BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26105_g1_i1 len=1096 path=[1:0-1095]

Length=1096
                                                                      Score     E

ref|XP_006367465.1|  PREDICTED: oleosin 1-like                          176   5e-50   
ref|XP_004241990.1|  PREDICTED: oleosin 1-like                          175   5e-50   
ref|XP_009610907.1|  PREDICTED: oleosin 1-like                          175   6e-50   
ref|XP_009771392.1|  PREDICTED: oleosin 1-like                          175   6e-50   
gb|EYU19479.1|  hypothetical protein MIMGU_mgv1a015669mg                170   1e-47   
ref|XP_011081346.1|  PREDICTED: oleosin 1-like                          166   2e-46   
ref|XP_009796414.1|  PREDICTED: oleosin 1-like                          157   4e-43   
ref|XP_009614001.1|  PREDICTED: oleosin 1-like                          155   2e-42   
gb|AAX49392.1|  OLE-4                                                   150   3e-40   Coffea canephora [robusta coffee]
emb|CDP10020.1|  unnamed protein product                                147   5e-39   
ref|XP_004245807.1|  PREDICTED: oleosin 1-like                          145   2e-38   
ref|XP_006359267.1|  PREDICTED: oleosin 1-like                          142   3e-37   
ref|XP_003631370.1|  PREDICTED: oleosin 1                               135   8e-35   
ref|XP_010555609.1|  PREDICTED: oleosin Bn-III-like                     130   1e-32   
ref|XP_009606946.1|  PREDICTED: oleosin 1-like                          130   1e-32   
emb|CDP05381.1|  unnamed protein product                                129   2e-32   
gb|EYU20173.1|  hypothetical protein MIMGU_mgv1a015301mg                129   3e-32   
ref|XP_010109129.1|  Oleosin 1                                          129   3e-32   
ref|XP_008453870.1|  PREDICTED: oleosin 1-like                          128   4e-32   
ref|XP_010536555.1|  PREDICTED: oleosin 18.5 kDa-like                   128   5e-32   
gb|AFP19885.1|  14.3 kDa oleosin                                        127   9e-32   
gb|ABW90150.2|  oleosin 3                                               127   9e-32   Jatropha curcas
gb|AAX49390.1|  OLE-2                                                   127   1e-31   Coffea canephora [robusta coffee]
ref|XP_006421522.1|  hypothetical protein CICLE_v10006168mg             126   2e-31   
ref|XP_009764678.1|  PREDICTED: oleosin 1-like                          126   4e-31   
gb|ABQ57397.1|  oleosin L-isoform                                       126   4e-31   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_006490018.1|  PREDICTED: oleosin 1-like                          125   5e-31   
ref|XP_002304591.1|  Oleosin 18.5 kDa family protein                    125   5e-31   Populus trichocarpa [western balsam poplar]
gb|AAD42942.1|AF091840_1  15 kDa oleosin                                125   9e-31   Sesamum indicum [beniseed]
gb|ACH85188.1|  main allergen 15 kDa oleosin                            125   1e-30   Sesamum indicum [beniseed]
gb|ADB03184.1|  oleosin I                                               124   1e-30   Vernicia fordii [tung oil tree]
ref|XP_004146901.1|  PREDICTED: oleosin 18.5 kDa-like                   124   1e-30   
ref|XP_010038411.1|  PREDICTED: oleosin 1-like                          123   5e-30   
gb|EPS62608.1|  oleosin                                                 123   5e-30   
ref|XP_002281746.1|  PREDICTED: oleosin 1                               122   5e-30   Vitis vinifera
ref|XP_010693742.1|  PREDICTED: oleosin 1-like                          122   8e-30   
ref|XP_011076526.1|  PREDICTED: oleosin 1-like                          124   9e-30   
gb|ACG69518.1|  oleosin S3-6                                            122   2e-29   Brassica napus [oilseed rape]
ref|XP_010433682.1|  PREDICTED: oleosin 18.5 kDa                        122   2e-29   
ref|XP_009778273.1|  PREDICTED: oleosin 1-like                          121   2e-29   
ref|XP_009137499.1|  PREDICTED: oleosin 18.5 kDa-like                   122   2e-29   
ref|XP_009601962.1|  PREDICTED: oleosin 1-like                          121   2e-29   
ref|NP_194244.1|  oleosin 1                                             121   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404312.1|  PREDICTED: oleosin 16 kDa-like                     120   6e-29   
ref|XP_006285813.1|  hypothetical protein CARUB_v10007289mg             121   6e-29   
gb|AAO65960.1|  oleosin                                                 119   6e-29   Corylus avellana [European hazelnut]
gb|ACG69520.1|  oleosin S3-8                                            121   7e-29   Brassica napus [oilseed rape]
gb|EPS69345.1|  oleosin                                                 118   8e-29   
ref|XP_011022366.1|  PREDICTED: oleosin 1-like                          119   8e-29   
sp|P29109.1|OLEO5_BRANA  RecName: Full=Oleosin Bn-V; Short=BnV          120   8e-29   Brassica napus [oilseed rape]
emb|CDP10019.1|  unnamed protein product                                122   8e-29   
ref|XP_006413337.1|  hypothetical protein EUTSA_v10027215mg             120   9e-29   
ref|XP_002869688.1|  hypothetical protein ARALYDRAFT_492319             120   1e-28   
ref|XP_004240765.1|  PREDICTED: oleosin 1                               119   1e-28   
ref|XP_010438923.1|  PREDICTED: oleosin 18.5 kDa-like                   120   1e-28   
ref|XP_006357933.1|  PREDICTED: oleosin 1-like                          119   2e-28   
gb|ACG69517.1|  oleosin S3-5                                            119   2e-28   Brassica napus [oilseed rape]
emb|CDY03377.1|  BnaC01g17050D                                          119   2e-28   
ref|XP_004307777.1|  PREDICTED: oleosin 1-like                          119   2e-28   
gb|KFK29003.1|  hypothetical protein AALP_AA7G076700                    120   2e-28   
emb|CDY34345.1|  BnaA01g14480D                                          119   2e-28   
gb|ABD14345.1|  oleosin-like protein                                    119   3e-28   Brassica napus [oilseed rape]
ref|XP_009362716.1|  PREDICTED: oleosin 1-like                          118   3e-28   
sp|P29111.1|OLEO2_BRANA  RecName: Full=Major oleosin NAP-II             119   3e-28   Brassica napus [oilseed rape]
gb|ACG69516.1|  oleosin S3-4                                            119   3e-28   Brassica napus [oilseed rape]
sp|P29110.1|OLEO3_BRANA  RecName: Full=Oleosin Bn-III; Short=BnIII      119   3e-28   Brassica napus [oilseed rape]
gb|ACG69515.1|  oleosin S3-3                                            119   3e-28   Brassica napus [oilseed rape]
gb|AAW70038.1|  oleosin-like protein                                    119   4e-28   Brassica rapa
gb|ABF57563.1|  OleIII                                                  117   4e-28   Camellia oleifera [abura-tsubaki]
ref|XP_009138898.1|  PREDICTED: oleosin Bn-III                          119   5e-28   
ref|XP_009109224.1|  PREDICTED: oleosin 18.5 kDa                        118   5e-28   
ref|XP_011026733.1|  PREDICTED: oleosin 1-like                          117   5e-28   
gb|ACG69521.1|  oleosin S3-9                                            118   5e-28   Brassica napus [oilseed rape]
gb|ABB01619.1|  oleosin low molecular weight isoform                    117   6e-28   Linum usitatissimum
ref|XP_009333692.1|  PREDICTED: oleosin 1-like                          116   1e-27   
gb|ABB01620.1|  oleosin low molecular weight isoform                    116   2e-27   Linum usitatissimum
ref|XP_007218565.1|  hypothetical protein PRUPE_ppa012948mg             115   2e-27   
gb|ABB01617.1|  oleosin low molecular weight isoform                    115   5e-27   Linum usitatissimum
gb|AET74077.1|  oleosin                                                 114   5e-27   
ref|XP_008367838.1|  PREDICTED: oleosin 18.5 kDa-like                   113   6e-27   
gb|ACG69514.1|  oleosin S3-2                                            115   6e-27   Brassica napus [oilseed rape]
gb|ABB01618.1|  oleosin low molecular weight isoform                    114   7e-27   Linum usitatissimum
ref|XP_007144224.1|  hypothetical protein PHAVU_007G138300g             113   1e-26   
gb|AHI54563.1|  OleIII                                                  112   2e-26   
ref|XP_008234447.1|  PREDICTED: oleosin 1                               112   2e-26   
gb|ACG69513.1|  oleosin S3-1                                            113   4e-26   Brassica napus [oilseed rape]
gb|AET74076.1|  oleosin                                                 111   6e-26   
gb|AAZ20277.1|  oleosin 2                                               111   6e-26   Arachis hypogaea [goober]
ref|XP_002297927.1|  Oleosin 18.5 kDa family protein                    111   6e-26   Populus trichocarpa [western balsam poplar]
gb|AAZ20276.1|  oleosin 1                                               111   8e-26   Arachis hypogaea [goober]
ref|XP_010047300.1|  PREDICTED: oleosin 1                               110   1e-25   
gb|ABF57560.1|  OleII                                                   110   1e-25   Camellia oleifera [abura-tsubaki]
ref|XP_008376368.1|  PREDICTED: oleosin 1-like                          109   5e-25   
gb|KDP34143.1|  hypothetical protein JCGZ_07714                         109   5e-25   
gb|AFR46652.1|  oleosin1                                                108   7e-25   
emb|CDY08967.1|  BnaC08g11970D                                          109   8e-25   
emb|CDX77021.1|  BnaC04g38160D                                          108   1e-24   
ref|XP_002516493.1|  Oleosin, putative                                  110   1e-24   Ricinus communis
ref|XP_006853752.1|  hypothetical protein AMTR_s00056p00188310          108   1e-24   
ref|XP_004956407.1|  PREDICTED: oleosin Zm-I-like                       107   2e-24   
ref|XP_003556321.1|  PREDICTED: oleosin 1-like isoform 1                107   2e-24   
ref|XP_009140712.1|  PREDICTED: oleosin 1                               107   2e-24   
gb|KHG16380.1|  Oleosin 1                                               106   3e-24   
ref|NP_001237482.1|  uncharacterized protein LOC100306353               107   3e-24   
ref|XP_007038271.1|  Oleosin 1                                          106   3e-24   
ref|XP_011019556.1|  PREDICTED: oleosin 1-like                          108   5e-24   
ref|XP_006450748.1|  hypothetical protein CICLE_v10009815mg             106   6e-24   
ref|XP_002275496.1|  PREDICTED: oleosin 1                               106   6e-24   Vitis vinifera
ref|XP_002309527.2|  hypothetical protein POPTR_0006s25150g             107   6e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006295714.1|  hypothetical protein CARUB_v10024833mg             105   8e-24   
ref|XP_003591653.1|  Oleosin                                            105   1e-23   
ref|XP_007012203.1|  Oleosin                                            105   1e-23   
gb|KFK32534.1|  hypothetical protein AALP_AA6G255700                    104   2e-23   
ref|XP_002511014.1|  Oleosin 2                                          104   2e-23   Ricinus communis
ref|XP_009370420.1|  PREDICTED: oleosin 1-like                          104   2e-23   
emb|CAA57995.1|  low molecular weight oleosin                           104   2e-23   Hordeum vulgare [barley]
dbj|BAJ85423.1|  predicted protein                                      104   2e-23   
sp|Q96543.1|OLE16_BROSE  RecName: Full=Oleosin 16 kDa                   105   2e-23   Bromus secalinus [cheat]
ref|XP_009372826.1|  PREDICTED: oleosin 1-like                          103   8e-23   
ref|XP_010546531.1|  PREDICTED: oleosin 1                               102   8e-23   
ref|XP_008357299.1|  PREDICTED: oleosin 1-like                          103   8e-23   
ref|XP_010472616.1|  PREDICTED: oleosin 14.9 kDa-like                   102   9e-23   
gb|AAU21501.1|  oleosin 3                                               103   1e-22   Arachis hypogaea [goober]
ref|XP_008780784.1|  PREDICTED: oleosin 16 kDa-like                     102   1e-22   
ref|NP_001053473.1|  Os04g0546500                                       102   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417366.1|  PREDICTED: oleosin 1-like                          101   3e-22   
ref|XP_010668835.1|  PREDICTED: oleosin 16 kDa                          102   3e-22   
gb|AAC02239.1|  16 kDa oleosin                                          101   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010275437.1|  PREDICTED: oleosin 1-like                          100   4e-22   
ref|XP_002878899.1|  hypothetical protein ARALYDRAFT_901265             100   5e-22   
gb|AAO22794.1|  putative oleosin protein                                101   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786272.1|  PREDICTED: oleosin 16 kDa-like                     100   6e-22   
ref|XP_010429602.1|  PREDICTED: oleosin 14.9 kDa-like                   100   7e-22   
gb|AAC42242.1|  oleosin                                                 101   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180160.2|  Oleosin-like protein                                  100   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442776.1|  PREDICTED: oleosin 14.9 kDa-like                 99.8    1e-21   
emb|CAE02016.3|  OSJNBa0079A21.14                                       101   1e-21   
ref|XP_010244394.1|  PREDICTED: oleosin 16 kDa                        99.4    2e-21   
gb|AAF76238.1|AF273023_1  oleosin                                     99.0    2e-21   Elaeis guineensis
ref|NP_199934.1|  oleosin3                                            99.0    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482455.1|  PREDICTED: oleosin 14.9 kDa-like                 99.0    2e-21   
ref|XP_004501216.1|  PREDICTED: oleosin 1-like                        99.0    2e-21   
ref|XP_010919722.1|  PREDICTED: oleosin 16 kDa-like                   98.2    3e-21   
ref|XP_006282218.1|  hypothetical protein CARUB_v10028491mg           98.6    3e-21   
gb|AAO22633.1|  putative oleosin                                      98.2    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442605.1|  PREDICTED: oleosin 14.9 kDa                      98.2    3e-21   
gb|ACF82134.1|  unknown                                               98.6    4e-21   Zea mays [maize]
gb|AAA33481.1|  major protein L3                                      98.2    4e-21   Zea mays [maize]
ref|XP_003603568.1|  Oleosin                                          98.2    5e-21   
gb|AFR46654.1|  oleosin3                                              97.8    5e-21   
ref|XP_003580271.1|  PREDICTED: oleosin 16 kDa                        98.2    6e-21   
ref|XP_009386092.1|  PREDICTED: oleosin 16 kDa-like                   97.4    6e-21   
gb|ACG48556.1|  oleosin 16 kDa                                        99.8    7e-21   Zea mays [maize]
ref|XP_002448279.1|  hypothetical protein SORBIDRAFT_06g024350        97.8    8e-21   Sorghum bicolor [broomcorn]
ref|XP_002864102.1|  hypothetical protein ARALYDRAFT_495191           97.1    9e-21   
gb|KHN18226.1|  Oleosin 16 kDa                                        97.4    1e-20   
gb|AFG55837.1|  hypothetical protein 2_3802_02                        95.9    1e-20   
gb|KFK26734.1|  oleosin 1                                             96.7    1e-20   
ref|XP_003526464.2|  PREDICTED: oleosin 1-like                        98.2    1e-20   
gb|AFG55839.1|  hypothetical protein 2_3802_02                        94.4    3e-20   
gb|ACP27621.1|  L-oleosin                                             95.5    4e-20   Coix lacryma-jobi
ref|NP_001105338.1|  oleosin Zm-I                                     95.9    4e-20   Zea mays [maize]
ref|NP_001236098.1|  16.5 kDa oleosin                                 95.9    5e-20   
ref|XP_010934129.1|  PREDICTED: oleosin 16 kDa-like                   96.3    8e-20   
ref|XP_007137146.1|  hypothetical protein PHAVU_009G103600g           96.3    9e-20   
gb|AFK45755.1|  unknown                                               94.7    1e-19   
ref|XP_006371868.1|  hypothetical protein POPTR_0018s04820g           93.2    2e-19   
ref|XP_006402003.1|  hypothetical protein EUTSA_v10015754mg           93.2    2e-19   
gb|AAL40177.1|L76464_1  oleosin                                       93.2    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77750.1|  hypothetical protein OsI_16870                        90.5    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006653640.1|  PREDICTED: ethylene-responsive transcription...  93.2    2e-18   
gb|AFJ66235.1|  hypothetical protein 34G24.11                         90.9    2e-18   
gb|AGT63296.1|  oleosin                                               90.9    2e-18   
emb|CBI25770.3|  unnamed protein product                              92.8    3e-18   
ref|XP_009140871.1|  PREDICTED: oleosin 14.9 kDa                      90.1    3e-18   
gb|AGT21473.1|  oleosin-like                                          88.6    5e-18   
ref|XP_006837375.1|  hypothetical protein AMTR_s00111p00122760        87.8    2e-17   
gb|ACG69511.1|  oleosin S5-1                                          87.4    3e-17   Brassica napus [oilseed rape]
gb|ACH91012.1|  oleosin isoform OLE500a                               83.6    2e-16   Cocos nucifera
ref|XP_007209683.1|  hypothetical protein PRUPE_ppa012323mg           85.9    2e-16   
ref|XP_010251121.1|  PREDICTED: oleosin 21.2 kDa-like                 84.0    4e-16   
gb|AAD41080.1|AF147758_1  oleosin                                     82.4    4e-16   Elaeis guineensis
ref|XP_009602797.1|  PREDICTED: oleosin 1                             84.0    5e-16   
ref|XP_006355299.1|  PREDICTED: oleosin 1-like                        83.6    6e-16   
ref|XP_010238066.1|  PREDICTED: oleosin 16 kDa-like                   84.3    7e-16   
ref|XP_002965728.1|  hypothetical protein SELMODRAFT_84903            84.0    8e-16   
ref|XP_008244042.1|  PREDICTED: oleosin 1-like                        83.6    1e-15   
ref|XP_004148427.1|  PREDICTED: oleosin 16 kDa-like                   82.4    1e-15   
ref|XP_009757495.1|  PREDICTED: oleosin 1-like                        82.4    2e-15   
ref|XP_008444982.1|  PREDICTED: oleosin 1-like                        82.0    2e-15   
ref|XP_010110789.1|  Oleosin 16 kDa                                   82.4    2e-15   
ref|XP_004299241.1|  PREDICTED: oleosin 16 kDa-like                   82.4    3e-15   
ref|XP_010915347.1|  PREDICTED: oleosin 1                             81.3    3e-15   
ref|XP_006341651.1|  PREDICTED: oleosin 1-like                        82.8    4e-15   
ref|XP_007036421.1|  Oleosin family protein                           81.6    5e-15   
gb|AIC74543.1|  oleosin-G                                             80.5    7e-15   
ref|XP_008436973.1|  PREDICTED: oleosin 1-like                        80.1    9e-15   
ref|XP_004508582.1|  PREDICTED: oleosin 1-like                        80.9    1e-14   
gb|AAX49393.1|  OLE-5                                                 80.5    1e-14   Coffea canephora [robusta coffee]
ref|XP_010924186.1|  PREDICTED: oleosin 1-like                        80.1    2e-14   
ref|XP_009767218.1|  PREDICTED: oleosin 1                             80.1    2e-14   
ref|XP_003609083.1|  Oleosin                                          79.3    3e-14   
ref|XP_004245383.1|  PREDICTED: oleosin 16 kDa-like                   78.6    4e-14   
ref|XP_003524510.1|  PREDICTED: oleosin 1-like                        79.0    5e-14   
ref|XP_007155152.1|  hypothetical protein PHAVU_003G177800g           78.6    5e-14   
ref|XP_006596702.1|  PREDICTED: oleosin 1-like                        78.2    7e-14   
ref|XP_009601383.1|  PREDICTED: oleosin 1                             78.2    1e-13   
ref|XP_006842689.1|  hypothetical protein AMTR_s00147p00069460        78.2    1e-13   
ref|XP_006440904.1|  hypothetical protein CICLE_v10022589mg           78.2    1e-13   
ref|XP_006494251.1|  PREDICTED: oleosin 1-like                        77.8    1e-13   
dbj|BAK03796.1|  predicted protein                                    77.8    1e-13   
ref|XP_002468711.1|  hypothetical protein SORBIDRAFT_01g050670        77.4    1e-13   Sorghum bicolor [broomcorn]
gb|ACH91013.1|  oleosin isoform OLE500c                               75.5    1e-13   Cocos nucifera
ref|XP_010924760.1|  PREDICTED: oleosin 1-like                        77.4    1e-13   
ref|XP_004236249.1|  PREDICTED: oleosin 18.2 kDa-like                 77.4    2e-13   
gb|ABK40507.1|  pollen oleosin                                        77.0    2e-13   Lilium longiflorum [Easter lily]
ref|XP_006344451.1|  PREDICTED: oleosin 18.2 kDa-like                 76.6    2e-13   
gb|KGN50321.1|  Oleosin-like protein                                  77.8    2e-13   
gb|EPS64539.1|  oleosin                                               76.6    3e-13   
ref|XP_002441561.1|  hypothetical protein SORBIDRAFT_09g029350        76.3    4e-13   Sorghum bicolor [broomcorn]
ref|XP_002975381.1|  hypothetical protein SELMODRAFT_18412            75.5    6e-13   
ref|XP_010262686.1|  PREDICTED: oleosin 1-like                        75.9    7e-13   
ref|XP_010451202.1|  PREDICTED: oleosin 18.5 kDa-like                 74.7    8e-13   
ref|XP_010497693.1|  PREDICTED: oleosin 21.2 kDa                      74.7    8e-13   
ref|XP_008800936.1|  PREDICTED: oleosin 1-like                        75.1    1e-12   
gb|KFK33105.1|  hypothetical protein AALP_AA6G331800                  76.3    1e-12   
ref|XP_003549810.1|  PREDICTED: oleosin 1-like                        75.1    1e-12   
gb|KDP22470.1|  hypothetical protein JCGZ_26301                       73.6    1e-12   
ref|XP_006405494.1|  hypothetical protein EUTSA_v10028039mg           75.1    2e-12   
ref|XP_011071914.1|  PREDICTED: oleosin 18.2 kDa-like                 74.3    2e-12   
ref|XP_009625249.1|  PREDICTED: oleosin 18.2 kDa-like                 74.3    2e-12   
gb|AAB58402.1|  15.5 kDa oleosin                                      73.9    2e-12   Sesamum indicum [beniseed]
gb|ABQ57396.1|  oleosin H-isoform                                     73.9    3e-12   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_002868651.1|  hypothetical protein ARALYDRAFT_493945           74.7    3e-12   
ref|XP_002987365.1|  hypothetical protein SELMODRAFT_18396            73.2    3e-12   
ref|XP_010435899.1|  PREDICTED: oleosin 21.2 kDa-like                 74.7    3e-12   
gb|AAX49389.1|  OLE-1                                                 73.6    3e-12   Coffea canephora [robusta coffee]
ref|XP_006285841.1|  hypothetical protein CARUB_v10007329mg           74.3    3e-12   
ref|XP_002970414.1|  hypothetical protein SELMODRAFT_18324            72.8    4e-12   
emb|CBI15408.3|  unnamed protein product                              76.3    4e-12   
ref|XP_006399237.1|  hypothetical protein EUTSA_v10015089mg           72.4    4e-12   
ref|XP_004987230.1|  PREDICTED: oleosin 16 kDa-like                   73.2    4e-12   
ref|XP_004232322.1|  PREDICTED: oleosin 5-like                        73.2    4e-12   
emb|CDP12758.1|  unnamed protein product                              73.2    4e-12   
gb|AAB01098.1|  oleosin                                               73.6    5e-12   Daucus carota [carrots]
ref|XP_009621597.1|  PREDICTED: oleosin 14.9 kDa-like                 70.5    5e-12   
ref|XP_008810983.1|  PREDICTED: oleosin 1-like                        73.2    5e-12   
ref|XP_006338595.1|  PREDICTED: oleosin 5-like                        73.2    5e-12   
ref|XP_006655620.1|  PREDICTED: oleosin 16 kDa-like                   72.4    6e-12   
ref|XP_004235733.1|  PREDICTED: oleosin 1-like                        73.2    6e-12   
ref|NP_198858.1|  oleosin 2                                           73.6    6e-12   Arabidopsis thaliana [mouse-ear cress]
sp|P29528.1|OLEO7_GOSHI  RecName: Full=Oleosin 16.4 kDa               72.8    7e-12   Gossypium hirsutum [American cotton]
ref|XP_010425544.1|  PREDICTED: oleosin 20.3 kDa-like                 73.2    8e-12   
ref|XP_001766397.1|  predicted protein                                72.4    9e-12   
ref|XP_006470260.1|  PREDICTED: oleosin 18.2 kDa-like                 72.8    9e-12   
ref|XP_002511984.1|  Oleosin, putative                                72.4    1e-11   Ricinus communis
gb|AAR15433.1|  pollen coat oleosin-glycine rich protein              71.2    1e-11   Sisymbrium irio
ref|XP_009609885.1|  PREDICTED: oleosin 18.2 kDa-like                 72.4    1e-11   
ref|XP_009346735.1|  PREDICTED: oleosin 1-like                        72.0    2e-11   
gb|KDP20078.1|  hypothetical protein JCGZ_05847                       71.6    2e-11   
ref|XP_009772501.1|  PREDICTED: oleosin 5-like                        71.6    2e-11   
emb|CAA63022.1|  oleosin type2                                        72.0    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423194.1|  PREDICTED: oleosin-B1-like                       70.1    2e-11   
gb|AAY14574.1|  oleosin                                               71.2    2e-11   Coffea arabica [arabica coffee]
ref|XP_009764833.1|  PREDICTED: oleosin 18.2 kDa-like                 71.2    3e-11   
ref|XP_010491374.1|  PREDICTED: oleosin-B1                            70.1    3e-11   
ref|XP_010452722.1|  PREDICTED: oleosin-B1-like                       69.7    3e-11   
gb|AAB24078.1|  lipid body membrane protein                           71.6    3e-11   Daucus carota [carrots]
ref|XP_010514477.1|  PREDICTED: oleosin 20.3 kDa-like                 71.6    3e-11   
ref|XP_002273242.2|  PREDICTED: oleosin 18.2 kDa                      72.4    3e-11   Vitis vinifera
ref|XP_008364644.1|  PREDICTED: oleosin 1-like                        70.9    4e-11   
ref|XP_006290020.1|  hypothetical protein CARUB_v10003652mg           69.3    4e-11   
ref|XP_002966097.1|  hypothetical protein SELMODRAFT_28429            70.5    4e-11   
gb|AIA08667.1|  putative oleosin protein                              70.5    4e-11   
ref|XP_008458798.1|  PREDICTED: oleosin 18.2 kDa-like                 71.6    5e-11   
ref|XP_002322186.2|  hypothetical protein POPTR_0015s09360g           70.5    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002300049.2|  hypothetical protein POPTR_0001s35270g           71.2    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010502771.1|  PREDICTED: oleosin 20.3 kDa                      70.9    6e-11   
ref|XP_002281381.1|  PREDICTED: oleosin 18.2 kDa                      69.7    6e-11   Vitis vinifera
ref|XP_006293022.1|  hypothetical protein CARUB_v10019300mg           70.5    6e-11   
ref|XP_010108818.1|  Oleosin 5                                        70.1    7e-11   
gb|AAG24455.1|AF311746_1  19 kDa oleosin                              70.5    7e-11   
ref|XP_011077446.1|  PREDICTED: oleosin 1                             69.7    8e-11   
ref|XP_010528231.1|  PREDICTED: oleosin 21.2 kDa-like                 69.7    8e-11   
emb|CDX81061.1|  BnaC03g03150D                                        68.9    8e-11   
ref|XP_011005135.1|  PREDICTED: oleosin 18.2 kDa-like                 69.3    1e-10   
ref|XP_002966712.1|  hypothetical protein SELMODRAFT_407827           69.7    1e-10   
ref|XP_006446574.1|  hypothetical protein CICLE_v10016997mg           69.7    1e-10   
ref|XP_004493360.1|  PREDICTED: P24 oleosin isoform A-like            70.1    1e-10   
emb|CDY03988.1|  BnaC02g37030D                                        69.7    1e-10   
ref|XP_006306473.1|  hypothetical protein CARUB_v10012438mg           69.3    1e-10   
ref|XP_002891470.1|  hypothetical protein ARALYDRAFT_474043           69.3    1e-10   
ref|XP_008346731.1|  PREDICTED: oleosin 16.4 kDa-like                 70.1    1e-10   
gb|AAR15434.1|  pollen coat oleosin-glycine rich protein              67.8    2e-10   
ref|XP_010524296.1|  PREDICTED: oleosin 5 isoform X1                  68.9    2e-10   
ref|XP_002961506.1|  hypothetical protein SELMODRAFT_403436           68.6    2e-10   
ref|XP_007215103.1|  hypothetical protein PRUPE_ppa012747mg           68.6    2e-10   
ref|XP_010102499.1|  Oleosin 5                                        68.6    2e-10   
emb|CDX92248.1|  BnaA05g21590D                                        68.6    2e-10   
ref|XP_002971301.1|  hypothetical protein SELMODRAFT_94635            68.2    2e-10   
ref|XP_008795990.1|  PREDICTED: oleosin 21.2 kDa-like                 68.6    2e-10   
gb|AAG09751.1|AF237625_1  oleosin                                     68.6    3e-10   
sp|P29529.1|OLEO_HELAN  RecName: Full=Oleosin                         68.9    3e-10   
gb|ACG69503.1|  oleosin S2-1                                          68.9    3e-10   
ref|XP_009129400.1|  PREDICTED: oleosin S2-2-like                     68.9    3e-10   
ref|XP_009799883.1|  PREDICTED: oleosin 18.2 kDa-like                 68.2    3e-10   
ref|XP_010465964.1|  PREDICTED: oleosin 1-like                        68.6    3e-10   
ref|XP_002318659.2|  hypothetical protein POPTR_0012s08530g           68.2    3e-10   
ref|XP_009145881.1|  PREDICTED: oleosin 1-like                        68.6    3e-10   
ref|XP_010507004.1|  PREDICTED: oleosin 1-like                        68.6    3e-10   
emb|CDX99345.1|  BnaC05g34600D                                        68.2    3e-10   
gb|EPS67137.1|  oleosin                                               68.2    3e-10   
ref|XP_010506995.1|  PREDICTED: oleosin 1-like                        68.6    3e-10   
gb|KFK33678.1|  hypothetical protein AALP_AA5G045600                  68.6    3e-10   
ref|XP_006395410.1|  hypothetical protein EUTSA_v10005366mg           68.9    3e-10   
sp|P29527.1|OLEO6_GOSHI  RecName: Full=Oleosin 18.2 kDa               68.2    3e-10   
ref|XP_009605264.1|  PREDICTED: oleosin 5-like                        68.2    3e-10   
gb|EYU34735.1|  hypothetical protein MIMGU_mgv1a026303mg              70.1    4e-10   
gb|AAQ56112.1|  pollen specific glycine-rich protein GRP19            66.6    4e-10   
emb|CDY11685.1|  BnaC06g12930D                                        68.6    4e-10   
gb|AAK83833.1|  glycine-rich protein GRP19                            67.0    4e-10   
emb|CDX67456.1|  BnaA07g14960D                                        68.6    4e-10   
ref|XP_010500440.1|  PREDICTED: oleosin 16 kDa-like                   68.2    4e-10   
ref|XP_009125136.1|  PREDICTED: oleosin 21.2 kDa-like                 68.6    4e-10   
ref|XP_010695618.1|  PREDICTED: oleosin 1-like                        67.8    4e-10   
ref|XP_007031561.1|  Oleosin family protein, putative                 67.8    4e-10   
emb|CDP19364.1|  unnamed protein product                              67.4    4e-10   
gb|ACG69508.1|  oleosin S4-2                                          68.6    4e-10   
gb|ABF57561.1|  OleIV                                                 67.8    5e-10   
emb|CAA63011.1|  oleosin type4                                        68.2    5e-10   
ref|NP_189403.1|  oleosin 4                                           68.2    5e-10   
gb|AAM63098.1|  oleosin isoform                                       68.2    5e-10   
ref|XP_010461720.1|  PREDICTED: oleosin 16 kDa-like                   67.8    5e-10   
gb|EYU28276.1|  hypothetical protein MIMGU_mgv1a015478mg              67.4    5e-10   
gb|AAR15481.1|  pollen coat oleosin-glycine rich protein              66.2    6e-10   
ref|XP_009612534.1|  PREDICTED: oleosin 18.2 kDa-like                 67.4    6e-10   
ref|XP_002875395.1|  hypothetical protein ARALYDRAFT_484554           67.8    7e-10   
ref|XP_010037528.1|  PREDICTED: oleosin 5-like                        67.0    7e-10   
ref|XP_006406591.1|  hypothetical protein EUTSA_v10021947mg           67.0    8e-10   
ref|XP_006847626.1|  hypothetical protein AMTR_s00014p00251930        66.6    9e-10   
ref|XP_006399238.1|  hypothetical protein EUTSA_v10015090mg           65.9    9e-10   
ref|XP_010479327.1|  PREDICTED: oleosin 16 kDa-like                   67.0    9e-10   
ref|XP_011047822.1|  PREDICTED: oleosin 16.4 kDa-like                 67.0    9e-10   
ref|XP_003527133.2|  PREDICTED: oleosin Bn-V-like                     67.4    9e-10   
ref|XP_003549608.1|  PREDICTED: P24 oleosin isoform B-like            66.6    1e-09   
gb|AFR46653.1|  oleosin2                                              66.2    1e-09   
ref|XP_006300117.1|  hypothetical protein CARUB_v10016346mg           66.6    1e-09   
ref|XP_010910343.1|  PREDICTED: oleosin 18 kDa-like                   66.2    1e-09   
gb|ABF57562.1|  OleV                                                  66.2    1e-09   
gb|ACG37867.1|  oleosin Bn-V                                          66.2    1e-09   
gb|ACG69507.1|  oleosin S4-1                                          67.0    1e-09   
ref|XP_009782086.1|  PREDICTED: oleosin 18.2 kDa-like                 66.2    2e-09   
ref|XP_004141106.1|  PREDICTED: oleosin 5-like                        65.9    2e-09   
ref|NP_196372.1|  glycine-rich protein 19                             64.7    2e-09   
gb|ABW90149.2|  oleosin 2                                             65.9    2e-09   
gb|AAD10371.1|  early embryogenesis protein                           65.9    2e-09   
ref|NP_001152711.1|  oleosin Bn-V                                     65.5    2e-09   
gb|EYU44783.1|  hypothetical protein MIMGU_mgv1a014985mg              65.5    3e-09   
gb|KFK33679.1|  hypothetical protein AALP_AA5G045700                  68.9    3e-09   
ref|XP_004961136.1|  PREDICTED: oleosin 16 kDa-like                   65.5    3e-09   
ref|XP_009111581.1|  PREDICTED: oleosin S2-2                          65.9    3e-09   
ref|XP_004142849.1|  PREDICTED: oleosin 18.2 kDa-like                 65.5    3e-09   
gb|ACG69509.1|  oleosin S4-3                                          66.2    3e-09   
ref|XP_004251808.1|  PREDICTED: oleosin 5-like                        65.5    3e-09   
ref|XP_008443562.1|  PREDICTED: oleosin 18.2 kDa                      65.5    3e-09   
gb|EYU20399.1|  hypothetical protein MIMGU_mgv1a016041mg              64.7    4e-09   
ref|XP_004304649.1|  PREDICTED: oleosin 18.2 kDa-like                 65.1    4e-09   
gb|KGN51363.1|  Oleosin 2                                             65.5    4e-09   
dbj|BAB09005.1|  unnamed protein product                              65.9    4e-09   
gb|AAR15445.1|  pollen coat oleosin-glycine rich protein              63.9    4e-09   
emb|CDY50118.1|  BnaC04g32530D                                        65.9    4e-09   
ref|XP_009361546.1|  PREDICTED: oleosin 1-like                        63.9    4e-09   
emb|CAA43182.1|  24 kDa oleosin isoform                               64.7    5e-09   
ref|XP_007036351.1|  Oleosin family protein, putative                 65.1    5e-09   
ref|XP_011098431.1|  PREDICTED: oleosin 18.2 kDa-like                 64.7    5e-09   
ref|XP_008230552.1|  PREDICTED: oleosin 18.2 kDa-like                 64.7    5e-09   
ref|XP_006298643.1|  hypothetical protein CARUB_v10014732mg           65.1    5e-09   
ref|XP_010678836.1|  PREDICTED: oleosin 18.2 kDa-like                 64.7    5e-09   
ref|XP_010248607.1|  PREDICTED: oleosin 18.2 kDa-like                 64.3    5e-09   
ref|XP_008239310.1|  PREDICTED: oleosin 16.4 kDa-like                 65.1    6e-09   
gb|AAR15496.1|  pollen coat oleosin-glycine rich protein              63.5    6e-09   
gb|AAG43516.1|AF210696_1  15kD oleosin-like protein 1                 63.9    7e-09   
ref|XP_008220136.1|  PREDICTED: oleosin 1-like                        63.5    7e-09   
ref|XP_009392929.1|  PREDICTED: oleosin 1-like                        64.3    7e-09   
ref|XP_006477549.1|  PREDICTED: oleosin 18 kDa-like                   64.3    7e-09   
gb|AGG78364.1|  oleosin                                               63.5    7e-09   
ref|XP_007209574.1|  hypothetical protein PRUPE_ppa011111mg           65.1    8e-09   
ref|XP_008341422.1|  PREDICTED: oleosin 18.2 kDa                      64.3    8e-09   
gb|KDP31050.1|  hypothetical protein JCGZ_11426                       63.9    9e-09   
ref|XP_010033312.1|  PREDICTED: oleosin 18.2 kDa-like                 64.3    9e-09   
ref|XP_008365377.1|  PREDICTED: oleosin 18.2 kDa-like                 64.3    9e-09   
gb|KFK39208.1|  hypothetical protein AALP_AA3G213400                  63.9    1e-08   
ref|XP_009334119.1|  PREDICTED: oleosin 18.2 kDa                      63.9    1e-08   
ref|NP_001078543.1|  glycine-rich protein 19                          62.4    1e-08   
ref|XP_011010368.1|  PREDICTED: oleosin 1-like                        63.9    1e-08   
gb|ABB01624.1|  oleosin high molecular weight isoform                 63.9    1e-08   
ref|XP_006350024.1|  PREDICTED: oleosin 5-like                        63.5    1e-08   
gb|AAG01171.1|AF288622_1  seed oleosin isoform 1                      63.5    1e-08   
ref|XP_009140003.1|  PREDICTED: oleosin 21.2 kDa-like                 64.3    1e-08   
gb|AAQ56113.1|  pollen specific glycine-rich protein GRP16            63.9    1e-08   
ref|XP_011046251.1|  PREDICTED: oleosin 16.4 kDa-like                 63.5    1e-08   
ref|XP_002882173.1|  glycine-rich protein                             63.5    2e-08   
emb|CAN80216.1|  hypothetical protein VITISV_043128                   62.8    2e-08   
ref|XP_011097414.1|  PREDICTED: oleosin 16.4 kDa                      63.2    2e-08   
ref|XP_006289949.1|  hypothetical protein CARUB_v10003577mg           65.5    2e-08   
sp|C3S7F0.1|OLES1_BRANA  RecName: Full=Oleosin S1-2                   63.5    2e-08   
ref|XP_006408525.1|  hypothetical protein EUTSA_v10021571mg           63.5    2e-08   
ref|XP_002864743.1|  glycine-rich protein                             63.9    2e-08   
gb|AAR15461.1|  pollen coat oleosin-glycine rich protein              65.5    2e-08   
ref|XP_003618145.1|  Oleosin                                          63.5    2e-08   
ref|XP_002323804.1|  oleosin family protein                           62.8    2e-08   
emb|CDX82338.1|  BnaA03g34830D                                        62.8    2e-08   
ref|XP_010497851.1|  PREDICTED: oleosin GRP-17-like                   61.2    2e-08   
gb|AAQ56111.1|  pollen specific glycine-rich protein GRP17            65.1    3e-08   
ref|XP_002273158.3|  PREDICTED: P24 oleosin isoform A                 62.8    3e-08   
gb|ACA30297.1|  putative oleosin                                      62.0    3e-08   
gb|ADB03185.1|  oleosin II                                            62.4    3e-08   
ref|XP_002873316.1|  pollen specific glycine-rich protein GRP19       61.6    3e-08   
ref|XP_004292835.1|  PREDICTED: oleosin 14.9 kDa-like                 62.0    3e-08   
ref|XP_009136039.1|  PREDICTED: oleosin 1-like                        62.8    3e-08   
ref|XP_007225060.1|  hypothetical protein PRUPE_ppa018784mg           61.6    3e-08   
gb|ADD17087.1|  putative oleosin                                      62.8    3e-08   
ref|XP_004298983.1|  PREDICTED: oleosin 5-like                        62.8    3e-08   
gb|AAG43517.1|AF210697_1  15kD oleosin-like protein 2                 61.6    4e-08   
ref|XP_010496295.1|  PREDICTED: oleosin 5-like                        62.4    4e-08   
gb|ABB01616.1|  oleosin high molecular weight isoform                 62.0    5e-08   
emb|CDX78300.1|  BnaA03g02120D                                        60.1    5e-08   
ref|XP_010435635.1|  PREDICTED: oleosin 5                             62.0    5e-08   
ref|XP_002317928.1|  glycine-rich family protein                      61.6    5e-08   
ref|XP_009377176.1|  PREDICTED: oleosin 18.2 kDa-like                 61.6    6e-08   
ref|XP_009404978.1|  PREDICTED: oleosin 1-like                        61.6    6e-08   
gb|AAO67349.2|  oleosin                                               61.6    6e-08   
gb|AAL92479.1|  oleosin                                               61.6    6e-08   
ref|XP_008777688.1|  PREDICTED: oleosin 18 kDa-like                   60.8    7e-08   
ref|NP_186806.1|  oleosin 5                                           61.6    7e-08   
ref|NP_200969.4|  oleosin                                             63.2    7e-08   
emb|CDY70779.1|  BnaA10g30180D                                        61.6    8e-08   
gb|ABF57559.1|  OleI                                                  60.8    8e-08   
ref|XP_009361547.1|  PREDICTED: oleosin 16 kDa-like                   60.5    9e-08   
ref|XP_009370385.1|  PREDICTED: oleosin 5-like                        60.8    1e-07   
gb|ACG69510.1|  oleosin S4-4                                          61.6    1e-07   
ref|XP_010452724.1|  PREDICTED: oleosin-B1-like                       60.5    1e-07   
gb|AAT11925.1|  oleosin isoform                                       60.8    1e-07   
gb|EYU22164.1|  hypothetical protein MIMGU_mgv1a021055mg              59.7    1e-07   
ref|NP_001056403.1|  Os05g0576700                                     60.5    1e-07   
ref|XP_004515879.1|  PREDICTED: oleosin 18 kDa-like                   60.5    2e-07   
ref|XP_008798606.1|  PREDICTED: oleosin 16 kDa                        59.7    2e-07   
ref|NP_850788.2|  glycine-rich protein 16                             60.8    2e-07   
gb|AFK36792.1|  unknown                                               60.8    2e-07   
emb|CDX91941.1|  BnaC03g32430D                                        63.2    2e-07   
ref|XP_002873315.1|  hypothetical protein ARALYDRAFT_908702           61.2    2e-07   
gb|EPS60535.1|  hypothetical protein M569_14267                       59.7    2e-07   
ref|XP_009134605.1|  PREDICTED: oleosin S1-2                          60.5    2e-07   
ref|XP_008801946.1|  PREDICTED: oleosin 18 kDa-like                   59.7    2e-07   
gb|AAR15495.1|  pollen coat oleosin-glycine rich protein              61.2    2e-07   
gb|ACI87763.1|  putative oleosin                                      58.5    2e-07   
gb|AAR15444.1|  pollen coat oleosin-glycine rich protein              60.8    2e-07   
gb|AHI54566.1|  OleI                                                  59.3    3e-07   
gb|AAK83846.1|  glycine-rich protein GRP16                            60.5    3e-07   
emb|CAA77893.1|  Glycine-rich protein                                 60.5    3e-07   
ref|XP_006399240.1|  hypothetical protein EUTSA_v10014500mg           60.8    3e-07   
ref|XP_006408828.1|  hypothetical protein EUTSA_v10002154mg           58.9    3e-07   
gb|AAK83847.1|  glycine-rich protein GRP16                            60.5    3e-07   
dbj|BAJ87238.1|  predicted protein                                    59.7    3e-07   
gb|AAK83834.1|  glycine-rich protein GRP16                            60.5    3e-07   
ref|XP_006289379.1|  hypothetical protein CARUB_v10002873mg           62.0    3e-07   
gb|AAR15460.1|  pollen coat oleosin-glycine rich protein              62.0    3e-07   
ref|NP_001146998.1|  oleosin 16 kDa                                   59.3    4e-07   
gb|AGG78360.1|  oleosin-1                                             59.3    4e-07   
ref|XP_011011823.1|  PREDICTED: oleosin 18.2 kDa-like                 58.9    4e-07   
ref|NP_196371.1|  glycine-rich protein 16                             60.5    4e-07   
emb|CAA57994.1|  high molecular weight oleosin                        59.3    4e-07   
gb|EEE64794.1|  hypothetical protein OsJ_19650                        60.1    4e-07   
gb|AAK13450.1|  oleosin variant B                                     59.3    4e-07   
emb|CDP02073.1|  unnamed protein product                              58.9    4e-07   
gb|AGG78359.1|  oleosin-2                                             58.5    4e-07   
ref|WP_033581554.1|  hypothetical protein                             58.2    4e-07   
ref|XP_001756137.1|  predicted protein                                59.3    4e-07   
gb|AHI54573.1|  OleIV                                                 58.9    5e-07   
ref|NP_001238518.1|  P24 oleosin isoform B                            59.7    5e-07   
gb|AAK38472.1|  putative oleosin                                      61.2    5e-07   
ref|XP_002511342.1|  Oleosin 18.2 kDa, putative                       58.5    5e-07   
emb|CDY60494.1|  BnaCnng36370D                                        59.7    5e-07   
gb|AAX49391.1|  OLE-3                                                 58.9    5e-07   
gb|ABW90148.2|  oleosin 1                                             58.5    5e-07   
gb|KEH22161.1|  oleosin                                               58.9    5e-07   
gb|KFK37622.1|  hypothetical protein AALP_AA3G007200                  59.3    5e-07   
gb|KFK34264.1|  hypothetical protein AALP_AA5G122400                  58.5    6e-07   
ref|XP_006394487.1|  hypothetical protein EUTSA_v10005330mg           59.7    6e-07   
gb|AAK13449.1|  oleosin variant A                                     58.9    6e-07   
gb|AAU21499.2|  oleosin 1                                             58.5    7e-07   
sp|P29530.2|OLEO1_SOYBN  RecName: Full=P24 oleosin isoform A; Alt...  59.3    7e-07   
ref|XP_008360893.1|  PREDICTED: oleosin 1-like                        58.5    7e-07   
gb|AAR15463.1|  pollen coat oleosin-glycine rich protein              58.5    7e-07   
ref|NP_001119185.1|  glycine rich protein 17                          60.8    7e-07   
ref|XP_010936629.1|  PREDICTED: oleosin 5-like                        57.8    8e-07   
gb|AGG78357.1|  oleosin-2                                             58.5    8e-07   
ref|XP_006286767.1|  hypothetical protein CARUB_v10003317mg           58.2    8e-07   
gb|AAQ56114.1|  pollen specific glycine-rich protein GRP20            57.4    8e-07   
ref|XP_003553822.1|  PREDICTED: P24 oleosin isoform A                 58.9    9e-07   



>ref|XP_006367465.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=134

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPRHEQQLS QVAKT TAVT+GGSLM+LSGLTL AT+IGL + TPLLVIFSPVLVPA +T
Sbjct  4    QPRHEQQLSRQVAKTTTAVTVGGSLMVLSGLTLAATVIGLAIVTPLLVIFSPVLVPAVIT  63

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               IL GFLASG FGATA+FVFYWMYRY TGKHPIGA KIDYAR+K+++AA D+KEKAEQ
Sbjct  64   LGLILGGFLASGGFGATASFVFYWMYRYVTGKHPIGATKIDYARDKIAHAANDVKEKAEQ  123

Query  589  LAAQ  600
            L  Q
Sbjct  124  LGHQ  127



>ref|XP_004241990.1| PREDICTED: oleosin 1-like [Solanum lycopersicum]
Length=134

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPRHEQ LS QVAKT TAVT+GGSLM+LSGL L AT+IGL +ATPLLVIFSPVLVPA +T
Sbjct  4    QPRHEQHLSRQVAKTTTAVTVGGSLMVLSGLMLAATVIGLAIATPLLVIFSPVLVPAVIT  63

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               IL GFLASG FGATA+FVFYWMYRY TGKHPIGA KIDYAR+K+++AA D+KEKAEQ
Sbjct  64   IGLILGGFLASGGFGATASFVFYWMYRYVTGKHPIGATKIDYARDKIAHAANDVKEKAEQ  123

Query  589  LAAQ  600
            L  Q
Sbjct  124  LGHQ  127



>ref|XP_009610907.1| PREDICTED: oleosin 1-like [Nicotiana tomentosiformis]
Length=134

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPR EQQLS QVAKT TAVT+GGSLM+LSGLTL AT+IGL +ATPLLVIFSPVLVPA +T
Sbjct  4    QPRPEQQLSRQVAKTTTAVTVGGSLMVLSGLTLAATVIGLAIATPLLVIFSPVLVPAVIT  63

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               ILAGFLA+G FGATA+FVFYWMYRY TGKHPIGA KIDYAR+K+++AA D+KEKAEQ
Sbjct  64   VGLILAGFLATGGFGATASFVFYWMYRYVTGKHPIGASKIDYARDKIAHAAHDVKEKAEQ  123

Query  589  LAAQPGNK  612
            L  Q G +
Sbjct  124  LGHQAGQQ  131



>ref|XP_009771392.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=134

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPR EQQLS QVAKT TAVT+GGSLM+LS LTL AT+IGL VATPLLVIFSPVLVPA +T
Sbjct  4    QPRPEQQLSRQVAKTTTAVTVGGSLMVLSSLTLAATVIGLAVATPLLVIFSPVLVPAVIT  63

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               ILAGFLA+G FGATA+FVFYWMYRY TGKHPIGA KIDYAR+K+++AA D+KEKAEQ
Sbjct  64   VGLILAGFLATGGFGATASFVFYWMYRYVTGKHPIGASKIDYARDKIAHAAYDVKEKAEQ  123

Query  589  LAAQPGNK  612
            L  Q G +
Sbjct  124  LGHQAGQQ  131



>gb|EYU19479.1| hypothetical protein MIMGU_mgv1a015669mg [Erythranthe guttata]
Length=149

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  223  YYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAA  402
            Y +P H+QQLS QVAKT TAVT+GGSLM+LSGLTL AT+IGLV+ATPLLVIFSPVLVPAA
Sbjct  12   YDEPHHKQQLSRQVAKTTTAVTLGGSLMVLSGLTLAATVIGLVLATPLLVIFSPVLVPAA  71

Query  403  LTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKA  582
            +T F I AG   SG FGATA+FVFYWMYRYATGKHPIGAD++D AREK S+AA D+KEKA
Sbjct  72   ITLFLIFAGLATSGGFGATASFVFYWMYRYATGKHPIGADQLDRAREKFSHAAHDVKEKA  131

Query  583  EQLAAQPGNKG  615
            E    Q   +G
Sbjct  132  EHYGQQTHARG  142



>ref|XP_011081346.1| PREDICTED: oleosin 1-like [Sesamum indicum]
Length=139

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 116/135 (86%), Gaps = 5/135 (4%)
 Frame = +1

Query  229  QPRHE---QQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPA  399
            Q RH+   QQLS+QVAKT TAVT+GGSLM+LSGLTL AT+IGLV+ATPLLVIFSPVLVPA
Sbjct  5    QTRHDPQKQQLSHQVAKTTTAVTLGGSLMVLSGLTLAATVIGLVLATPLLVIFSPVLVPA  64

Query  400  ALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEK  579
            A+T F ILAGF+ SG FGA A+F+FYWMY+YATGKHPIGA+++D AREKL++AA D+KE+
Sbjct  65   AITLFLILAGFVTSGGFGAVASFLFYWMYKYATGKHPIGAEQLDRAREKLAHAAHDVKER  124

Query  580  AEQLAAQ--PGNKGT  618
            AEQ   Q   G++GT
Sbjct  125  AEQFGQQHVKGSQGT  139



>ref|XP_009796414.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=138

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 115/134 (86%), Gaps = 4/134 (3%)
 Frame = +1

Query  229  QPRHEQ--QLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAA  402
            QPRHEQ  QLS QVAKT TAVT+GGSLM+LSGLTL AT+IGLVVATPLLVIFSPVLVPA 
Sbjct  5    QPRHEQHQQLSRQVAKTTTAVTVGGSLMVLSGLTLAATVIGLVVATPLLVIFSPVLVPAT  64

Query  403  LTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKA  582
            +T F IL G LA+G FGATATFVFYWMYRY TGKHPIGADKIDYAR++L++AA D+KEKA
Sbjct  65   ITIFMILGGLLAAGGFGATATFVFYWMYRYTTGKHPIGADKIDYARDRLAHAAHDIKEKA  124

Query  583  EQLA--AQPGNKGT  618
            EQL   AQ   KGT
Sbjct  125  EQLGHQAQQQIKGT  138



>ref|XP_009614001.1| PREDICTED: oleosin 1-like [Nicotiana tomentosiformis]
Length=138

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 114/134 (85%), Gaps = 4/134 (3%)
 Frame = +1

Query  229  QPRHEQ--QLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAA  402
            QPRHEQ  QLS QVAKT TAVT+GGSLM+LSGLTL AT+IGLVVATPLLVIFSPVLVPA 
Sbjct  5    QPRHEQHQQLSRQVAKTTTAVTVGGSLMVLSGLTLAATVIGLVVATPLLVIFSPVLVPAT  64

Query  403  LTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKA  582
            +T F IL G LA+G FGATATFVFYWMYRY  GKHPIGADKIDYAR++L++AA D+KEKA
Sbjct  65   ITIFMILGGLLAAGGFGATATFVFYWMYRYTIGKHPIGADKIDYARDRLAHAAHDIKEKA  124

Query  583  EQLA--AQPGNKGT  618
            EQL   AQ   KGT
Sbjct  125  EQLGHQAQQQIKGT  138



>gb|AAX49392.1| OLE-4 [Coffea canephora]
Length=142

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QP+ +   S QV KT TAV +GGSLMLLSGLTL  TIIGLV+ATPLLVIFSPV+VPAA+T
Sbjct  7    QPQTQHSTS-QVVKTTTAVAVGGSLMLLSGLTLAGTIIGLVLATPLLVIFSPVIVPAAVT  65

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             F ILAGF  SG  G TATF+FYWM+RYATGKHPIGAD++D AREK+++AA++M++KAE 
Sbjct  66   FFLILAGFFISGGLGVTATFIFYWMFRYATGKHPIGADQLDRAREKIAHAAKEMRDKAEH  125

Query  589  LA--AQPGNKGTTLQDS  633
                AQ   KG+  QD+
Sbjct  126  FGQQAQQQIKGSPDQDT  142



>emb|CDP10020.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +1

Query  244  QQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFIL  423
            Q  + QV KT TAV +GGSLM+LS LTL  T+IGLV+ATPLLVIFSPV+VPAA+T F IL
Sbjct  11   QHSTSQVVKTTTAVAVGGSLMVLSVLTLAGTMIGLVLATPLLVIFSPVIVPAAVTFFLIL  70

Query  424  AGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLA--A  597
            AGF  SG  G TATF+FYWM+RYATGKHPIGAD++D AREK+++AA++M++KAE     A
Sbjct  71   AGFFISGGLGVTATFIFYWMFRYATGKHPIGADQLDRAREKIAHAAKEMRDKAEHFGQQA  130

Query  598  QPGNKGTTLQDS  633
            Q   KG+   D+
Sbjct  131  QQQIKGSPDHDT  142



>ref|XP_004245807.1| PREDICTED: oleosin 1-like [Solanum lycopersicum]
Length=140

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = +1

Query  214  MQHYYQPRHEQ--QLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPV  387
            M      RHEQ  QLS QVAKT TAVT+GGSLM+LSGLTL  T+IGLVVATPLLVIFSPV
Sbjct  1    MSQIQSGRHEQHQQLSRQVAKTTTAVTVGGSLMVLSGLTLAVTVIGLVVATPLLVIFSPV  60

Query  388  LVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQD  567
            LVPAA+T F IL G LA+ +FGATATFVFYWMYRY TGKHPIGAD++DYAR++L++AA D
Sbjct  61   LVPAAITIFMILGGLLAATAFGATATFVFYWMYRYTTGKHPIGADQLDYARDRLAHAAHD  120

Query  568  MKEKAE  585
            +KEKAE
Sbjct  121  IKEKAE  126



>ref|XP_006359267.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=151

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 111/138 (80%), Gaps = 14/138 (10%)
 Frame = +1

Query  229  QP-RHEQ--QLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPA  399
            QP RHEQ  QLS QVAKT TAVT+GGSLM+LSGLTL  T+IGLVVATPLLVIFSPVLVPA
Sbjct  5    QPARHEQNQQLSRQVAKTTTAVTVGGSLMVLSGLTLAVTVIGLVVATPLLVIFSPVLVPA  64

Query  400  ALTTFFILAGFLASGSFGATATFVFYWMYRYA-----------TGKHPIGADKIDYAREK  546
            A+T F I+ G LA+ +FGATATFVFYWMYRY            TGKHPIGADK+DYAR++
Sbjct  65   AITIFMIMGGLLAATAFGATATFVFYWMYRYVTFADATFQMYTTGKHPIGADKLDYARDR  124

Query  547  LSNAAQDMKEKAEQLAAQ  600
            L++AA D+KEKAEQL  Q
Sbjct  125  LAHAAHDIKEKAEQLGHQ  142



>ref|XP_003631370.1| PREDICTED: oleosin 1 [Vitis vinifera]
 emb|CAN68989.1| hypothetical protein VITISV_017729 [Vitis vinifera]
Length=133

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 101/135 (75%), Gaps = 4/135 (3%)
 Frame = +1

Query  214  MQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLV  393
            M H  QP  + QLSYQ+ KT+TA T+GGS M+LSGLTL  T+I LVVATPLLVIFSPVLV
Sbjct  1    MAHQDQP-QKTQLSYQLIKTSTAATIGGSCMVLSGLTLAGTVIALVVATPLLVIFSPVLV  59

Query  394  PAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            PAA+T F   +G +ASG FG +A  VF W+Y+Y  G+HP+GAD++D AR+KL+  A ++K
Sbjct  60   PAAITVFLAASGLVASGGFGVSAVSVFLWLYKYVRGQHPVGADRLDRARDKLTGKAMEVK  119

Query  574  EKAEQLAAQPGNKGT  618
            E+A   A Q G +GT
Sbjct  120  ERA---AEQIGTRGT  131



>ref|XP_010555609.1| PREDICTED: oleosin Bn-III-like [Tarenaya hassleriana]
Length=144

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +1

Query  229  QPR-----HEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLV  393
            QPR      EQ  S Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLV
Sbjct  5    QPRPLEMSREQPKSRQMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLV  64

Query  394  PAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            PA +T   ++ GFLASG FG  A  VF W+YRY TG+HP GADK+D AR KL++ AQ+MK
Sbjct  65   PAVITVALLVTGFLASGGFGIAAITVFSWIYRYVTGRHPPGADKLDSARLKLASKAQEMK  124

Query  574  EKAEQLAAQ  600
            ++A+Q   Q
Sbjct  125  DRAQQFGQQ  133



>ref|XP_009606946.1| PREDICTED: oleosin 1-like [Nicotiana tomentosiformis]
Length=143

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            SYQV K ATAVT GGSL++LSGLTL  TII L VATPLL+IFSPVLVPA +T FF++ GF
Sbjct  22   SYQVVKAATAVTAGGSLLVLSGLTLAGTIIALTVATPLLLIFSPVLVPATITLFFLMFGF  81

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            LASG FG  A  V  W+YRY TG+HP GA +++YAR+KL+  A++MKE+AEQ   Q
Sbjct  82   LASGGFGVAAISVLSWIYRYVTGRHPPGAVQLEYARDKLATKAREMKERAEQFGQQ  137



>emb|CDP05381.1| unnamed protein product [Coffea canephora]
Length=135

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R ++ LS+QV K ATAVT GGSL++LSGL L  T+I L +ATPLLVIFSPVLVPA +T F
Sbjct  5    RQQRPLSHQVVKAATAVTAGGSLLVLSGLILAGTVIALALATPLLVIFSPVLVPAGITVF  64

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLA  594
             ++ GFL+SG FG  A  V  W+YRY TGK+P GAD++D AR+KL+  A++MK++AEQ  
Sbjct  65   LLVTGFLSSGGFGVAALSVLSWIYRYVTGKNPPGADQLDRARQKLALKAREMKDRAEQYG  124

Query  595  AQ  600
             Q
Sbjct  125  QQ  126



>gb|EYU20173.1| hypothetical protein MIMGU_mgv1a015301mg [Erythranthe guttata]
Length=162

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S+Q+ K ATAVT GGSL++LSGLTL  T++ L +ATPLLVIFSPVLVPAA+T F + +GF
Sbjct  37   SHQMVKAATAVTAGGSLLVLSGLTLAGTVVALTIATPLLVIFSPVLVPAAITIFLLGSGF  96

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
            LASG FG  A  V  W+YRY TGKHP+GAD++D AR KL+  A++MK++AEQ   Q    
Sbjct  97   LASGGFGVAALSVMSWIYRYVTGKHPVGADQLDTARTKLAGKAREMKDRAEQFGQQNITG  156

Query  613  GTT  621
            G T
Sbjct  157  GGT  159



>ref|XP_010109129.1| Oleosin 1 [Morus notabilis]
 gb|EXC21058.1| Oleosin 1 [Morus notabilis]
Length=148

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPR     S+QV K ATAVT GGS+++LSGL L  T+I L +ATPL VIFSPVLVPA +T
Sbjct  20   QPR-----SHQVVKAATAVTAGGSMLVLSGLILAGTVIALTIATPLFVIFSPVLVPAVIT  74

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               I+ GFLASG FG  A  V  W+YRY TGKHP GAD++D AR KL++ A++MK+KAEQ
Sbjct  75   VGLIITGFLASGGFGVAAISVLSWIYRYVTGKHPPGADQLDQARHKLASKAREMKDKAEQ  134

Query  589  LAAQ  600
               Q
Sbjct  135  FGQQ  138



>ref|XP_008453870.1| PREDICTED: oleosin 1-like [Cucumis melo]
Length=142

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = +1

Query  226  YQPRHEQ---QLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVP  396
            YQP H+Q   Q  YQV K ATA T GGSL++LSGL L  T+I L +ATPLLVIFSPVLVP
Sbjct  7    YQPSHQQTGSQPRYQVVKAATAATAGGSLLVLSGLILAGTVIALTIATPLLVIFSPVLVP  66

Query  397  AALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKE  576
            A +T   ++ GFLASG FG     VF W+YRY TGKHP GAD++D AR KL++ A++MK+
Sbjct  67   AVITVSLLIMGFLASGGFGVAGITVFSWIYRYVTGKHPPGADQLDLARHKLASKAREMKD  126

Query  577  KAEQLAAQ  600
            +AEQ   Q
Sbjct  127  RAEQFGQQ  134



>ref|XP_010536555.1| PREDICTED: oleosin 18.5 kDa-like [Tarenaya hassleriana]
Length=144

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +1

Query  217  QHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVP  396
            Q       +Q  S Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVP
Sbjct  9    QEMSSSWEQQPKSRQMVKVATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVP  68

Query  397  AALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKE  576
            A +T   ++ GFL+SG FG  A  VF W+YRY TGKHP GADK+D AR KL++ AQD+K+
Sbjct  69   AVITVALLITGFLSSGGFGIAAITVFSWIYRYVTGKHPPGADKLDSARMKLASKAQDLKD  128

Query  577  KAEQLAAQ  600
            +A+Q   Q
Sbjct  129  RAQQFGQQ  136



>gb|AFP19885.1| 14.3 kDa oleosin [Jatropha curcas]
 gb|KDP22471.1| hypothetical protein JCGZ_26302 [Jatropha curcas]
Length=137

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 93/127 (73%), Gaps = 2/127 (2%)
 Frame = +1

Query  214  MQHYYQPRH--EQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPV  387
            M  + Q +H  +Q  S+QV K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPV
Sbjct  1    MAEHPQSQHVGQQPRSHQVVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPV  60

Query  388  LVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQD  567
            LVPA +T   I+ GFLASG FG  A  V  W+YRY TGKHP GA+ +D AR KL+  A++
Sbjct  61   LVPAVITVCLIITGFLASGGFGVAAISVLSWIYRYVTGKHPPGAESLDQARLKLAGKARE  120

Query  568  MKEKAEQ  588
            MK++AEQ
Sbjct  121  MKDRAEQ  127



>gb|ABW90150.2| oleosin 3 [Jatropha curcas]
Length=137

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +1

Query  214  MQHYYQPRH--EQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPV  387
            M  + Q +H  +Q  S+QV K ATAVT GGSL++LSGLTL  T+I L V TPLLVIFSPV
Sbjct  1    MAEHPQSQHVGQQPRSHQVVKAATAVTAGGSLLVLSGLTLAGTVIALTVPTPLLVIFSPV  60

Query  388  LVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQD  567
            +VP  +T   I+ GFLASG FG  A FV +W+YRY TGKHP GA+ +D AR KL+  A++
Sbjct  61   MVPTVITVCLIITGFLASGGFGVAAIFVLFWIYRYVTGKHPPGAENLDQARLKLAGKARE  120

Query  568  MKEKAEQLA  594
            MK++AEQ  
Sbjct  121  MKDRAEQFG  129



>gb|AAX49390.1| OLE-2 [Coffea canephora]
Length=135

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R +Q LS+QV K ATAVT GGSL++LSGL L  T+I L +ATPLLVIFSPVLVPA +T F
Sbjct  5    RQQQPLSHQVVKAATAVTAGGSLLVLSGLILAGTVIALALATPLLVIFSPVLVPAGITVF  64

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLA  594
             ++ GFL+SG FG  A  V  W+Y Y TGK+P GAD++D AR+KL+  A++MK++AEQ  
Sbjct  65   LLVTGFLSSGGFGVAALSVLSWIYGYVTGKNPPGADQLDRARQKLALKAREMKDRAEQYG  124

Query  595  AQ  600
             Q
Sbjct  125  QQ  126



>ref|XP_006421522.1| hypothetical protein CICLE_v10006168mg [Citrus clementina]
 gb|ESR34762.1| hypothetical protein CICLE_v10006168mg [Citrus clementina]
 gb|KDO39225.1| hypothetical protein CISIN_1g041282mg [Citrus sinensis]
Length=144

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 12/144 (8%)
 Frame = +1

Query  214  MQHYYQPRHEQQL------SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVI  375
            M  +YQP  + QL      S+QV K ATAVT GGSL++LSGLT+  T+I L +ATPLLVI
Sbjct  1    MAEHYQPHEQTQLQSRQPRSHQVVKAATAVTAGGSLLVLSGLTMAGTVIALTIATPLLVI  60

Query  376  FSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSN  555
             SPVLVPA +T   ++ GFLASG FG  A  V  W+YRY TG HP GAD+++ AR KL++
Sbjct  61   CSPVLVPAVITVSLLIMGFLASGGFGVAAISVLSWIYRYVTGGHPPGADQLEQARMKLAS  120

Query  556  AAQDMKEKAEQL------AAQPGN  609
             A++M+++AEQ        +QPG+
Sbjct  121  KAREMRDRAEQFGQQQSTGSQPGS  144



>ref|XP_009764678.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=146

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            SYQV K ATAVT GGSL++LSGLTL  TII L VATPLL+IFSPVLVPA +T F ++ GF
Sbjct  23   SYQVVKAATAVTAGGSLLVLSGLTLAGTIIALTVATPLLLIFSPVLVPATITIFLLMFGF  82

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            LASG FG  A  V  W+YRY TG+HP GA ++++AR+KL+  A++MKE+AEQ   Q
Sbjct  83   LASGGFGVAAISVLSWIYRYMTGRHPPGAVQLEHARDKLATKAREMKERAEQFGQQ  138



>gb|ABQ57397.1| oleosin L-isoform [Ficus pumila var. awkeotsang]
Length=153

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S+QV K ATAVT GGSL++LS L L  T+I L +ATPL VIFSPVLVPA +T   I+ GF
Sbjct  28   SHQVVKAATAVTAGGSLLVLSALILAGTVIALTIATPLFVIFSPVLVPAVITLGLIIIGF  87

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            LASG FG  A  V  W+YRY TGKHP GAD++D AR KL++ A++MK+KAEQ   Q
Sbjct  88   LASGGFGVAALTVLSWIYRYVTGKHPPGADQLDQARHKLASKAREMKDKAEQFGQQ  143



>ref|XP_006490018.1| PREDICTED: oleosin 1-like [Citrus sinensis]
 emb|CAA88360.1| oleosin-like protein [Citrus sinensis]
 gb|KDO40159.1| hypothetical protein CISIN_1g040357mg [Citrus sinensis]
 prf||2119230A oleosin homolog
Length=144

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +1

Query  214  MQHYYQPRHEQQL------SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVI  375
            M  +YQP  + QL      S+QV K ATAVT GGSL++LSGLT+  T+I L +ATPLLVI
Sbjct  1    MAEHYQPLQQTQLQSRQPRSHQVVKAATAVTAGGSLLVLSGLTMAGTVIALTIATPLLVI  60

Query  376  FSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSN  555
             SPVLVPA +T   ++ GFLASG FG  A  V  W+YRY TG HP GAD+++ AR KL+ 
Sbjct  61   CSPVLVPAVITVSLLIMGFLASGGFGVAAISVLSWIYRYVTGGHPPGADQLEQARMKLAG  120

Query  556  AAQDMKEKAEQLAAQ  600
             A++M+++AEQ   Q
Sbjct  121  KAREMRDRAEQFGQQ  135



>ref|XP_002304591.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
 gb|EEE79570.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
Length=134

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  214  MQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLV  393
            +Q    PR +Q  S+QV K  TAVT GGSL+++S LT TAT+I L VATPLL+IFSPV+V
Sbjct  4    LQKSKHPR-QQPRSHQVVKATTAVTTGGSLLVVSSLTFTATVILLTVATPLLIIFSPVIV  62

Query  394  PAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            PA +T + +L GFLASG FG T   V  WMYRY TG+HP GA+++D A  KL   A++MK
Sbjct  63   PAVITIYLLLMGFLASGGFGVTGITVMSWMYRYVTGRHPPGAEQLDQAGMKLVGKAREMK  122

Query  574  EKAEQLAAQ  600
            E+ EQ   Q
Sbjct  123  ERGEQFGLQ  131



>gb|AAD42942.1|AF091840_1 15 kDa oleosin [Sesamum indicum]
 gb|ACH85187.1| main allergen 15 kDa oleosin [Sesamum indicum]
Length=145

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPR ++     V K ATAVT GGSL++LSGLTL  T+I L +ATPLLVIFSPVLVPA +T
Sbjct  19   QPRAQR-----VVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVIT  73

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             F + AGFLASG FG  A  V  W+YRY TGKHP GAD+++ A+ KL++ A++MK++AEQ
Sbjct  74   IFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQ  133

Query  589  LAAQP  603
             + QP
Sbjct  134  FSQQP  138



>gb|ACH85188.1| main allergen 15 kDa oleosin [Sesamum indicum]
Length=145

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPR ++     V K ATAVT GGSL++LSGLTL  T+I L +ATPLLVIFSPVLVPA +T
Sbjct  19   QPRAQR-----VVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVIT  73

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             F + AGFLASG FG  A  V  W+YRY TGKHP GAD+++ A+ KL++ A++MK++AEQ
Sbjct  74   IFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQ  133

Query  589  LAAQP  603
             + QP
Sbjct  134  FSQQP  138



>gb|ADB03184.1| oleosin I [Vernicia fordii]
Length=137

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S+QV K ATAVT GGSL++LSGLTLT T+IGL +ATPL V+FSPVLVPA +T F I+ GF
Sbjct  16   SHQVVKAATAVTAGGSLLVLSGLTLTGTVIGLTIATPLFVLFSPVLVPAVITVFLIVTGF  75

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLA  594
            LASG FG  A  V  W+YRY TGK P GA+ +D AR KL+  A++MK++AEQL 
Sbjct  76   LASGGFGVAAISVLSWIYRYVTGKQPPGAESLDQARMKLAGKAREMKDRAEQLG  129



>ref|XP_004146901.1| PREDICTED: oleosin 18.5 kDa-like [Cucumis sativus]
 ref|XP_004172267.1| PREDICTED: oleosin 18.5 kDa-like [Cucumis sativus]
 gb|KGN53169.1| hypothetical protein Csa_4G023040 [Cucumis sativus]
Length=142

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +1

Query  226  YQPRHEQ---QLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVP  396
            YQ  H+Q   Q  YQV K ATA T GGSL++LSGL L  T+I L +ATPLLVIFSPVLVP
Sbjct  7    YQQSHQQPGSQPRYQVVKAATAATAGGSLLVLSGLILAGTVIALTIATPLLVIFSPVLVP  66

Query  397  AALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKE  576
            A +T   ++ GFLASG FG     VF W+YRY TGKHP GAD++D AR KL++ A++MK+
Sbjct  67   AVITVSLLIMGFLASGGFGVAGITVFSWIYRYVTGKHPPGADQLDLARHKLASKAREMKD  126

Query  577  KAEQLAAQ  600
            +AEQ   Q
Sbjct  127  RAEQFGQQ  134



>ref|XP_010038411.1| PREDICTED: oleosin 1-like [Eucalyptus grandis]
 gb|KCW46234.1| hypothetical protein EUGRSUZ_K00124 [Eucalyptus grandis]
Length=149

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  250  LSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAG  429
            +++QV K  TAVT GGSL++LSGLTL  T+I L +ATPLLVIFSPVLVPA +T   ++ G
Sbjct  27   VAHQVVKAMTAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITVGLLIMG  86

Query  430  FLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            FLASG FG  A  V  W+YRY TGKHP GAD++D AR KL++ A++MK++AEQ   Q
Sbjct  87   FLASGGFGVAAVTVLSWIYRYVTGKHPPGADQLDQARMKLASKAREMKDRAEQFGQQ  143



>gb|EPS62608.1| oleosin [Genlisea aurea]
Length=147

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +1

Query  205  KMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSP  384
            + P   Y  PR     S+Q+ KTATA+T G S +LL GLTL  T++ L VATPLLVIFSP
Sbjct  13   QRPFSTYALPR-----SHQLVKTATALTAGSSFLLLFGLTLAGTVVALTVATPLLVIFSP  67

Query  385  VLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQ  564
            VLVPAA+  F I +GFLASG FG  A  V  W++R+ TGKHP GAD+++ AR++L+  A+
Sbjct  68   VLVPAAIAVFVIASGFLASGGFGVAALSVLSWIFRFVTGKHPPGADQVETARDRLAVKAK  127

Query  565  DMKEKAEQLAAQ--PGNKGT  618
            +MK+KA+Q   Q  PG++ +
Sbjct  128  EMKDKADQFGHQYVPGSQAS  147



>ref|XP_002281746.1| PREDICTED: oleosin 1 [Vitis vinifera]
 emb|CAN69350.1| hypothetical protein VITISV_012978 [Vitis vinifera]
Length=144

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            SYQ  K ATA T GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPAA+  FF++ GF
Sbjct  22   SYQAVKAATAATAGGSLLVLSGLTLVGTVIALTVATPLLVIFSPVLVPAAIAVFFLVLGF  81

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ-PGN  609
            LASG FG  A  V  W+YRY TG+HP GAD +D AR KL++ A++MK++AEQ   Q  G 
Sbjct  82   LASGGFGVAAVTVLSWIYRYVTGRHPPGADHLDSARMKLASKAREMKDRAEQFGQQHTGQ  141

Query  610  KGT  618
            +GT
Sbjct  142  QGT  144



>ref|XP_010693742.1| PREDICTED: oleosin 1-like [Beta vulgaris subsp. vulgaris]
Length=154

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 3/140 (2%)
 Frame = +1

Query  217  QHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVP  396
            QH   P  +Q  ++Q+ K ATA+T GGSL++LS LTL  T+I L +ATPLLVIFSPVLVP
Sbjct  18   QHTTHPG-QQPRAHQMVKAATAITAGGSLLVLSALTLAGTVIALTIATPLLVIFSPVLVP  76

Query  397  AALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKE  576
            AA+T   +++GFLASG FG  A  V  W+YRY TG+HP GAD++D AR KL+   ++ +E
Sbjct  77   AAITVVLLISGFLASGGFGVAAVSVLAWIYRYVTGRHPPGADQLDQARMKLAGKTREARE  136

Query  577  KAEQLAAQPGNKGTTLQDST  636
            K E    Q    G T Q ST
Sbjct  137  KGEHYTQQ--TTGGTHQQST  154



>ref|XP_011076526.1| PREDICTED: oleosin 1-like [Sesamum indicum]
Length=224

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPR ++     V K ATAVT GGSL++LSGLTL  T+I L +ATPLLVIFSPVLVPA +T
Sbjct  98   QPRAQR-----VVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVIT  152

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             F + AGFLASG FG  A  V  W+YRY TGKHP GAD+++ A+ KL++ A++MK++AEQ
Sbjct  153  IFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQ  212

Query  589  LAAQP  603
             + QP
Sbjct  213  FSQQP  217



>gb|ACG69518.1| oleosin S3-6 [Brassica napus]
 emb|CDY11058.1| BnaA03g47170D [Brassica napus]
Length=183

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L+VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  45   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALIVATPLLVIFSPILVPALITVALLITGF  104

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQDMK++A     Q
Sbjct  105  LSSGGFGIAAITVFSWIYKYATGEHPKGSDKLDSARMKLGSKAQDMKDRAHYYGQQ  160



>ref|XP_010433682.1| PREDICTED: oleosin 18.5 kDa [Camelina sativa]
 ref|XP_010448472.1| PREDICTED: oleosin 18.5 kDa [Camelina sativa]
Length=181

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  48   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  107

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
            L+SG FG  A  VF W+YRYATG+HP G+DK+D AR KL + AQD+K++A+
Sbjct  108  LSSGGFGIAAITVFSWIYRYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQ  158



>ref|XP_009778273.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=146

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 97/138 (70%), Gaps = 9/138 (7%)
 Frame = +1

Query  214  MQHYYQPRH--EQQL-------SYQVAKTATAVtmggslmllsgltltATIIGLVVATPL  366
            M  YY  +H   QQL       S+Q+ K ATAVT GGSL++LSGLTL  T+I L VATPL
Sbjct  1    MADYYGQQHTQHQQLNSVQQPRSHQMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPL  60

Query  367  LVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREK  546
            LVIFSPV+VPA +T F +++GFLASG FG  A  V  W+YRY TGK P GAD++++AR +
Sbjct  61   LVIFSPVIVPAVITIFMLVSGFLASGGFGVAAISVLSWIYRYVTGKRPPGADQLEHARHR  120

Query  547  LSNAAQDMKEKAEQLAAQ  600
            L+  A +MK++A++   Q
Sbjct  121  LATKAGEMKDRAQEFGQQ  138



>ref|XP_009137499.1| PREDICTED: oleosin 18.5 kDa-like [Brassica rapa]
Length=184

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L+VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  45   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALIVATPLLVIFSPILVPALITVALLITGF  104

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQDMK++A     Q
Sbjct  105  LSSGGFGIAAITVFSWIYKYATGEHPKGSDKLDSARMKLGSKAQDMKDRAHYYGQQ  160



>ref|XP_009601962.1| PREDICTED: oleosin 1-like [Nicotiana tomentosiformis]
Length=146

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 97/138 (70%), Gaps = 9/138 (7%)
 Frame = +1

Query  214  MQHYYQPRH--EQQL-------SYQVAKTATAVtmggslmllsgltltATIIGLVVATPL  366
            M  YY  +H   QQL       S+Q+ K ATAVT GGSL++LSGLTL  T+I L VATPL
Sbjct  1    MADYYGQQHTQHQQLNPVQQPRSHQMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPL  60

Query  367  LVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREK  546
            LVIFSPV+VPA +T F +++GFLASG FG  A  V  W+YRY TGK P GAD++++AR +
Sbjct  61   LVIFSPVIVPAVITIFMLVSGFLASGGFGVAAISVLSWIYRYVTGKRPPGADQLEHARHR  120

Query  547  LSNAAQDMKEKAEQLAAQ  600
            L+  A +MK++A++   Q
Sbjct  121  LATKAGEMKDRAQEFGQQ  138



>ref|NP_194244.1| oleosin 1 [Arabidopsis thaliana]
 sp|P29525.1|OLEO1_ARATH RecName: Full=Oleosin 18.5 kDa [Arabidopsis thaliana]
 emb|CAA44225.1| oleosin [Arabidopsis thaliana]
 emb|CAB36756.1| oleosin, 18.5K [Arabidopsis thaliana]
 emb|CAB79423.1| oleosin, 18.5K [Arabidopsis thaliana]
 gb|AAQ22658.1| At4g25140 [Arabidopsis thaliana]
 gb|AEE85016.1| oleosin 1 [Arabidopsis thaliana]
Length=173

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  40   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  99

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQD+K++A+
Sbjct  100  LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQ  150



>ref|XP_009404312.1| PREDICTED: oleosin 16 kDa-like [Musa acuminata subsp. malaccensis]
Length=141

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S+ V K  TA   GGS+++LSGLTL  T+IGL VATPLLVIFSPVLVPAA+  F +  GF
Sbjct  23   SHTVVKAVTAAMAGGSMLVLSGLTLAVTVIGLTVATPLLVIFSPVLVPAAIAVFLVATGF  82

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            L SG FG  A  V  WMY+Y TGKHP GAD++D AR++L++ A+D+KE A+Q
Sbjct  83   LTSGGFGLAALSVLSWMYKYLTGKHPPGADQLDQARQRLASKARDIKESAQQ  134



>ref|XP_006285813.1| hypothetical protein CARUB_v10007289mg [Capsella rubella]
 gb|EOA18711.1| hypothetical protein CARUB_v10007289mg [Capsella rubella]
Length=183

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  50   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  109

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQD+K++A+
Sbjct  110  LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQ  160



>gb|AAO65960.1| oleosin [Corylus avellana]
Length=140

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 7/133 (5%)
 Frame = +1

Query  226  YQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAAL  405
            +QPR     S+QV K ATA T GGSL++ SGL L  T+I L +ATPL VIFSPVLVPA +
Sbjct  13   HQPR-----SHQVVKAATAATAGGSLLVPSGLILAGTVIALTLATPLFVIFSPVLVPAVI  67

Query  406  TTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
            T   I+ GFLASG FG  A  V  W+YRY TG+HP GAD++D+AR KL++ A++MK++AE
Sbjct  68   TVSLIIMGFLASGGFGVAAVTVLSWIYRYVTGRHPPGADQLDHARMKLASKAREMKDRAE  127

Query  586  QLAAQ--PGNKGT  618
            Q   Q   G++G+
Sbjct  128  QFGQQHVTGSQGS  140



>gb|ACG69520.1| oleosin S3-8 [Brassica napus]
 emb|CDX92679.1| BnaC07g39370D [Brassica napus]
Length=186

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 7/126 (6%)
 Frame = +1

Query  205  KMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSP  384
             M  Q+Y + R       Q+AK  TAVT GGSL++LS LTL  T+I L+VATPLLVIFSP
Sbjct  36   NMSGQNYSKSR-------QIAKATTAVTAGGSLLVLSSLTLVGTVIALIVATPLLVIFSP  88

Query  385  VLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQ  564
            +LVPA +T   ++ GFL+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQ
Sbjct  89   ILVPALITVALLITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQ  148

Query  565  DMKEKA  582
            DMK++A
Sbjct  149  DMKDRA  154



>gb|EPS69345.1| oleosin, partial [Genlisea aurea]
Length=109

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S +VAK  TAVT+GGSLM+LSGLTL  T+I LV+ATPLLVIFSPVLVPAA+    I+ GF
Sbjct  1    SRRVAKATTAVTLGGSLMVLSGLTLVGTVIALVLATPLLVIFSPVLVPAAIAVLLIVGGF  60

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEK  579
            +ASG FGA A+FV YWMY+Y TGKHP GA ++D  R+++ + A D KE+
Sbjct  61   VASGGFGAIASFVLYWMYKYTTGKHPTGASELDRFRDRMGHFAHDAKEQ  109



>ref|XP_011022366.1| PREDICTED: oleosin 1-like [Populus euphratica]
Length=134

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R  Q  S+QV K  TAVT GGSL+++S LT TAT+I L VATPLL+IFSPV+VPA +T +
Sbjct  10   RRRQPRSHQVVKATTAVTTGGSLLVVSSLTFTATVILLTVATPLLIIFSPVIVPAVITVY  69

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLA  594
             +L GFL SG FG T   V  WMYRY TG HP GA+++D A  KL   A++MKE+ E   
Sbjct  70   LLLMGFLVSGGFGVTGITVMTWMYRYVTGMHPPGAEQLDQAVMKLVGKAREMKERGELFG  129

Query  595  AQ  600
             Q
Sbjct  130  LQ  131



>sp|P29109.1|OLEO5_BRANA RecName: Full=Oleosin Bn-V; Short=BnV, partial [Brassica napus]
 emb|CAA45313.1| oleosin BN-V [Brassica napus]
Length=183

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 7/126 (6%)
 Frame = +1

Query  205  KMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSP  384
             M  Q+Y + R       Q+AK  TAVT G SL++LS LTL  T+I L+VATPLLVIFSP
Sbjct  33   NMSGQNYSKSR-------QIAKATTAVTAGDSLLVLSSLTLVGTVIALIVATPLLVIFSP  85

Query  385  VLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQ  564
            +LVPA +T   ++ GFL+SG+FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQ
Sbjct  86   ILVPALITVALLITGFLSSGAFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQ  145

Query  565  DMKEKA  582
            DMK++A
Sbjct  146  DMKDRA  151



>emb|CDP10019.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 38/155 (25%)
 Frame = +1

Query  244  QQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFIL  423
            Q+ S Q  KT TAV +GGSL +L      + +IGLV+ATPLLV+F PVLVPAA+T F IL
Sbjct  11   QRSSSQAVKTITAVAVGGSLTVL------SGLIGLVLATPLLVVFGPVLVPAAVTIFLIL  64

Query  424  AGFLASGSFGATATFVFYWMYRYATGKHPIGADKID------------------------  531
            AGF   G  G TA+F+FYWM+RYATGKHPIGAD++D                        
Sbjct  65   AGFFICGGLGVTASFIFYWMFRYATGKHPIGADQLDRVREKIARASFIFYWMFRYATGKN  124

Query  532  --------YAREKLSNAAQDMKEKAEQLAAQPGNK  612
                     A+EK+++AA++MK+KAEQ   Q   +
Sbjct  125  PIGADQLNRAKEKIADAAKEMKDKAEQFGRQEAEE  159



>ref|XP_006413337.1| hypothetical protein EUTSA_v10027215mg [Eutrema salsugineum]
 gb|ESQ54790.1| hypothetical protein EUTSA_v10027215mg [Eutrema salsugineum]
Length=176

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  44   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  103

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
            L+SG FG  A  VF W+Y+YATG+HP G+D++D AR KL + AQD+K++A+      G +
Sbjct  104  LSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRAQYYGQHTGGE  163



>ref|XP_002869688.1| hypothetical protein ARALYDRAFT_492319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45947.1| hypothetical protein ARALYDRAFT_492319 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  40   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  99

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
            L+SG FG  A  VF W+Y+YATG+HP G+D++D AR KL + AQD+K++A+
Sbjct  100  LSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRAQ  150



>ref|XP_004240765.1| PREDICTED: oleosin 1 [Solanum lycopersicum]
Length=147

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 9/136 (7%)
 Frame = +1

Query  220  HYYQPRH---------EQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLV  372
            +Y QP+H         +Q  S+Q+ K ATAVT GGSL+LLSGLTL AT+I L +ATP+LV
Sbjct  4    YYGQPQHTQHQFFHGGQQPRSHQMVKAATAVTAGGSLLLLSGLTLAATVIALTIATPVLV  63

Query  373  IFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLS  552
            IFSPV+VPA +T F + +GFLASG FG  A  V  W+YRY TGK P GAD+++ AR KL+
Sbjct  64   IFSPVIVPAVITLFLLFSGFLASGGFGVAAVSVLSWIYRYVTGKRPPGADQLEQARHKLA  123

Query  553  NAAQDMKEKAEQLAAQ  600
              A +MK+KA++   Q
Sbjct  124  TKAGEMKDKAQEFGQQ  139



>ref|XP_010438923.1| PREDICTED: oleosin 18.5 kDa-like [Camelina sativa]
Length=181

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  48   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  107

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
            L+SG FG  A  VF W+Y+YATG+HP G+D++D AR KL + AQD+K++A+
Sbjct  108  LSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRAQ  158



>ref|XP_006357933.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=148

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 96/137 (70%), Gaps = 10/137 (7%)
 Frame = +1

Query  220  HYYQPRH----------EQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLL  369
            +Y QP+H          +Q  S+Q+ K ATAVT GGSL+LLSGLTL AT+I L +ATP+L
Sbjct  4    YYGQPQHTQHQFLHGAGQQPRSHQMVKAATAVTAGGSLLLLSGLTLAATVIALTIATPVL  63

Query  370  VIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKL  549
            VIFSPV+VPA +T F + +GFLASG FG  A  V  W+YRY TGK P GAD+++ AR KL
Sbjct  64   VIFSPVIVPAVITLFLLFSGFLASGGFGVAAISVLSWIYRYVTGKRPPGADQLEQARRKL  123

Query  550  SNAAQDMKEKAEQLAAQ  600
            +  A +MK+KA++   Q
Sbjct  124  ATKAGEMKDKAQEFGQQ  140



>gb|ACG69517.1| oleosin S3-5 [Brassica napus]
Length=183

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L+VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  45   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALIVATPLLVIFSPILVPALITVALLITGF  104

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR K  + AQDMK++A     Q
Sbjct  105  LSSGGFGIAAITVFSWIYKYATGEHPKGSDKLDSARMKPGSKAQDMKDRAHYYGQQ  160



>emb|CDY03377.1| BnaC01g17050D [Brassica napus]
Length=170

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  37   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVAMLITGF  96

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQD+K++A+    Q
Sbjct  97   LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQ  152



>ref|XP_004307777.1| PREDICTED: oleosin 1-like [Fragaria vesca subsp. vesca]
Length=157

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATPLLVIFSPVLVPA +T   I+ GFLASG FG  A  V  W+Y+Y TG HP
Sbjct  53   GTVICLTVATPLLVIFSPVLVPAVITVALIMTGFLASGGFGVAAISVLSWIYKYVTGSHP  112

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
             GADK+D AR KL+  A+DMK++AEQ   Q
Sbjct  113  PGADKLDSARHKLAGKARDMKDRAEQFGQQ  142



>gb|KFK29003.1| hypothetical protein AALP_AA7G076700 [Arabis alpina]
Length=194

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R +   S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T  
Sbjct  51   RGDYSKSRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVA  110

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKA  582
             ++ GFL+SG FG  A  VF W+Y+YATG+HP G+D++D AR KL + AQD+K++A
Sbjct  111  LLITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRA  166



>emb|CDY34345.1| BnaA01g14480D [Brassica napus]
Length=170

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  37   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  96

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL    QDMK++A+    Q
Sbjct  97   LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  152



>gb|ABD14345.1| oleosin-like protein [Brassica napus]
Length=187

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  54   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  113

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL    QDMK++A+    Q
Sbjct  114  LSSGGFGIAAVTVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  169



>ref|XP_009362716.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=146

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            SYQVA TATAVT+GGSL +LSGL L  T+I L +ATPL++IFSPVLVPA +T   I+ GF
Sbjct  23   SYQVAMTATAVTVGGSLFVLSGLVLAGTVIALTIATPLMIIFSPVLVPAVITLSLIIMGF  82

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            L SG FG  +  V  W+YRY TGK P GAD++D AR KL+  A++MK+ AE 
Sbjct  83   LTSGGFGVASVTVLTWIYRYVTGKQPSGADQLDSARHKLAGKAREMKDSAEH  134



>sp|P29111.1|OLEO2_BRANA RecName: Full=Major oleosin NAP-II, partial [Brassica napus]
 emb|CAA41064.1| oleosin nap-II [Brassica napus]
 gb|AAB22218.2| oleosin napII, partial [Brassica napus]
Length=175

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  42   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  101

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL    QDMK++A+    Q
Sbjct  102  LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  157



>gb|ACG69516.1| oleosin S3-4 [Brassica napus]
 prf||1803528A oleosin
Length=187

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  54   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  113

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL    QDMK++A+    Q
Sbjct  114  LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  169



>sp|P29110.1|OLEO3_BRANA RecName: Full=Oleosin Bn-III; Short=BnIII [Brassica napus]
 emb|CAA43941.1| oleosin BN-III [Brassica napus]
 gb|ACG69519.1| oleosin S3-7 [Brassica napus]
 prf||2009397A oleosin
Length=195

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  54   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVAMLITGF  113

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQD+K++A+    Q
Sbjct  114  LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQ  169



>gb|ACG69515.1| oleosin S3-3 [Brassica napus]
Length=187

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  54   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  113

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL    QDMK++A+    Q
Sbjct  114  LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  169



>gb|AAW70038.1| oleosin-like protein [Brassica rapa subsp. oleifera]
Length=178

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  37   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  96

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL    QDMK++A+    Q
Sbjct  97   LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  152



>gb|ABF57563.1| OleIII [Camellia oleifera]
Length=140

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  268  KTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGS  447
            K ATA+T GGSL++LSGLTL  T+I L +ATPLLVIFSPVLVPAA+T   +  GFLASG 
Sbjct  22   KAATAITAGGSLLVLSGLTLAGTVIALALATPLLVIFSPVLVPAAVTVCLLNMGFLASGG  81

Query  448  FGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            FG     V  W+YRY TGKHP GAD++D AR KL++ A++MK++AEQ   Q
Sbjct  82   FGVAGISVLSWIYRYVTGKHPPGADQLDQARTKLASKAREMKDRAEQFGQQ  132



>ref|XP_009138898.1| PREDICTED: oleosin Bn-III [Brassica rapa]
Length=195

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK  TAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  54   SRQIAKAVTAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  113

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL    QDMK++A+    Q
Sbjct  114  LSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  169



>ref|XP_009109224.1| PREDICTED: oleosin 18.5 kDa [Brassica rapa]
 emb|CDY24856.1| BnaA08g14540D [Brassica napus]
Length=180

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GFL+
Sbjct  46   QIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGFLS  105

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL   AQD+K++A+    Q
Sbjct  106  SGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGTKAQDIKDRAQYYGQQ  159



>ref|XP_011026733.1| PREDICTED: oleosin 1-like [Populus euphratica]
Length=134

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  214  MQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLV  393
            +Q   QP  +Q  S Q+ K  TAVT GGSL++LSGLTL AT+I L +ATPLLVIFSPV+V
Sbjct  4    LQQSQQP-GKQPRSQQIVKATTAVTAGGSLLVLSGLTLAATVILLTIATPLLVIFSPVIV  62

Query  394  PAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            PAA+T   +L GFLASG FG        W+Y Y TG+HP GAD+++ AR KL+  A++MK
Sbjct  63   PAAMTISLLLMGFLASGGFGVAGITAMSWIYGYVTGRHPPGADQLEQARMKLAGKAREMK  122

Query  574  EKAEQLAAQ  600
            ++AEQ   Q
Sbjct  123  DRAEQFGHQ  131



>gb|ACG69521.1| oleosin S3-9 [Brassica napus]
Length=186

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 90/126 (71%), Gaps = 7/126 (6%)
 Frame = +1

Query  205  KMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSP  384
             M  Q+Y + R       Q+AK  TAVT GGSL++LS LTL  T+I  +VATPLLVIFSP
Sbjct  36   NMSGQNYSKSR-------QIAKATTAVTAGGSLLVLSSLTLVGTVIASIVATPLLVIFSP  88

Query  385  VLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQ  564
            +LVPA +T   ++ GFL+SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQ
Sbjct  89   ILVPALITVALLITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQ  148

Query  565  DMKEKA  582
            DMK++A
Sbjct  149  DMKDRA  154



>gb|ABB01619.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=143

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QP+++ + SYQ  K ATA T GGSL++LSGL L AT+I L +ATPLLVIFSPVLVPA +T
Sbjct  13   QPQYQTK-SYQAVKAATAATAGGSLLVLSGLILVATVIALTMATPLLVIFSPVLVPALIT  71

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               ++ GFLASG FG  A  V  W+YRY TG+HP+GAD +D AR ++S  A++MK++A  
Sbjct  72   VGLVITGFLASGGFGVAAITVLSWIYRYVTGRHPVGADSLDQARMRISGKAREMKDRASD  131

Query  589  LAAQ  600
               Q
Sbjct  132  FGQQ  135



>ref|XP_009333692.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=134

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R+ + LSYQ+AK +TA+T  GSL +LS LTLTA ++GLV ATPLLVIFSPVLVPA +   
Sbjct  3    RNPENLSYQLAKASTAITFSGSLSVLSSLTLTAVVMGLVAATPLLVIFSPVLVPAGVAML  62

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             +  G + SG FGATA  VFYW+Y Y TG+HP+GADK+D     L++  + +K + ++
Sbjct  63   LLNTGLVMSGGFGATAAMVFYWVYNYVTGQHPVGADKLDQLASTLASGVRSIKNRHDE  120



>gb|ABB01620.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=142

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QP+++ + SYQ  K ATA T GGSL++LSGL L ATII L +ATPLLVIFSPVLVPA +T
Sbjct  12   QPQYQTK-SYQAVKAATAATAGGSLLVLSGLILVATIIALTMATPLLVIFSPVLVPALIT  70

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               ++ GFLASG FG  A  V  W+YRY TG+HP+GAD +D AR +++  A++MK++A  
Sbjct  71   VGLLITGFLASGGFGVAAITVLSWIYRYVTGRHPVGADSLDQARMRITGKAREMKDRASD  130

Query  589  LAAQ  600
               Q
Sbjct  131  FGQQ  134



>ref|XP_007218565.1| hypothetical protein PRUPE_ppa012948mg [Prunus persica]
 sp|Q43804.1|OLEO1_PRUDU RecName: Full=Oleosin 1 [Prunus dulcis]
 emb|CAA55008.1| oleosin [Prunus dulcis]
 gb|EMJ19764.1| hypothetical protein PRUPE_ppa012948mg [Prunus persica]
Length=148

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 94/138 (68%), Gaps = 7/138 (5%)
 Frame = +1

Query  208  MPMQHYYQPRH-------EQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPL  366
            M  QH+ QP H       +Q  SYQVAK ATAVT GGSL++LSGL L  T+I L +ATPL
Sbjct  1    MADQHFQQPLHFQGSYGQQQPRSYQVAKAATAVTAGGSLLVLSGLVLAGTVIALTIATPL  60

Query  367  LVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREK  546
            LVIFSPVLVPA +T   I  GFL SG FG  A  V  W+Y+Y TGK P GAD++D AR K
Sbjct  61   LVIFSPVLVPALITVALITMGFLTSGGFGVAAVTVLSWIYKYVTGKQPPGADQLDQARHK  120

Query  547  LSNAAQDMKEKAEQLAAQ  600
            L+  A+D+K++AEQ   Q
Sbjct  121  LAGKARDIKDRAEQFGQQ  138



>gb|ABB01617.1| oleosin low molecular weight isoform [Linum usitatissimum]
 gb|ABB01622.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=155

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            + +Q  SYQ  K ATA T GGSL++LSGL LTAT+I L++ATPLLVIFSPVLVPA +T  
Sbjct  25   QQQQPRSYQAVKAATAATAGGSLIVLSGLILTATVISLIIATPLLVIFSPVLVPALITVG  84

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLA  594
             ++ GFLASG FG  A  V  W+YRY TG HP G D +D AR KL+  A+++K++A + A
Sbjct  85   LLITGFLASGGFGVAAVTVLSWIYRYVTGGHPAGGDSLDQARSKLAGKAREVKDRASEFA  144

Query  595  AQ  600
             Q
Sbjct  145  QQ  146



>gb|AET74077.1| oleosin [Juglans regia]
Length=139

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 5/124 (4%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            QPR     S+QV K ATA T GGSL++LSGL LT T+I L VATPL VIFSPVLVPA +T
Sbjct  14   QPR-----SHQVVKAATAATAGGSLLVLSGLILTGTVISLTVATPLFVIFSPVLVPAVIT  68

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
               I+ GFLASG FG  A  V  W+YRY TG+ P GA++ID AR +L++ A++MK++AEQ
Sbjct  69   VALIILGFLASGGFGVAAVTVLSWIYRYVTGRQPPGAEQIDQARMRLASKAREMKDRAEQ  128

Query  589  LAAQ  600
               Q
Sbjct  129  FGQQ  132



>ref|XP_008367838.1| PREDICTED: oleosin 18.5 kDa-like [Malus domestica]
Length=116

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R+ + LSYQ+AK +TA+T  GSL +LS LTLTA +IGLV ATPLLVIFSPVLVPA +   
Sbjct  3    RNPENLSYQLAKASTAITFSGSLSVLSSLTLTAVVIGLVAATPLLVIFSPVLVPAGVAML  62

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKE  576
             +  G + SG  GATA  VFYW+Y Y TG+HP+GADK+D     L++  + +K 
Sbjct  63   LLNTGLVMSGGLGATAAMVFYWVYNYVTGQHPVGADKLDQLASTLASGVRSIKN  116



>gb|ACG69514.1| oleosin S3-2 [Brassica napus]
Length=180

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ G L+
Sbjct  46   QIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGSLS  105

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
            SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL   AQD+K++A+
Sbjct  106  SGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGTKAQDIKDRAQ  154



>gb|ABB01618.1| oleosin low molecular weight isoform [Linum usitatissimum]
 gb|ABB01621.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=155

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (70%), Gaps = 5/129 (4%)
 Frame = +1

Query  214  MQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLV  393
            M    QPR     SYQ  K ATA T GGSL++LSGL LTAT+I L++ATPLLVIFSPVLV
Sbjct  23   MHQQQQPR-----SYQAVKAATAATAGGSLIVLSGLILTATVISLILATPLLVIFSPVLV  77

Query  394  PAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            PA +T   ++ GFLASG FG  A  V  W+YRY TG HP+GAD ++ AR +L+  A+++K
Sbjct  78   PALITVGLLITGFLASGGFGVAAVTVLSWIYRYVTGGHPVGADSLEQARSRLAGKAREVK  137

Query  574  EKAEQLAAQ  600
            ++A +   Q
Sbjct  138  DRASEFGQQ  146



>ref|XP_007144224.1| hypothetical protein PHAVU_007G138300g [Phaseolus vulgaris]
 gb|ESW16218.1| hypothetical protein PHAVU_007G138300g [Phaseolus vulgaris]
Length=138

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +1

Query  211  PMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVL  390
            P   Y    H+Q L  QVAK  TAVT GGS ++++ L LT T+I L + TPL VIFSPVL
Sbjct  12   PSLGYKDDPHQQTLCTQVAKAITAVTAGGSFLVVAALILTGTVIALTIVTPLFVIFSPVL  71

Query  391  VPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDM  570
            VPA +T  F+  GFLASG F   A  V  W+Y Y TGKHP GAD++D AR+KL N A+++
Sbjct  72   VPAVITVAFLSLGFLASGGFCVMAITVLAWIYGYVTGKHPPGADQLDSARDKLLNKAREI  131

Query  571  KE  576
            K+
Sbjct  132  KD  133



>gb|AHI54563.1| OleIII, partial [Camellia japonica]
Length=126

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  268  KTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGS  447
            K ATAVT GGSL++LSGLTL  T+I L +ATPLLVIFSPVLVPAA+T   ++ GFL SG 
Sbjct  22   KAATAVTAGGSLLVLSGLTLAGTVIALALATPLLVIFSPVLVPAAITVCLLIMGFLTSGG  81

Query  448  FGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKA  582
            FG     V  W+YRY TGKHP GAD++D AR KL++ A++MK++A
Sbjct  82   FGVAGISVLSWIYRYVTGKHPPGADQLDQARTKLASKAREMKDRA  126



>ref|XP_008234447.1| PREDICTED: oleosin 1 [Prunus mume]
Length=148

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = +1

Query  208  MPMQHYYQPRH-------EQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPL  366
            M  QH+  P H       +Q  SYQVAK ATAVT GGSL++LSGL L  T+I L +ATPL
Sbjct  1    MADQHFQPPLHFQGSYGQQQPRSYQVAKAATAVTAGGSLLVLSGLVLAGTVIALTIATPL  60

Query  367  LVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREK  546
            LVIFSPVLVPA +T   I  GFL SG FG  A  V  W+Y+Y TGK P GAD++D AR K
Sbjct  61   LVIFSPVLVPALITVALITMGFLTSGGFGVAAVTVLSWIYKYVTGKQPPGADQLDQARHK  120

Query  547  LSNAAQDMKEKAEQLAAQ  600
            L+  A+D+K++AEQ   Q
Sbjct  121  LAGKARDIKDRAEQFGQQ  138



>gb|ACG69513.1| oleosin S3-1 [Brassica napus]
Length=180

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+AK ATAVT GGSL++LS LTL  T+I L VAT LLVIFSP+LVPA +T   ++ GFL+
Sbjct  46   QIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATTLLVIFSPILVPALITVALLITGFLS  105

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            SG FG     VF W+Y+YATG+HP G+DK+D AR KL   AQD+K++A+    Q
Sbjct  106  SGGFGIADITVFSWIYKYATGEHPQGSDKLDSARMKLGTKAQDIKDRAQYYGQQ  159



>gb|AET74076.1| oleosin [Juglans regia]
Length=140

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S+QV K ATA T GGSL+LLSGL L +T+I L V TPLLVIFSPVLVPA +T   I+ GF
Sbjct  17   SHQVVKAATAATAGGSLLLLSGLILASTVIALTVVTPLLVIFSPVLVPAVITVCLIIFGF  76

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            LASG FG  A  V  W+YRY TG+ P G ++ID AR KL++ A++MK+KAEQ   Q
Sbjct  77   LASGGFGVAALTVLSWIYRYMTGRQPPGTEQIDQARMKLASKAREMKDKAEQFGQQ  132



>gb|AAZ20277.1| oleosin 2 [Arachis hypogaea]
Length=137

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R +Q  S Q+ K  TAV  GGSL++L+GL L AT+IGL   TPL VIFSPVLVPA +T  
Sbjct  12   RQDQPRSTQLVKATTAVVAGGSLLILAGLVLAATVIGLTTITPLFVIFSPVLVPAVITVA  71

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             +  GFLASG FG  A  V  W+YRY TGKHP GA+++D AR KL + A+++K+  +Q
Sbjct  72   LLGLGFLASGGFGVAAITVLTWIYRYVTGKHPPGANQLDTARHKLMSKAREIKDYGQQ  129



>ref|XP_002297927.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
 gb|EEE82732.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
Length=134

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = +1

Query  214  MQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLV  393
            +Q   QP  +Q  S Q+ K  TAVT GGSL++LSGLTL AT+I L +ATPLLVIFSPV+V
Sbjct  4    LQQSQQP-GKQPRSQQIVKATTAVTAGGSLLVLSGLTLAATVILLTIATPLLVIFSPVIV  62

Query  394  PAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            PA +    +L GFLASG FG        W+Y Y TG+HP G+D+++ AR KL+  A++MK
Sbjct  63   PAVMAVSLLLMGFLASGGFGVAGITAMSWIYGYVTGRHPPGSDQLEQARIKLAVKAREMK  122

Query  574  EKAEQLAAQ  600
            ++AEQ   Q
Sbjct  123  DRAEQFGHQ  131



>gb|AAZ20276.1| oleosin 1 [Arachis hypogaea]
Length=137

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R EQ  S Q+ K  TAV  GGSL++L+GL L  T+IGL   TPL VIFSPVLVPA +T  
Sbjct  12   RQEQPRSTQLVKATTAVVAGGSLLILAGLVLAGTVIGLTTITPLFVIFSPVLVPAVITVA  71

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             +  GFLASG FG  A  V  W+YRY TGKHP GA+++D AR KL   A+++K+  +Q
Sbjct  72   LLGLGFLASGGFGVAAITVLTWIYRYVTGKHPPGANQLDTARHKLMGKAREIKDFGQQ  129



>ref|XP_010047300.1| PREDICTED: oleosin 1 [Eucalyptus grandis]
 gb|KCW79182.1| hypothetical protein EUGRSUZ_C00618 [Eucalyptus grandis]
Length=148

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q  K ATA T+GG+L++LSGLTLT T++ L+VATP++V+FSP+LVPA +    I AGFLA
Sbjct  23   QAVKVATATTIGGALLVLSGLTLTGTVLALIVATPIMVLFSPILVPAGIAVALITAGFLA  82

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            SG FGA A     WMYRY  GKHP G ++++YAR K+++ A+D+KEKA++
Sbjct  83   SGGFGAAAVTALTWMYRYFAGKHPAGEEQVEYARAKIADTARDVKEKAKE  132



>gb|ABF57560.1| OleII [Camellia oleifera]
 gb|AHI54564.1| OleII, partial [Camellia japonica]
Length=141

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 95/138 (69%), Gaps = 6/138 (4%)
 Frame = +1

Query  187  FSSIFPKMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPL  366
             + I+P+   Q   +PR     S+QVAK ATA T  GSL++LS LTL  T++ L +ATPL
Sbjct  1    MAEIYPQQ-QQPTTEPR-----SHQVAKAATAATACGSLLILSALTLAGTVVALTLATPL  54

Query  367  LVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREK  546
            LVIFSPVLVPAA+    ++ GF+ASG FG  A  V  W+YRY TGK P GA+++DYAR K
Sbjct  55   LVIFSPVLVPAAIAVCLLILGFVASGGFGLAAVSVLSWIYRYVTGKQPPGAEQLDYARMK  114

Query  547  LSNAAQDMKEKAEQLAAQ  600
            L++ A++MK+KAE    Q
Sbjct  115  LASKAREMKDKAELFGQQ  132



>ref|XP_008376368.1| PREDICTED: oleosin 1-like [Malus domestica]
Length=148

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L +ATPLLVIFSPVLVPA +T   I  GFL SG FG  A  V  W+YRY TG+HP
Sbjct  56   GTVIALTIATPLLVIFSPVLVPAVITLSLITMGFLTSGGFGVAAVTVLSWIYRYVTGRHP  115

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
              AD++D AR KL+  A++M+++AEQ   Q
Sbjct  116  PDADQLDSARYKLAGKAREMRDRAEQYGQQ  145



>gb|KDP34143.1| hypothetical protein JCGZ_07714 [Jatropha curcas]
Length=146

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R     SY   K ATAVT+G + ++LSGLTLT TII L++ATP LV+FSP+LVPAA+   
Sbjct  13   RDPAPQSYPRVKFATAVTLGAAFLILSGLTLTGTIIALIMATPFLVLFSPILVPAAIAVV  72

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             + +GF  SG  G  A  V  WMY Y  GKHP GADKIDYAR +L+  A D+KEKA++
Sbjct  73   LVASGFFFSGGCGLAAIMVLTWMYNYLAGKHPPGADKIDYARGQLARKAHDIKEKAKE  130



>gb|AFR46652.1| oleosin1 [Plukenetia volubilis]
Length=143

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T+I LVVATP LV+ SPVLVPA +  F +  GF  SGS G  A  V  WMY Y TGKHP 
Sbjct  41   TVIALVVATPALVVCSPVLVPATIVVFLVTCGFFFSGSCGLAAIMVLTWMYNYLTGKHPP  100

Query  514  GADKIDYAREKLSNAAQDMKEKAEQ  588
            GAD++DYAR +++  A DMKE+A++
Sbjct  101  GADRLDYARGQIARKAHDMKERAKE  125



>emb|CDY08967.1| BnaC08g11970D [Brassica napus]
Length=179

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVA-TPLLVIFSPVLVPAALTTFFILAGFL  435
            Q+AK ATAVT GGSL++LS LTL  T+I L    +PLLVIFSP+LVPA +T   ++ GFL
Sbjct  46   QIAKAATAVTAGGSLLVLSSLTLVGTVIALTPGLSPLLVIFSPILVPALITVALLITGFL  105

Query  436  ASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            +SG FG  A  VF W+Y+YATG+HP G+DK+D AR KL + AQD+K++A+    Q
Sbjct  106  SSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDIKDRAQYYGQQ  160



>emb|CDX77021.1| BnaC04g38160D [Brassica napus]
Length=145

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 5/97 (5%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T+IGLVVATPL+V+FSPVLVPA +T   + AGFL SG  G  A     W+YRY TGKHP+
Sbjct  51   TVIGLVVATPLMVLFSPVLVPAVITMCLLTAGFLFSGGCGVAAATALSWIYRYVTGKHPM  110

Query  514  GADKIDYAREKLSNAAQDMKEKAEQLAAQPGNKGTTL  624
            GADK+DYAR  +S+ A++++       AQP    TT+
Sbjct  111  GADKVDYARVMISDKAKELEHY-----AQPQTDQTTI  142



>ref|XP_002516493.1| Oleosin, putative [Ricinus communis]
 gb|EEF45834.1| Oleosin, putative [Ricinus communis]
Length=232

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = +1

Query  178  LLKFSSIFPKMPMQHYYQPRHEQQL-------SYQVAKTATAVtmggslmllsgltltAT  336
            +L FS+ +   P     QPR   Q+       S+ V K  TA T+G + + LSGL LT T
Sbjct  71   ILSFSAYYYHTPFNMSDQPRSLHQMTPGTAAPSHLVVKFLTAATVGVACLFLSGLILTGT  130

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +I LV+ATPLLV+  P++VPAA+  F + +GF  SG  G  A     WMY+Y TGKHP G
Sbjct  131  VITLVMATPLLVLSGPIMVPAAIVVFLVCSGFFFSGGCGLAAIMSLTWMYKYLTGKHPPG  190

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            ADK+DYAR +++  A DMKE+A++
Sbjct  191  ADKLDYARGQIARKAHDMKERAKE  214



>ref|XP_006853752.1| hypothetical protein AMTR_s00056p00188310 [Amborella trichopoda]
 gb|ERN15219.1| hypothetical protein AMTR_s00056p00188310 [Amborella trichopoda]
Length=147

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +I LV+ATP+LVIFSP+LVPA +  F  + GFL SG FG  A     W+Y Y TGKHP+G
Sbjct  49   VIVLVLATPVLVIFSPILVPAGIAIFLAVTGFLFSGGFGVAALSALAWIYNYVTGKHPVG  108

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +DKID AR  L++ A+DMKEKA+Q
Sbjct  109  SDKIDRARMTLASKAKDMKEKAKQ  132



>ref|XP_004956407.1| PREDICTED: oleosin Zm-I-like [Setaria italica]
Length=154

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+T   + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  61   GTVIALTVATPVLVIFSPVLVPAAITLALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHP  120

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
             GAD++D+A+ +L++ A+D+K+ A+
Sbjct  121  PGADQLDHAKARLASKARDIKDAAQ  145



>ref|XP_003556321.1| PREDICTED: oleosin 1-like isoform 1 [Glycine max]
Length=147

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 87/131 (66%), Gaps = 7/131 (5%)
 Frame = +1

Query  217  QHYYQPRH-----EQQLSY--QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVI  375
            QH Y  R+     EQQ SY  QV K ATAVT GGSL++L+ L L  TII L + TP LVI
Sbjct  9    QHQYPHRYPNDPYEQQTSYSTQVVKAATAVTAGGSLLILASLILAGTIIALTIVTPPLVI  68

Query  376  FSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSN  555
            FSPVLVPA +T   +  GFLASG FG  A  V  W+YRY TGK+P GAD++D A  K+ +
Sbjct  69   FSPVLVPAVITVALLSLGFLASGGFGVAAITVLAWIYRYVTGKYPPGADQLDSAPHKIMD  128

Query  556  AAQDMKEKAEQ  588
             A+++K+  +Q
Sbjct  129  KAREIKDYGQQ  139



>ref|XP_009140712.1| PREDICTED: oleosin 1 [Brassica rapa]
 emb|CDY35326.1| BnaA04g15210D [Brassica napus]
Length=146

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 9/98 (9%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T+IGLVVATPL+V+FSPVLVPA +T   + AGFL SG  G  A     W+YRY TGKHP+
Sbjct  52   TVIGLVVATPLMVLFSPVLVPAVITMCLLTAGFLFSGGCGVAAATALSWIYRYVTGKHPM  111

Query  514  GADKIDYAREKLSNAAQDMKEKAEQLA--AQPGNKGTT  621
            GADK+DYAR  +S       EKA++L   AQP    TT
Sbjct  112  GADKVDYARMMIS-------EKAKELGHYAQPQTDQTT  142



>gb|KHG16380.1| Oleosin 1 [Gossypium arboreum]
Length=131

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +1

Query  217  QHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVP  396
             HY Q  + Q +++Q+ K ATA T GGSL++LSGL L  T+I L +ATPL VIFSPVLVP
Sbjct  3    DHYLQ--NTQPMTHQMVKAATAATAGGSLLILSGLILAGTVIALTIATPLFVIFSPVLVP  60

Query  397  AALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKE  576
            A + T  +  GF+ASG FG  A  V  W+YRY TG+HP  AD++D A  KL++ A++MK+
Sbjct  61   ALIATALLATGFVASGGFGVAAVTVLSWIYRYVTGRHPPAADQLDSAGMKLASKAREMKD  120

Query  577  KAEQL  591
            +A QL
Sbjct  121  RAAQL  125



>ref|NP_001237482.1| uncharacterized protein LOC100306353 [Glycine max]
 gb|ACU14486.1| unknown [Glycine max]
Length=147

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 86/135 (64%), Gaps = 13/135 (10%)
 Frame = +1

Query  223  YYQPRHEQQLSY-------------QVAKTATAVtmggslmllsgltltATIIGLVVATP  363
            +YQP+H+  L Y             QV K ATAVT GGSL++L+ L L AT+I L + TP
Sbjct  5    HYQPQHQYPLRYPNDPHQQTRSSTHQVVKAATAVTAGGSLLILASLILAATVIALTIVTP  64

Query  364  LLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYARE  543
            L VIFSPVLVPA +T   +  GFLAS  FG  A  V  W+YRY TGK P GAD++D AR 
Sbjct  65   LFVIFSPVLVPAVITVALLSLGFLASSGFGVAAITVLAWIYRYVTGKQPPGADQLDSARH  124

Query  544  KLSNAAQDMKEKAEQ  588
            K+ + A+++K+  +Q
Sbjct  125  KIMDKAREIKDYGQQ  139



>ref|XP_007038271.1| Oleosin 1 [Theobroma cacao]
 gb|EOY22772.1| Oleosin 1 [Theobroma cacao]
Length=138

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = +1

Query  217  QHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVP  396
            Q Y+ P + Q  S+Q+ K ATA T GGSL++LSGL L  T+I L +ATPL VIFSPVLVP
Sbjct  9    QQYHHP-YSQPRSHQMVKAATAATAGGSLLILSGLILAGTVIALTIATPLFVIFSPVLVP  67

Query  397  AALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKE  576
            A +    ++ GF+ASG FG  A  V  W+YRY TG HP GAD++D AR  L+  A++M E
Sbjct  68   ALIAAALLVTGFMASGGFGVAAITVLSWIYRYVTGGHPPGADQLDQARMTLARKAREMNE  127

Query  577  KAEQLAA  597
              EQL +
Sbjct  128  GPEQLTS  134



>ref|XP_011019556.1| PREDICTED: oleosin 1-like [Populus euphratica]
Length=239

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = +1

Query  211  PMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVL  390
            PM  Y +P   Q +S +  K  TA T+G +L++LSGLTLT T+I LVVATP+LV+ SP+L
Sbjct  97   PMSRY-EPSSGQPISRKAVKFMTAGTIGAALLVLSGLTLTGTVIALVVATPVLVLSSPIL  155

Query  391  VPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDM  570
            VPA +  F + +GF  S   G  A  V  W+Y Y TGKHP GADK+DYAR ++S  A+DM
Sbjct  156  VPAVIVVFLVTSGFFFSSGCGLAAIMVSLWIYNYVTGKHPPGADKLDYARGRISETAKDM  215

Query  571  KEKAEQ  588
            K++A++
Sbjct  216  KDRAKE  221



>ref|XP_006450748.1| hypothetical protein CICLE_v10009815mg [Citrus clementina]
 ref|XP_006476125.1| PREDICTED: oleosin 1-like [Citrus sinensis]
 gb|ESR63988.1| hypothetical protein CICLE_v10009815mg [Citrus clementina]
 gb|KDO79938.1| hypothetical protein CISIN_1g045010mg [Citrus sinensis]
Length=146

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L++ATP+LV+FSP+LVPAA+  F    GFL SG  G TA  V  W+Y Y  GKHP
Sbjct  45   GTVIALIMATPVLVLFSPILVPAAIAVFLATVGFLVSGGCGVTAITVLSWIYSYVKGKHP  104

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             GAD +DYAR K+++ A+DM E+A++
Sbjct  105  PGADHLDYARTKIADKARDMTERAKE  130



>ref|XP_002275496.1| PREDICTED: oleosin 1 [Vitis vinifera]
 emb|CAN74835.1| hypothetical protein VITISV_023324 [Vitis vinifera]
Length=146

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q  K  TA T+G  L++LSGLTLT T+I L++ATP LV+FSP+LVPA    F    GF
Sbjct  19   SRQAVKFLTAATIGTILLVLSGLTLTGTVIALIIATPALVVFSPILVPAGTVIFLATTGF  78

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            L SG  G TA     W+Y Y  GKHP GAD++DYAR +++N A+DMKE+A++
Sbjct  79   LFSGCCGVTALMALSWLYEYVAGKHPPGADQLDYARMRIANKARDMKERAKE  130



>ref|XP_002309527.2| hypothetical protein POPTR_0006s25150g, partial [Populus trichocarpa]
 gb|EEE93050.2| hypothetical protein POPTR_0006s25150g, partial [Populus trichocarpa]
Length=185

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +1

Query  187  FSSIFP--KMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVAT  360
            F+ IFP   +PM  Y +P   Q  S +  K  TA T+G +L++LSGLTLT T+I LVVAT
Sbjct  33   FALIFPVIAVPMSRY-EPSSGQPTSRKAVKFMTAGTIGAALLVLSGLTLTGTVIALVVAT  91

Query  361  PLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAR  540
            P+LV+ SP+LVPAA+  F + +GF  S   G  A  V  W+Y Y TGKHP GADK+DYA 
Sbjct  92   PVLVLSSPILVPAAIVVFLVASGFFFSSGCGLAAIMVSLWIYNYVTGKHPPGADKLDYAG  151

Query  541  EKLSNAAQDMKEKAEQLA  594
             +++  A+DMK++A++  
Sbjct  152  GRIAETAKDMKDRAKECG  169



>ref|XP_006295714.1| hypothetical protein CARUB_v10024833mg [Capsella rubella]
 gb|EOA28612.1| hypothetical protein CARUB_v10024833mg [Capsella rubella]
Length=150

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL+VATPL+V+FSPVLVPA +T   + AGF  SG  G  A     W+YRY TGKHP
Sbjct  54   GTVIGLIVATPLMVLFSPVLVPAMITLVLLTAGFFFSGGCGVAAATALTWIYRYVTGKHP  113

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            +GADK+DYAR ++S  A+++   A  L  Q
Sbjct  114  MGADKVDYARMRISEKAKELGHFAHPLTHQ  143



>ref|XP_003591653.1| Oleosin [Medicago truncatula]
 gb|AES61904.1| oleosin [Medicago truncatula]
Length=149

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K++TAVT GGSL++LSGL L  T+I L +ATPL ++FSPVLVPA +T   +  GF  
Sbjct  32   QLLKSSTAVTAGGSLLILSGLVLAGTVIALTIATPLFLLFSPVLVPAVITVALLTLGFFV  91

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            SG FG  A  V  W+YRY TGKHP GAD++D AR KL N A+++K+  +Q
Sbjct  92   SGGFGVAAITVLAWIYRYVTGKHPPGADQLDTARHKLMNKAREIKDYGQQ  141



>ref|XP_007012203.1| Oleosin [Theobroma cacao]
 gb|AAM46778.1|AF466103_1 15.8 kDa oleosin [Theobroma cacao]
 gb|EOY29822.1| Oleosin [Theobroma cacao]
Length=147

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q AK  TA T+G +L+ LSGLTLT T++ L++ATPL+VIFSP+LVPA +  F ++ GF
Sbjct  20   SRQAAKFLTATTLGATLLFLSGLTLTGTVMALIMATPLMVIFSPILVPAGVVIFLVITGF  79

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            L SG  G  A     W+Y Y  GKHP GAD++DYAR  L+  A+DM EKA++
Sbjct  80   LFSGGCGVAAITALSWIYNYVRGKHPPGADQLDYARNTLARTARDMTEKAKE  131



>gb|KFK32534.1| hypothetical protein AALP_AA6G255700 [Arabis alpina]
Length=143

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL++ATPL+V+FSPVLVPA +TT  + AGFL SG +G  A     W+YRY TGKHPIG
Sbjct  50   VIGLIIATPLMVLFSPVLVPAVITTGILTAGFLFSGGYGVAAVTALSWIYRYVTGKHPIG  109

Query  517  ADKIDYAREKLSNAAQDMKEKAE  585
            +D++DYAR  +S  A+++   A 
Sbjct  110  SDRVDYARSMISEKAKELGHYAH  132



>ref|XP_002511014.1| Oleosin 2 [Ricinus communis]
 gb|AAR15172.1| oleosin [Ricinus communis]
 gb|EEF51616.1| Oleosin 2 [Ricinus communis]
Length=138

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K  TA T G SL+ LSGLTLT T+I L +ATPL+V+FSPVL+PA +    I AGFL 
Sbjct  18   QLVKAGTAATAGSSLLFLSGLTLTGTVIALALATPLMVLFSPVLLPAVIIISLIGAGFLT  77

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            SG FG  A  V  W+YRY TGK P GA+ +D AR KL+  A++MK++AEQ
Sbjct  78   SGGFGFGAILVLSWIYRYVTGKQPPGAESLDQARLKLAGKAREMKDRAEQ  127



>ref|XP_009370420.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=148

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L +ATPLLVIFSPVLVPA +T   I  GFL SG F   A  V  W+YRY TGKHP
Sbjct  56   GTVIALTIATPLLVIFSPVLVPAVITLSLITMGFLTSGGFSVAAVTVLSWIYRYVTGKHP  115

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
              AD++D AR KL+  A++++++ EQ   Q
Sbjct  116  PDADQLDSARYKLAGKAREIRDRVEQYGQQ  145



>emb|CAA57995.1| low molecular weight oleosin [Hordeum vulgare subsp. vulgare]
Length=158

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  65   GTVIALTVATPVLVIFSPVLVPAAIALALMSAGFVTSGGLGVAALSVFSWMYKYLTGKHP  124

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
             GAD++D+A+ +L++ A+D+K+ A+
Sbjct  125  PGADQLDHAKARLASKARDIKDAAQ  149



>dbj|BAJ85423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  66   GTVIALTVATPVLVIFSPVLVPAAIALALMSAGFVTSGGLGVAALSVFSWMYKYLTGKHP  125

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
             GAD++D+A+ +L++ A+D+K+ A+
Sbjct  126  PGADQLDHAKARLASKARDIKDAAQ  150



>sp|Q96543.1|OLE16_BROSE RecName: Full=Oleosin 16 kDa [Bromus secalinus]
 gb|AAB67992.1| oleosin [Bromus secalinus]
Length=167

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA++   + AGF+ SG  G  A  VF WMY+Y  GKHP
Sbjct  74   GTVIALTVATPVLVIFSPVLVPAAISMALMSAGFVTSGGLGVAAVSVFSWMYKYLAGKHP  133

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
             GAD++D+A+ +L++ A+D+K+ A+
Sbjct  134  PGADQLDHAKARLASKARDIKDAAQ  158



>ref|XP_009372826.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=148

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L +ATPLLVIFSPVLVPA +T   I  GFL SG F   A  V  W+YRY TGKHP
Sbjct  56   GTVIALTIATPLLVIFSPVLVPAVITLSLITMGFLTSGGFSVAAVTVLSWIYRYVTGKHP  115

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
               D++D AR KL+  A++++++ EQ   Q
Sbjct  116  PDVDQLDSARYKLAGKAREIRDRVEQYGQQ  145



>ref|XP_010546531.1| PREDICTED: oleosin 1 [Tarenaya hassleriana]
Length=138

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I LV+ATPL+VIFSPVL+PA +T   + AGFL SG  G  A     W+YRY TGKHP
Sbjct  43   GTVIALVLATPLMVIFSPVLIPAVITMVVLAAGFLFSGGCGVAAATALSWIYRYVTGKHP  102

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
            IGADKIDYAR +++  A++     +Q
Sbjct  103  IGADKIDYARMRIAEKAKEYGHYVQQ  128



>ref|XP_008357299.1| PREDICTED: oleosin 1-like [Malus domestica]
Length=152

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L ++TPLLVIFSPVLVP  +    I+ GFL S  FG  +  V  W+YRYATGK P
Sbjct  57   GTVIALTISTPLLVIFSPVLVPTVIAFSLIIMGFLTSSGFGVASVTVVTWIYRYATGKQP  116

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQL  591
             GAD++D AR KL+  A +MK++AEQ 
Sbjct  117  PGADQLDSARHKLARKASEMKDRAEQF  143



>ref|XP_010472616.1| PREDICTED: oleosin 14.9 kDa-like [Camelina sativa]
Length=149

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 83/123 (67%), Gaps = 5/123 (4%)
 Frame = +1

Query  202  PKMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFS  381
            P M   H   P      + Q+ +  TA T+G SL++LSGLTLT T+IGL+VATPL+V+FS
Sbjct  16   PIMKSLHDSSPS-----TRQIVRILTAATIGLSLLVLSGLTLTGTVIGLIVATPLMVLFS  70

Query  382  PVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAA  561
            PVLVPA +T   +  GFL SG  G  A     W+YRY TGKHP+GADK+DYAR +++  A
Sbjct  71   PVLVPAVITMGLLTVGFLFSGGCGVAAATALTWIYRYVTGKHPVGADKVDYARMRITEKA  130

Query  562  QDM  570
            +++
Sbjct  131  KEL  133



>gb|AAU21501.1| oleosin 3 [Arachis hypogaea]
Length=166

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL++ATPLLVIFSP+LVPAA+T      GFL SG  G  A     W+Y Y TGKHP
Sbjct  67   GTVIGLIIATPLLVIFSPILVPAAITLALAAGGFLFSGGCGVAAIAALSWLYSYVTGKHP  126

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLA----AQPGNKG  615
             G+D++DYA+  +++ A+D+K++A+  A    AQ G  G
Sbjct  127  AGSDRLDYAKGVIADKARDVKDRAKDYAGAGRAQEGTPG  165



>ref|XP_008780784.1| PREDICTED: oleosin 16 kDa-like, partial [Phoenix dactylifera]
Length=144

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  244  QQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFIL  423
            Q  S+ + +  TA T+GG L+LLSGLTLT T+IGL V TPLLVIFSPVLVPA +  F ++
Sbjct  27   QPTSHTIVRGVTAATIGGLLLLLSGLTLTGTVIGLTVVTPLLVIFSPVLVPATIAVFLLV  86

Query  424  AGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            AGF+ SG FG  A  V  WMY+Y TG+ P G D+++ AR +L++ A+D+KE A+ 
Sbjct  87   AGFVTSGGFGVAALSVLSWMYQYVTGRRPPGFDQLEQARARLASKARDIKESAQH  141



>ref|NP_001053473.1| Os04g0546500 [Oryza sativa Japonica Group]
 sp|Q42980.2|OLEO1_ORYSJ RecName: Full=Oleosin 16 kDa; AltName: Full=OSE701 [Oryza sativa 
Japonica Group]
 dbj|BAF15387.1| Os04g0546500 [Oryza sativa Japonica Group]
Length=148

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +1

Query  229  QPRHEQQLSYQVA-KTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAAL  405
            Q + E+Q     A KT TA T GGS+++LSGL L  T+I L VATP+LVIFSPVLVPAA+
Sbjct  20   QEQQEKQRFMMTALKTVTAATAGGSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAI  79

Query  406  TTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
                + AGF+ SG  G  A  VF WMY+Y TGKHP GAD++D+A+ +L++ A+D+KE A+
Sbjct  80   ALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAAQ  139



>ref|XP_010417366.1| PREDICTED: oleosin 1-like [Camelina sativa]
 ref|XP_010417367.1| PREDICTED: oleosin 1-like [Camelina sativa]
Length=148

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL+VATPL+V+FSPVLVPA +T   +  GFL SG  G  A     W+YRY TGKHP
Sbjct  53   GTVIGLIVATPLMVLFSPVLVPAVITMGLLTVGFLFSGGCGVAAATALTWIYRYVTGKHP  112

Query  511  IGADKIDYAREKLSNAAQDM  570
            +GADK+DYAR +++  A+++
Sbjct  113  MGADKVDYARMRITEKAKEL  132



>ref|XP_010668835.1| PREDICTED: oleosin 16 kDa [Beta vulgaris subsp. vulgaris]
Length=168

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            ++ LV+ATP+LV+FSP+LVPA +  F I +GF+ SG  G  A     W+Y+Y TGKHP+G
Sbjct  55   VLALVLATPVLVLFSPILVPATMVVFVIASGFVFSGGCGVAAVSALSWIYQYTTGKHPMG  114

Query  517  ADKIDYAREKLSNAAQDMKEKAE  585
            AD++D AR +++N A+++KEKA+
Sbjct  115  ADQLDRARMRITNVAREIKEKAK  137



>gb|AAC02239.1| 16 kDa oleosin [Oryza sativa]
 emb|CAH67261.1| OSIGBa0101C23.13 [Oryza sativa Indica Group]
 gb|EAY95056.1| hypothetical protein OsI_16871 [Oryza sativa Indica Group]
 gb|EAZ31530.1| hypothetical protein OsJ_15670 [Oryza sativa Japonica Group]
 gb|AGH17547.1| 16KDa oleosin [Oryza sativa]
Length=148

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +1

Query  229  QPRHEQQLSYQVA-KTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAAL  405
            Q + E+Q     A KT TA T GGS+++LSGL L  T+I L VATP+LVIFSPVLVPAA+
Sbjct  20   QEQQEKQPFMMTALKTVTAATAGGSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAI  79

Query  406  TTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
                + AGF+ SG  G  A  VF WMY+Y TGKHP GAD++D+A+ +L++ A+D+KE A+
Sbjct  80   ALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAAQ  139



>ref|XP_010275437.1| PREDICTED: oleosin 1-like [Nelumbo nucifera]
Length=126

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  HEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFF  417
             +Q    +V K   A+++GG ++LL+GLTL AT+IGL +ATPLLVIFSP+L+PAA+    
Sbjct  7    QQQPNCQKVVKAVAAISIGGCVLLLAGLTLAATVIGLTLATPLLVIFSPILLPAAMAASL  66

Query  418  ILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEK  579
            ++ GFL SG  G     V  W+Y+Y TGKHP G+D++  A  KL +A +DMKEK
Sbjct  67   LITGFLTSGGLGVAGVSVLSWLYQYVTGKHPPGSDQLHQAEMKLQSAVKDMKEK  120



>ref|XP_002878899.1| hypothetical protein ARALYDRAFT_901265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55158.1| hypothetical protein ARALYDRAFT_901265 [Arabidopsis lyrata subsp. 
lyrata]
Length=143

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGLVVATPL+V+FSPVLVPA +T   +  GFL SG  G  A     W+Y+Y +GKHP
Sbjct  45   GTVIGLVVATPLMVLFSPVLVPAVITMGLLTMGFLFSGGCGVAAATALTWIYKYVSGKHP  104

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
            +GADK+DYAR +++  A+++   A+
Sbjct  105  MGADKVDYARMRIAEKAKELGHYAQ  129



>gb|AAO22794.1| putative oleosin protein [Arabidopsis thaliana]
Length=167

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +1

Query  238  HEQQLS-YQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            HE   S  Q+ +  TA T+G SL++LSGLTLT T+IGL+VATPL+V+FSPVLVPA +T  
Sbjct  37   HESSPSTRQIVRFVTAATIGLSLLVLSGLTLTGTVIGLIVATPLMVLFSPVLVPAVITIG  96

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDM  570
             +  GFL SG  G  A     W+Y+Y TGKHP+GADK+DYAR +++  A+++
Sbjct  97   LLTMGFLFSGGCGVAAATALTWIYKYVTGKHPMGADKVDYARMRIAEKAKEL  148



>ref|XP_008786272.1| PREDICTED: oleosin 16 kDa-like [Phoenix dactylifera]
Length=132

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            Q +  Q  S +V K  TA T+GGSL+LLSGL +  T+IG+ V TPLLVIFSPVLVPA +T
Sbjct  5    QQKEHQPTSPRVVKGVTAATIGGSLLLLSGLMMAGTVIGVTVVTPLLVIFSPVLVPAVIT  64

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             F ++ GF+ SG  G  A  V  W+Y+Y TGK   G+++++ AR +L++ A+D+K+ A++
Sbjct  65   VFLLVTGFVTSGGLGVAAISVLSWLYKYLTGKRLPGSEQLEQARAQLASKARDIKDHAQR  124

Query  589  LAAQ  600
               Q
Sbjct  125  RTEQ  128



>ref|XP_010429602.1| PREDICTED: oleosin 14.9 kDa-like [Camelina sativa]
Length=146

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL+VATPL+V+FSPVLVPA +T   +  GFL SG  G  A     W+YRY TGKHP
Sbjct  53   GTVIGLIVATPLMVLFSPVLVPAVITMGLLTVGFLFSGGCGVAAASALTWIYRYVTGKHP  112

Query  511  IGADKIDYAREKLSNAAQD  567
            +GADK+DYAR +++  A++
Sbjct  113  MGADKVDYARMRITEKAKE  131



>gb|AAC42242.1| oleosin [Arabidopsis thaliana]
Length=174

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +1

Query  238  HEQQLS-YQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            HE   S  Q+ +  TA T+G SL++LSGLTLT T+IGL+VATPL+V+FSPVLVPA +T  
Sbjct  44   HESSPSTRQIVRFVTAATIGLSLLVLSGLTLTGTVIGLIVATPLMVLFSPVLVPAVITIG  103

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDM  570
             +  GFL SG  G  A     W+Y+Y TGKHP+GADK+DYAR +++  A+++
Sbjct  104  LLTMGFLFSGGCGVAAATALTWIYKYVTGKHPMGADKVDYARMRIAEKAKEL  155



>ref|NP_180160.2| Oleosin-like protein [Arabidopsis thaliana]
 gb|AAZ23930.1| At2g25890 [Arabidopsis thaliana]
 gb|AEC07768.1| Oleosin-like protein [Arabidopsis thaliana]
Length=149

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +1

Query  238  HEQQLS-YQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            HE   S  Q+ +  TA T+G SL++LSGLTLT T+IGL+VATPL+V+FSPVLVPA +T  
Sbjct  19   HESSPSTRQIVRFVTAATIGLSLLVLSGLTLTGTVIGLIVATPLMVLFSPVLVPAVITIG  78

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDM  570
             +  GFL SG  G  A     W+Y+Y TGKHP+GADK+DYAR +++  A+++
Sbjct  79   LLTMGFLFSGGCGVAAATALTWIYKYVTGKHPMGADKVDYARMRIAEKAKEL  130



>ref|XP_010442776.1| PREDICTED: oleosin 14.9 kDa-like [Camelina sativa]
Length=143

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  25   QMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAVITVTLIITGFLA  84

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            SG FG  A   F W+YR+ TG    G+DKI+ AR K+ + AQD K
Sbjct  85   SGGFGIAAITAFSWLYRHMTGS---GSDKIENARMKVGSRAQDTK  126



>emb|CAE02016.3| OSJNBa0079A21.14 [Oryza sativa Japonica Group]
Length=224

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +1

Query  229  QPRHEQQLSYQVA-KTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAAL  405
            Q + E+Q     A KT TA T GGS+++LSGL L  T+I L VATP+LVIFSPVLVPAA+
Sbjct  96   QEQQEKQRFMMTALKTVTAATAGGSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAI  155

Query  406  TTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
                + AGF+ SG  G  A  VF WMY+Y TGKHP GAD++D+A+ +L++ A+D+KE A+
Sbjct  156  ALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAAQ  215



>ref|XP_010244394.1| PREDICTED: oleosin 16 kDa [Nelumbo nucifera]
Length=143

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q  K  TA T+G +L++LSGL LT T+I LV+ATPLLV+FSP+L+PAA+  F +  GF
Sbjct  19   SRQTVKFLTAATIGTTLLVLSGLILTGTVISLVIATPLLVLFSPILIPAAIVVFLVATGF  78

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            L SG     A  V  W Y Y +GKHP+G+D++DYAR  L+N A++  +  +Q A +
Sbjct  79   LFSGGCAVAALSVMSWTYNYMSGKHPLGSDQLDYARTTLANKAKEYGQYVQQKAQE  134



>gb|AAF76238.1|AF273023_1 oleosin [Elaeis guineensis]
Length=140

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            Q   +Q  S +V K   A T+GGSL+L+SGLTL  T+IGL V TPLLVIFSPVLVPA + 
Sbjct  13   QMAEQQPTSQRVVKGVAAATIGGSLLLVSGLTLAGTVIGLAVVTPLLVIFSPVLVPAVIA  72

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             F ++ GF+ SG  G  A  V  W+Y+Y TGK   G+++++ AR +L++ A+D+KE A+ 
Sbjct  73   VFLLVTGFVTSGGLGVAALSVLSWLYKYLTGKRVPGSEQLEQARARLASKARDVKESAQH  132

Query  589  LAAQ  600
             + Q
Sbjct  133  RSEQ  136



>ref|NP_199934.1| oleosin3 [Arabidopsis thaliana]
 sp|Q43284.2|OLEO3_ARATH RecName: Full=Oleosin 14.9 kDa [Arabidopsis thaliana]
 dbj|BAA97384.1| oleosin-like [Arabidopsis thaliana]
 emb|CAA90878.2| oleosin [Arabidopsis thaliana]
 gb|AAW38973.1| At5g51210 [Arabidopsis thaliana]
 gb|AAX22276.1| At5g51210 [Arabidopsis thaliana]
 gb|AED96053.1| oleosin3 [Arabidopsis thaliana]
Length=141

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  26   QMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAVVTVALIITGFLA  85

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            SG FG  A   F W+YR+ TG    G+DKI+ AR K+ +  QD K     +  Q
Sbjct  86   SGGFGIAAITAFSWLYRHMTGS---GSDKIENARMKVGSRVQDTKYGQHNIGVQ  136



>ref|XP_010482455.1| PREDICTED: oleosin 14.9 kDa-like [Camelina sativa]
Length=143

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  25   QMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAVITVTLIITGFLA  84

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            SG FG  A   F W+YR+ TG    G+++ID AR K+ + AQD K
Sbjct  85   SGGFGIAAITAFSWLYRHMTGS---GSERIDNARMKVGSRAQDTK  126



>ref|XP_004501216.1| PREDICTED: oleosin 1-like [Cicer arietinum]
Length=153

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = +1

Query  226  YQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAAL  405
            Y P   Q  S Q  K  TA T+G SL+ LSGL L  T+IGL++ATPLLV+FSP+LVPAA+
Sbjct  17   YDPNINQP-SRQTVKFLTAATIGVSLLFLSGLILVGTVIGLIIATPLLVLFSPILVPAAI  75

Query  406  TTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
                I  GFL SG  G  A     W+Y Y +G  P G+D +DYA+  +++ A+D+KE+A+
Sbjct  76   ILSLIAGGFLFSGGCGVAAIAALSWIYNYVSGNRPAGSDTLDYAKGMITDKARDVKERAK  135

Query  586  Q  588
            +
Sbjct  136  E  136



>ref|XP_010919722.1| PREDICTED: oleosin 16 kDa-like [Elaeis guineensis]
Length=132

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  229  QPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALT  408
            Q +  Q  S+ V + A A T+GGSL+LLSGLTLT T+IGL   TPLLVIF PVLVPAA+ 
Sbjct  5    QQKERQPTSHAVVRGAMAATIGGSLLLLSGLTLTGTVIGLTAVTPLLVIFGPVLVPAAIA  64

Query  409  TFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
             F ++AGF+ +G  G  A  V  WMY+Y TG+ P G ++++ AR +L++ A+D+KE A+
Sbjct  65   VFLLVAGFVTAGGLGVAALSVLSWMYKYLTGRRPPGFEQLEQARARLASKARDIKESAQ  123



>ref|XP_006282218.1| hypothetical protein CARUB_v10028491mg [Capsella rubella]
 gb|EOA15116.1| hypothetical protein CARUB_v10028491mg [Capsella rubella]
Length=146

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  28   QMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAVITVTLIITGFLA  87

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            SG FG  A   F W+YR+ TG    G++KI+ AR K+ + AQD K
Sbjct  88   SGGFGIAAITAFSWLYRHMTGS---GSEKIENARMKMGSRAQDTK  129



>gb|AAO22633.1| putative oleosin [Arabidopsis thaliana]
Length=141

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T++ L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  26   QMVKAATAVTAGGSLLVLSGLTLAGTVVALTVATPLLVIFSPVLVPAVVTVALIITGFLA  85

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            SG FG  A   F W+YR+ TG    G+DKI+ AR K+ +  QD K     +  Q
Sbjct  86   SGGFGIAAITAFSWLYRHMTGS---GSDKIENARMKVGSRVQDTKYGQHNIGVQ  136



>ref|XP_010442605.1| PREDICTED: oleosin 14.9 kDa [Camelina sativa]
Length=143

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  25   QMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAVITVTLIITGFLA  84

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            SG FG  A   F W+YR+ TG    G+DKI+ AR K+ +  QD K
Sbjct  85   SGGFGIAAITAFSWLYRHMTGS---GSDKIENARMKVGSRTQDTK  126



>gb|ACF82134.1| unknown [Zea mays]
 gb|ACG24643.1| oleosin 16 kDa [Zea mays]
 tpg|DAA36592.1| TPA: oleosin1 [Zea mays]
Length=156

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  63   GTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHP  122

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
             GAD++D+A+ +L++ A+D+K+ A+
Sbjct  123  PGADQLDHAKARLASKARDIKDAAQ  147



>gb|AAA33481.1| major protein L3, partial [Zea mays]
Length=147

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  54   GTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHP  113

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
             GAD++D+A+ +L++ A+D+K+ A+
Sbjct  114  PGADQLDHAKARLASKARDIKDAAQ  138



>ref|XP_003603568.1| Oleosin [Medicago truncatula]
 gb|AES73819.1| oleosin [Medicago truncatula]
Length=161

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
             +  Q S Q  K  TA T+G +L+ LSGL L  T+IGL++ATPLLVIFSP+LVPAA+   
Sbjct  27   NNNNQPSRQTVKFITAATIGVTLLFLSGLILVGTVIGLIIATPLLVIFSPILVPAAIVLS  86

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
             I  GF+ SG  G  A     W+Y Y +G  P G D +DYA+  +++ A+D+KE+A+ 
Sbjct  87   LIAGGFMFSGGCGVAAIAALSWIYNYVSGNRPAGTDTLDYAKGLITDKARDVKERAKD  144



>gb|AFR46654.1| oleosin3 [Plukenetia volubilis]
Length=139

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +1

Query  208  MPMQHYYQP--RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFS  381
            M  Q   +P  +H    S+QV K ATA T G S + LSGLTL  T+I L   TPL+VIFS
Sbjct  1    MADQQVLRPGAQHHPPRSHQVLKAATAATAGCSFLFLSGLTLAGTVIALTTTTPLMVIFS  60

Query  382  PVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAA  561
            PVL PA +T   I+AGF+ SG F   A  V  W+YR+ TG+  +GA+ +D AR + +  A
Sbjct  61   PVLAPAVITAGLIIAGFMISGGFSFAAILVLSWIYRHVTGQRTLGAESLDEARLRWAGKA  120

Query  562  QDMKEKAEQ  588
            ++ K++AEQ
Sbjct  121  RETKDRAEQ  129



>ref|XP_003580271.1| PREDICTED: oleosin 16 kDa [Brachypodium distachyon]
Length=161

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T++ L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  68   GTVVALTVATPVLVIFSPVLVPAAVALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHP  127

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
             GAD++D+A+ ++++ A+D+K+ A+    Q
Sbjct  128  PGADQLDHAKARIASKARDIKDAAQHRVDQ  157



>ref|XP_009386092.1| PREDICTED: oleosin 16 kDa-like [Musa acuminata subsp. malaccensis]
Length=136

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T+I L VATPLL+IFSPVLVPAA+    + AGFLASG  G  A  V +WMY+  TGK P 
Sbjct  43   TVIALAVATPLLMIFSPVLVPAAIVVLLLAAGFLASGGLGVAALAVLWWMYKDLTGKQPP  102

Query  514  GADKIDYAREKLSNAAQDMKEKAEQ  588
            G + ++  R++L + A+D++E  +Q
Sbjct  103  GVELLEQVRQRLVSKARDIRESLQQ  127



>gb|ACG48556.1| oleosin 16 kDa [Zea mays]
Length=233

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  63   GTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHP  122

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
             GAD++D+A+ +L++ A+D+K+ A+
Sbjct  123  PGADQLDHAKARLASKARDIKDAAQ  147



>ref|XP_002448279.1| hypothetical protein SORBIDRAFT_06g024350 [Sorghum bicolor]
 gb|EES12607.1| hypothetical protein SORBIDRAFT_06g024350 [Sorghum bicolor]
Length=160

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  67   GTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHP  126

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             GAD++D+A+ +L++ A+D+K+ A+ 
Sbjct  127  PGADQLDHAKARLASKARDIKDAAQH  152



>ref|XP_002864102.1| hypothetical protein ARALYDRAFT_495191 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40361.1| hypothetical protein ARALYDRAFT_495191 [Arabidopsis lyrata subsp. 
lyrata]
Length=141

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +1

Query  205  KMPMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSP  384
            +M  +   Q  H ++   Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSP
Sbjct  10   EMISRDSTQESHPKE--RQMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSP  67

Query  385  VLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQ  564
            VLVPA +T   I+ GFLASG FG  A   F W+YR+ TG    G++KI+ AR K+ +  Q
Sbjct  68   VLVPAVITVALIITGFLASGGFGIAAITAFSWVYRHLTGS---GSEKIENARMKVGSRVQ  124

Query  565  DMKEKAEQLAAQ  600
            D K     +  Q
Sbjct  125  DTKYGQHNIGVQ  136



>gb|KHN18226.1| Oleosin 16 kDa [Glycine soja]
Length=166

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL++ATPLLVIFSP+LVPAA   F + +GFL SG  G  A     W+Y Y +G  P G
Sbjct  66   VIGLIIATPLLVIFSPILVPAAFVLFLVASGFLFSGGCGVAAIAALSWIYNYVSGNQPAG  125

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D +DYA+  L++ A+D+KE+A+ 
Sbjct  126  SDTLDYAKGYLTDKARDVKERAKD  149



>gb|AFG55837.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55838.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55841.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55843.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55847.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55848.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55851.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
Length=102

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGLVV TP+L+ FSP+L+P A+  F  +AGFL++G FG  A     W+Y Y  G+HP
Sbjct  1    GTVIGLVVLTPVLIFFSPILIPVAIVLFVAVAGFLSAGGFGLAALSAISWLYNYIKGRHP  60

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             GAD+IDYAR ++++ A  +K+ A +
Sbjct  61   PGADQIDYARMRIADTASHVKDYARE  86



>gb|KFK26734.1| oleosin 1 [Arabis alpina]
Length=144

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  26   QMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAVITVVLIITGFLA  85

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMK  573
            SG FG  A   F W+YR+ TG    G+++++ AR KL + +QD K
Sbjct  86   SGGFGIAAITAFSWLYRHLTGS---GSERLENARMKLGSRSQDTK  127



>ref|XP_003526464.2| PREDICTED: oleosin 1-like [Glycine max]
Length=212

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL++ATPLLVIFSP+LVPAA   F + +GFL SG  G  A     W+Y Y +G  P G
Sbjct  112  VIGLIIATPLLVIFSPILVPAAFVLFLVASGFLFSGGCGVAAIAALSWIYNYVSGNQPAG  171

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D +DYA+  L++ A+D+KE+A+ 
Sbjct  172  SDTLDYAKGYLTDKARDVKERAKD  195



>gb|AFG55839.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55840.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55842.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55844.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55845.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55846.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55849.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55850.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
Length=102

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGLVV TP+L+ FSP+L+P A   F  +AGFL++G FG  A     W+Y Y  G+HP
Sbjct  1    GTVIGLVVLTPVLIFFSPILIPVATVLFVAVAGFLSAGGFGLAALSAISWLYNYIKGRHP  60

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             GAD+IDYAR ++++ A  +K+ A +
Sbjct  61   PGADQIDYARMRIADTASHVKDYARE  86



>gb|ACP27621.1| L-oleosin [Coix lacryma-jobi]
Length=151

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
              +I L VATP+LVIFSPVLVPAA+    + AGF  SG  G  A  VF WMY+Y TGKHP
Sbjct  58   GNVIALTVATPVLVIFSPVLVPAAIALALMAAGFATSGGLGVAALSVFSWMYKYLTGKHP  117

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             GAD++D+A+ +L++ A+D+K+ A+ 
Sbjct  118  PGADQLDHAKARLASKARDIKDAAQH  143



>ref|NP_001105338.1| oleosin Zm-I [Zea mays]
 sp|P13436.2|OLEO1_MAIZE RecName: Full=Oleosin Zm-I; AltName: Full=Lipid body-associated 
major protein; AltName: Full=Lipid body-associated protein 
L3; AltName: Full=Oleosin 16 kDa [Zea mays]
 gb|AAA68065.1| 16 kDa oleosin [Zea mays]
Length=156

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP
Sbjct  63   GTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHP  122

Query  511  IGADKIDYAREKLSNAAQDMKEKAE  585
              AD++D+A+ +L++ A+D+K+ A+
Sbjct  123  PAADQLDHAKARLASKARDVKDAAQ  147



>ref|NP_001236098.1| 16.5 kDa oleosin [Glycine max]
 gb|ACO90355.1| 16.5 kDa oleosin [Glycine max]
 gb|ACU13135.1| unknown [Glycine max]
Length=165

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL++ATPLLVIFSP+LVPAA   F + +GFL SG  G  A     W+Y Y +G  P G
Sbjct  65   VIGLIIATPLLVIFSPILVPAAFVLFLVASGFLFSGGCGVAAIAALSWIYNYVSGNQPAG  124

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
             D +DYA+  L++ A+D+KE+A+ 
Sbjct  125  YDTLDYAKGYLADKARDVKERAKD  148



>ref|XP_010934129.1| PREDICTED: oleosin 16 kDa-like [Elaeis guineensis]
Length=210

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = +1

Query  238  HEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFF  417
             +Q  S +V K   A T+GGSL+L+SGLTL  T+IGL V TPLLVI SPVLVPA +  F 
Sbjct  86   EQQPTSQRVVKGVAAATIGGSLLLVSGLTLAGTVIGLAVVTPLLVIVSPVLVPAVIAVFL  145

Query  418  ILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAA  597
            ++ GF+ SG  G  A  V  W+Y+Y TGK   G+++++ AR +L++ A+D+KE A+  + 
Sbjct  146  LVTGFVTSGGLGVAALSVLSWLYKYLTGKRVPGSEQLEQARARLASKARDVKESAQHRSE  205

Query  598  Q  600
            Q
Sbjct  206  Q  206



>ref|XP_007137146.1| hypothetical protein PHAVU_009G103600g, partial [Phaseolus vulgaris]
 gb|ESW09140.1| hypothetical protein PHAVU_009G103600g, partial [Phaseolus vulgaris]
Length=218

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L++ATPLLVIFSPVLVPAA   F + +GFL SG  G  A  V  W+Y+Y     P
Sbjct  116  GTVISLIIATPLLVIFSPVLVPAAFVLFLVASGFLFSGGCGVVAVAVLSWIYKYLAANQP  175

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+D +DYA+  L++ A+D+KE+A+ 
Sbjct  176  AGSDTLDYAKGYLADKARDVKERAKD  201



>gb|AFK45755.1| unknown [Lotus japonicus]
Length=162

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T+IGL++ATPLLV+FSP+LVPAA+       GF+ SG  G  A     W+Y Y +GK+P 
Sbjct  60   TVIGLIIATPLLVLFSPILVPAAIILSLAAGGFMFSGGCGVAAVAALSWIYNYVSGKYPA  119

Query  514  GADKIDYAREKLSNAAQDMKEKAE------QLAAQPGNKGTT  621
            G D +DYAR  +++ A+D+KE+A+      Q  AQ    G+T
Sbjct  120  GYDTLDYARGMIADKARDVKERAKDYGNYAQGRAQEATHGST  161



>ref|XP_006371868.1| hypothetical protein POPTR_0018s04820g [Populus trichocarpa]
 gb|ERP49665.1| hypothetical protein POPTR_0018s04820g [Populus trichocarpa]
Length=131

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = +1

Query  214  MQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLV  393
            M  Y Q   +      V K  TA T+G +L++LSGLTLT T+I L+VATP+LV+ SPVLV
Sbjct  1    MSRYEQSSAQPTSRKAVLKFMTAGTIGAALLVLSGLTLTGTVIALIVATPILVLCSPVLV  60

Query  394  PAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDM  570
            PAA+  F + +GF  SG  G  A  V  W Y Y TGKHP GAD++DYA  K++  A  +
Sbjct  61   PAAMVVFLVSSGFFFSGGCGLAAIMVLLWTYNYVTGKHPPGADRLDYATRKIAEKANSV  119



>ref|XP_006402003.1| hypothetical protein EUTSA_v10015754mg [Eutrema salsugineum]
 gb|ESQ43456.1| hypothetical protein EUTSA_v10015754mg [Eutrema salsugineum]
Length=148

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 77/117 (66%), Gaps = 4/117 (3%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            + Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GF
Sbjct  27   ARQMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAMITVVLIITGF  86

Query  433  LASGSFGATATFVFYWMYRYATGKHPIGAD-KIDYAREKLSNAAQDMKEKAEQLAAQ  600
            LASG FG  A   F W+YR+ TG    GAD +I+ AR K  +  QD K     +  Q
Sbjct  87   LASGGFGIAAITAFSWLYRHMTGA---GADQRIESARMKFGSRGQDTKFGQHNIGVQ  140



>gb|AAL40177.1|L76464_1 oleosin [Oryza sativa]
 gb|AAC33281.1| 16 kDa oleosin isoform R16 [Oryza sativa Japonica Group]
Length=148

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = +1

Query  229  QPRHEQQLSYQVA-KTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAAL  405
            Q + E+Q     A KT TA T GGS+++LSGL L  T+I L VATP+LVIFSPVLVPAA+
Sbjct  20   QEQQEKQPFMMTALKTVTAATAGGSILVLSGLILAGTVIALTVATPVLVIFSPVLVPAAI  79

Query  406  TTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEKAE  585
                + AGF+ S   G  A  VF WMY+Y TGKHP GAD +D+ + ++++  +D+KE A 
Sbjct  80   ALALMAAGFVTSVGLGVAALSVFSWMYKYLTGKHPPGADHLDHTKARVASKLRDIKEAAH  139

Query  586  QLAAQ  600
             L  Q
Sbjct  140  HLIDQ  144



>gb|EEC77750.1| hypothetical protein OsI_16870 [Oryza sativa Indica Group]
Length=140

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  ATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDY  534
             TP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP GAD++D+
Sbjct  55   GTPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDH  114

Query  535  AREKLSNAAQDMKEKAEQLAAQ  600
            A+ +L++ A+D+KE A+    Q
Sbjct  115  AKARLASKARDIKEAAQHRIDQ  136



>ref|XP_006653640.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Oryza 
brachyantha]
Length=263

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  349  VVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKI  528
            +VATP+LVIFSPVLVPAA+    + AGF+ SG  G  A  VF WMY+Y TGKHP GAD++
Sbjct  176  LVATPVLVIFSPVLVPAAIALALMAAGFITSGGLGVAALSVFSWMYKYLTGKHPPGADQL  235

Query  529  DYAREKLSNAAQDMKEKAEQLAAQ  600
            D+A+ +L++ A+D+KE A+    Q
Sbjct  236  DHAKARLASKARDIKEAAQHRIDQ  259



>gb|AFJ66235.1| hypothetical protein 34G24.11 [Capsella rubella]
Length=155

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 12/114 (11%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q+ K ATAVT GGSL++LSGLTL  T+I L VATPLLVIFSPVLVPA +T   I+ GFLA
Sbjct  28   QMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPLLVIFSPVLVPAVITVTLIITGFLA  87

Query  439  SGSFGATATFVFYWMYRYA---------TGKHPIGADKIDYAREKLSNAAQDMK  573
            SG FG  A   F W+YR+          TG    G++KI+ AR K+ + AQD K
Sbjct  88   SGGFGIAAITAFSWLYRFEYMVNVYRHMTGS---GSEKIENARMKMGSRAQDTK  138



>gb|AGT63296.1| oleosin [Persea americana var. drymifolia]
Length=159

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            AT I L++ATPLLVI+SP+LVP   TTF +  GF+ S  FG  A  +  WMYRYATGKHP
Sbjct  43   ATAISLLMATPLLVIWSPILVP---TTFLVATGFIFSSGFGIAALSMVAWMYRYATGKHP  99

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
             G +++D+  + L + A+ MK KA++ A Q
Sbjct  100  PGLEQLDHVMKVLVHEAKIMKNKAKEYAYQ  129



>emb|CBI25770.3| unnamed protein product [Vitis vinifera]
Length=267

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -3

Query  515  PIGCFPVAYLYIQ*KTKVAVAPKLPEAKNPARMKKVVSAAGTSTGLKITSKGVATTRPIM  336
            P GC P+ YLY    T  A+ P  P+A +P   K  V AAGTSTGL ITS GVATTR I 
Sbjct  68   PTGCCPLTYLYSHKNTDTALTPNPPDATSPLAAKNTVMAAGTSTGLNITSSGVATTRAIT  127

Query  335  VAVRVRPESSMREPPMVTAV  276
            V  RVRPE +M+EPPMV AV
Sbjct  128  VPARVRPERTMQEPPMVAAV  147



>ref|XP_009140871.1| PREDICTED: oleosin 14.9 kDa [Brassica rapa]
 gb|ACG69512.1| oleosin S5-2 [Brassica napus]
 emb|CDY05844.1| BnaA10g05760D [Brassica napus]
Length=149

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R   +   Q+ K AT V  GGSL++LSGLTL  T+I L VATPLL+IFSPVLVPA +T  
Sbjct  22   RDHPKTGAQMVKVATGVAAGGSLLVLSGLTLAGTVIALAVATPLLIIFSPVLVPAVITVV  81

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGAD-KIDYAREKLSNAAQDMKEKAEQL  591
             I+ GFLASG FG  A   F W+YR+ TG    G+D KI+ AR K+ +   D K     +
Sbjct  82   LIITGFLASGGFGIAAITAFSWLYRHMTGS---GSDQKIESARMKVGSRGYDTKSGQHNI  138

Query  592  A  594
             
Sbjct  139  G  139



>gb|AGT21473.1| oleosin-like [Carica papaya]
Length=116

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (61%), Gaps = 26/137 (19%)
 Frame = +1

Query  211  PMQHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVL  390
            P Q   +PR     S+QV K ATAVT GGSL++LSGLTL  T+I L +ATPL VIFSPVL
Sbjct  5    PHQRSPEPR-----SHQVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLFVIFSPVL  59

Query  391  VPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDM  570
            VPA +    ++ G                    Y TG+HP GADK+D AR KL+  A++M
Sbjct  60   VPAVIAVALLITG--------------------YVTGRHPPGADKLDQARMKLAGKAREM  99

Query  571  KEKAEQLAAQ-PGNKGT  618
            KEKAEQ   Q  G++G+
Sbjct  100  KEKAEQYGQQVAGSQGS  116



>ref|XP_006837375.1| hypothetical protein AMTR_s00111p00122760 [Amborella trichopoda]
 gb|ERN00229.1| hypothetical protein AMTR_s00111p00122760 [Amborella trichopoda]
Length=137

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 77/118 (65%), Gaps = 3/118 (3%)
 Frame = +1

Query  235  RHEQQL---SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAAL  405
            R +Q +   S++V K  TA T+GG  ++ SGLTLT TII + +ATPLLVIFSP+LVPAA 
Sbjct  12   RSDQDITPKSHKVVKGLTAATLGGGSLVASGLTLTGTIIAITIATPLLVIFSPILVPAAG  71

Query  406  TTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSNAAQDMKEK  579
                  AGF+ SG F   A   F WMY Y  GKHP GA  +D A+  +++ AQD+KE+
Sbjct  72   ALLLATAGFVTSGGFAVAAIIAFSWMYGYVMGKHPPGAKTLDQAKAMVASKAQDLKEQ  129



>gb|ACG69511.1| oleosin S5-1 [Brassica napus]
 emb|CDX71696.1| BnaC09g27370D [Brassica napus]
Length=149

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +1

Query  235  RHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTF  414
            R   +   Q+ K AT V  GGSL++LSGLTL  T+I   VATPLL+IFSPVLVPA +T  
Sbjct  22   RDHPKTGAQMVKVATGVAAGGSLLVLSGLTLAGTVIAFAVATPLLIIFSPVLVPAVITVV  81

Query  415  FILAGFLASGSFGATATFVFYWMYRYATGKHPIGAD-KIDYAREKLSNAAQDMK  573
             I+ GFLASG FG  A   F W+YR+ TG    G+D KI+ AR K+ +   D K
Sbjct  82   LIITGFLASGGFGIAAITAFSWLYRHMTGS---GSDQKIESARMKVGSRGYDTK  132



>gb|ACH91012.1| oleosin isoform OLE500a [Cocos nucifera]
Length=79

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  376  FSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSN  555
            FSPVLVPAA+  F ++AGF+ SG FG  A  V  WMY+Y TG+ P G+++++ AR +L++
Sbjct  1    FSPVLVPAAIAVFLLVAGFVTSGGFGLAALSVLSWMYKYLTGRRPPGSEQLEQARARLAS  60

Query  556  AAQDMKEKAE  585
             A+D+KE A+
Sbjct  61   KARDIKESAQ  70



>ref|XP_007209683.1| hypothetical protein PRUPE_ppa012323mg [Prunus persica]
 gb|EMJ10882.1| hypothetical protein PRUPE_ppa012323mg [Prunus persica]
Length=174

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            I+GL++ TPL++I SP+ VP     F  +AGF++   FGA A  V  WMYRY  G HP G
Sbjct  75   ILGLILVTPLIIISSPIWVPVGALLFLTVAGFVSMCGFGAAAAAVSSWMYRYFKGMHPPG  134

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++ + A  +K+ A +
Sbjct  135  SDRVDYARSRIYDTASHVKDYARE  158



>ref|XP_010251121.1| PREDICTED: oleosin 21.2 kDa-like [Nelumbo nucifera]
Length=137

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            AT+IGLVV+TPLL+IFSPVL+PAA T    + GFL + +FG  A   F W+  Y  GK  
Sbjct  48   ATVIGLVVSTPLLIIFSPVLIPAATTIGLAVMGFLTAAAFGLAALSSFSWILNYLRGKRA  107

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
               + +DYA+ ++  AA  M++KA+ ++ Q
Sbjct  108  TLPEHLDYAQRRMQEAAGYMEQKAKDMSTQ  137



>gb|AAD41080.1|AF147758_1 oleosin [Elaeis guineensis]
Length=83

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  364  LLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYARE  543
            +LVIFSPVLVPA +  F ++ GF+ SG  G  A  V  W+Y+Y TGK   G+D+++ AR 
Sbjct  1    MLVIFSPVLVPAVIAVFLLVTGFVTSGGLGVAALSVLSWLYKYLTGKRLPGSDQLEQARA  60

Query  544  KLSNAAQDMKEKAEQLAAQ  600
            ++++ A+D+KE A+  + Q
Sbjct  61   RIASKARDVKESAQHRSEQ  79



>ref|XP_009602797.1| PREDICTED: oleosin 1 [Nicotiana tomentosiformis]
Length=140

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L++ TPLL++ SP+LVPA +    I AGFL SG  G  A    +W YR   GK+ 
Sbjct  40   GTVIFLILVTPLLIMASPILVPAVIIHVLISAGFLFSGGSGIGALAAMFWTYRNVGGKNL  99

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             GAD++D+AR K+++ A  MKE+A++      NK
Sbjct  100  FGADQLDFARMKIASKAWGMKERAKEGGQSVQNK  133



>ref|XP_006355299.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=140

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L++A P LV+FSP+LVPAA+      AGFL SG  G        W+YR   G+ P
Sbjct  40   GTVIFLILAAPFLVVFSPILVPAAMILVLSTAGFLFSGGSGIGGLAAILWLYRKVRGQLP  99

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
              AD++D+AR ++++ A DMKE+A++
Sbjct  100  YAADQLDFARMRIASKAWDMKERAKE  125



>ref|XP_010238066.1| PREDICTED: oleosin 16 kDa-like [Brachypodium distachyon]
Length=171

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRY-----A  495
             T++ LVVATPLLVIFSPVLVPAA+    + AGF++SG+FGA A  V  WMYRY      
Sbjct  73   GTVLALVVATPLLVIFSPVLVPAAVAVSLLAAGFVSSGAFGAAAMGVLAWMYRYYVSSSG  132

Query  496  TGKHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQ  600
                P GADK+DYAR +L + A D+K  A+    Q
Sbjct  133  ESSSPPGADKVDYARARLDSKAHDVKNWAQNRLDQ  167



>ref|XP_002965728.1| hypothetical protein SELMODRAFT_84903 [Selaginella moellendorffii]
 ref|XP_002971607.1| hypothetical protein SELMODRAFT_95913 [Selaginella moellendorffii]
 gb|EFJ27356.1| hypothetical protein SELMODRAFT_95913 [Selaginella moellendorffii]
 gb|EFJ33148.1| hypothetical protein SELMODRAFT_84903 [Selaginella moellendorffii]
Length=174

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            ATI+ LV+ TP+ ++FSP+LVP  +    +  G L++ +F A+      W+Y+YA G+HP
Sbjct  69   ATIVFLVIGTPIFLLFSPILVPLGILAIVVTGGILSTIAFVASCVAAVTWIYKYAKGRHP  128

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
            +G D+I+ AR +L + A  M EKA +
Sbjct  129  VGTDQIEAARHRLMDTATQMTEKARE  154



>ref|XP_008244042.1| PREDICTED: oleosin 1-like [Prunus mume]
Length=174

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            I+GL++ TPL++I SP+ VP     F  +AGF++   FGA    V  WMYRY  G HP G
Sbjct  75   ILGLILFTPLIIISSPIWVPVGALLFLTVAGFVSMCGFGAATVAVSSWMYRYLKGMHPPG  134

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++ + A  +K+ A +
Sbjct  135  SDRVDYARSRIYDTASHVKDYARE  158



>ref|XP_004148427.1| PREDICTED: oleosin 16 kDa-like [Cucumis sativus]
 ref|XP_004162984.1| PREDICTED: oleosin 16 kDa-like [Cucumis sativus]
 gb|KGN62791.1| hypothetical protein Csa_2G372860 [Cucumis sativus]
Length=135

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T++ L+++TP+LV+FSP+LVPA        AG   S +    A     W+Y Y TG  P+
Sbjct  47   TVLILILSTPILVLFSPILVPAVTVLVLSAAGLFFSATCAVAAVAALSWLYSYMTGDQPV  106

Query  514  GADKIDYAREKLSNAAQDMKEKA  582
            GA+++D+AR+K+   A+DMKEKA
Sbjct  107  GAEQLDFARDKIVEMAKDMKEKA  129



>ref|XP_009757495.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=140

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I L++ TP L++ SP+LVPA +    I AGFL SG  G  A    +WMYR   G++ 
Sbjct  40   GTVIFLILVTPFLIMASPILVPAVIIHVLISAGFLFSGGSGTGALAAMFWMYRNVRGENL  99

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             GAD++D+AR ++++ A  MKE+A++      NK
Sbjct  100  FGADQLDFARMRIASKAWVMKERAKEGGQSVQNK  133



>ref|XP_008444982.1| PREDICTED: oleosin 1-like [Cucumis melo]
Length=134

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T++ L+++TP+LV+FSPVLVPA        AG   S +    A     W+YRY TG  P 
Sbjct  47   TVLLLILSTPILVLFSPVLVPAVTVLVLAAAGLFFSATCVVGAVAALSWLYRYMTGNQPA  106

Query  514  GADKIDYAREKLSNAAQDMKEKAEQ  588
            GA+++D+A++K+   A++MKEKA Q
Sbjct  107  GAEQLDFAKDKIVEMAKEMKEKATQ  131



>ref|XP_010110789.1| Oleosin 16 kDa [Morus notabilis]
 gb|EXC28054.1| Oleosin 16 kDa [Morus notabilis]
Length=156

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            AT++G +  TPL+V+ SP+ VPAA   FF+ AGFL    FG        W+YRY  G HP
Sbjct  55   ATVLGFIFLTPLIVVSSPIWVPAAFVLFFVAAGFLLFCGFGVAVVGGLAWIYRYFRGLHP  114

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+D+ DYAR ++ + A  +K+ A +
Sbjct  115  PGSDRFDYARNQIYDTASHVKDYARE  140



>ref|XP_004299241.1| PREDICTED: oleosin 16 kDa-like [Fragaria vesca subsp. vesca]
Length=168

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T++GL+  TP+L++ SP+ VP     F   AGF++   FGA A     WMYRY  G HP 
Sbjct  68   TVLGLIFFTPILIVSSPIWVPLGTVLFLATAGFVSMCGFGAAAVGGLSWMYRYFKGMHPP  127

Query  514  GADKIDYAREKLSNAAQDMKEKAEQ  588
            G+D++DYAR ++ + A  +K+ A++
Sbjct  128  GSDRVDYARSRIYDTASHVKDYAKE  152



>ref|XP_010915347.1| PREDICTED: oleosin 1 [Elaeis guineensis]
Length=125

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  259  QVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLA  438
            Q A+ ATA  +G  L++LSGLTLT T+IGLV ATPLLVIFSP+LVPAA     + AG L 
Sbjct  6    QAARFATAGAIGAGLLVLSGLTLTGTVIGLVAATPLLVIFSPILVPAAAVVAVVAAGLLL  65

Query  439  SGSFGATATFVFYWMYRYATGKHPIGADKID  531
            SG FG  A     W+Y Y TGKHP GAD++D
Sbjct  66   SGGFGVAAVSALTWIYNYVTGKHPPGADRLD  96



>ref|XP_006341651.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=209

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            A I+GL+  TPL++I SP+ VP     F  +AGFL+   FG        W+YRY  G HP
Sbjct  108  AIILGLIFFTPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVATLAFLSWLYRYIRGLHP  167

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             G+D++DYAR ++++ A  +K+ A +      NK
Sbjct  168  PGSDRVDYARSRIADTASHVKDYAREYGGYLHNK  201



>ref|XP_007036421.1| Oleosin family protein [Theobroma cacao]
 gb|EOY20922.1| Oleosin family protein [Theobroma cacao]
Length=163

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            A I+GLV+  PL+VI SP+ +P     F  +AGFL++  FG        WMYRY  G HP
Sbjct  62   AAILGLVIFMPLIVISSPIWIPVGTVLFVTVAGFLSACGFGLVVMAALSWMYRYFRGMHP  121

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+D++DYAR ++ + A  +K+ A +
Sbjct  122  PGSDRVDYARSRIYDTASHVKDYAME  147



>gb|AIC74543.1| oleosin-G [Pinus massoniana]
Length=138

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  361  PLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAR  540
            P+L+ FSP+L+P A   F  +AGFL++G FG  A     W+Y Y  G+HP GAD+IDYAR
Sbjct  47   PVLIFFSPILIPLATVLFVAVAGFLSAGGFGLAALSAISWLYNYIKGRHPPGADQIDYAR  106

Query  541  EKLSNAAQDMKEKAEQ  588
             ++++ A  +K+ A +
Sbjct  107  MRIADTATHVKDYARE  122



>ref|XP_008436973.1| PREDICTED: oleosin 1-like [Cucumis melo]
Length=130

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 5/110 (5%)
 Frame = +1

Query  217  QHYYQPRHEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVP  396
            QH+   +  +  S++V K ATAVT G S + LSGL +T T+IGL V TPLLVIFSPVLVP
Sbjct  13   QHFSSDQLPR--SHKVVKAATAVTTGTSFLFLSGLLMTGTVIGLAVVTPLLVIFSPVLVP  70

Query  397  AALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREK  546
            A +T   +  GFLASG FGA A  V  W++RY       G ++  Y  EK
Sbjct  71   AVITASLLFLGFLASGGFGAAAVVVSMWIFRYMGNN---GRNRRGYLPEK  117



>ref|XP_004508582.1| PREDICTED: oleosin 1-like [Cicer arietinum]
Length=166

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            AT+I ++  +PL+++ SP+ VPA    F + AGFL+   FG  A   F W+YRY  G HP
Sbjct  65   ATVISIIFFSPLIIVSSPIWVPAGTFFFLLTAGFLSMCGFGLVAVAAFSWLYRYYRGLHP  124

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+D+ DYAR ++ + A  +K+ A +
Sbjct  125  PGSDRFDYARNRIYDTASHVKDYARE  150



>gb|AAX49393.1| OLE-5 [Coffea canephora]
Length=167

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +1

Query  343  GLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGAD  522
            GL+   PL++I SP+ VPA    F I+AG L+   FG  A   F W+YRY  G HP G+D
Sbjct  70   GLIFFAPLIIISSPIWVPAGSILFVIIAGLLSFFGFGVAAMAAFSWLYRYFRGFHPPGSD  129

Query  523  KIDYAREKLSNAAQDMKEKAEQ  588
            ++DYAR +++N A  +K+ A +
Sbjct  130  RVDYARSRIANTASQVKDYARE  151



>ref|XP_010924186.1| PREDICTED: oleosin 1-like [Elaeis guineensis]
Length=159

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +1

Query  343  GLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGAD  522
            GLV   P++++ SP+  P A   F  +AGFL+   FG  A     W+YRY +G+HP+G+D
Sbjct  62   GLVFFGPVILLTSPIWFPVAAVIFMAIAGFLSVCGFGVVAAAGATWLYRYFSGRHPVGSD  121

Query  523  KIDYAREKLSNAAQDMKEKAEQ  588
            ++DYAR ++++ A  MK+ A +
Sbjct  122  RVDYARSRIADTASQMKDYARE  143



>ref|XP_009767218.1| PREDICTED: oleosin 1 [Nicotiana sylvestris]
Length=165

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            A I+GL+  TPL++I SP+ VP     F  +AGFL+   FG  +     W+YRY  G HP
Sbjct  64   AIILGLIFFTPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVASLASLSWLYRYFRGFHP  123

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+D++DYAR ++++ A  +K+ A +
Sbjct  124  PGSDRVDYARSRIADTASHVKDYARE  149



>ref|XP_003609083.1| Oleosin [Medicago truncatula]
 ref|XP_003609116.1| Oleosin [Medicago truncatula]
 gb|AES91280.1| oleosin [Medicago truncatula]
Length=151

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            AT++ L+  +PL+++ SP+ VPA    F + AGFL+   FG  A     W YRY  G HP
Sbjct  50   ATVVSLIFFSPLIIVSSPIWVPAGTFLFLLAAGFLSMCGFGVVAVAASSWFYRYFRGLHP  109

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+D++DYAR +L + A  +K+ A +
Sbjct  110  PGSDRVDYARNRLYDTASHVKDYARE  135



>ref|XP_004245383.1| PREDICTED: oleosin 16 kDa-like [Solanum lycopersicum]
Length=140

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+I +++A P LV+FSP+LVPAA+      AGFL SG  G        W+ R A G+ P
Sbjct  40   GTVIFMILAAPFLVVFSPILVPAAMILVLSTAGFLFSGGSGIGGLAAILWLCRKARGQLP  99

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
              A ++D+AR ++++ A DMKE+A++
Sbjct  100  YAAGQLDFARMRIASKAWDMKERAKE  125



>ref|XP_003524510.1| PREDICTED: oleosin 1-like [Glycine max]
Length=163

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            ++GL+   PL+++ SPV VPA    F + AGFL+   FG        WMYRY  G HP G
Sbjct  64   VLGLIFFLPLIIVSSPVWVPAGTLLFIVTAGFLSVCGFGVALVAALSWMYRYFRGLHPPG  123

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++ + A  +K+ A +
Sbjct  124  SDRVDYARSRIYDTASHVKDYARE  147



>ref|XP_007155152.1| hypothetical protein PHAVU_003G177800g [Phaseolus vulgaris]
 gb|AGV54349.1| oleosin 16 kDa-like protein [Phaseolus vulgaris]
 gb|ESW27146.1| hypothetical protein PHAVU_003G177800g [Phaseolus vulgaris]
Length=160

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            ++GL+  TPL+++ SPV VPA++  F I AGF ++  F         WMYRY  G HP G
Sbjct  61   VLGLIFFTPLIIVSSPVWVPASILLFVITAGFFSACGFVVALVAALSWMYRYFRGLHPPG  120

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++ + A  +K+ A +
Sbjct  121  SDQVDYARSRIYDTASHVKDCARE  144



>ref|XP_006596702.1| PREDICTED: oleosin 1-like, partial [Glycine max]
Length=152

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            I+GL+   PL+++ SPV VPA    F + AGFL+   FG        WMYRY  G HP G
Sbjct  53   ILGLIFFLPLIILSSPVWVPAGTLVFIVTAGFLSVCGFGVALVAALSWMYRYFRGLHPPG  112

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++ + A  +K+ A  
Sbjct  113  SDRVDYARTRIYDTASHVKDYARD  136



>ref|XP_009601383.1| PREDICTED: oleosin 1 [Nicotiana tomentosiformis]
Length=165

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            I+G++  TPL++I SP+ VP     F  +AGFL+   FG  +     W+YRY  G HP G
Sbjct  66   ILGIIFFTPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVASLASLSWLYRYFRGFHPPG  125

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++++ A  +K+ A +
Sbjct  126  SDRVDYARSRIADTASHVKDYARE  149



>ref|XP_006842689.1| hypothetical protein AMTR_s00147p00069460 [Amborella trichopoda]
 gb|ERN04364.1| hypothetical protein AMTR_s00147p00069460 [Amborella trichopoda]
Length=168

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +1

Query  340  IGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGA  519
            +GL+V TPL+++ SPV +P         +GF+A   FG        WMYRY  G+HP+G+
Sbjct  70   VGLIVITPLVLLSSPVWIPVLAFLGVAASGFVAVTGFGLAVLGGLTWMYRYIKGRHPVGS  129

Query  520  DKIDYAREKLSNAAQDMKEKAEQ  588
            D++DYAR +L++ A  MK+ A  
Sbjct  130  DRVDYARMRLTDTASQMKDYARD  152



>ref|XP_006440904.1| hypothetical protein CICLE_v10022589mg [Citrus clementina]
 gb|ESR54144.1| hypothetical protein CICLE_v10022589mg [Citrus clementina]
Length=166

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            ATI+GL+   PLL++ SP+ VP     F  +AGFL+   FG        WMYRY  G HP
Sbjct  65   ATILGLIFFAPLLILSSPIWVPIGTILFIAVAGFLSVCGFGVAVLAGLSWMYRYFNGMHP  124

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+++ DYAR ++ + A  +K+ A +
Sbjct  125  PGSNRFDYARSRIYDTASHVKDYARE  150



>ref|XP_006494251.1| PREDICTED: oleosin 1-like [Citrus sinensis]
 gb|KDO37079.1| hypothetical protein CISIN_1g047028mg [Citrus sinensis]
Length=166

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            ATI+GL+   PLL++ SP+ VP     F  +AGFL+   FG        WMYRY  G HP
Sbjct  65   ATILGLIFFAPLLILSSPIWVPIGTILFIAVAGFLSVCGFGVAVLAGLSWMYRYFNGMHP  124

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G+++ DYAR ++ + A  +K+ A +
Sbjct  125  PGSNRFDYARSRIYDTASHVKDYARE  150



>dbj|BAK03796.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  238  HEQQLSYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFF  417
            H Q  +  +AK   A    GS++ LS LTLT T++ L+VATPLLVIFSPVLVPAA+    
Sbjct  41   HNQPAAVTLAKGVAAAAAAGSMLFLSALTLTGTVLALIVATPLLVIFSPVLVPAAIAVTM  100

Query  418  ILAGFLASGSFGATATFVFYWMYRYAT--GKHPIGADKIDYAREKLSNAAQDMKEKAEQ  588
            + AGF++SG+FGA A  V  WMY+Y +     P+GAD +D+A  KL + A D+K  A+ 
Sbjct  101  LTAGFVSSGAFGAAAVAVLAWMYKYLSHGSPSPMGADTVDHAGAKLDSKAHDVKNWAQH  159



>ref|XP_002468711.1| hypothetical protein SORBIDRAFT_01g050670 [Sorghum bicolor]
 gb|EER95709.1| hypothetical protein SORBIDRAFT_01g050670 [Sorghum bicolor]
Length=139

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T++ L+VATPLLVIFSPVLVPAA+T   +  GF++SG FGA A  V  WMYRY   +  
Sbjct  48   GTVLALIVATPLLVIFSPVLVPAAITVALLTTGFVSSGGFGAAAVAVLAWMYRYL--QTT  105

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
              +      + +LS  A D+K+ A+ 
Sbjct  106  TSSSDQQQHQHQLSGKAHDVKDWAQH  131



>gb|ACH91013.1| oleosin isoform OLE500c [Cocos nucifera]
Length=76

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +1

Query  376  FSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYAREKLSN  555
            FSPVLVPA +T F ++ GF+ SG  G  A  V  W+Y+Y TGK   GA++++ AR + ++
Sbjct  1    FSPVLVPAVITVFLLVTGFVTSGVLGVAALSVLSWLYKYLTGKRVPGAEQLEQARARFAS  60

Query  556  AAQDMKEKAEQLAAQ  600
             A+D+KE A+    Q
Sbjct  61   KARDVKESAQHRTEQ  75



>ref|XP_010924760.1| PREDICTED: oleosin 1-like [Elaeis guineensis]
Length=159

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            + GLV   P++++ SP+  P A   F  +AGFL+   FG        W+YRY +G+HP+G
Sbjct  60   VAGLVFFGPIILLTSPIWFPVAAVVFLAIAGFLSFCGFGVAVVAGATWLYRYFSGRHPLG  119

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++++ A  MK+ A +
Sbjct  120  SDRVDYARSRVADTASHMKDYARE  143



>ref|XP_004236249.1| PREDICTED: oleosin 18.2 kDa-like [Solanum lycopersicum]
Length=153

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL VATP+ +IFSPVLVPAALT    + GFL SG+FG TA     WM  Y      
Sbjct  60   GTLIGLAVATPVFLIFSPVLVPAALTIALAVTGFLTSGAFGITALSSLSWMINYMRRMRG  119

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G +++++A+ ++  AA    ++  Q
Sbjct  120  TGGEQMEHAKRRVQEAAGHTGQRTGQ  145



>gb|ABK40507.1| pollen oleosin [Lilium longiflorum]
Length=169

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  340  IGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGA  519
            +G V+  PL+++ SPV +P     F + AGFL++  FG  A     W+YRY +G+HP+G+
Sbjct  71   MGFVLFAPLILLTSPVWIPLVTIFFLLTAGFLSTCGFGVAALAGGTWLYRYLSGRHPLGS  130

Query  520  DKIDYAREKLSNAAQDMKEKAEQ  588
            +++DYAR ++++ A  +K+ A +
Sbjct  131  ERVDYARSRIADTASHVKDYARE  153



>ref|XP_006344451.1| PREDICTED: oleosin 18.2 kDa-like [Solanum tuberosum]
Length=148

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL VATP+ ++FSPVLVPAALT    + GFL SG+FG TA     WM  Y      
Sbjct  62   GTVIGLAVATPVFLLFSPVLVPAALTIALAVTGFLTSGAFGITALSALSWMINYMRKMRG  121

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
               +++++A+ ++  AA  M ++  Q
Sbjct  122  TAGEQMEHAKRRVQEAAGHMGQRTAQ  147



>gb|KGN50321.1| Oleosin-like protein [Cucumis sativus]
Length=203

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 2/96 (2%)
 Frame = +1

Query  211  PMQHYYQPRHEQQL--SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSP  384
            P    +Q     QL  S++V K ATAVT G S ++LS L +  T+IGL V TPL VIFSP
Sbjct  80   PQYSKFQQFSSDQLPRSHKVVKAATAVTTGTSFLVLSALIMAGTVIGLAVVTPLFVIFSP  139

Query  385  VLVPAALTTFFILAGFLASGSFGATATFVFYWMYRY  492
            VLVPA +T   ++ GFLASG FGA A  V  W +RY
Sbjct  140  VLVPALITATLLILGFLASGGFGAAAIVVLLWFFRY  175



>gb|EPS64539.1| oleosin, partial [Genlisea aurea]
Length=158

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 8/97 (8%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWM---YRYATG  501
             T++GL +ATPL VI SPVLVPAA+     + GFL SG+FG T      W+   +R ATG
Sbjct  40   GTLLGLAIATPLFVICSPVLVPAAVLLAGAVTGFLTSGAFGLTGLSSLSWVLNSFRKATG  99

Query  502  KHPIGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
              P     ++YAR ++  A   M EK +Q+    G+K
Sbjct  100  SEP-----LEYARHRMQEATIQMGEKTKQIGEMMGDK  131



>ref|XP_002441561.1| hypothetical protein SORBIDRAFT_09g029350 [Sorghum bicolor]
 gb|EES19991.1| hypothetical protein SORBIDRAFT_09g029350 [Sorghum bicolor]
Length=167

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            ++ LV   P+ ++ SP+ VP A+  F + A  L++  F   A  V  WMYRY TG+HP+G
Sbjct  68   VVALVFLGPIALLTSPIWVPIAVALFVLTAAALSACGFVVAALAVGTWMYRYFTGRHPVG  127

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            AD++DYAR ++++ A  +K+ A +
Sbjct  128  ADRVDYARSRIADTASHVKDYARE  151



>ref|XP_002975381.1| hypothetical protein SELMODRAFT_18412, partial [Selaginella moellendorffii]
 gb|EFJ23582.1| hypothetical protein SELMODRAFT_18412, partial [Selaginella moellendorffii]
Length=136

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +1

Query  340  IGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGA  519
            + L +ATPL ++FSP+LVP A        GF++  +   TA     W+Y Y  G+HP+GA
Sbjct  49   LSLALATPLFILFSPILVPLAGIVAVGTGGFVSLSAAFVTACSAVAWLYNYVKGRHPVGA  108

Query  520  DKIDYAREKLSNAAQDMKEKAEQLAAQ  600
            DKID  + K+++ A  + EKA ++A +
Sbjct  109  DKIDAVKHKIADTASHVSEKAREVARE  135



>ref|XP_010262686.1| PREDICTED: oleosin 1-like [Nelumbo nucifera]
Length=165

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +1

Query  343  GLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGAD  522
            GL+  TPL+VI SP+ VPA    F  +AG L+   FG        W+Y+Y  G HP G+D
Sbjct  68   GLIFFTPLIVISSPIWVPAGTILFVSIAGLLSMCGFGVAVLAGASWLYKYFRGWHPPGSD  127

Query  523  KIDYAREKLSNAAQDMKEKAEQ  588
            ++DYAR ++++ A  MK+ A +
Sbjct  128  RVDYARSRIADTANHMKDYARE  149



>ref|XP_010451202.1| PREDICTED: oleosin 18.5 kDa-like, partial [Camelina sativa]
Length=125

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  253  SYQVAKTATAVtmggslmllsgltltATIIGLVVATPLLVIFSPVLVPAALTTFFILAGF  432
            S Q+AK ATAVT GGSL++LS LTL  T+I L VATPLLVIFSP+LVPA +T   ++ GF
Sbjct  48   SRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGF  107

Query  433  LASGSFGATATFVFYWMY  486
            L+SG FG  A  VF W+Y
Sbjct  108  LSSGGFGIAAITVFSWIY  125



>ref|XP_010497693.1| PREDICTED: oleosin 21.2 kDa, partial [Camelina sativa]
Length=129

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             ++IGL+VA PL ++FSPV+VPAALT    + GFLASG FG T      W+  Y  G   
Sbjct  7    GSVIGLMVALPLFLLFSPVIVPAALTIGLAMTGFLASGMFGLTGLSSISWVMNYLRGTRR  66

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
               ++++YA+ ++++A     +K +++     NK
Sbjct  67   TVPEQLEYAKRRMADAVGYAGQKGKEMGQHVQNK  100



>ref|XP_008800936.1| PREDICTED: oleosin 1-like [Phoenix dactylifera]
Length=159

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +1

Query  343  GLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGAD  522
            GLV   P++++ SP+  P A   F  +AGFL+    G  +     W+YRY +G+HP+G+D
Sbjct  62   GLVFFGPIILLTSPIWFPIAAVIFMAIAGFLSVCGVGIASVAGATWLYRYFSGRHPVGSD  121

Query  523  KIDYAREKLSNAAQDMKEKAEQ  588
            ++DYAR ++++ A  MK+ A +
Sbjct  122  RVDYARSRIADTASQMKDYARE  143



>gb|KFK33105.1| hypothetical protein AALP_AA6G331800 [Arabis alpina]
Length=212

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL++A PL ++FSPV+VPAALT    +AGFL SG FG T      W+  Y  G     
Sbjct  88   VIGLMIALPLFLLFSPVIVPAALTIGLAVAGFLTSGMFGLTGLSSISWVMNYLRGSRQSV  147

Query  517  ADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             ++++YA+ K+++A     +K +++  Q  NK
Sbjct  148  PEQLEYAKRKMADAVGYAGQKGKEMGQQVQNK  179



>ref|XP_003549810.1| PREDICTED: oleosin 1-like [Glycine max]
Length=156

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            ++GL+   PL+++ SPV VPA    F + A FL+   FG     V  WMY Y  G HP G
Sbjct  57   VLGLIFFLPLIIVSSPVWVPAGTFLFIVTAAFLSVCGFGVALVAVLSWMYHYFRGLHPPG  116

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++DYAR ++ + A  +K+ A +
Sbjct  117  SDRVDYARSRIYDTASHVKDYARE  140



>gb|KDP22470.1| hypothetical protein JCGZ_26301 [Jatropha curcas]
Length=108

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  464  VAVAPKLPEAKNPARMKKVVSAAGTSTGLKITSKGVATTRPIMVAVRVRPESSMREPPMV  285
            +A  PK PEAKNP  +K+ V  AGT TGL +TS GVAT   + V  RV+PE + R+PP V
Sbjct  1    MAATPKPPEAKNPVIIKQTVITAGTRTGLNMTSNGVATVSAMTVPARVKPERTRRDPPAV  60

Query  284  TAVAVLATW*ESCC  243
            TAVA   TW +  C
Sbjct  61   TAVAAFTTWWDRGC  74



>ref|XP_006405494.1| hypothetical protein EUTSA_v10028039mg [Eutrema salsugineum]
 gb|ESQ46947.1| hypothetical protein EUTSA_v10028039mg [Eutrema salsugineum]
Length=198

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL+VA PL ++FSPVLVPAALT    + GFLASG FG T      W+  Y  G     
Sbjct  79   VIGLMVALPLFLLFSPVLVPAALTIGLAMTGFLASGMFGLTGLSSISWVMNYLRGTRKSV  138

Query  517  ADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             +++DYA+ ++++A     +K +++     NK
Sbjct  139  PEQLDYAKSRMADAVGYAGQKGKEMGQFVKNK  170



>ref|XP_011071914.1| PREDICTED: oleosin 18.2 kDa-like [Sesamum indicum]
Length=144

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             TIIGL VATPL VIFSP+LVPAALT    + GFL SG+FG TA     W+  Y      
Sbjct  51   GTIIGLAVATPLFVIFSPILVPAALTIALAVTGFLTSGAFGITALSSISWLLNYVRRMRG  110

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
               +++D+AR ++         +A Q
Sbjct  111  SLPEQLDHARRRVQETVGQKTREAGQ  136



>ref|XP_009625249.1| PREDICTED: oleosin 18.2 kDa-like [Nicotiana tomentosiformis]
Length=145

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL VATPLL++FSPVLVPA +T    + GFL SG+FG TA     W+  Y      
Sbjct  56   GTLIGLAVATPLLLLFSPVLVPAVITIALAVTGFLTSGAFGITALSSLSWIINYLRSIRG  115

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
             G +++++A+ ++ + A  M ++  +
Sbjct  116  PGREQLEHAKRRVQDTAGTMGQRTRE  141



>gb|AAB58402.1| 15.5 kDa oleosin [Sesamum indicum]
Length=144

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             TIIGL VATPL VIFSP+LVPAALT    + GFL SG+FG TA     W+  Y      
Sbjct  51   GTIIGLAVATPLFVIFSPILVPAALTIALAVTGFLTSGAFGITALSSISWLLNYVRRMRG  110

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQ  588
               +++D+AR ++         +A Q
Sbjct  111  SLPEQLDHARRRVQETVGQKTREAGQ  136



>gb|ABQ57396.1| oleosin H-isoform [Ficus pumila var. awkeotsang]
Length=155

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL ++TP+ ++FSPVLVPAA+T    + GFL SG+FG T      W++ Y   K  
Sbjct  57   GTLIGLALSTPVFILFSPVLVPAAITIGLAITGFLTSGAFGVTGLSSLSWVFNYF--KRT  114

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQPGNKG  615
               D++DYA+ ++ + A    +KA+++  +  +KG
Sbjct  115  SVPDQLDYAKRRVQDMAGYTGQKAKEVGQEVQSKG  149



>ref|XP_002868651.1| hypothetical protein ARALYDRAFT_493945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44910.1| hypothetical protein ARALYDRAFT_493945 [Arabidopsis lyrata subsp. 
lyrata]
Length=199

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL+VA PL ++FSPV+VPAALT    + GFLASG FG T      W+  Y  G     
Sbjct  79   VIGLMVALPLFLLFSPVIVPAALTIGLAMTGFLASGMFGLTGLSSISWVMNYLRGTRRTV  138

Query  517  ADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             ++++YA+ ++++A     +K +++     NK
Sbjct  139  PEQLEYAKRRMADAVGYAGQKGKEMGQHVQNK  170



>ref|XP_002987365.1| hypothetical protein SELMODRAFT_18396, partial [Selaginella moellendorffii]
 gb|EFJ11452.1| hypothetical protein SELMODRAFT_18396, partial [Selaginella moellendorffii]
Length=132

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +1

Query  340  IGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGA  519
            + L +ATPL ++FSP+LVP A        GF++  +   TA     W+Y Y  G+HP+GA
Sbjct  50   LSLALATPLFILFSPILVPLAGIVAVGTGGFVSLSAAFVTACSAVAWLYNYVKGRHPVGA  109

Query  520  DKIDYAREKLSNAAQDMKEKAEQ  588
            DKID  + K+++ A  + EKA +
Sbjct  110  DKIDAVKHKIADTASHVSEKARE  132



>ref|XP_010435899.1| PREDICTED: oleosin 21.2 kDa-like [Camelina sativa]
 ref|XP_010441181.1| PREDICTED: oleosin 21.2 kDa-like [Camelina sativa]
Length=200

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL+VA PL ++FSPV+VPAALT    + GFLASG FG T      W+  Y  G     
Sbjct  80   VIGLMVALPLFLLFSPVIVPAALTIGLAMTGFLASGMFGLTGLSSISWVMNYLRGTRRTV  139

Query  517  ADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             ++++YA+ ++++A     +K +++     NK
Sbjct  140  PEQLEYAKRRMADAVGYAGQKGKEMGQHVQNK  171



>gb|AAX49389.1| OLE-1 [Coffea canephora]
Length=148

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL V TPL VIFSP+LVPA  T    LAGFL SG+FG TA     WM  Y      
Sbjct  52   GTVIGLAVTTPLFVIFSPILVPAVFTLGLTLAGFLTSGAFGITALASLSWMLNYIRLMKA  111

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLA  594
               +++D A+ ++ + A  + +KA  + 
Sbjct  112  SSQEQMDLAKWRVQDTAGQVGQKARDVG  139



>ref|XP_006285841.1| hypothetical protein CARUB_v10007329mg [Capsella rubella]
 gb|EOA18739.1| hypothetical protein CARUB_v10007329mg [Capsella rubella]
Length=200

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +IGL+VA PL ++FSPV+VPAALT    + GFLASG FG T      W+  Y  G     
Sbjct  79   VIGLMVALPLFLLFSPVIVPAALTIGLAVTGFLASGMFGLTGLSSISWVMNYLRGTRRTV  138

Query  517  ADKIDYAREKLSNAAQDMKEKAEQLAAQPGNK  612
             ++++YA+ ++++A     +K +++     NK
Sbjct  139  PEQLEYAKRRMADAVSYAGQKGKEMGQHVQNK  170



>ref|XP_002970414.1| hypothetical protein SELMODRAFT_18324, partial [Selaginella moellendorffii]
 ref|XP_002978493.1| hypothetical protein SELMODRAFT_18322, partial [Selaginella moellendorffii]
 gb|EFJ20479.1| hypothetical protein SELMODRAFT_18322, partial [Selaginella moellendorffii]
 gb|EFJ28544.1| hypothetical protein SELMODRAFT_18324, partial [Selaginella moellendorffii]
Length=115

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 56/86 (65%), Gaps = 4/86 (5%)
 Frame = +1

Query  334  TIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPI  513
            T++ L+VA+PLL++FSPVLVP A+    +L   +   SF A    V  W+Y+Y  G+ P+
Sbjct  33   TMVALLVASPLLILFSPVLVPLAIAAAVVLGCLV---SFLAVVAMV-AWLYKYVKGRRPV  88

Query  514  GADKIDYAREKLSNAAQDMKEKAEQL  591
            GA+++D A+ ++ + A  + EKA ++
Sbjct  89   GANQVDAAKNRIVDTASQVTEKAREV  114



>emb|CBI15408.3| unnamed protein product [Vitis vinifera]
Length=318

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            AT+IGL+  TPL+++ SP+ VPA    F   AGFL+   FG        W+Y+Y  G +P
Sbjct  60   ATVIGLIFFTPLILLSSPIWVPAGTVLFLAAAGFLSMCGFGLAVLAGLSWIYKYFRGWNP  119

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLAAQP  603
             G+ + DYAR ++++ A  +K+ A +    P
Sbjct  120  PGSGRFDYARSRIADTASHVKDYAREYGGNP  150



>ref|XP_006399237.1| hypothetical protein EUTSA_v10015089mg [Eutrema salsugineum]
 gb|ESQ40690.1| hypothetical protein EUTSA_v10015089mg [Eutrema salsugineum]
Length=105

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  340  IGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
            +GL V+TPL VIFSP+LVPA + T  +  GF ASGSFGATA  +F W+Y+  TGK P
Sbjct  30   VGLAVSTPLFVIFSPILVPATIATTLLATGFTASGSFGATALSIFMWLYKRYTGKEP  86



>ref|XP_004987230.1| PREDICTED: oleosin 16 kDa-like [Setaria italica]
Length=146

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRY  492
             T++ L+VATPLLVIFSPVLVPAA+T   + AGF++SG FGA A  V  WMYR+
Sbjct  67   GTVLALIVATPLLVIFSPVLVPAAITLALLTAGFVSSGGFGAAAVGVLAWMYRH  120



>ref|XP_004232322.1| PREDICTED: oleosin 5-like [Solanum lycopersicum]
Length=149

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 6/102 (6%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL +ATP+ ++FSPV+VPA LT    +AGFL SG+FG T    F W+  Y      
Sbjct  46   GTLIGLALATPVFLLFSPVIVPATLTIALAVAGFLTSGAFGITGLSSFSWILNYFRQGKS  105

Query  511  IGADKIDYAREKLSNAAQDMKEKAE------QLAAQPGNKGT  618
            +  + ++ A+ ++++AA  + +K +      Q  AQ G +GT
Sbjct  106  MVPESMEAAKRRMADAASHLGQKTKDAGQTIQSKAQEGKEGT  147



>emb|CDP12758.1| unnamed protein product [Coffea canephora]
Length=148

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL V TPL VIFSP+LVPA  T    LAGFL SG+FG TA     WM  Y      
Sbjct  52   GTVIGLAVTTPLFVIFSPILVPAVFTLGLALAGFLTSGAFGITALASLSWMLNYIRLMKA  111

Query  511  IGADKIDYAREKLSNAAQDMKEKAEQLA  594
               +++D A+ ++ + A  + +KA  + 
Sbjct  112  SSQEQMDLAKWRVQDTAGQVGQKARDVG  139



>gb|AAB01098.1| oleosin, partial [Daucus carota]
Length=168

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGAT-ATFVFYWMYRYATGKH  507
            AT+IGLV+ATP++VIFSPVLVPA L      A  ++ G        FV +WMYRY  GKH
Sbjct  60   ATVIGLVIATPVMVIFSPVLVPAGLPA--APARRVSHGGGAGGHRAFVLFWMYRYTAGKH  117

Query  508  PIGADKIDYAREKL  549
            PIGA+++D+A  +L
Sbjct  118  PIGANQLDFAATRL  131



>ref|XP_009621597.1| PREDICTED: oleosin 14.9 kDa-like [Nicotiana tomentosiformis]
Length=46

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  361  PLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMY  486
            PLLVIFSPVLVPA +T   ILAGFLA+G FGATA+FVFYWMY
Sbjct  5    PLLVIFSPVLVPAVITVGLILAGFLATGGFGATASFVFYWMY  46



>ref|XP_008810983.1| PREDICTED: oleosin 1-like [Phoenix dactylifera]
Length=159

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            +  LV   P++++ SP+  P A   F  +AGFL+   FG  A     W+YRY +G+HP+G
Sbjct  60   VAALVFFGPIILLTSPIWFPVAAVIFISIAGFLSFCGFGVAAVAGATWLYRYFSGRHPVG  119

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            +D++D AR ++++ A  MK+ A +
Sbjct  120  SDRVDSARSRIADTASHMKDYARE  143



>ref|XP_006338595.1| PREDICTED: oleosin 5-like [Solanum tuberosum]
Length=166

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 6/102 (6%)
 Frame = +1

Query  331  ATIIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHP  510
             T+IGL VATP+ + FSPVLVPA LT    +AGFL SG+FG T    F W+  Y      
Sbjct  62   GTLIGLAVATPVFLFFSPVLVPATLTLGLAVAGFLTSGAFGITGLSSFSWILNYFRQGKS  121

Query  511  IGADKIDYAREKLSNAAQDMKEKAE------QLAAQPGNKGT  618
            +  + ++ A+ ++++AA  + +K +      Q  AQ G +GT
Sbjct  122  MVPESMEAAKRRVADAAAHLGQKTKDAGQTIQSKAQEGKEGT  163



>ref|XP_006655620.1| PREDICTED: oleosin 16 kDa-like, partial [Oryza brachyantha]
Length=129

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  IIGLVVATPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIG  516
            ++ L+   P+ ++ SP+ VP A+  F + A  L++ +F   A     WMYRY TG+HP+G
Sbjct  30   VVALIFLGPIALLTSPIWVPVAIALFVLAAAVLSTCAFAVAAVAGGTWMYRYFTGRHPVG  89

Query  517  ADKIDYAREKLSNAAQDMKEKAEQ  588
            AD++DYAR ++++ A  +K+ A +
Sbjct  90   ADRVDYARSRIADTASHVKDYARE  113



>ref|XP_004235733.1| PREDICTED: oleosin 1-like [Solanum lycopersicum]
Length=165

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +1

Query  358  TPLLVIFSPVLVPAALTTFFILAGFLASGSFGATATFVFYWMYRYATGKHPIGADKIDYA  537
            TPL++I SP+ VP     F  +AGFL+   FG        W+YRY  G HP G+D++DYA
Sbjct  73   TPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVATLASLSWLYRYIRGFHPPGSDRVDYA  132

Query  538  REKLSNAAQDMKEKAEQ  588
            R ++++ A  +K+ A +
Sbjct  133  RSRIADTASHVKDYARE  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2654494324880