPIGYTFGAGMFEMENVKGGSPYGSGTFGEHEIGEPSELELAQAFHQ  183

Query  267  GKYIAAITKKLK  232
            GKY A I KKLK
Sbjct  184  GKYFAGIAKKLK  195



>dbj|BAK01428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA E+KKGADSV GVE  +++VPETL +E+LGK+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEMKKGADSVPGVEVTIWRVPETLPEEVLGKMHAAPGRED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+I+ + L EADG +FGFPTRFGMM+AQ KAF D+TGGLW+ Q+L+GKPAG+F++TG+Q
Sbjct  61   HPVITASQLAEADGILFGFPTRFGMMAAQMKAFFDSTGGLWQAQSLSGKPAGVFFATGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPS  298
            GGGQETTALTA+TQL HHGM+FVP+GY+ GAGMF M++VKGGSPYGAGT+AG DGSR PS
Sbjct  121  GGGQETTALTAVTQLTHHGMLFVPVGYTHGAGMFAMDEVKGGSPYGAGTFAGADGSRVPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKS  229
              EL  A HQGKY A I KKLK+
Sbjct  181  DAELALAAHQGKYFAGIAKKLKA  203



>gb|EMT29400.1| Flavoprotein wrbA [Aegilops tauschii]
Length=204

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA E+KKGADSV GVE  +++VPETL +E+LGK+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEMKKGADSVPGVEVTVWRVPETLPEEVLGKMHAAPGRED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+I+ + L EADG +FGFPTRFGMM+AQ KAF D+TGGLW+ Q+L+GKPAG+F++TG+Q
Sbjct  61   HPVITASQLAEADGILFGFPTRFGMMAAQMKAFFDSTGGLWQAQSLSGKPAGVFFATGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPS  298
            GGGQETTALTA+TQL HHGM+FVP+GY+ GAGMF M++VKGGSPYGAGT+AG DGSR PS
Sbjct  121  GGGQETTALTAVTQLTHHGMLFVPVGYTHGAGMFAMDEVKGGSPYGAGTFAGADGSRVPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKS  229
              EL  A HQGKY A I KKLK+
Sbjct  181  DAELALAAHQGKYFAGIAKKLKA  203



>ref|XP_003557696.1| PREDICTED: flavoprotein-like protein YCP4 [Brachypodium distachyon]
Length=204

 Score =   265 bits (676),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA EIKKGADS+ GVEA +++VPETL + +L K+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEIKKGADSISGVEATIWRVPETLPESVLSKMQAAPARED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
              +I+ +DL +ADG +FGFPTRFGMM+AQ KAF DATGGLW T ALAGKPAG F+++G+Q
Sbjct  61   HGVITASDLADADGILFGFPTRFGMMAAQMKAFFDATGGLWHTGALAGKPAGFFFASGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPS  298
            GGGQETTALTA+TQL HHGM+FVP+GY+ GAGMF M++VKGGSPYGAGT+AG DGSR PS
Sbjct  121  GGGQETTALTAVTQLAHHGMVFVPVGYTHGAGMFAMDEVKGGSPYGAGTFAGADGSRVPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKS  229
            + EL  A HQGKY A + KKLK+
Sbjct  181  EAELALAEHQGKYFAGVAKKLKA  203



>ref|NP_001151964.1| LOC100285601 [Zea mays]
 gb|ACG45157.1| flavoprotein wrbA [Zea mays]
Length=182

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  765  IKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRF  586
            +KKGA SVEGVE K++QVPE LS+E+LGK+ APPK+D P+I+P +L EADG +FGFPTRF
Sbjct  1    MKKGAASVEGVEVKVWQVPEILSEEVLGKMGAPPKTDAPVITPQELAEADGVLFGFPTRF  60

Query  585  GMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFV  406
            GMM+AQ KAF DATGGLWR Q+LAGKPAGLF+STGSQGGGQETT LTA+TQL HHGM+FV
Sbjct  61   GMMAAQMKAFFDATGGLWREQSLAGKPAGLFFSTGSQGGGQETTPLTAVTQLTHHGMVFV  120

Query  405  PIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLKSG  226
            P+GY+FGA +F+ME V GGSPYGAGT+AGDGSR P++LELE AFHQG Y A I K+LK G
Sbjct  121  PVGYTFGAKIFDMESVHGGSPYGAGTFAGDGSRWPTELELEHAFHQGNYFAGIAKRLKGG  180

Query  225  SA  220
            SA
Sbjct  181  SA  182



>ref|XP_006354301.1| PREDICTED: minor allergen Alt a 7-like [Solanum tuberosum]
Length=333

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  LFQVPETLSDEILGKLSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDAT  544
            + QVPETLS+E+L K+SAPPKSDVPII+P +L EADGFVFGFPTRFG++SAQFKAFLDAT
Sbjct  167  VVQVPETLSEEVLAKMSAPPKSDVPIITPQELAEADGFVFGFPTRFGILSAQFKAFLDAT  226

Query  543  GGLWRTQALAGKPAGLFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEME  364
            GGLWRTQ LAGKPAG+FYSTGSQGGGQETT LTAITQLVHHGMIFVPIGY+FGAGMFEME
Sbjct  227  GGLWRTQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMFEME  286

Query  363  KVKGGSPYGAGTYAGDGSRQPSQLELEQAFHQGKYIAAITKKLK  232
             VKGGSPYGAGT+ GDGSRQPS+LEL+QA HQGKYIAAI KKLK
Sbjct  287  NVKGGSPYGAGTFTGDGSRQPSELELQQAHHQGKYIAAIAKKLK  330



>dbj|BAJ98367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA E+K+GADSV GVE  +++V ETL++E+LGK+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEMKRGADSVPGVEVTVWRVAETLAEEVLGKMHAAPGRED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+I+   L EADG +FGFPTRFGMM+AQ KAF D+TGGLW+ Q+LAGKPAG+F++TG+Q
Sbjct  61   HPVITAQQLAEADGVLFGFPTRFGMMAAQMKAFFDSTGGLWQAQSLAGKPAGVFFATGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPS  298
            GGGQETTALTA+TQL HHGM+FVP+GY+ GAGMF +++VKGGSPYGAGT+AG DGSR PS
Sbjct  121  GGGQETTALTAVTQLTHHGMLFVPVGYTHGAGMFAVDEVKGGSPYGAGTFAGADGSRTPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKS  229
              EL  A HQGKY A + KKLK+
Sbjct  181  DAELALAAHQGKYFAGVAKKLKA  203



>gb|EMT23536.1| Flavoprotein wrbA [Aegilops tauschii]
Length=204

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA EIKKGADSV GVE  +++VPETL +++LGK+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEIKKGADSVPGVEVTVWRVPETLPEDVLGKMHAAPGRED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+I+   L EADG +FGFPTRFGMM+AQ KAF D+TGGLW+ Q+LAGKPAG+F++TG+Q
Sbjct  61   HPVITARQLAEADGILFGFPTRFGMMAAQMKAFFDSTGGLWQEQSLAGKPAGVFFATGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYA-GDGSRQPS  298
            GGGQETTALTA+TQL HHGM+FVP+GY+ GAGMF M++VKGGSPYGAGT+A  DGSR PS
Sbjct  121  GGGQETTALTAVTQLTHHGMLFVPVGYTHGAGMFAMDEVKGGSPYGAGTFASADGSRMPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKS  229
              EL  A HQGKY A I +KLK+
Sbjct  181  DAELALAAHQGKYFAGIAQKLKA  203



>ref|XP_003527289.1| PREDICTED: P25 protein-like [Glycine max]
Length=220

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 172/206 (83%), Gaps = 6/206 (3%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            M  K+YIV+YS  GHVE+LA EIK GADSV GVE++L+QVPETLS E L  L APPKSDV
Sbjct  1    MTVKVYIVYYSMLGHVERLAQEIKTGADSVPGVESQLWQVPETLSTEELEALRAPPKSDV  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLW--RTQALAGKPAGLFYstgs  478
            PII+ N+L +ADGFVFGFPTRFGMM+AQF+AFLD+ G LW    Q L GKPAG+F+STG 
Sbjct  61   PIITRNELRDADGFVFGFPTRFGMMAAQFQAFLDSIGLLWDEEDQFLEGKPAGMFFSTGC  120

Query  477  qgggqetTALTAITQLVHHGMIFVPIGYSFGA---GMFEMEKVKGGSPYGAGTYAG-DGS  310
            QGGGQETTALTAI QLV+HG++FVPI Y+ GA   GMFE+E+V+GGSP+G+GTYAG DG 
Sbjct  121  QGGGQETTALTAIPQLVNHGLLFVPILYTLGAGISGMFEIEEVRGGSPFGSGTYAGTDGK  180

Query  309  RQPSQLELEQAFHQGKYIAAITKKLK  232
            R P+++EL QAFHQGK IAAI+KKLK
Sbjct  181  RNPTEIELRQAFHQGKCIAAISKKLK  206



>gb|EMS46699.1| Flavoprotein wrbA [Triticum urartu]
Length=204

 Score =   262 bits (669),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA EIKKGADSV GVE  +++VPETL +++LGK+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEIKKGADSVPGVEVSVWRVPETLPEDVLGKMHAAPGRED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+I+   L EADG +FGFPTRFGMM+AQ KAF D+TGGLW+ Q+LAGKPAG+F++TG+Q
Sbjct  61   HPVITARQLAEADGILFGFPTRFGMMAAQMKAFFDSTGGLWQEQSLAGKPAGVFFATGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYA-GDGSRQPS  298
            GGGQETTALTA+TQL HHGM+FVP+GY+ GA MF M++VKGGSPYGAGT+A  DGSR PS
Sbjct  121  GGGQETTALTAVTQLAHHGMLFVPVGYTHGAAMFAMDEVKGGSPYGAGTFASADGSRMPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKS  229
              EL  A HQGKY A I KKLK+
Sbjct  181  DAELALAAHQGKYFAGIAKKLKA  203



>gb|EMT23327.1| Flavoprotein wrbA [Aegilops tauschii]
Length=204

 Score =   261 bits (668),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA EIKKGADSV GVE  +++VPETL +E+LGK+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVATLAEEIKKGADSVPGVEVTVWRVPETLPEEVLGKMHAAPGRED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+I+ + L EADG +FGFPTRFGMM+AQ KAF D+TGGLW+  +LAGKPAG+F +TG+Q
Sbjct  61   HPVITASQLAEADGILFGFPTRFGMMAAQMKAFFDSTGGLWQEGSLAGKPAGVFLATGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPS  298
            GGGQETTALTAITQL HHGM+FVP+GY+ GAGMF M++VKGGSPYGAGT+A  DGSR PS
Sbjct  121  GGGQETTALTAITQLTHHGMLFVPVGYTHGAGMFAMDEVKGGSPYGAGTFASKDGSRTPS  180

Query  297  QLELEQAFHQGKYIAAITKKLKS  229
              EL  A HQGKY A I KKLK+
Sbjct  181  DAELALAAHQGKYFAGIAKKLKA  203



>ref|XP_007149666.1| hypothetical protein PHAVU_005G088900g [Phaseolus vulgaris]
 gb|ESW21660.1| hypothetical protein PHAVU_005G088900g [Phaseolus vulgaris]
Length=152

 Score =   259 bits (662),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/149 (92%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = -3

Query  678  LSAPPKSDVPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAG  499
            +SAPPKSDVPII+P++L+EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR Q LAGKPAG
Sbjct  1    MSAPPKSDVPIITPDELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAG  60

Query  498  LFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG  319
            +FYSTGSQGGGQETTALTAITQLVHHGMIFVPIGY+FGAGMFEMEKVKGGSPYGAGT+AG
Sbjct  61   IFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAG  120

Query  318  DGSRQPSQLELEQAFHQGKYIAAITKKLK  232
            DGSRQPS+LELEQAFHQGKYIAAITKKLK
Sbjct  121  DGSRQPSELELEQAFHQGKYIAAITKKLK  149



>ref|XP_011097213.1| PREDICTED: probable NAD(P)H dehydrogenase (quinone) FQR1-like 
1 [Sesamum indicum]
Length=265

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 3/208 (1%)
 Frame = -3

Query  849  TIQDPPMAT-KLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLS  673
            TI   P+   KL+IVFYS YGHVE LA  +K+GADSV GVEA+LF+VPETL +E+L K+ 
Sbjct  55   TIPSGPLRNLKLFIVFYSMYGHVEALAWRMKRGADSVAGVEAELFRVPETLPEEVLVKMR  114

Query  672  APPKSD-VPII-SPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAG  499
            AP K D +P+I SP DL   DGF+FGFPTR+G M+AQ KAF D+TG LWR Q LAGKPAG
Sbjct  115  APSKDDSIPVIGSPEDLAGGDGFLFGFPTRYGCMAAQMKAFFDSTGQLWREQKLAGKPAG  174

Query  498  LFYstgsqgggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG  319
             F STG+QGGGQETTA TAITQL HHGM+FVPIGY+FGAGMF+M+ ++GGSPYGAG +AG
Sbjct  175  FFVSTGTQGGGQETTAWTAITQLAHHGMLFVPIGYTFGAGMFKMDSIRGGSPYGAGVFAG  234

Query  318  DGSRQPSQLELEQAFHQGKYIAAITKKL  235
            DG+R+PS+LEL  A HQGKY+AAI K+L
Sbjct  235  DGTREPSELELALAEHQGKYMAAIVKRL  262



>ref|XP_006844791.1| hypothetical protein AMTR_s00016p00260310 [Amborella trichopoda]
 gb|ERN06466.1| hypothetical protein AMTR_s00016p00260310 [Amborella trichopoda]
Length=208

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 168/202 (83%), Gaps = 3/202 (1%)
 Frame = -3

Query  825  TKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKS-DVP  649
            T++YIV+YS +GHV  +A EI +GA S+EGVEA L+QVPETL   +L K+ APPK  DVP
Sbjct  4    TRVYIVYYSLFGHVGTMAKEIHRGASSIEGVEATLWQVPETLPKRVLEKMKAPPKCGDVP  63

Query  648  IISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDAT--GGLWRTQALAGKPAGLFYstgsq  475
            IISP +L EAD F+FGFP+RFGMM+AQFKAF ++     +W++Q LAGKPAG+F+STG  
Sbjct  64   IISPEELLEADAFIFGFPSRFGMMAAQFKAFFESIEMASIWKSQKLAGKPAGIFWSTGYH  123

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSQ  295
            GGGQE TALTAITQL HHG++FVP+GY+FG+GMFEM++VKGGS YGAGTYA DG+R P++
Sbjct  124  GGGQENTALTAITQLAHHGIMFVPLGYTFGSGMFEMDEVKGGSSYGAGTYAADGTRPPTE  183

Query  294  LELEQAFHQGKYIAAITKKLKS  229
            LEL+QAF+QG YIA I +KLK+
Sbjct  184  LELQQAFYQGTYIARIARKLKA  205



>ref|NP_001190538.1| flavodoxin-like quinone reductase 1 [Arabidopsis thaliana]
 gb|AED96503.1| flavodoxin-like quinone reductase 1 [Arabidopsis thaliana]
Length=244

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKLSAPPKSDV  652
            MATK+YIV+YS YGHVEKLA EI+KGA SVEGVEAKL+QVPETL +E L K+SAPPKS+ 
Sbjct  1    MATKVYIVYYSMYGHVEKLAEEIRKGAASVEGVEAKLWQVPETLHEEALSKMSAPPKSES  60

Query  651  PIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsqg  472
            PII+PN+L EADGFVFGFPTRFGMM+AQFKAFLDATGGLWR QALAGKPAG+FYSTGSQG
Sbjct  61   PIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQALAGKPAGIFYSTGSQG  120

Query  471  ggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGS  346
            GGQETTALTAITQLVHHGM+FVPIGY+FGAGMFEME VK G+
Sbjct  121  GGQETTALTAITQLVHHGMLFVPIGYTFGAGMFEMENVKAGA  162



>ref|XP_008649359.1| PREDICTED: flavoprotein-like protein YCP4 [Zea mays]
 gb|AFW77204.1| hypothetical protein ZEAMMB73_253341 [Zea mays]
Length=214

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = -3

Query  831  MATKLYIVFYSTYGHVEKLAHEIKKGADSVEGVEAKLFQVPETLSDEILGKL-SAPPKSD  655
            MATK+YIV+YST+GHV  LA EIKKGAD+V GVEA +++V ETL +E+LGK+ +AP + D
Sbjct  1    MATKIYIVYYSTWGHVAALAEEIKKGADAVAGVEATVWRVAETLPEEVLGKMGAAPARED  60

Query  654  VPIISPNDLTEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGLFYstgsq  475
             P+ISP  L +AD  + GFPTRFGMM+AQ KAFLDATGGLW+ QALAGKPAG+F  TG+Q
Sbjct  61   HPVISPRQLADADAVLLGFPTRFGMMAAQMKAFLDATGGLWQGQALAGKPAGVFLCTGTQ  120

Query  474  gggqetTALTAITQLVHHGMIFVPIGYSFGAGMFEMEKVKGGSPYGAGTYAG-DGSRQPS  298
            GGGQETTALTA+TQL HHGM+FVP+GY+FGAGMF +++V+GGSPYGAGT+AG DGSR P+
Sbjct  121  GGGQETTALTAVTQLAHHGMLFVPVGYTFGAGMFGIDQVRGGSPYGAGTFAGADGSRTPT  180

Query  297  QLELEQAFHQGKYIAAI  247
            ++EL  A HQG Y A I
Sbjct  181  EVELAMARHQGTYFAGI  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2217996789222