BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26100_g1_i1 len=1051 path=[1029:0-1050]

Length=1051
                                                                      Score     E

ref|XP_011087741.1|  PREDICTED: uncharacterized protein LOC105169136    375   4e-124   
emb|CAN77049.1|  hypothetical protein VITISV_039116                     365   8e-122   Vitis vinifera
ref|XP_009616453.1|  PREDICTED: uncharacterized protein LOC104108990    363   3e-121   
ref|XP_009780007.1|  PREDICTED: uncharacterized protein LOC104229121    361   2e-120   
gb|EYU26533.1|  hypothetical protein MIMGU_mgv1a011226mg                361   2e-120   
ref|XP_010538389.1|  PREDICTED: uncharacterized protein LOC104812760    356   2e-118   
ref|XP_004230490.1|  PREDICTED: uncharacterized protein LOC101253229    347   7e-115   
ref|XP_002267621.1|  PREDICTED: uncharacterized protein LOC100258355    346   1e-114   Vitis vinifera
ref|XP_006847019.1|  hypothetical protein AMTR_s00017p00160740          346   3e-114   
gb|KDP38856.1|  hypothetical protein JCGZ_05013                         345   3e-114   
ref|XP_006390795.1|  hypothetical protein EUTSA_v10018974mg             343   2e-113   
ref|XP_006349375.1|  PREDICTED: uncharacterized protein LOC102578321    342   5e-113   
ref|XP_011005214.1|  PREDICTED: uncharacterized protein LOC105111531    341   1e-112   
ref|XP_010681778.1|  PREDICTED: uncharacterized protein LOC104896707    341   2e-112   
ref|XP_009104924.1|  PREDICTED: uncharacterized protein LOC103830861    341   2e-112   
ref|XP_010415824.1|  PREDICTED: uncharacterized protein LOC104701782    340   3e-112   
ref|XP_007042235.1|  Senescence associated gene 18 isoform 1            339   8e-112   
ref|XP_006301109.1|  hypothetical protein CARUB_v10021503mg             339   8e-112   
emb|CDO97557.1|  unnamed protein product                                339   9e-112   
ref|XP_007223254.1|  hypothetical protein PRUPE_ppa009391mg             339   1e-111   
ref|XP_009355230.1|  PREDICTED: uncharacterized protein LOC103946300    339   1e-111   
ref|XP_010427946.1|  PREDICTED: uncharacterized protein LOC104712691    338   2e-111   
ref|XP_008218784.1|  PREDICTED: uncharacterized protein LOC103319070    336   1e-110   
gb|KFK41556.1|  hypothetical protein AALP_AA2G144500                    336   2e-110   
ref|XP_004299933.1|  PREDICTED: uncharacterized protein LOC101309638    336   2e-110   
ref|XP_003531590.1|  PREDICTED: uncharacterized protein LOC100810128    335   2e-110   
ref|XP_010518920.1|  PREDICTED: uncharacterized protein LOC104798496    335   3e-110   
gb|KFK41555.1|  hypothetical protein AALP_AA2G144500                    335   3e-110   
ref|XP_009406110.1|  PREDICTED: uncharacterized protein LOC103989...    334   6e-110   
ref|XP_006471102.1|  PREDICTED: uncharacterized protein LOC102617260    334   6e-110   
ref|XP_003547538.1|  PREDICTED: uncharacterized protein LOC100816173    334   7e-110   
ref|XP_006431860.1|  hypothetical protein CICLE_v10002064mg             334   1e-109   
emb|CDY49218.1|  BnaCnng17070D                                          333   2e-109   
gb|KHN11231.1|  hypothetical protein glysoja_023295                     332   4e-109   
gb|ACU19396.1|  unknown                                                 332   6e-109   Glycine max [soybeans]
ref|XP_010242817.1|  PREDICTED: uncharacterized protein LOC104587...    333   6e-109   
ref|XP_009406111.1|  PREDICTED: uncharacterized protein LOC103989...    329   6e-108   
ref|XP_010030112.1|  PREDICTED: uncharacterized protein LOC104419966    328   2e-107   
ref|XP_002529266.1|  conserved hypothetical protein                     328   5e-107   Ricinus communis
ref|XP_004485489.1|  PREDICTED: uncharacterized protein LOC101513407    324   6e-106   
ref|XP_002888824.1|  hypothetical protein ARALYDRAFT_476250             323   1e-105   
ref|XP_003593011.1|  hypothetical protein MTR_2g006770                  322   6e-105   
ref|XP_010242815.1|  PREDICTED: uncharacterized protein LOC104587...    323   7e-105   
ref|XP_010242816.1|  PREDICTED: uncharacterized protein LOC104587...    323   8e-105   
ref|XP_008449409.1|  PREDICTED: uncharacterized protein LOC103491...    320   2e-104   
ref|XP_008781500.1|  PREDICTED: uncharacterized protein LOC103701271    320   4e-104   
ref|NP_177275.1|  senescence associated protein 18                      319   4e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45098.1|  unknown                                                 318   9e-104   
ref|XP_004140109.1|  PREDICTED: uncharacterized protein LOC101206038    317   3e-103   
gb|EPS65399.1|  hypothetical protein M569_09379                         317   3e-103   
ref|XP_002456981.1|  hypothetical protein SORBIDRAFT_03g046710          317   6e-103   Sorghum bicolor [broomcorn]
gb|ADE75903.1|  unknown                                                 316   8e-103   
ref|XP_010930877.1|  PREDICTED: uncharacterized protein LOC105051925    314   4e-102   
ref|NP_001045476.1|  Os01g0962200                                       315   4e-102   Oryza sativa Japonica Group [Japonica rice]
emb|CDX68322.1|  BnaA07g23620D                                          314   7e-102   
ref|XP_006645356.1|  PREDICTED: uncharacterized protein LOC102716178    313   1e-101   
ref|XP_007133145.1|  hypothetical protein PHAVU_011G155400g             313   2e-101   
ref|XP_004971350.1|  PREDICTED: uncharacterized protein LOC101773401    313   2e-101   
ref|XP_010242820.1|  PREDICTED: uncharacterized protein LOC104587065    311   3e-101   
ref|XP_008449408.1|  PREDICTED: uncharacterized protein LOC103491...    312   3e-101   
dbj|BAJ85366.1|  predicted protein                                      311   7e-101   
gb|EMS50962.1|  hypothetical protein TRIUR3_31964                       311   1e-100   
gb|AFW83891.1|  membrane protein                                        310   4e-100   
emb|CDM86850.1|  unnamed protein product                                309   5e-100   
ref|NP_001148401.1|  LOC100282016                                       307   3e-99    Zea mays [maize]
gb|EEC72214.1|  hypothetical protein OsI_05309                          303   8e-98    Oryza sativa Indica Group [Indian rice]
gb|EMT21492.1|  hypothetical protein F775_27479                         303   1e-97    
ref|XP_004504135.1|  PREDICTED: uncharacterized protein LOC101501512    300   8e-97    
ref|XP_002298170.2|  hypothetical protein POPTR_0001s21910g             295   6e-95    Populus trichocarpa [western balsam poplar]
gb|KHG07841.1|  Putative alkaline ceramidase dcd3A                      294   1e-94    
ref|XP_002987349.1|  hypothetical protein SELMODRAFT_426141             294   3e-94    
gb|KHN33456.1|  hypothetical protein glysoja_005498                     291   2e-93    
ref|XP_001765199.1|  predicted protein                                  289   1e-92    
ref|XP_002989152.1|  hypothetical protein SELMODRAFT_427788             289   3e-92    
ref|XP_006585253.1|  PREDICTED: uncharacterized protein LOC100819917    285   8e-91    
ref|XP_003565126.1|  PREDICTED: uncharacterized protein LOC100824275    284   4e-90    
gb|KEH20750.1|  alkaline phytoceramidase (APHC)                         281   1e-89    
gb|ADE76923.1|  unknown                                                 277   2e-87    
ref|XP_010471127.1|  PREDICTED: uncharacterized protein LOC104750...    275   4e-87    
gb|KHN29019.1|  hypothetical protein glysoja_008354                     273   3e-86    
ref|NP_001185369.1|  senescence associated protein 18                   272   3e-86    
ref|XP_007159691.1|  hypothetical protein PHAVU_002G259100g             271   1e-85    
ref|XP_010471126.1|  PREDICTED: uncharacterized protein LOC104750...    254   2e-79    
ref|XP_007042236.1|  Senescence associated gene 18 isoform 2            253   9e-79    
ref|XP_010047343.1|  PREDICTED: uncharacterized protein LOC104436306    243   1e-74    
ref|XP_009361937.1|  PREDICTED: uncharacterized protein LOC103952133    240   1e-73    
gb|KCW79227.1|  hypothetical protein EUGRSUZ_C00652                     241   2e-73    
ref|XP_007222903.1|  hypothetical protein PRUPE_ppa009985mg             239   4e-73    
ref|XP_002963991.1|  hypothetical protein SELMODRAFT_166507             238   6e-73    
ref|XP_008220479.1|  PREDICTED: uncharacterized protein LOC103320560    238   9e-73    
ref|XP_008393638.1|  PREDICTED: uncharacterized protein LOC103455822    238   1e-72    
ref|XP_004292793.1|  PREDICTED: uncharacterized protein LOC101307374    238   2e-72    
ref|XP_010103903.1|  3-ketoacyl-CoA synthase 7                          248   2e-72    
ref|XP_008377686.1|  PREDICTED: uncharacterized protein LOC103440...    236   8e-72    
ref|XP_006826760.1|  hypothetical protein AMTR_s00136p00077480          246   9e-72    
ref|XP_007012287.1|  Alkaline phytoceramidase (aPHC)                    235   2e-71    
ref|NP_001190292.1|  Alkaline phytoceramidase (aPHC)                    233   7e-71    
ref|NP_196748.1|  Alkaline phytoceramidase (aPHC)                       233   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002967933.1|  hypothetical protein SELMODRAFT_145064             233   1e-70    
ref|XP_002871502.1|  predicted protein                                  232   3e-70    
ref|XP_010242225.1|  PREDICTED: uncharacterized protein LOC104586633    229   2e-69    
ref|XP_010262108.1|  PREDICTED: uncharacterized protein LOC104600...    226   3e-68    
ref|XP_010262111.1|  PREDICTED: uncharacterized protein LOC104600...    226   5e-68    
ref|XP_006450848.1|  hypothetical protein CICLE_v10009178mg             226   7e-68    
ref|XP_010491937.1|  PREDICTED: uncharacterized protein LOC104769421    226   8e-68    
gb|KDO80113.1|  hypothetical protein CISIN_1g024361mg                   226   8e-68    
ref|XP_010519849.1|  PREDICTED: uncharacterized protein LOC104799...    225   2e-67    
ref|XP_009121908.1|  PREDICTED: uncharacterized protein LOC103846687    225   2e-67    
ref|XP_010262110.1|  PREDICTED: uncharacterized protein LOC104600...    224   2e-67    
ref|XP_010419768.1|  PREDICTED: uncharacterized protein LOC104705454    224   2e-67    
emb|CDX97150.1|  BnaC09g44750D                                          224   3e-67    
ref|XP_010453247.1|  PREDICTED: uncharacterized protein LOC104735201    224   4e-67    
ref|XP_006286801.1|  hypothetical protein CARUB_v10003547mg             223   1e-66    
ref|XP_006399706.1|  hypothetical protein EUTSA_v10014390mg             221   4e-66    
ref|XP_011019458.1|  PREDICTED: uncharacterized protein LOC105122195    221   5e-66    
gb|KFK25448.1|  hypothetical protein AALP_AA8G116500                    220   5e-66    
ref|XP_002279190.2|  PREDICTED: uncharacterized protein LOC100245...    220   8e-66    Vitis vinifera
ref|XP_002309502.1|  hypothetical protein POPTR_0006s24510g             218   2e-65    Populus trichocarpa [western balsam poplar]
emb|CDX69727.1|  BnaA10g20760D                                          218   9e-65    
emb|CBI20661.3|  unnamed protein product                                215   1e-63    
ref|XP_010925422.1|  PREDICTED: uncharacterized protein LOC105047...    211   2e-62    
ref|XP_010925421.1|  PREDICTED: uncharacterized protein LOC105047...    211   3e-62    
ref|XP_010925420.1|  PREDICTED: uncharacterized protein LOC105047...    211   3e-62    
ref|XP_008793247.1|  PREDICTED: uncharacterized protein LOC103709...    211   4e-62    
ref|XP_008793245.1|  PREDICTED: uncharacterized protein LOC103709...    210   5e-62    
ref|XP_008793246.1|  PREDICTED: uncharacterized protein LOC103709...    210   6e-62    
ref|XP_009390127.1|  PREDICTED: uncharacterized protein LOC103976585    208   6e-61    
ref|XP_003565460.1|  PREDICTED: uncharacterized protein LOC100837666    206   4e-60    
gb|KHN06541.1|  hypothetical protein glysoja_010885                     199   2e-58    
ref|XP_007136829.1|  hypothetical protein PHAVU_009G077800g             199   1e-57    
ref|NP_001042300.2|  Os01g0197500                                       204   4e-55    Oryza sativa Japonica Group [Japonica rice]
gb|AES73402.2|  alkaline phytoceramidase (APHC)                         192   4e-55    
ref|XP_009406112.1|  PREDICTED: uncharacterized protein LOC103989...    187   2e-54    
ref|XP_006581293.1|  PREDICTED: uncharacterized protein LOC100806...    191   2e-54    
ref|XP_008784258.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    187   3e-54    
dbj|BAD73218.1|  hypothetical protein                                   192   3e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003523644.2|  PREDICTED: uncharacterized protein LOC100796...    189   2e-53    
ref|XP_002455004.1|  hypothetical protein SORBIDRAFT_03g002820          189   2e-53    Sorghum bicolor [broomcorn]
ref|XP_003527749.1|  PREDICTED: uncharacterized protein LOC100806...    185   4e-52    
ref|XP_006645604.1|  PREDICTED: putative pentatricopeptide repeat...    192   2e-51    
ref|XP_006578079.1|  PREDICTED: uncharacterized protein LOC100796...    183   2e-51    
gb|KHN29720.1|  hypothetical protein glysoja_016342                     183   2e-51    
ref|XP_006578080.1|  PREDICTED: uncharacterized protein LOC100796...    181   2e-50    
ref|XP_008377687.1|  PREDICTED: uncharacterized protein LOC103440...    179   2e-50    
ref|XP_010519850.1|  PREDICTED: uncharacterized protein LOC104799...    179   2e-50    
ref|XP_004498885.1|  PREDICTED: uncharacterized protein LOC101503...    180   3e-50    
ref|XP_004498884.1|  PREDICTED: uncharacterized protein LOC101503...    179   1e-49    
ref|XP_004971741.1|  PREDICTED: putative pentatricopeptide repeat...    189   1e-49    
ref|XP_002516438.1|  conserved hypothetical protein                     175   7e-49    Ricinus communis
ref|XP_006450849.1|  hypothetical protein CICLE_v10009178mg             173   1e-48    
ref|WP_036050418.1|  hypothetical protein                               174   2e-48    
ref|XP_003603151.1|  hypothetical protein MTR_3g104420                  174   3e-48    
ref|XP_003588985.1|  hypothetical protein MTR_1g016080                  173   1e-47    
ref|WP_031435672.1|  hypothetical protein                               168   6e-46    
gb|ACN27189.1|  unknown                                                 164   1e-45    Zea mays [maize]
emb|CDH46891.1|  conserved membrane hypothetical protein                167   2e-45    
ref|WP_034435626.1|  hypothetical protein                               167   2e-45    
gb|EAZ10900.1|  hypothetical protein OsJ_00743                          164   8e-45    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70111.1|  hypothetical protein OsI_00770                          164   4e-44    Oryza sativa Indica Group [Indian rice]
ref|WP_035665038.1|  hypothetical protein                               161   2e-43    
gb|KHG02301.1|  Cholinephosphotransferase 1                             160   2e-43    
gb|AFO66499.1|  putative membrane protein                               159   5e-43    
gb|EMT24036.1|  hypothetical protein F775_07873                         159   9e-43    
emb|CAN80191.1|  hypothetical protein VITISV_042374                     160   2e-42    Vitis vinifera
ref|WP_011381118.1|  hypothetical protein                               156   3e-41    
ref|WP_036576277.1|  alkaline phytoceramidase                           155   8e-41    
ref|WP_028108575.1|  hypothetical protein                               154   2e-40    
ref|WP_011685468.1|  hypothetical protein                               153   2e-40    
ref|WP_036503285.1|  hypothetical protein                               152   6e-40    
ref|WP_002812888.1|  hypothetical protein                               152   1e-39    
ref|WP_012325438.1|  hypothetical protein                               151   3e-39    
ref|WP_013221742.1|  hypothetical protein                               150   3e-39    
ref|WP_040524243.1|  hypothetical protein                               150   4e-39    
gb|KHN32207.1|  hypothetical protein glysoja_035300                     149   4e-39    
emb|CDM86752.1|  unnamed protein product                                155   5e-39    
ref|WP_029448136.1|  hypothetical protein                               149   7e-39    
ref|WP_005010110.1|  hypothetical protein                               148   3e-38    
ref|XP_010272339.1|  PREDICTED: uncharacterized protein LOC104608144    145   4e-38    
ref|WP_010960302.1|  hypothetical protein                               145   2e-37    
ref|WP_011524850.1|  hypothetical protein                               145   3e-37    
ref|WP_017842421.1|  Alkaline phytoceramidase (aPHC)                    143   2e-36    
gb|AEC33262.1|  hypothetical protein 400.2                              144   2e-36    
ref|WP_026045863.1|  alkaline phytoceramidase                           143   2e-36    
ref|WP_008166542.1|  hypothetical protein                               142   2e-36    
ref|XP_010648353.1|  PREDICTED: uncharacterized protein LOC100245...    141   2e-36    
ref|WP_034393606.1|  hypothetical protein                               142   3e-36    
ref|WP_035416441.1|  hypothetical protein                               142   4e-36    
ref|WP_029049308.1|  hypothetical protein                               142   4e-36    
ref|XP_006580247.1|  PREDICTED: uncharacterized protein LOC100783174    138   5e-36    
ref|WP_033076902.1|  hypothetical protein                               141   6e-36    
gb|AHE98487.1|  hypothetical protein THITH_09665                        141   7e-36    
ref|WP_003065637.1|  hypothetical protein                               142   8e-36    
gb|ADI21825.1|  hypothetical protein                                    141   1e-35    
ref|WP_011468221.1|  protein phosphatase 2C-like protein                141   1e-35    
emb|CCU62598.1|  hypothetical protein EBAPG3_16310                      140   1e-35    
ref|WP_012098533.1|  hypothetical protein                               141   1e-35    
ref|WP_040852276.1|  alkaline phytoceramidase                           140   2e-35    
ref|WP_026609937.1|  alkaline phytoceramidase                           140   2e-35    
ref|WP_012836805.1|  hypothetical protein                               140   3e-35    
ref|WP_011634892.1|  hypothetical protein                               140   4e-35    
ref|WP_034377973.1|  hypothetical protein                               139   6e-35    
ref|WP_034405232.1|  hypothetical protein                               139   9e-35    
ref|WP_010808915.1|  hypothetical protein                               139   1e-34    
ref|WP_011614983.1|  hypothetical protein                               138   1e-34    
ref|WP_014147301.1|  hypothetical protein                               138   1e-34    
ref|WP_034352990.1|  hypothetical protein                               138   2e-34    
ref|WP_011997153.1|  membrane protein                                   137   3e-34    
ref|WP_035819033.1|  hypothetical protein                               137   5e-34    
gb|EGG99752.1|  hypothetical protein imdm_742                           136   8e-34    
ref|WP_005742680.1|  protein phosphatase 2C-like                        136   1e-33    
emb|CDM86619.1|  unnamed protein product                                140   1e-33    
ref|WP_013956273.1|  hypothetical protein                               135   2e-33    
ref|WP_005771218.1|  membrane protein                                   135   2e-33    
ref|WP_039669478.1|  membrane protein                                   135   2e-33    
ref|WP_003059304.1|  hypothetical protein                               135   2e-33    
gb|AIJ44580.1|  hypothetical protein O987_01955                         135   3e-33    
ref|WP_012570288.1|  membrane protein                                   135   3e-33    
ref|WP_022535145.1|  hypothetical protein                               134   3e-33    
ref|WP_003078072.1|  hypothetical protein                               134   4e-33    
ref|WP_012220243.1|  membrane protein                                   134   4e-33    
ref|WP_013033994.1|  hypothetical protein                               134   6e-33    
ref|WP_013819846.1|  hypothetical protein                               132   2e-32    
ref|WP_020158235.1|  MULTISPECIES: hypothetical protein                 132   2e-32    
ref|WP_024303176.1|  hypothetical protein                               132   2e-32    
ref|WP_015258209.1|  alkaline phytoceramidase                           132   2e-32    
ref|WP_036243865.1|  alkaline phytoceramidase                           130   3e-32    
ref|WP_036247916.1|  alkaline phytoceramidase                           132   3e-32    
ref|WP_032124352.1|  hypothetical protein                               131   5e-32    
ref|WP_022949955.1|  Alkaline phytoceramidase (aPHC)                    130   1e-31    
ref|WP_040523192.1|  hypothetical protein                               130   1e-31    
ref|WP_011043229.1|  hypothetical protein                               130   1e-31    
ref|WP_034370065.1|  hypothetical protein                               130   2e-31    
ref|WP_013646336.1|  alkaline phytoceramidase                           129   3e-31    
ref|WP_013964857.1|  alkaline phytoceramidase                           129   3e-31    
ref|WP_026635895.1|  hypothetical protein                               128   4e-31    
ref|WP_034061702.1|  hypothetical protein                               128   7e-31    
ref|WP_039050743.1|  MULTISPECIES: hypothetical protein                 127   1e-30    
ref|XP_002294763.1|  predicted protein                                  127   3e-30    Thalassiosira pseudonana CCMP1335
ref|WP_005373706.1|  Alkaline phytoceramidase (aPHC)                    126   3e-30    
emb|CEE12979.1|  hypothetical protein BN1094_01523                      125   6e-30    
ref|WP_011628715.1|  hypothetical protein                               124   1e-29    
ref|WP_040879759.1|  hypothetical protein                               123   3e-29    
ref|WP_009205004.1|  hypothetical protein                               124   3e-29    
ref|WP_031429698.1|  alkaline phytoceramidase                           123   3e-29    
ref|WP_010645564.1|  protein phosphatase 2C-like protein                122   5e-29    
ref|WP_033961000.1|  hypothetical protein                               122   6e-29    
ref|WP_012800967.1|  hypothetical protein                               121   2e-28    
ref|WP_028982523.1|  hypothetical protein                               121   2e-28    
ref|WP_034606499.1|  hypothetical protein                               119   3e-28    
ref|XP_010463240.1|  PREDICTED: uncharacterized protein LOC104743907    118   3e-28    
ref|WP_040916594.1|  hypothetical protein                               120   4e-28    
gb|AFD03192.1|  hypothetical protein                                    119   5e-28    
ref|XP_010456505.1|  PREDICTED: uncharacterized protein LOC104737960    116   9e-28    
ref|WP_025281005.1|  MULTISPECIES: hypothetical protein                 119   9e-28    
ref|WP_039469744.1|  membrane protein                                   119   1e-27    
ref|WP_027149794.1|  alkaline phytoceramidase                           119   1e-27    
ref|WP_033094568.1|  hypothetical protein                               119   1e-27    
ref|WP_036551588.1|  hypothetical protein                               119   1e-27    
gb|KGJ90136.1|  Alkaline phytoceramidase                                119   2e-27    
ref|WP_026261208.1|  hypothetical protein                               117   5e-27    
ref|WP_033411529.1|  alkaline phytoceramidase                           116   1e-26    
ref|WP_035198518.1|  hypothetical protein                               117   1e-26    
ref|WP_018615711.1|  hypothetical protein                               115   2e-26    
gb|EJL83573.1|  hypothetical protein PMI15_02586                        115   4e-26    
ref|WP_034477498.1|  hypothetical protein                               115   4e-26    
ref|WP_009124744.1|  hypothetical protein                               115   5e-26    
ref|WP_011799738.1|  hypothetical protein                               114   1e-25    
ref|WP_028462477.1|  alkaline phytoceramidase                           113   2e-25    
ref|WP_034387495.1|  hypothetical protein                               112   2e-25    
ref|WP_036823253.1|  membrane protein                                   112   2e-25    
ref|WP_029389253.1|  hypothetical protein                               112   3e-25    
ref|WP_015765695.1|  hypothetical protein                               112   5e-25    
gb|EKD71498.1|  hypothetical protein ACD_46C00179G0001                  110   5e-25    
ref|WP_011220528.1|  hypothetical protein                               112   5e-25    
ref|WP_035055978.1|  hypothetical protein                               110   7e-25    
ref|WP_027469820.1|  hypothetical protein                               111   7e-25    
ref|WP_038383808.1|  hypothetical protein                               111   7e-25    
emb|CDM82153.1|  unnamed protein product                                108   8e-25    
ref|WP_036141622.1|  hypothetical protein                               110   1e-24    
ref|WP_036858811.1|  hypothetical protein                               110   1e-24    
ref|WP_035471533.1|  hypothetical protein                               109   3e-24    
ref|WP_013093879.1|  hypothetical protein                               109   4e-24    
ref|WP_035977240.1|  hypothetical protein                               108   4e-24    
ref|WP_011255058.1|  hypothetical protein                               108   6e-24    
ref|WP_036838838.1|  hypothetical protein                               108   7e-24    
ref|WP_035490960.1|  hypothetical protein                               108   1e-23    
ref|WP_029734726.1|  hypothetical protein                               107   1e-23    
ref|WP_011809421.1|  hypothetical protein                               108   1e-23    
ref|WP_028344893.1|  hypothetical protein                               107   2e-23    
ref|WP_019653936.1|  hypothetical protein                               107   2e-23    
ref|WP_018905194.1|  hypothetical protein                               107   3e-23    
ref|WP_015867819.1|  hypothetical protein                               107   3e-23    
ref|WP_024578486.1|  hypothetical protein                               107   4e-23    
ref|WP_006230380.1|  hypothetical protein                               106   6e-23    
ref|WP_008920234.1|  hypothetical protein                               105   1e-22    
ref|WP_029676685.1|  hypothetical protein                               103   3e-22    
gb|KDR43202.1|  hypothetical protein BG61_40200                         103   4e-22    
ref|WP_027254233.1|  hypothetical protein                               103   5e-22    
ref|WP_013544143.1|  hypothetical protein                               103   9e-22    
emb|CDY72077.1|  BnaAnng39800D                                        99.8    1e-21    
ref|WP_035939275.1|  hypothetical protein                               101   2e-21    
ref|WP_028258393.1|  hypothetical protein                               102   2e-21    
ref|WP_028250844.1|  hypothetical protein                               101   3e-21    
ref|WP_011481427.1|  hypothetical protein                               101   3e-21    
ref|XP_002863698.1|  hypothetical protein ARALYDRAFT_917393           98.6    4e-21    
ref|WP_021012949.1|  hypothetical protein                               100   1e-20    
emb|CDM86698.1|  unnamed protein product                                102   2e-20    
ref|WP_016454494.1|  hypothetical protein                             98.6    3e-20    
ref|WP_035202221.1|  hypothetical protein                             98.2    3e-20    
dbj|BAO28063.1|  hypothetical protein SUTH_00246                      97.8    5e-20    
ref|XP_005843068.1|  hypothetical protein CHLNCDRAFT_141602           97.4    5e-20    
ref|WP_034397946.1|  hypothetical protein                             97.4    6e-20    
ref|WP_027563222.1|  MULTISPECIES: hypothetical protein               97.4    7e-20    
gb|EJE54363.1|  hypothetical protein PMI14_00731                      97.1    1e-19    
ref|WP_028601694.1|  hypothetical protein                             96.7    1e-19    
ref|WP_038965220.1|  hypothetical protein                             95.5    2e-19    
emb|CDX69725.1|  BnaA10g20740D                                        94.0    2e-19    
gb|EZP49120.1|  hypothetical protein BW39_05018                       95.9    2e-19    
ref|WP_016450354.1|  hypothetical protein                             95.9    2e-19    
emb|CDY49917.1|  BnaC03g66010D                                        95.5    2e-19    
ref|WP_035697824.1|  hypothetical protein                             95.5    2e-19    
ref|WP_038202030.1|  hypothetical protein                             95.9    2e-19    
ref|WP_034368819.1|  hypothetical protein                             95.9    2e-19    
ref|WP_014491186.1|  hypothetical protein                             95.1    3e-19    
ref|WP_035241409.1|  hypothetical protein                             95.1    4e-19    
ref|WP_011083808.1|  hypothetical protein                             95.1    4e-19    
gb|KGT77904.1|  hypothetical protein MA20_22945                       94.4    6e-19    
ref|WP_039186773.1|  hypothetical protein                             93.6    7e-19    
ref|WP_038954638.1|  hypothetical protein                             94.4    8e-19    
ref|XP_008655736.1|  PREDICTED: uncharacterized protein LOC103634937  91.3    8e-19    
ref|WP_012202468.1|  hypothetical protein                             94.4    8e-19    
ref|WP_028172659.1|  hypothetical protein                             94.0    1e-18    
ref|WP_013800296.1|  hypothetical protein                             93.6    1e-18    
ref|WP_028155238.1|  hypothetical protein                             93.2    2e-18    
ref|WP_036045404.1|  hypothetical protein                             92.8    2e-18    
ref|WP_036002177.1|  hypothetical protein                             92.4    4e-18    
gb|EJN12478.1|  hypothetical protein PMI42_04204                      92.4    4e-18    
ref|WP_035966095.1|  hypothetical protein                             91.7    4e-18    
ref|WP_018644411.1|  hypothetical protein                             91.3    5e-18    
gb|EAQ96675.1|  hypothetical protein KT71_06609                       91.3    6e-18    
ref|XP_010509411.1|  PREDICTED: uncharacterized protein LOC104785821  88.2    1e-17    
dbj|GAJ32319.1|  hypothetical protein BDOA9_0115080                   90.9    1e-17    
ref|WP_025033344.1|  hypothetical protein                             90.5    1e-17    
ref|WP_035673023.1|  MULTISPECIES: hypothetical protein               89.7    2e-17    
ref|WP_018316799.1|  hypothetical protein                             89.7    2e-17    
ref|WP_007468456.1|  putative membrane protein                        89.7    3e-17    
ref|WP_028139684.1|  MULTISPECIES: hypothetical protein               89.4    3e-17    
ref|XP_010499589.1|  PREDICTED: uncharacterized protein LOC104777082  85.1    6e-17    
ref|WP_040362524.1|  hypothetical protein                             88.6    6e-17    
ref|WP_028149098.1|  hypothetical protein                             88.6    7e-17    
ref|XP_010487175.1|  PREDICTED: uncharacterized protein LOC104765196  85.1    8e-17    
ref|WP_015015984.1|  hypothetical protein                             88.6    1e-16    
gb|AFW62461.1|  hypothetical protein ZEAMMB73_836787                  84.3    1e-16    
ref|WP_041101377.1|  hypothetical protein                             85.9    2e-16    
ref|WP_038946822.1|  hypothetical protein                             87.4    2e-16    
ref|WP_038970722.1|  hypothetical protein                             87.4    2e-16    
ref|WP_028133851.1|  hypothetical protein                             86.7    3e-16    
ref|WP_039158154.1|  hypothetical protein                             86.3    4e-16    
ref|WP_038935746.1|  hypothetical protein                             86.3    4e-16    
ref|WP_036018032.1|  hypothetical protein                             85.5    4e-16    
ref|XP_002885885.1|  hypothetical protein ARALYDRAFT_899593           82.4    7e-16    
gb|AFW62462.1|  hypothetical protein ZEAMMB73_836787                  83.2    2e-15    
ref|WP_035208974.1|  hypothetical protein                             83.6    3e-15    
ref|WP_026263061.1|  hypothetical protein                             83.2    4e-15    
ref|WP_034642141.1|  hypothetical protein                             78.6    5e-14    
ref|WP_034345767.1|  hypothetical protein                             79.3    1e-13    
ref|WP_035226763.1|  hypothetical protein                             79.3    1e-13    
ref|WP_002926033.1|  MULTISPECIES: hypothetical protein               79.3    1e-13    
ref|WP_013902980.1|  membrane protein                                 77.4    2e-13    
ref|WP_035251781.1|  hypothetical protein                             78.2    3e-13    
ref|WP_011797505.1|  hypothetical protein                             75.9    3e-12    
emb|CDX72867.1|  BnaC06g33150D                                        73.2    5e-12    
ref|WP_040330298.1|  hypothetical protein                             72.4    6e-12    
gb|EER58095.1|  conserved hypothetical protein                        72.0    1e-11    
ref|WP_013596742.1|  hypothetical protein                             72.4    4e-11    
ref|WP_009548507.1|  hypothetical protein                             70.1    2e-10    
emb|CDM86631.1|  unnamed protein product                              67.0    8e-09    
emb|CDY50851.1|  BnaC08g47970D                                        55.5    6e-06    
ref|WP_036504739.1|  alkaline phytoceramidase                         53.9    7e-06    
ref|WP_036527847.1|  alkaline phytoceramidase                         53.9    7e-06    
emb|CDX81898.1|  BnaC08g37030D                                        54.3    1e-05    
dbj|BAJ96810.1|  predicted protein                                    53.1    2e-05    
ref|WP_028448871.1|  hypothetical protein                             55.5    2e-05    
ref|WP_040892434.1|  hypothetical protein                             48.9    4e-04    
dbj|GAL87752.1|  hypothetical protein MYP_4983                        49.3    4e-04    



>ref|XP_011087741.1| PREDICTED: uncharacterized protein LOC105169136 [Sesamum indicum]
Length=402

 Score =   375 bits (962),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/266 (67%), Positives = 214/266 (80%), Gaps = 2/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAI+CFVVL ML+TP IPQ + YHDFAD+R+FFGIP TL+V SNFPF  +GL GL LCY
Sbjct  123  GVAIVCFVVL-MLVTPAIPQSQEYHDFADQREFFGIPNTLNVISNFPFFIVGLIGLVLCY  181

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            Y NY K+SLQGE+ GWT F+ G+A VAFGSSYYHL PND RLVWDRLPM +A   I++IF
Sbjct  182  YKNYFKLSLQGELCGWTFFFIGVAAVAFGSSYYHLKPNDARLVWDRLPMTVAFTSIIAIF  241

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IERVDE++G LSIIP LL G  S++YWR FDDLRPYA+V+ VP IAI +MA+ +PP YT
Sbjct  242  IIERVDERKGTLSIIPLLLAGAVSILYWRFFDDLRPYALVQFVPCIAIPVMAILLPPMYT  301

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA+I E ADKPIY L+ H VSGHTLKH+  A++ V LTLMLA+R++ 
Sbjct  302  HSTYWLWAAGFYLLAKIEEAADKPIYSLTYHIVSGHTLKHLCAAMVPVFLTLMLAKREVA  361

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
             ER+SLLQ WR+ S +K KENGT + 
Sbjct  362  EERLSLLQMWRI-SWSKVKENGTNIE  386



>emb|CAN77049.1| hypothetical protein VITISV_039116 [Vitis vinifera]
Length=286

 Score =   365 bits (936),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/268 (66%), Positives = 215/268 (80%), Gaps = 2/268 (1%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G+AILCFVVL M++TP IPQ +AYHDFAD+R+FFGIP TL+V SNFPFL +GL GL L
Sbjct  8    VWGLAILCFVVL-MIVTPAIPQSEAYHDFADQREFFGIPNTLNVISNFPFLIVGLIGLVL  66

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            CY+GNY K+SLQGE+ GWT F+ G+A V  GSSYYHL PND RLVWDRLPM IA   I++
Sbjct  67   CYHGNYFKLSLQGELWGWTFFFIGVAAVGIGSSYYHLKPNDARLVWDRLPMTIAFTSIIA  126

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
            IFVIER+DE++G LSI+P LLVGV S++YWR FDDLRPYA+V+ +P IAI LMA+ +PP 
Sbjct  127  IFVIERIDERKGTLSIVPLLLVGVISILYWRFFDDLRPYALVQFLPCIAIPLMAILLPPM  186

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHST+WLWAAG  LLA++ E  DKPIYK + H VSGHTLKH+  A++ V LTLMLA+R 
Sbjct  187  YTHSTFWLWAAGFYLLAKVEEAEDKPIYKWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRS  246

Query  167  IQTERISLLQRWRMSSRNKAKENGTKVS  84
            I+TER SLL+ W++ S  K KE+  KV 
Sbjct  247  IETERQSLLKTWKI-SWTKVKEDEVKVE  273



>ref|XP_009616453.1| PREDICTED: uncharacterized protein LOC104108990 [Nicotiana tomentosiformis]
Length=286

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 212/266 (80%), Gaps = 2/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAI CFVVL M++TP IPQ + YH+FAD+R F GIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GVAIFCFVVL-MIVTPAIPQSQEYHNFADQRLFLGIPNALNVVSNFPFLVIGLIGLVLCH  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY K+SLQGE+ GWT FY G+A VAFGSSYYHLNPND  LVWDRLPM +A   I++IF
Sbjct  69   HGNYFKLSLQGELWGWTCFYIGVAAVAFGSSYYHLNPNDASLVWDRLPMTVAFTSIVAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G LS+IP LL GV S++YWR F+DLRPYA+V+ VP +AI +MA+ +PP YT
Sbjct  129  IIERIDERKGTLSLIPLLLAGVISIMYWRFFEDLRPYAVVQFVPCLAIPVMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA+I E ADKPIY  + H VSGHTLKH+  A++ V LTLMLA+RD +
Sbjct  189  HSTYWLWAAGFYLLAKIEEAADKPIYNWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRDTE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
            T RISL Q WR+ S +KAKENG +V 
Sbjct  249  TNRISLYQSWRI-SWSKAKENGAEVE  273



>ref|XP_009780007.1| PREDICTED: uncharacterized protein LOC104229121 [Nicotiana sylvestris]
Length=288

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/265 (65%), Positives = 212/265 (80%), Gaps = 2/265 (1%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VAI CF+VL M++TP IPQ + YH+FAD+R+F GIP  L+V SNFPFL IGL GL LC++
Sbjct  11   VAIFCFIVL-MIVTPAIPQSQEYHNFADQRQFLGIPNALNVVSNFPFLVIGLIGLVLCHH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY K+SLQGE+ GWT FY G+A VAFGSSYYHLNPND  LVWDRLPM +A   I++IF+
Sbjct  70   GNYFKLSLQGELWGWTCFYIGVAAVAFGSSYYHLNPNDATLVWDRLPMTVAFTSIVAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE++G LS+IP LL GV S++YWR F+DLRPYA+V+ VP +AI +MA+ +PP YTH
Sbjct  130  IERIDERKGTLSLIPLLLAGVISIMYWRFFEDLRPYAVVQFVPCLAIPVMAILLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA+I E AD+PIY  + H VSGHTLKH+  A++ V LTLMLA+RD +T
Sbjct  190  STYWLWAAGFYLLAKIEEAADRPIYNWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRDTET  249

Query  158  ERISLLQRWRMSSRNKAKENGTKVS  84
             RISL Q WR+ S +KAKENG +V 
Sbjct  250  NRISLYQSWRI-SWSKAKENGAEVE  273



>gb|EYU26533.1| hypothetical protein MIMGU_mgv1a011226mg [Erythranthe guttata]
Length=288

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 211/268 (79%), Gaps = 2/268 (1%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V GVAI+CFVVL ML+TP IPQ + YHDFAD+R+F GIP  L+V SNFPFL +G+ GL L
Sbjct  8    VWGVAIVCFVVL-MLVTPAIPQSQEYHDFADQREFLGIPNALNVISNFPFLVVGVIGLVL  66

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            CYY NY K+S+QGE+ GWTVF+ G+A VAFGS+YYHL PND RLVWDRLPM +A   I++
Sbjct  67   CYYKNYFKLSIQGELCGWTVFFVGVAAVAFGSAYYHLEPNDARLVWDRLPMTVAFTSIIA  126

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
            IF+IERVDE++G  SI+P +L G+ S++YWR FDDLRPYA+V+ VP I I +MA+ +PP 
Sbjct  127  IFIIERVDERKGTWSIVPLILAGIVSIVYWRFFDDLRPYAVVQFVPCIVIPVMAILLPPM  186

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHSTYWLWAAG  L+A+I E ADKPIY  + H VSGHT+KH+  A++ + LT+MLA+R+
Sbjct  187  YTHSTYWLWAAGFYLIAKIEEAADKPIYNFTFHIVSGHTIKHLCAAMVPIFLTIMLAKRE  246

Query  167  IQTERISLLQRWRMSSRNKAKENGTKVS  84
            I  ER++LLQ WR+ S  K KENG  V 
Sbjct  247  ITEERVTLLQIWRI-SWTKVKENGNDVE  273



>ref|XP_010538389.1| PREDICTED: uncharacterized protein LOC104812760 [Tarenaya hassleriana]
Length=288

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 212/266 (80%), Gaps = 4/266 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GV I+CFVVL M++TP IPQ +AYHDFAD+R FFGIP+ L+V SNFPFL IGL GL LCY
Sbjct  10   GVGIICFVVL-MIVTPAIPQSQAYHDFADQRTFFGIPHALNVISNFPFLIIGLVGLVLCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            Y NY + SL+GE LGWT F+ G+A+VAFGSSYYHL+P+D RLVWDRLPM IA   I++IF
Sbjct  69   YPNYFRFSLRGEKLGWTCFFIGVASVAFGSSYYHLHPDDARLVWDRLPMTIAFTSIMAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            VIER+DE +G LSI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP YT
Sbjct  129  VIERIDEHKGTLSIVPLLLAGLVSILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E ADKPIY+ + H VSGHTLKH+  A++ V LTLMLA+R ++
Sbjct  189  HSTYWLWAAGFYLLAKVEEAADKPIYRWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRTVE  248

Query  161  TERISLLQRWRMS---SRNKAKENGT  93
            TER+SLL+ W++S    R K  E+ +
Sbjct  249  TERMSLLKTWKISWTRIRGKGSESES  274



>ref|XP_004230490.1| PREDICTED: uncharacterized protein LOC101253229 [Solanum lycopersicum]
Length=288

 Score =   347 bits (890),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/265 (65%), Positives = 211/265 (80%), Gaps = 2/265 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAI+CFVVL M++TP IPQ + YH+FAD+RKF GIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GVAIVCFVVL-MIVTPAIPQSQEYHNFADQRKFLGIPNALNVVSNFPFLVIGLIGLVLCH  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY K+SLQGE+ GWT FY G+A VAFGS+YYHL PND RLVWDRLPM +A   I+ IF
Sbjct  69   HGNYFKLSLQGELWGWTCFYIGVAAVAFGSAYYHLKPNDARLVWDRLPMTVAFTSIIGIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G +S+IP +L GV S++YWR FDDLRPYA V+ VP +AI LMA+ +PP YT
Sbjct  129  IIERIDERKGTVSLIPLILAGVVSIMYWRFFDDLRPYAAVQFVPCLAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA+I E ADKPIY  + H VSGHT+KH+  A++ V LTLMLA+RDI+
Sbjct  189  HSTYWLWAAGFYLLAKIEEAADKPIYNWTYHIVSGHTVKHLCAAMVPVFLTLMLAKRDIE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKV  87
            T R+SL Q WR+ S +K KENG  V
Sbjct  249  TNRVSLFQSWRI-SWSKTKENGAAV  272



>ref|XP_002267621.1| PREDICTED: uncharacterized protein LOC100258355 [Vitis vinifera]
 ref|XP_010657687.1| PREDICTED: uncharacterized protein LOC100258355 [Vitis vinifera]
 ref|XP_010657688.1| PREDICTED: uncharacterized protein LOC100258355 [Vitis vinifera]
 emb|CBI23777.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 215/268 (80%), Gaps = 2/268 (1%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G+AILCFVVL M++TP IPQ +AYHDFAD+R+FFGIP TL+V SNFPFL +GL GL L
Sbjct  8    VWGLAILCFVVL-MIVTPAIPQSEAYHDFADQREFFGIPNTLNVISNFPFLIVGLIGLVL  66

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            CY+GNY K+SLQGE+ GWT F+ G+A V  GSSYYHL PND RLVWDRLPM IA   I++
Sbjct  67   CYHGNYFKLSLQGELWGWTFFFIGVAAVGIGSSYYHLKPNDARLVWDRLPMTIAFTSIIA  126

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
            IF+IER+DE++G LSI+P LLVGV S++YWR FDDLRPYA+V+ +P IAI LMA+ +PP 
Sbjct  127  IFIIERIDERKGTLSIVPLLLVGVISILYWRFFDDLRPYALVQFLPCIAIPLMAILLPPM  186

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHST+WLWAAG  LLA++ E  DKPIYK + H VSGHTLKH+  A++ V LTLMLA+R 
Sbjct  187  YTHSTFWLWAAGFYLLAKVEEAEDKPIYKWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRS  246

Query  167  IQTERISLLQRWRMSSRNKAKENGTKVS  84
            I+TER SLL+ W++ S  K KE+  KV 
Sbjct  247  IETERQSLLKTWKI-SWTKVKEDEVKVE  273



>ref|XP_006847019.1| hypothetical protein AMTR_s00017p00160740 [Amborella trichopoda]
 gb|ERN08600.1| hypothetical protein AMTR_s00017p00160740 [Amborella trichopoda]
Length=300

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 203/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G AI CFVVL M++TP IPQ + YH+FAD+R+FFGIP TL+V SNFPFL +G+ GL +
Sbjct  8    VWGGAIFCFVVL-MVVTPSIPQSQEYHNFADQREFFGIPNTLNVVSNFPFLLVGIVGLVI  66

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            CY+GNY  + LQGE+ GWT+F+ G+A VAFGSSYYHL P+D RLVWDRLPM IA   I++
Sbjct  67   CYHGNYFNLRLQGELWGWTIFFIGVAAVAFGSSYYHLKPDDARLVWDRLPMTIAFTSIMA  126

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
            IF+IER+DEK G +SIIP L+ G+ S++YWR FDDLRPYA+V+ VP IAI +MA+ +PP 
Sbjct  127  IFMIERIDEKTGTISIIPLLMAGIISILYWRFFDDLRPYALVQFVPCIAIPIMAIVMPPM  186

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YWLWAAG  LLA++ E  DK IYK + H VSGHTLKH+F A++ V LTLMLA+R 
Sbjct  187  YTHSAYWLWAAGFYLLAKVEEAEDKLIYKWTHHIVSGHTLKHLFAAMVPVFLTLMLAKRS  246

Query  167  IQTERISLLQRWRMS  123
            I+ ER SLLQ WR+S
Sbjct  247  IEPERESLLQSWRVS  261



>gb|KDP38856.1| hypothetical protein JCGZ_05013 [Jatropha curcas]
Length=288

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 212/266 (80%), Gaps = 2/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAILCFVVL M++TP IPQ + YHDFADKR+FFGIP TL+V SNFPFL IG+ GL LC+
Sbjct  10   GVAILCFVVL-MIVTPAIPQSEEYHDFADKREFFGIPNTLNVVSNFPFLVIGVVGLVLCF  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY K+SLQGE+ GWT F+ G+A VAFGS YYHL PND RLVWDRLPM +A   I++IF
Sbjct  69   HGNYFKLSLQGELWGWTCFFLGVAAVAFGSGYYHLKPNDARLVWDRLPMTVAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G +SI+P +L G+ S+ YWR FDDLRPYA+++ VP IAI LMA+ +PP YT
Sbjct  129  IIERIDERKGTISILPLILAGIISIAYWRFFDDLRPYALIQFVPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HS YWLWAAG  LLA++ E  DK IY  + H VSGHTLKH+  A++ V LTLMLA+R I+
Sbjct  189  HSAYWLWAAGFYLLAKVEEATDKQIYSWTHHFVSGHTLKHLCAAMVPVFLTLMLAKRSIE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
            TERISL ++W++ S  K KENGT+V 
Sbjct  249  TERISLYKKWKI-SWTKVKENGTEVE  273



>ref|XP_006390795.1| hypothetical protein EUTSA_v10018974mg [Eutrema salsugineum]
 gb|ESQ28081.1| hypothetical protein EUTSA_v10018974mg [Eutrema salsugineum]
Length=284

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 208/266 (78%), Gaps = 2/266 (1%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            ++  G AI+ F+VL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IGL GL
Sbjct  6    ITAWGAAIVIFLVL-MIVTPTIPQSQAYHDFADQRSFFGIPNALNVVSNFPFLIIGLVGL  64

Query  713  ALCYY-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAG  537
             LCYY  +Y ++SL+GE LGWT F+ G+A VAFGSSYYHL+P+D RLVWDRLPM IA   
Sbjct  65   VLCYYPDDYFRLSLRGEKLGWTCFFVGVAAVAFGSSYYHLHPDDARLVWDRLPMTIAFTS  124

Query  536  ILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWI  357
            I++IFVIER+DE +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +
Sbjct  125  IMAIFVIERIDEHKGTYSIVPLLLAGLVSILYWRFFDDLRPYALVQFVPCIVIPLMAILL  184

Query  356  PPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLA  177
            PP YTHSTYWLWAAG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA
Sbjct  185  PPMYTHSTYWLWAAGFYLLAKVEEAADKPIYSWTHHILSGHSLKHLCAAMVPVFLTLMLA  244

Query  176  QRDIQTERISLLQRWRMSSRNKAKEN  99
            +R +QTERISL + W++S +   +E+
Sbjct  245  KRTVQTERISLYKTWKISWKGSEEES  270



>ref|XP_006349375.1| PREDICTED: uncharacterized protein LOC102578321 [Solanum tuberosum]
Length=288

 Score =   342 bits (878),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 210/266 (79%), Gaps = 2/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAI+CF+VL M++TP IPQ + YH+FAD+RKF GIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GVAIVCFIVL-MIITPAIPQSQEYHNFADQRKFLGIPNALNVVSNFPFLVIGLIGLVLCH  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY K+SLQGE+ GWT FY G+A VAFGS+YYHL PND RLVWDRLPM +A   I+ IF
Sbjct  69   HGNYFKLSLQGELWGWTCFYIGVAAVAFGSAYYHLKPNDARLVWDRLPMTVAFTSIIGIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G +S+IP +L GV S++YWR FDDLRPYA V+ +P +AI LMA+ +PP YT
Sbjct  129  IIERIDERKGTVSLIPLILAGVVSIMYWRFFDDLRPYAAVQFIPCLAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA+I E ADK IY  + H VSGHT+KH+  A++ V LTLMLA+RDI+
Sbjct  189  HSTYWLWAAGFYLLAKIEEAADKRIYNWTYHIVSGHTVKHLCAAMVPVFLTLMLAKRDIE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
            T RISL Q WR+ S +K KENG  V 
Sbjct  249  TNRISLFQSWRI-SWSKTKENGAAVD  273



>ref|XP_011005214.1| PREDICTED: uncharacterized protein LOC105111531 [Populus euphratica]
Length=289

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 210/272 (77%), Gaps = 5/272 (2%)
 Frame = -3

Query  890  SVCG--VAILCFVVLLMLLTPRIPQPKAYHDFADKRK-FFGIPYTLDVTSNFPFLAIGLA  720
            S CG  VAILCF++L M++TP IPQ + YH+FAD+R  FFGIP TL+V SNFPFL IG+ 
Sbjct  5    SACGWVVAILCFIIL-MVVTPAIPQSQEYHNFADQRDLFFGIPNTLNVVSNFPFLVIGVI  63

Query  719  GLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALA  540
            GL LC+Y NY ++ L GEV GWT F+ G+A VAFGS YYHL P+DDRLVWDRLPM +A  
Sbjct  64   GLVLCHYRNYFQLRLPGEVWGWTCFFVGVAAVAFGSGYYHLKPDDDRLVWDRLPMTVAFT  123

Query  539  GILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALW  360
             I++IF++ER+DE++G +SIIP LL GV S+ YWR FDDLRPYA+V+ VP +AI LMA+ 
Sbjct  124  SIVAIFILERIDERKGTVSIIPLLLAGVISIAYWRFFDDLRPYALVQFVPCLAIPLMAIL  183

Query  359  IPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLML  180
            +PP YTHS YWLWAAG  LLA++ E ADKPIYK + H VSGHTLKH+  A++ V LTLML
Sbjct  184  LPPMYTHSLYWLWAAGFYLLAKVEEAADKPIYKWTHHIVSGHTLKHLCAAMVPVFLTLML  243

Query  179  AQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            A+R I+ ER SL Q W++ S  + ++N ++V 
Sbjct  244  AKRSIEIERTSLFQTWKV-SWTRIRKNDSEVE  274



>ref|XP_010681778.1| PREDICTED: uncharacterized protein LOC104896707 [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/260 (62%), Positives = 204/260 (78%), Gaps = 1/260 (0%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            +A+L FVVL M++TP IPQ + YH+FAD+R+F GIP  L+V SN PFL IGL GL LC+Y
Sbjct  11   IAVLIFVVL-MIVTPAIPQSQEYHNFADQRQFLGIPNMLNVISNIPFLVIGLVGLVLCHY  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY K+SLQGEV GWT FY G+A V  GSSYYHL P+D RLVWDRLPM +A   +++IF+
Sbjct  70   GNYFKLSLQGEVWGWTCFYIGVAAVGIGSSYYHLQPDDARLVWDRLPMTVAFTSLVAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE++G  S+IP LL G+ S++YWR FDDLRPYA+V+ VP IA+ +MA+ +PP YTH
Sbjct  130  IERIDEQKGTASVIPLLLAGIISIMYWRFFDDLRPYAVVQFVPCIALPMMAILLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAA   LLA+I E ADKPIY+L+ H VSGHTLKH+  A++ V LTLMLA+R I+T
Sbjct  190  STYWLWAAVFYLLAKIEEAADKPIYELTHHIVSGHTLKHLSAAVVPVFLTLMLAKRTIET  249

Query  158  ERISLLQRWRMSSRNKAKEN  99
            ER+SLL  WR+S   + ++ 
Sbjct  250  ERVSLLAGWRISWTKERRDK  269



>ref|XP_009104924.1| PREDICTED: uncharacterized protein LOC103830861 [Brassica rapa]
Length=289

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 206/267 (77%), Gaps = 5/267 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G A + F+VL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GAATVIFLVL-MIVTPTIPQSQAYHDFADQRTFFGIPNALNVISNFPFLVIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            Y  +Y + SL+GE LGWT F+ G+A VAFGSSYYHL+P+D RLVWDRLPM IA   I++I
Sbjct  69   YPDDYFRFSLRGEKLGWTCFFVGVAAVAFGSSYYHLHPDDARLVWDRLPMTIAFTSIMAI  128

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI+P LLVG+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP Y
Sbjct  129  FVIERIDEHKGTYSIVPLLLVGLVSILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMY  188

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  LLA++ E ADKPIY  + H +SGH++KHV  A++ V LTLMLA+R +
Sbjct  189  THSTYWLWAAGFYLLAKVEEAADKPIYSWTHHILSGHSIKHVCAAMVPVFLTLMLAKRSV  248

Query  164  QTERISLLQRWRMS---SRNKAKENGT  93
            QTERISL + W++S   SR K  E  +
Sbjct  249  QTERISLYKTWKISWTRSRGKGTEEES  275



>ref|XP_010415824.1| PREDICTED: uncharacterized protein LOC104701782 [Camelina sativa]
Length=289

 Score =   340 bits (873),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 207/266 (78%), Gaps = 3/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ +AYHDFAD+R FFGIP TL+V SNFPFL IGL GL LC+
Sbjct  10   GAAIIIFIVL-MIVTPTIPQSQAYHDFADQRSFFGIPNTLNVISNFPFLIIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            Y  ++ + SL+GE +GWT FY G+A VAFGSSYYHL+PND  L+WDRLPM IA   I++I
Sbjct  69   YPEDFFRFSLRGEKIGWTCFYVGVAAVAFGSSYYHLHPNDATLLWDRLPMTIAFTSIMAI  128

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP Y
Sbjct  129  FVIERIDEHKGTYSIVPLLLAGLISILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMY  188

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA+R +
Sbjct  189  THSTYWLWAAGFYLLAKVEEAADKPIYSWTHHIISGHSLKHLCAAMVPVFLTLMLAKRTV  248

Query  164  QTERISLLQRWRMS-SRNKAKENGTK  90
            QTERISL   W++S +R+K  E+  +
Sbjct  249  QTERISLYTTWKVSWTRSKGNESEEE  274



>ref|XP_007042235.1| Senescence associated gene 18 isoform 1 [Theobroma cacao]
 gb|EOX98066.1| Senescence associated gene 18 isoform 1 [Theobroma cacao]
Length=288

 Score =   339 bits (870),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 211/266 (79%), Gaps = 2/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAIL FVVL M++TP IPQ + YHDFAD+R+FFGIP TL+V SNFPFL IG+ GL LCY
Sbjct  10   GVAILSFVVL-MIVTPAIPQSQEYHDFADQREFFGIPNTLNVVSNFPFLVIGVVGLVLCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            Y NY K+ LQGE+ GWT F+ G+A V  GSSYYHL PND RLVWDRLPM IA   I++IF
Sbjct  69   YKNYFKLCLQGELWGWTCFFIGVAAVGVGSSYYHLQPNDARLVWDRLPMTIAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G +SIIP LL GV S++YWR FDDLRPYA+V+ VP IAI LMA+ +PP YT
Sbjct  129  IIERIDEQKGTVSIIPLLLAGVISIMYWRFFDDLRPYALVQFVPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HST+WLWAAG  LLA++ E  DK IYK + H VSGHTLKH+  A++ V LTLMLA+R I+
Sbjct  189  HSTFWLWAAGFYLLAKVEEAMDKVIYKWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRTIE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
            TERISLL+ W++ S  K K+NG++V 
Sbjct  249  TERISLLKTWKV-SWTKFKKNGSEVE  273



>ref|XP_006301109.1| hypothetical protein CARUB_v10021503mg [Capsella rubella]
 gb|EOA34007.1| hypothetical protein CARUB_v10021503mg [Capsella rubella]
Length=289

 Score =   339 bits (870),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/261 (63%), Positives = 204/261 (78%), Gaps = 3/261 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ +AYHDFAD+R F  IP TL+V SNFPFL IGL GL LC+
Sbjct  10   GSAIIIFIVL-MIVTPTIPQSQAYHDFADQRSFLWIPNTLNVISNFPFLIIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            + GNY + SL+GE +GWT FY G+A VAFGSSYYHL+PNDD L+WDRLPM IA   I++I
Sbjct  69   FPGNYFRFSLRGERIGWTCFYAGVAAVAFGSSYYHLHPNDDTLLWDRLPMTIAFTSIMAI  128

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI P LL G+ S+ YWR FDDLRPYA+V+ VP IAI LMA+ +PP Y
Sbjct  129  FVIERIDEHKGTYSIFPLLLAGLVSIFYWRFFDDLRPYAVVQFVPCIAIPLMAILLPPMY  188

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA+R +
Sbjct  189  THSTYWLWAAGFYLLAKVEEAADKPIYSWTHHIISGHSLKHLSAAMVPVFLTLMLAKRTV  248

Query  164  QTERISLLQRWRMS-SRNKAK  105
            QTER SL + W++S +R+K K
Sbjct  249  QTERTSLYKTWKISWARSKGK  269



>emb|CDO97557.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   339 bits (869),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 207/270 (77%), Gaps = 2/270 (1%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L V GVAILCF+VL M++TP+IPQ + YHDFAD+R+FFGIP  L+V SNFPF  IG  GL
Sbjct  6    LLVWGVAILCFIVL-MVVTPKIPQSEQYHDFADQREFFGIPNMLNVVSNFPFFVIGAIGL  64

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
             LCYY NY ++  QGE+LGWT F+ G+  VAFGS+YYHL PND RLVWDRLPM IA   I
Sbjct  65   ILCYYRNYFRLRSQGELLGWTCFFIGVTAVAFGSAYYHLKPNDARLVWDRLPMTIAFTSI  124

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            +SIF+IERVDEK G LSI+P LL G+ S++YW  FDDLRPYA+V+ VP IAI LM + +P
Sbjct  125  ISIFIIERVDEKWGTLSILPLLLTGIVSILYWWFFDDLRPYALVQFVPCIAIPLMTILLP  184

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
            P YTHS YWLWAAG  ++A++ E ADKPIYK + H VSGHTLKH+F A++ V LTLML +
Sbjct  185  PMYTHSLYWLWAAGFYVIAKVEEAADKPIYKWTHHIVSGHTLKHLFAAMVPVFLTLMLMK  244

Query  173  RDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            R I+TER SL Q WR+ S  K K NG KV 
Sbjct  245  RVIETERRSLFQTWRI-SWTKVKGNGEKVE  273



>ref|XP_007223254.1| hypothetical protein PRUPE_ppa009391mg [Prunus persica]
 gb|EMJ24453.1| hypothetical protein PRUPE_ppa009391mg [Prunus persica]
Length=294

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/265 (65%), Positives = 208/265 (78%), Gaps = 1/265 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V GVAILCFVVL M++TP IPQ +AYHDFAD+R+F GIP TL+V SNFPFL IGL GL L
Sbjct  8    VWGVAILCFVVL-MIVTPAIPQSEAYHDFADQREFLGIPNTLNVVSNFPFLVIGLIGLVL  66

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            CYYG+Y K SLQGE+ GWT FY G+A VA GSSYYHL PND RLVWDRLPM IA   I++
Sbjct  67   CYYGDYFKFSLQGELWGWTCFYIGVAAVAIGSSYYHLKPNDARLVWDRLPMTIAFTSIIA  126

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
            IF+IER+DE++G +SIIP LL G+ S++YWR FDDLRPYAMV+ +P IAI LMA+ +PP 
Sbjct  127  IFIIERIDERKGTISIIPLLLAGIISILYWRFFDDLRPYAMVQFLPCIAIPLMAILLPPM  186

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHSTYWLWAAG  LLA++ E ADK IY  + H VSGHTLKH+  A++ V LTLMLA+R 
Sbjct  187  YTHSTYWLWAAGFYLLAKVEEAADKVIYDWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRT  246

Query  167  IQTERISLLQRWRMSSRNKAKENGT  93
            ++  R SLL+ W++S     K +GT
Sbjct  247  VEPARQSLLKTWKISWTKFRKTDGT  271



>ref|XP_009355230.1| PREDICTED: uncharacterized protein LOC103946300 [Pyrus x bretschneideri]
Length=294

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 208/263 (79%), Gaps = 1/263 (0%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAILCFVVL M++TP IPQ +AYHDFAD+R+FFGIP TL+V SNFPFL IGL GL LCY
Sbjct  10   GVAILCFVVL-MIVTPAIPQSQAYHDFADQREFFGIPNTLNVVSNFPFLVIGLIGLFLCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            Y +Y K SLQGE+ GWT FY G+A V  GSSYYHL PND RLVWDRLPM IA   I++IF
Sbjct  69   YKDYFKFSLQGELWGWTCFYIGVAAVGIGSSYYHLKPNDARLVWDRLPMTIAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE +G +SIIP LL GV S++YWR FDDLRPYAMV+ +P IAI LMA+ +PP YT
Sbjct  129  IIERIDEWKGTISIIPLLLAGVISILYWRFFDDLRPYAMVQFLPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E ADK IY  + H VSGHTLKH+  A++ V LTLMLA+R ++
Sbjct  189  HSTYWLWAAGFYLLAKVEEAADKVIYDWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRTVE  248

Query  161  TERISLLQRWRMSSRNKAKENGT  93
             ER SLL+ W++S  N  K++GT
Sbjct  249  PERQSLLKVWKISWTNFRKKDGT  271



>ref|XP_010427946.1| PREDICTED: uncharacterized protein LOC104712691 [Camelina sativa]
Length=289

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GAAIIIFIVL-MIVTPTIPQSQAYHDFADQRSFFGIPNALNVISNFPFLIIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            Y  ++ + SL+GE +GWT FY G+A VAFGSSYYHL+PND  L+WDRLPM IA   I++I
Sbjct  69   YPEDFFRFSLRGEKIGWTCFYVGVAAVAFGSSYYHLHPNDATLLWDRLPMTIAFTSIMAI  128

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP Y
Sbjct  129  FVIERIDEHKGTYSIVPLLLAGLISILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMY  188

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  L+A++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA+R +
Sbjct  189  THSTYWLWAAGFYLIAKVEEAADKPIYSWTHHIISGHSLKHLCAAMVPVFLTLMLAKRTV  248

Query  164  QTERISLLQRWRMSSRNKAKENGTK  90
            QTERISL   W++ S  ++K NG++
Sbjct  249  QTERISLYTTWKV-SWTRSKANGSE  272



>ref|XP_008218784.1| PREDICTED: uncharacterized protein LOC103319070 [Prunus mume]
Length=294

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAIL FVVL M++TP IPQ +AYHDFAD+R+F GIP TL+V SNFPFL IGL GL LCY
Sbjct  10   GVAILSFVVL-MIVTPAIPQSEAYHDFADQREFLGIPNTLNVVSNFPFLVIGLIGLVLCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            YG+Y K SLQGE+ GWT FY G+A VA GSSYYHL PND RLVWDRLPM IA   I++IF
Sbjct  69   YGDYFKFSLQGELWGWTCFYIGVAAVAIGSSYYHLKPNDARLVWDRLPMTIAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G +SIIP LL G+ S++YWR FDDLRPYAMV+ +P IAI +MA+ +PP YT
Sbjct  129  IIERIDERKGTISIIPLLLAGIVSILYWRFFDDLRPYAMVQFLPCIAIPVMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E ADK IY  + H VSGHTLKH+  A++ V LTLMLA+R ++
Sbjct  189  HSTYWLWAAGFYLLAKVEEAADKVIYDWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRTVE  248

Query  161  TERISLLQRWRMSSRNKAKENGT  93
             ER SLL+ W++S     K +GT
Sbjct  249  PERQSLLKTWKISWTKFRKTDGT  271



>gb|KFK41556.1| hypothetical protein AALP_AA2G144500 [Arabis alpina]
Length=289

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 204/267 (76%), Gaps = 2/267 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GSAIVIFLVL-MIVTPTIPQSQAYHDFADQRTFFGIPNALNVISNFPFLIIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            Y  +Y + SL+GE LGWT F+ GI  VAFGSSYYHL+P+D RLVWDRLPM IA   I++I
Sbjct  69   YPDDYFRFSLRGEKLGWTCFFVGIVAVAFGSSYYHLHPDDARLVWDRLPMTIAFTSIMAI  128

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP Y
Sbjct  129  FVIERIDEHKGTYSIVPLLLAGLVSILYWRFFDDLRPYAVVQFVPCIVIPLMAILLPPMY  188

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  LLA++ E ADKPIY  +   +SGH++KHV  A++ V LTLMLA+R +
Sbjct  189  THSTYWLWAAGFYLLAKVEEAADKPIYSWTHQILSGHSIKHVCAAMVPVFLTLMLAKRTV  248

Query  164  QTERISLLQRWRMSSRNKAKENGTKVS  84
            QTERISL   W++S R + K +  + S
Sbjct  249  QTERISLYTTWKISWRTREKGSDDEES  275



>ref|XP_004299933.1| PREDICTED: uncharacterized protein LOC101309638 [Fragaria vesca 
subsp. vesca]
Length=291

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/270 (64%), Positives = 214/270 (79%), Gaps = 5/270 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAILCFVVL M++TP IPQ +AYHDFAD+R FFGIP TL+V SNFPFL IGL GL LCY
Sbjct  10   GVAILCFVVL-MIVTPAIPQSQAYHDFADQRHFFGIPNTLNVISNFPFLVIGLIGLILCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            YGNY+K+SLQGE+ GWT FY G+A V  GSSYYHLNPND  LVWDRLPM IA   I++IF
Sbjct  69   YGNYMKLSLQGELWGWTCFYIGVAAVGIGSSYYHLNPNDATLVWDRLPMTIAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRR---FDDLRPYAMVETVPIIAIVLMALWIPP  351
            +IER+DE++G +SIIP LL GV S++YWR+   FDDLRPYA+V+ +P IAI LMA+ +PP
Sbjct  129  IIERIDEQKGTISIIPLLLAGVISILYWRQELFFDDLRPYALVQFLPCIAIPLMAILLPP  188

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
             YTHSTYWLWAA   LLA++ E  DK IYK + H VSGHTLKH+  A++ V LTLMLA+R
Sbjct  189  MYTHSTYWLWAAVFYLLAKVEEAGDKVIYKWTNHIVSGHTLKHLCAAMVPVFLTLMLAKR  248

Query  170  DIQTERISLLQRWRMS-SRNKAKENGTKVS  84
             I+TER SLL+ W++S +  + K++ T V+
Sbjct  249  TIETERQSLLKIWKVSWTEYRKKDDDTVVA  278



>ref|XP_003531590.1| PREDICTED: uncharacterized protein LOC100810128 [Glycine max]
Length=288

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 200/265 (75%), Gaps = 1/265 (0%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+LCF+VL M++TP IPQ + YHDFAD R F GIP  L+V SNFPFL IGL GL LCY+
Sbjct  11   VALLCFLVL-MIVTPSIPQSQEYHDFADHRTFLGIPNALNVISNFPFLVIGLVGLVLCYH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY ++SLQGE+ GWT FY G+A VA GSS+YHL P+D RLVWDRLPM +A   I++IF+
Sbjct  70   GNYFRLSLQGELWGWTCFYVGVAAVAVGSSFYHLKPDDARLVWDRLPMTVAFTSIMAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE++G +SIIP +L G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP YTH
Sbjct  130  IERIDERKGTVSIIPLVLAGIISIVYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA++ E  D  IY+ + H VSGHTLKH+  A++ V LT MLA+R ++ 
Sbjct  190  STYWLWAAGSYLLAKVLEATDDVIYEWTRHIVSGHTLKHLVAAMVPVFLTFMLAKRSVEP  249

Query  158  ERISLLQRWRMSSRNKAKENGTKVS  84
            ER SLL+ WR+S     + N    S
Sbjct  250  ERQSLLKTWRVSWTKFREGNSNTES  274



>ref|XP_010518920.1| PREDICTED: uncharacterized protein LOC104798496 [Tarenaya hassleriana]
Length=288

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 203/266 (76%), Gaps = 4/266 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GV I+CFVVL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL +GL GL LCY
Sbjct  10   GVPIICFVVL-MIVTPAIPQSQAYHDFADQRAFFGIPNALNVISNFPFLIVGLVGLVLCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            Y NY   SL+GE LGW+  + G+A VAFGSSYYHL+P+D  LVWDRLPM IA   I++IF
Sbjct  69   YPNYFIFSLRGERLGWSCLFIGVAAVAFGSSYYHLHPDDAGLVWDRLPMTIAFTSIMAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            VIER+DE +G  SI P L+ G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP YT
Sbjct  129  VIERIDEHKGTASIAPLLVAGLVSILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HS YWLWAAG  L+A++ E ADKPIY+ + H +SGHTLKH+  A++ V LTLML++R I+
Sbjct  189  HSAYWLWAAGFYLVAKVEEAADKPIYRWTHHTISGHTLKHLCAAMVPVFLTLMLSKRSIE  248

Query  161  TERISLLQRWRMS---SRNKAKENGT  93
            TERISL++ W+ S    R K  E+ +
Sbjct  249  TERISLIKAWKTSWGRIRGKGSESES  274



>gb|KFK41555.1| hypothetical protein AALP_AA2G144500 [Arabis alpina]
Length=302

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 204/267 (76%), Gaps = 2/267 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GSAIVIFLVL-MIVTPTIPQSQAYHDFADQRTFFGIPNALNVISNFPFLIIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            Y  +Y + SL+GE LGWT F+ GI  VAFGSSYYHL+P+D RLVWDRLPM IA   I++I
Sbjct  69   YPDDYFRFSLRGEKLGWTCFFVGIVAVAFGSSYYHLHPDDARLVWDRLPMTIAFTSIMAI  128

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP Y
Sbjct  129  FVIERIDEHKGTYSIVPLLLAGLVSILYWRFFDDLRPYAVVQFVPCIVIPLMAILLPPMY  188

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  LLA++ E ADKPIY  +   +SGH++KHV  A++ V LTLMLA+R +
Sbjct  189  THSTYWLWAAGFYLLAKVEEAADKPIYSWTHQILSGHSIKHVCAAMVPVFLTLMLAKRTV  248

Query  164  QTERISLLQRWRMSSRNKAKENGTKVS  84
            QTERISL   W++S R + K +  + S
Sbjct  249  QTERISLYTTWKISWRTREKGSDDEES  275



>ref|XP_009406110.1| PREDICTED: uncharacterized protein LOC103989082 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   334 bits (857),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 207/275 (75%), Gaps = 3/275 (1%)
 Frame = -3

Query  905  QGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAI  729
            +G  L   G A+L FVVL M++TP IPQ + YH+FAD+R+ F GIP TL+V SN PFL +
Sbjct  3    RGKQLCAWGAAVLIFVVL-MVVTPAIPQSEEYHNFADQRELFLGIPNTLNVISNIPFLFV  61

Query  728  GLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAI  549
            G+ GL LC+Y NY ++ LQGE+ GW++F+ G+  VAFGSSYYHL PND RLVWDRLPM +
Sbjct  62   GVVGLTLCFYRNYFRLRLQGEIWGWSIFFLGVTAVAFGSSYYHLKPNDARLVWDRLPMTV  121

Query  548  ALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLM  369
            A   I++IF+IERVDEK G  SI P ++ G+ +++YWR FDDLRPYA+++ +P I I LM
Sbjct  122  AFTSIMAIFIIERVDEKTGTTSIAPLVIAGILTILYWRFFDDLRPYALIQFLPCIIIPLM  181

Query  368  ALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILT  189
            A+ IPP YTHS+YWLWAAG  LLA++ E  DK IYK + H VSGHTLKH+F A++ V LT
Sbjct  182  AILIPPMYTHSSYWLWAAGFYLLAKVEEAEDKQIYKWTNHIVSGHTLKHLFAAMVPVFLT  241

Query  188  LMLAQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            LMLA+RDI+ ER SLLQ+W++    + KENG K  
Sbjct  242  LMLAKRDIEPERRSLLQKWKI-YWIRIKENGLKAE  275



>ref|XP_006471102.1| PREDICTED: uncharacterized protein LOC102617260 [Citrus sinensis]
 gb|KDO53460.1| hypothetical protein CISIN_1g022991mg [Citrus sinensis]
Length=289

 Score =   334 bits (857),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 208/265 (78%), Gaps = 2/265 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVA++CF+VL M++TP IPQ + YHDFAD+RKFFGIP TL+V SNFPFL IG+ GL LC+
Sbjct  10   GVALICFIVL-MIVTPAIPQSEEYHDFADQRKFFGIPNTLNVVSNFPFLVIGIVGLVLCF  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY  + LQGE+ GW  F+ G+A V  GSSYYHL PND RLVWDRLPM IA   I++IF
Sbjct  69   HGNYFNLRLQGELWGWACFFIGVAAVGVGSSYYHLEPNDARLVWDRLPMTIAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE +G +S+IP LL GV S++YW  FDDLRPYA+V+ VP IAI LMA+ +PP YT
Sbjct  129  IIERIDEHKGTVSLIPLLLAGVVSILYWSFFDDLRPYALVQFVPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E  DKPIY+ + H VSGHTLKH+  A++ V LTLMLA+R I+
Sbjct  189  HSTYWLWAAGFYLLAKVEEAMDKPIYRWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRTIE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKV  87
            TER+SLL+ WR+    + KEN +KV
Sbjct  249  TERVSLLKTWRI-RWTRRKENDSKV  272



>ref|XP_003547538.1| PREDICTED: uncharacterized protein LOC100816173 [Glycine max]
Length=288

 Score =   334 bits (857),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 202/265 (76%), Gaps = 2/265 (1%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA++CF+ LLM++TP IPQ + YHDFAD R F GIP  L+V SNFPFL IGL GL LC++
Sbjct  11   VALVCFL-LLMIVTPAIPQSQEYHDFADHRTFLGIPNALNVISNFPFLVIGLVGLVLCHH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY ++SLQGE+ GWT FY G+A VA GSSYYHL P+D RLVWDRLPM +A   I++IF+
Sbjct  70   GNYFRLSLQGELWGWTCFYVGVAAVAVGSSYYHLKPDDARLVWDRLPMTVAFTSIMAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE++G +SIIP +L G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP YTH
Sbjct  130  IERIDERKGTVSIIPLVLAGIISIVYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA++ E  D  IY+ + H VSGHTLKH+  A++ V LT MLA+R ++ 
Sbjct  190  STYWLWAAGSYLLAKVLEATDDVIYEWAQHIVSGHTLKHLVAAMVPVFLTFMLAKRSVEP  249

Query  158  ERISLLQRWRMSSRNKAKENGTKVS  84
            ER SLL+ WR+ S  K +E  + + 
Sbjct  250  ERQSLLKTWRV-SWTKFREGNSNIE  273



>ref|XP_006431860.1| hypothetical protein CICLE_v10002064mg [Citrus clementina]
 gb|ESR45100.1| hypothetical protein CICLE_v10002064mg [Citrus clementina]
Length=289

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 207/265 (78%), Gaps = 2/265 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVA++CF+VL M++TP IPQ + YHDFAD+RKFFGIP TL+V SNFPFL IG+ GL LC+
Sbjct  10   GVALICFIVL-MIVTPAIPQSEEYHDFADQRKFFGIPNTLNVVSNFPFLVIGIVGLVLCF  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY  + LQGE+ GW  F+ G+A V  GSSYYHL PND RLVWDRLPM IA   I++IF
Sbjct  69   HGNYFNLRLQGELWGWACFFIGVAAVGVGSSYYHLEPNDARLVWDRLPMTIAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE +G +S+IP LL GV S++YW  FDDLRPYA+V+ VP IAI LMA+ +PP YT
Sbjct  129  IIERIDEHKGTVSLIPLLLAGVVSILYWSFFDDLRPYALVQFVPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E  DKPIY+ + H VSGHTLKH+  A + V LTLMLA+R I+
Sbjct  189  HSTYWLWAAGFYLLAKVEEAMDKPIYRWTHHIVSGHTLKHLCAATVPVFLTLMLAKRTIE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKV  87
            TER+SLL+ WR+    + KEN +KV
Sbjct  249  TERVSLLKTWRI-RWTRRKENDSKV  272



>emb|CDY49218.1| BnaCnng17070D [Brassica napus]
Length=287

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 204/267 (76%), Gaps = 7/267 (3%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ FVVL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GAAIVIFVVL-MIVTPTIPQSQAYHDFADQRTFFGIPNALNVISNFPFLIIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            Y  +Y + SL+GE LGWT F+ G+A VAFGSSYYHL+P+D RLVWDRLPM IA   I++I
Sbjct  69   YPDDYFRFSLRGEKLGWTCFFVGVAAVAFGSSYYHLHPDDARLVWDRLPMTIAFTSIMAI  128

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI+P LLVG+G +   R FDDLRPYA+V+ VP I I LMA+ +PP Y
Sbjct  129  FVIERIDEHKGTYSIVPLLLVGLGVIC--RFFDDLRPYALVQFVPCIVIPLMAILLPPMY  186

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  LLA++ E ADKPIY  + H +SGH++KHV  A++ V LTLMLA+R +
Sbjct  187  THSTYWLWAAGFYLLAKVEEAADKPIYSWTHHIISGHSIKHVCAAMVPVFLTLMLAKRSV  246

Query  164  QTERISLLQRWRMS---SRNKAKENGT  93
            QTERISL + W++S   SR K  E  +
Sbjct  247  QTERISLYKTWKISWTRSRGKGTEEES  273



>gb|KHN11231.1| hypothetical protein glysoja_023295 [Glycine soja]
Length=289

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 201/266 (76%), Gaps = 2/266 (1%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+LCF+VL M++TP IPQ + YHDFAD R F GIP  L+V SNFPFL IGL GL LCY+
Sbjct  11   VALLCFLVL-MIVTPSIPQSQEYHDFADHRTFLGIPNALNVISNFPFLVIGLVGLVLCYH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY ++SLQGE+ GWT FY G+A VA GSS+YHL P+D RLVWDRLPM +A   I++IF+
Sbjct  70   GNYFRLSLQGELWGWTCFYVGVAAVAVGSSFYHLKPDDARLVWDRLPMTVAFTSIMAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRR-FDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            IER+DE++G +SIIP +L G+ S++YWR+ FDDLRPYA+V+ VP I I LMA+ +PP YT
Sbjct  130  IERIDERKGTVSIIPLVLAGIISIVYWRQFFDDLRPYALVQFVPCIVIPLMAILLPPMYT  189

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E  D  IY+ + H VSGHTLKH+  A++ V LT MLA+R ++
Sbjct  190  HSTYWLWAAGSYLLAKVLEATDDVIYEWTRHIVSGHTLKHLVAAMVPVFLTFMLAKRSVE  249

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
             ER SLL+ WR+S     + N    S
Sbjct  250  PERQSLLKTWRVSWTKFREGNSNTES  275



>gb|ACU19396.1| unknown [Glycine max]
Length=288

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 199/265 (75%), Gaps = 1/265 (0%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+LCF+VL M++TP IPQ + YHDFAD R F GIP  L+V SNFPFL IGL G  LCY+
Sbjct  11   VALLCFLVL-MIVTPSIPQSQEYHDFADHRTFLGIPNALNVISNFPFLVIGLVGPVLCYH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY ++SLQGE+ GWT FY G+A VA GSS+YHL P+D RLVWDRLPM +A   I++IF+
Sbjct  70   GNYFRLSLQGELWGWTCFYVGVAAVAVGSSFYHLKPDDARLVWDRLPMTVAFTSIMAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE++G +SIIP +L G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP YTH
Sbjct  130  IERIDERKGTVSIIPLVLAGIISIVYWRFFDDLRPYALVQFVPCIVIPLMAILLPPIYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA++ E  D  IY+ + H VSGHTLKH+  A++ V LT MLA+R ++ 
Sbjct  190  STYWLWAAGSYLLAKVLEATDDVIYEWTRHIVSGHTLKHLVAAMVPVFLTFMLAKRSVEP  249

Query  158  ERISLLQRWRMSSRNKAKENGTKVS  84
            ER SLL+ WR+S     + N    S
Sbjct  250  ERQSLLKTWRVSWTKFREGNSNTES  274



>ref|XP_010242817.1| PREDICTED: uncharacterized protein LOC104587063 isoform X3 [Nelumbo 
nucifera]
Length=324

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 166/270 (61%), Positives = 208/270 (77%), Gaps = 2/270 (1%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L V GVAI+CFVVL M++TP IPQ + YHDFAD+R FFGIP TL+V SNFPFL +G+ GL
Sbjct  6    LYVWGVAIVCFVVL-MIVTPAIPQNEEYHDFADQRDFFGIPNTLNVVSNFPFLVVGIVGL  64

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
             LCY+ NY   S QGE+ GWT+F+ G+  VAFGS+YYHL PND RLVWDRLPM +A   I
Sbjct  65   ILCYHRNYFHFSTQGELWGWTIFFIGVTAVAFGSAYYHLKPNDARLVWDRLPMTVAFTSI  124

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            +SIF+IER+D+K+G LSIIP +L G+ S+ YWR FDDLRPYA+V+ VP I I +MA+ +P
Sbjct  125  ISIFIIERIDDKKGTLSIIPLVLTGIISIFYWRYFDDLRPYALVQFVPCIVIPIMAILLP  184

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
            P YTHS YWLWAA   LLA+I E  DKPIYK + H VSGHTLKH+F A++ + LTLMLA+
Sbjct  185  PMYTHSAYWLWAAAFYLLAKIEEAEDKPIYKWTSHVVSGHTLKHLFAAMVPLFLTLMLAK  244

Query  173  RDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            R I  ER SLL+ W++S + K ++NG K+ 
Sbjct  245  RRIAPERQSLLETWKISWK-KVRQNGFKME  273



>ref|XP_009406111.1| PREDICTED: uncharacterized protein LOC103989082 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=286

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 206/275 (75%), Gaps = 5/275 (2%)
 Frame = -3

Query  905  QGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAI  729
            +G  L   G A+L FVVL M++TP IPQ + YH+FAD+R+ F GIP TL+V SN PFL +
Sbjct  3    RGKQLCAWGAAVLIFVVL-MVVTPAIPQSEEYHNFADQRELFLGIPNTLNVISNIPFLFV  61

Query  728  GLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAI  549
            G+ GL LC+Y NY +  LQGE+ GW++F+ G+  VAFGSSYYHL PND RLVWDRLPM +
Sbjct  62   GVVGLTLCFYRNYFR--LQGEIWGWSIFFLGVTAVAFGSSYYHLKPNDARLVWDRLPMTV  119

Query  548  ALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLM  369
            A   I++IF+IERVDEK G  SI P ++ G+ +++YWR FDDLRPYA+++ +P I I LM
Sbjct  120  AFTSIMAIFIIERVDEKTGTTSIAPLVIAGILTILYWRFFDDLRPYALIQFLPCIIIPLM  179

Query  368  ALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILT  189
            A+ IPP YTHS+YWLWAAG  LLA++ E  DK IYK + H VSGHTLKH+F A++ V LT
Sbjct  180  AILIPPMYTHSSYWLWAAGFYLLAKVEEAEDKQIYKWTNHIVSGHTLKHLFAAMVPVFLT  239

Query  188  LMLAQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            LMLA+RDI+ ER SLLQ+W++    + KENG K  
Sbjct  240  LMLAKRDIEPERRSLLQKWKI-YWIRIKENGLKAE  273



>ref|XP_010030112.1| PREDICTED: uncharacterized protein LOC104419966 [Eucalyptus grandis]
 ref|XP_010030113.1| PREDICTED: uncharacterized protein LOC104419966 [Eucalyptus grandis]
 gb|KCW57076.1| hypothetical protein EUGRSUZ_I02729 [Eucalyptus grandis]
 gb|KCW57077.1| hypothetical protein EUGRSUZ_I02729 [Eucalyptus grandis]
Length=287

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/263 (62%), Positives = 204/263 (78%), Gaps = 1/263 (0%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAI+CFVVL M++TP IPQ +AYHDFADKR+FFGIP TL+V SNFPFL +GL GL LCY
Sbjct  10   GVAIVCFVVL-MIVTPAIPQSEAYHDFADKREFFGIPNTLNVVSNFPFLVVGLVGLVLCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            YGNY  +S QGE+LGWT F+ G+A VAFGSSYYHL P+D  LVWDRLPM IA   I++IF
Sbjct  69   YGNYFMLSSQGELLGWTCFFVGVAAVAFGSSYYHLKPDDATLVWDRLPMTIAFTSIVAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+D+ +G +SI+P +L G+ S++YWR FDDLRPYA+V+ +P IAI LMA+ +PP YT
Sbjct  129  IIERIDQHKGTVSIVPLILAGILSILYWRFFDDLRPYALVQFLPCIAIPLMAIILPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAA   L+A++ E  DK IY  + H VSGHTLKH+  A++ V LTLMLA+R I 
Sbjct  189  HSTYWLWAAAFYLIAKVEEAEDKVIYGWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRTID  248

Query  161  TERISLLQRWRMSSRNKAKENGT  93
             ER SLL  W++S     ++N +
Sbjct  249  LERQSLLVTWKVSWYRFKEKNSS  271



>ref|XP_002529266.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33098.1| conserved hypothetical protein [Ricinus communis]
Length=323

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 200/247 (81%), Gaps = 1/247 (0%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAILCF+VL M++TP IPQ + YHDFAD+R+FFGIP TL+V SNFPFL IG+ GL LC+
Sbjct  10   GVAILCFIVL-MIVTPSIPQSEEYHDFADQREFFGIPNTLNVVSNFPFLVIGVVGLVLCF  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            YGNY K+SLQGE+ GWT F+ G+A VAFGS YYHL PND RLVWDRLPM +A   I++IF
Sbjct  69   YGNYFKLSLQGELWGWTCFFIGVAAVAFGSGYYHLKPNDARLVWDRLPMTVAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G +SIIP +L G+ S+ YWR FDDLRPYA+V+ VP IAI LMA+ +PP YT
Sbjct  129  IIERIDERKGTISIIPLILAGIVSIAYWRFFDDLRPYALVQFVPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HS++WLWAAG  LLA++ E  DKPIY+ + H VSGHTLKH+  A++ V LTLMLA+R I+
Sbjct  189  HSSFWLWAAGFYLLAKVEEATDKPIYRWTHHLVSGHTLKHLCAAMVPVFLTLMLAKRSIE  248

Query  161  TERISLL  141
            TER  L+
Sbjct  249  TERFLLV  255



>ref|XP_004485489.1| PREDICTED: uncharacterized protein LOC101513407 [Cicer arietinum]
Length=286

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/270 (59%), Positives = 208/270 (77%), Gaps = 2/270 (1%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            +S  GVA++CF+VL M++TP IPQ + YH+FAD+R FFGIP  L+V SNFPFL +GL GL
Sbjct  6    VSAWGVALICFIVL-MIVTPTIPQSQEYHNFADQRTFFGIPNALNVISNFPFLVVGLIGL  64

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
             LCY+GNY K+SLQGE+ GWT FY G+A V  GSSYYHL P+D  LVWDRLPM IA   I
Sbjct  65   ILCYHGNYFKLSLQGELWGWTCFYLGVAAVGVGSSYYHLKPDDATLVWDRLPMTIAFTSI  124

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            ++IF+IER+DE++G++SI+P +L G+ S++YWR FDDLRPYA+V+ VP IA+ LMA+ +P
Sbjct  125  IAIFIIERIDERKGMISIVPLILAGIISIVYWRFFDDLRPYALVQFVPCIAMPLMAILLP  184

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
            P YTHSTYWLWAAG  LLA++ E  D  +YK + H VSGHTLKH+F A++ + LT MLA+
Sbjct  185  PMYTHSTYWLWAAGFYLLAKVLEATDDVVYKWTHHIVSGHTLKHLFAAMVPIFLTFMLAK  244

Query  173  RDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            R ++ +R SLL+ WR+ S  K KE  + V 
Sbjct  245  RSLEEDRQSLLKTWRI-SWTKIKEGDSSVE  273



>ref|XP_002888824.1| hypothetical protein ARALYDRAFT_476250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65083.1| hypothetical protein ARALYDRAFT_476250 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/261 (61%), Positives = 202/261 (77%), Gaps = 2/261 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ +AYH+FAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  5    GSAIVIFIVL-MIVTPTIPQSQAYHNFADQRSFFGIPNALNVISNFPFLIIGLIGLILCF  63

Query  701  Y-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            Y  +Y   SL+GE +GWT FY G+A+VAFGSSYYHL+PND  L+WDRLPM IA   I++I
Sbjct  64   YPEDYFSFSLRGEKIGWTCFYVGVASVAFGSSYYHLHPNDATLLWDRLPMTIAFTSIMAI  123

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            FVIER+DE +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP Y
Sbjct  124  FVIERIDEHKGTYSIVPLLLAGLVSILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMY  183

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THSTYWLWAAG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA+R +
Sbjct  184  THSTYWLWAAGFYLLAKVEEAADKPIYSWTHHIISGHSLKHLCAAMVPVFLTLMLAKRTV  243

Query  164  QTERISLLQRWRMSSRNKAKE  102
            QTERISL + W++ S  +  E
Sbjct  244  QTERISLYKTWKIGSEEERFE  264



>ref|XP_003593011.1| hypothetical protein MTR_2g006770 [Medicago truncatula]
 gb|ACJ85233.1| unknown [Medicago truncatula]
 gb|AES63262.1| alkaline phytoceramidase (APHC) [Medicago truncatula]
Length=286

 Score =   322 bits (824),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 204/266 (77%), Gaps = 2/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
             VA++CF+VL M++TP IPQ + YH+FAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  10   AVALICFIVL-MIVTPAIPQSQDYHNFADQRTFFGIPNALNVISNFPFLIIGLIGLVLCH  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY K+SLQGE+ GWT FY G+A V  GSSYYHL P+D  LVWDRLPM +A   I++IF
Sbjct  69   HGNYFKLSLQGELWGWTCFYVGVAAVGIGSSYYHLKPDDASLVWDRLPMTVAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G++SIIP +L GV S++YWR FDDLRPYA+++ VP IAI LMA+ +PP YT
Sbjct  129  IIERIDERKGMISIIPLVLAGVISIVYWRFFDDLRPYALIQFVPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E  D  +YK + H VSGHTLKH+F A++ V LT MLA+R ++
Sbjct  189  HSTYWLWAAGFYLLAKVLEATDDVVYKWTHHIVSGHTLKHLFAAMVPVFLTFMLAKRSVE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
             ER SL + WR+ S  K KE  + V 
Sbjct  249  PERQSLFKVWRI-SWTKVKEGDSNVE  273



>ref|XP_010242815.1| PREDICTED: uncharacterized protein LOC104587063 isoform X1 [Nelumbo 
nucifera]
Length=337

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 208/283 (73%), Gaps = 15/283 (5%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L V GVAI+CFVVL M++TP IPQ + YHDFAD+R FFGIP TL+V SNFPFL +G+ GL
Sbjct  6    LYVWGVAIVCFVVL-MIVTPAIPQNEEYHDFADQRDFFGIPNTLNVVSNFPFLVVGIVGL  64

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLP--------  558
             LCY+ NY   S QGE+ GWT+F+ G+  VAFGS+YYHL PND RLVWDRLP        
Sbjct  65   ILCYHRNYFHFSTQGELWGWTIFFIGVTAVAFGSAYYHLKPNDARLVWDRLPDLVSKRTI  124

Query  557  -----MAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETV  393
                 M +A   I+SIF+IER+D+K+G LSIIP +L G+ S+ YWR FDDLRPYA+V+ V
Sbjct  125  GSGREMTVAFTSIISIFIIERIDDKKGTLSIIPLVLTGIISIFYWRYFDDLRPYALVQFV  184

Query  392  PIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG  213
            P I I +MA+ +PP YTHS YWLWAA   LLA+I E  DKPIYK + H VSGHTLKH+F 
Sbjct  185  PCIVIPIMAILLPPMYTHSAYWLWAAAFYLLAKIEEAEDKPIYKWTSHVVSGHTLKHLFA  244

Query  212  AILAVILTLMLAQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            A++ + LTLMLA+R I  ER SLL+ W++S + K ++NG K+ 
Sbjct  245  AMVPLFLTLMLAKRRIAPERQSLLETWKISWK-KVRQNGFKME  286



>ref|XP_010242816.1| PREDICTED: uncharacterized protein LOC104587063 isoform X2 [Nelumbo 
nucifera]
Length=336

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 208/283 (73%), Gaps = 15/283 (5%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L V GVAI+CFVVL M++TP IPQ + YHDFAD+R FFGIP TL+V SNFPFL +G+ GL
Sbjct  6    LYVWGVAIVCFVVL-MIVTPAIPQNEEYHDFADQRDFFGIPNTLNVVSNFPFLVVGIVGL  64

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLP--------  558
             LCY+ NY   S QGE+ GWT+F+ G+  VAFGS+YYHL PND RLVWDRLP        
Sbjct  65   ILCYHRNYFHFSTQGELWGWTIFFIGVTAVAFGSAYYHLKPNDARLVWDRLPDLVSKRTI  124

Query  557  -----MAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETV  393
                 M +A   I+SIF+IER+D+K+G LSIIP +L G+ S+ YWR FDDLRPYA+V+ V
Sbjct  125  GSGREMTVAFTSIISIFIIERIDDKKGTLSIIPLVLTGIISIFYWRYFDDLRPYALVQFV  184

Query  392  PIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG  213
            P I I +MA+ +PP YTHS YWLWAA   LLA+I E  DKPIYK + H VSGHTLKH+F 
Sbjct  185  PCIVIPIMAILLPPMYTHSAYWLWAAAFYLLAKIEEAEDKPIYKWTSHVVSGHTLKHLFA  244

Query  212  AILAVILTLMLAQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            A++ + LTLMLA+R I  ER SLL+ W++S + K ++NG K+ 
Sbjct  245  AMVPLFLTLMLAKRRIAPERQSLLETWKISWK-KVRQNGFKME  286



>ref|XP_008449409.1| PREDICTED: uncharacterized protein LOC103491304 isoform X2 [Cucumis 
melo]
Length=288

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 207/265 (78%), Gaps = 2/265 (1%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            V+I+CF+VL M++TP IPQ + YHDFAD R+FFGIP TL+V SNFPFL IGL GL LCY+
Sbjct  11   VSIVCFLVL-MIVTPSIPQSQDYHDFADHRQFFGIPNTLNVVSNFPFLIIGLIGLVLCYH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
             NY ++SL+GE+ GWT FY G+A VAFGSSYYHL PND RLVWDRLPM IA   I+SIF+
Sbjct  70   ENYFRLSLRGELYGWTCFYIGVALVAFGSSYYHLKPNDARLVWDRLPMTIAFTSIISIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE +G LSIIP LLVG+ S++YW  FDDLRPYA+V+ VP IAI LM + +PP YTH
Sbjct  130  IERIDEYKGTLSIIPLLLVGIVSILYWCLFDDLRPYALVQFVPCIAIPLMTILLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA++ E +DK IYK + H VSGHTLKH+  +++ V LTLMLA+R I+ 
Sbjct  190  STYWLWAAGFYLLAKVEEASDKLIYKWTYHIVSGHTLKHLCASMVPVFLTLMLAKRTIEP  249

Query  158  ERISLLQRWRMSSRNKAKENGTKVS  84
            +R SL + W+++   K +++  KV 
Sbjct  250  DRQSLYKIWKVTLM-KFRDDKNKVE  273



>ref|XP_008781500.1| PREDICTED: uncharacterized protein LOC103701271 [Phoenix dactylifera]
Length=286

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 195/253 (77%), Gaps = 3/253 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALC  705
            G AI+ F+VL M++TP IPQ + YHDFAD+RK F GIP TL+V SNFPFL IGL G  LC
Sbjct  10   GAAIVIFIVL-MIVTPAIPQSQEYHDFADQRKLFLGIPNTLNVISNFPFLVIGLIGFVLC  68

Query  704  YYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
              G++ ++SLQGEV GW+ F+ G+A VAFGSSYYHL PND RLVWDRLPM IA   I++I
Sbjct  69   LRGSF-RLSLQGEVWGWSCFFIGVAAVAFGSSYYHLKPNDARLVWDRLPMTIAFTSIMAI  127

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            F+IER+DEK G+ SI P ++ G+ S++YWR FDDLR YA+V+ VP I I LMA+ IPP Y
Sbjct  128  FIIERIDEKTGMTSIAPLVMAGIISILYWRFFDDLRLYALVQFVPCIIIPLMAILIPPMY  187

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THS YWLWAAG  LLA++ E  DK IYK + H VSGHTLKH+  A++ V LTLMLA+R I
Sbjct  188  THSAYWLWAAGFYLLAKVEEAMDKVIYKWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRSI  247

Query  164  QTERISLLQRWRM  126
            + +RISL Q+WR+
Sbjct  248  EADRISLFQQWRI  260



>ref|NP_177275.1| senescence associated protein 18 [Arabidopsis thaliana]
 gb|AAG51683.1|AC016972_2 unknown protein; 59738-58353 [Arabidopsis thaliana]
 gb|ACI31302.1| At1g71190 [Arabidopsis thaliana]
 gb|AEE35170.1| senescence associated protein 18 [Arabidopsis thaliana]
Length=281

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 201/267 (75%), Gaps = 2/267 (1%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            +S  G AIL F++L M++TP IPQ +AYH+FAD+R F GIP  L+V SNFPFL IGL GL
Sbjct  6    MSAWGSAILIFIIL-MIVTPTIPQSQAYHNFADQRSFLGIPNFLNVISNFPFLIIGLIGL  64

Query  713  ALCYY-GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAG  537
             LC+Y  +Y   SL+GE +GWT FY G+A VAFGSSYYHL+PND  L+WDRLPM IA   
Sbjct  65   ILCFYPEDYFSFSLRGEKIGWTCFYIGVAAVAFGSSYYHLHPNDATLLWDRLPMTIAFTS  124

Query  536  ILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWI  357
            I++IFVIER+DE +G  SI P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +
Sbjct  125  IMAIFVIERIDEHKGTYSIAPLLLAGLVSILYWRFFDDLRPYALVQFVPCIVIPLMAILL  184

Query  356  PPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLA  177
            PP YTHSTYWLWAAG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA
Sbjct  185  PPMYTHSTYWLWAAGFYLLAKVEEAADKPIYSWTHHIISGHSLKHLCAAMVPVFLTLMLA  244

Query  176  QRDIQTERISLLQRWRMSSRNKAKENG  96
            +R +QTERISL + W+  S  +  E+ 
Sbjct  245  KRTVQTERISLYKTWKKGSEEERFEHS  271



>gb|AFK45098.1| unknown [Medicago truncatula]
Length=286

 Score =   318 bits (816),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 203/266 (76%), Gaps = 2/266 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
             VA++CF+VL M++TP IPQ + YH+FAD+R FFGIP  L+V SNFPFL  GL GL LC+
Sbjct  10   AVALICFIVL-MIVTPAIPQSQDYHNFADQRTFFGIPNALNVISNFPFLINGLIGLVLCH  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            +GNY K+SLQGE+ GWT FY G+A V  GSSYYHL P+D  LVWDRLPM +A   I++IF
Sbjct  69   HGNYFKLSLQGELWGWTCFYVGVAAVGIGSSYYHLKPDDASLVWDRLPMTVAFTSIIAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IER+DE++G++SIIP +L GV S++YWR FDDLRPYA+++ VP IAI LMA+ +PP YT
Sbjct  129  IIERIDERKGMISIIPLVLAGVISIVYWRFFDDLRPYALIQFVPCIAIPLMAILLPPMYT  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E  D  +YK + H VSGHTLKH+F A++ V LT MLA+R ++
Sbjct  189  HSTYWLWAAGFYLLAKVLEATDDVVYKWTHHIVSGHTLKHLFAAMVPVFLTFMLAKRSVE  248

Query  161  TERISLLQRWRMSSRNKAKENGTKVS  84
             ER SL + WR+ S  K KE  + V 
Sbjct  249  PERQSLFKVWRI-SWTKVKEGDSNVE  273



>ref|XP_004140109.1| PREDICTED: uncharacterized protein LOC101206038 [Cucumis sativus]
 ref|XP_004164083.1| PREDICTED: uncharacterized LOC101206038 [Cucumis sativus]
 gb|KGN47933.1| hypothetical protein Csa_6G416860 [Cucumis sativus]
Length=288

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 206/265 (78%), Gaps = 2/265 (1%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            ++I+CF+VL M++TP IPQ + YH FAD R+FFGIP TL+V SNFPFL IGL GL LCY+
Sbjct  11   LSIVCFLVL-MIVTPSIPQSQDYHHFADHRQFFGIPNTLNVVSNFPFLIIGLIGLVLCYH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
             NY ++SL+GE+ GWT FY G+A VAFGSSYYHL PND RLVWDRLPM IA   I+SIF+
Sbjct  70   ENYFRLSLRGELYGWTCFYIGVALVAFGSSYYHLEPNDARLVWDRLPMTIAFTSIISIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE +G LSIIP LLVG+ S++YW  FDDLRPYA+V+ VP IAI LM + +PP YTH
Sbjct  130  IERIDEYKGTLSIIPLLLVGIVSILYWCWFDDLRPYALVQFVPCIAIPLMTILLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA++ E +DK IYK + H VSGHTLKH+  +++ V LTLMLA+R I+ 
Sbjct  190  STYWLWAAGFYLLAKVEEASDKLIYKWTYHIVSGHTLKHLCASMVPVFLTLMLAKRTIEP  249

Query  158  ERISLLQRWRMSSRNKAKENGTKVS  84
            ER SL + W+++   K +++  KV 
Sbjct  250  ERQSLYKIWKVTLM-KFRDDKNKVE  273



>gb|EPS65399.1| hypothetical protein M569_09379, partial [Genlisea aurea]
Length=289

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/254 (62%), Positives = 192/254 (76%), Gaps = 3/254 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ + YHDF+D R+FFGIP  L+V SNFPF  IGL G+ L  
Sbjct  10   GAAIVIFIVL-MIVTPAIPQSQEYHDFSDHREFFGIPNALNVISNFPFFVIGLIGILLTL  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            Y NY  +SL GE  GW+VF+ G+  VAFGSSYYHL PNDDRLVWDRLPM +A   I++IF
Sbjct  69   YKNYFNLSLPGERWGWSVFFLGVTAVAFGSSYYHLKPNDDRLVWDRLPMTVAFTSIVAIF  128

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IERVD  +G  SIIP L VGV S++YWR FDDLRPYA+V+ VP IAI LMA+ +PP Y+
Sbjct  129  IIERVDSHKGTWSIIPLLSVGVISILYWRYFDDLRPYALVQFVPCIAIPLMAVLLPPMYS  188

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHR-VSGHTLKHVFGAILAVILTLMLAQRDI  165
            HSTYWLWAAG  LLA+I E  DK I+  S HR VSGHTLKH+  A++ V L +MLA+R +
Sbjct  189  HSTYWLWAAGFYLLAKIEEATDKLIFD-STHRIVSGHTLKHLAAAMVPVFLAVMLAKRVV  247

Query  164  QTERISLLQRWRMS  123
              ER+SLLQ WR+S
Sbjct  248  TEERMSLLQVWRIS  261



>ref|XP_002456981.1| hypothetical protein SORBIDRAFT_03g046710 [Sorghum bicolor]
 gb|EES02101.1| hypothetical protein SORBIDRAFT_03g046710 [Sorghum bicolor]
Length=296

 Score =   317 bits (812),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 189/246 (77%), Gaps = 1/246 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ +AYHDFAD+R  F GIP TL+V SN PF  +G+ GL LC+Y NY ++
Sbjct  20   VVLMLVTPAIPQDEAYHDFADQRTLFLGIPNTLNVISNIPFFFVGVTGLILCHYKNYFRL  79

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            S QGE+  WT+F+ G+  V FGSSYYHLNPND  LVWDRLPM IA   +++IF+IERVDE
Sbjct  80   SSQGELWSWTLFFAGVTAVGFGSSYYHLNPNDATLVWDRLPMTIAFTSVMAIFIIERVDE  139

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S++YWR FDDLRPYA+V+ VP IA+ +MA+ IPP YTHS+YWLW
Sbjct  140  RAGAKSLAPLVITGALSIMYWRHFDDLRPYAVVQFVPCIALPVMAIVIPPMYTHSSYWLW  199

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  LLA++ E ADKPIY  +   VSGHTLKH+  A++ V L LMLA+R I+ ER+SLL
Sbjct  200  AAGFYLLAKVEEAADKPIYNWTHQIVSGHTLKHLCAAMVPVFLALMLAKRTIEPERVSLL  259

Query  140  QRWRMS  123
            Q+W++S
Sbjct  260  QKWKIS  265



>gb|ADE75903.1| unknown [Picea sitchensis]
Length=276

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/280 (54%), Positives = 197/280 (70%), Gaps = 8/280 (3%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T   R + S   V  VA+ CF+ L M++TP IPQ + YH+FAD+R FFG+P TL+V SNF
Sbjct  2    TTLERIKDSRACVWCVALFCFIAL-MVVTPVIPQSQEYHNFADRRNFFGVPNTLNVISNF  60

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PFL IG+ GL LC YGN+  +SLQGEV GW  FY G+   AFGS+YYHL P+D RLVWDR
Sbjct  61   PFLIIGVVGLILCLYGNHFSLSLQGEVWGWVFFYVGVTATAFGSAYYHLKPDDARLVWDR  120

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM IA   I+++F+IER+DEK G +S+ P L+ G+ S+ YWR FDDLRPYA+V+ +P I
Sbjct  121  LPMTIAFTSIMAVFIIERIDEKTGTMSLFPLLMAGIVSIAYWRYFDDLRPYALVQFIPCI  180

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            AI  M + +P  YTHS YWLWAAG  LLA++ E ADKPIYK + + +SGHTLKH+  A++
Sbjct  181  AIPAMTILLPAMYTHSIYWLWAAGFYLLAKLEEAADKPIYKWTHYTISGHTLKHLCAAMV  240

Query  203  AVILTLMLAQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
             V LT+ML++R I+ ER   L +       K  E+G+  S
Sbjct  241  PVFLTIMLSRRSIEIERQFQLMK-------KTDEDGSSGS  273



>ref|XP_010930877.1| PREDICTED: uncharacterized protein LOC105051925 [Elaeis guineensis]
Length=286

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 193/253 (76%), Gaps = 3/253 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALC  705
            G AI+ F VL M++TP IPQ + YHDFAD+R+ F GIP TL+V SNFPFL IGL GL LC
Sbjct  10   GAAIVIFAVL-MIVTPAIPQSQEYHDFADQRELFLGIPNTLNVISNFPFLVIGLIGLVLC  68

Query  704  YYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
              G++ ++SLQGEV GW+ F+ G+A VAFGSSYYHL PND RLVWDRLPM IA   I++I
Sbjct  69   LRGSF-RLSLQGEVWGWSCFFIGVAAVAFGSSYYHLKPNDARLVWDRLPMTIAFTSIMAI  127

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            F+IER+DEK G+ SI P +L G+ S++YWR FDDLR YA+V+ VP I I LMA+ IPP Y
Sbjct  128  FIIERIDEKTGMTSIAPLVLAGIISILYWRFFDDLRLYALVQFVPCIIIPLMAILIPPMY  187

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THS YWLWAAG  LLA++ E  DK IYK + H VSGHTLKH+  A++ V LTLMLA+R I
Sbjct  188  THSAYWLWAAGFYLLAKVEEAMDKVIYKWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRSI  247

Query  164  QTERISLLQRWRM  126
            + +R SL Q WR+
Sbjct  248  EPDRRSLFQHWRI  260



>ref|NP_001045476.1| Os01g0962200 [Oryza sativa Japonica Group]
 dbj|BAD87231.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF07390.1| Os01g0962200 [Oryza sativa Japonica Group]
 dbj|BAG90523.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56051.1| hypothetical protein OsJ_04852 [Oryza sativa Japonica Group]
Length=294

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 192/256 (75%), Gaps = 1/256 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLA  711
            V  VA +   V+LML+TP IPQ + YHDFAD+R+ F GIP TL+V SN PF  +G+ GL 
Sbjct  10   VAWVAAVTIFVVLMLVTPAIPQNEEYHDFADQRRLFLGIPNTLNVISNIPFFFVGVVGLV  69

Query  710  LCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGIL  531
            LC+Y NY +++ QGE+  WT+F+ G+  VAFGSSYYHL PND  LVWDRLPM IA   ++
Sbjct  70   LCHYKNYFRLNSQGELWSWTLFFAGVTAVAFGSSYYHLKPNDATLVWDRLPMTIAFTSVM  129

Query  530  SIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPP  351
            +IF+IERVD++ G  S+ P ++ G  S++YWR FDDLRPYA+++ VP IAI +MA+ IPP
Sbjct  130  AIFIIERVDDRAGTKSLAPLVIAGALSIMYWRFFDDLRPYAVIQFVPCIAIPVMAIVIPP  189

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
             YTHS+YWLWAAG  LLA++ E ADKPIYK +   VSGHTLKH+  A++ V L LMLA+R
Sbjct  190  MYTHSSYWLWAAGFYLLAKVEEAADKPIYKWTHQIVSGHTLKHLAAAMVPVFLALMLAKR  249

Query  170  DIQTERISLLQRWRMS  123
             ++ ER+SL QRW++ 
Sbjct  250  TVEPERVSLFQRWKVK  265



>emb|CDX68322.1| BnaA07g23620D [Brassica napus]
Length=288

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 198/268 (74%), Gaps = 8/268 (3%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G A + F+VL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IGL GL LC+
Sbjct  10   GAATVIFLVL-MIVTPTIPQSQAYHDFADQRTFFGIPNALNVISNFPFLIIGLIGLVLCF  68

Query  701  Y-GNYVKISLQGEV-LGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            Y  +Y +      + LGWT F+ G+A VAFGSSYYHL+P+D RLVWDRLPM IA   I++
Sbjct  69   YPDDYFRFRRVNRLKLGWTCFFVGVAAVAFGSSYYHLHPDDARLVWDRLPMTIAFTSIMA  128

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
            IFVIER+DE +G  SI+P LLVG+  +   R FDDLRPYA+V+ VP I I LMA+ +PP 
Sbjct  129  IFVIERIDEHKGTYSIVPLLLVGLAVIC--RFFDDLRPYALVQFVPCIVIPLMAILLPPM  186

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHSTYWLWAAG  LLA++ E ADKPIY  + H +SGH++KHV  A++ V LTLMLA+R 
Sbjct  187  YTHSTYWLWAAGFYLLAKVEEAADKPIYSWTHHILSGHSIKHVCAAMVPVFLTLMLAKRS  246

Query  167  IQTERISLLQRWRMS---SRNKAKENGT  93
            +QTERISL + W++S   SR K  E  +
Sbjct  247  VQTERISLYKTWKISWTRSRGKGTEEES  274



>ref|XP_006645356.1| PREDICTED: uncharacterized protein LOC102716178 [Oryza brachyantha]
Length=298

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 198/280 (71%), Gaps = 12/280 (4%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLA  711
            V   A L   V+LML+TP IPQ + YHDFAD+R+ F GIP TL+V SN PF  +G+ GL 
Sbjct  11   VAWAAALTIFVVLMLVTPAIPQNEDYHDFADQRRLFLGIPNTLNVISNIPFFFVGVVGLI  70

Query  710  LCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGIL  531
            LC+Y N+ +++ QGE+  WT+F+ G+  VAFGSSYYHLNPND  LVWDRLPM IA   ++
Sbjct  71   LCHYKNFFRLNSQGELWSWTLFFAGVTAVAFGSSYYHLNPNDATLVWDRLPMTIAFTSVM  130

Query  530  SIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPP  351
            +IF+IERVD++ G  S+ P ++ G  S++YWR +DDLRPYA+++ VP IAI +MA+ IPP
Sbjct  131  AIFIIERVDDRAGTKSLAPLVIAGALSILYWRFYDDLRPYAVIQFVPCIAIPVMAIVIPP  190

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
             YTHS+YWLWAAG  LLA++ E ADKPIYK +   VSGHTLKH+  A++ V L +MLA+R
Sbjct  191  MYTHSSYWLWAAGFYLLAKVEEAADKPIYKWTHGIVSGHTLKHLAAAMVPVFLAVMLAKR  250

Query  170  DIQTERISLLQRWRM-----------SSRNKAKENGTKVS  84
             I+ ER+SL Q+W++             RN    N T VS
Sbjct  251  TIEPERVSLFQKWKVKLITVRESRFNQDRNTVNYNYTAVS  290



>ref|XP_007133145.1| hypothetical protein PHAVU_011G155400g [Phaseolus vulgaris]
 ref|XP_007133146.1| hypothetical protein PHAVU_011G155400g [Phaseolus vulgaris]
 gb|ESW05139.1| hypothetical protein PHAVU_011G155400g [Phaseolus vulgaris]
 gb|ESW05140.1| hypothetical protein PHAVU_011G155400g [Phaseolus vulgaris]
Length=288

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 196/252 (78%), Gaps = 1/252 (0%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+ CF+VL M++TP I Q + YH+FAD RKFFGIP  L+V SNFPFL IGL GL LC+ 
Sbjct  11   VALFCFLVL-MIVTPAIHQSQDYHNFADHRKFFGIPNALNVISNFPFLVIGLVGLVLCHR  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY  +SLQGE+ GWT FY G+A VA GSSYYHL P+D RLVWDRLPM +A   I++IF+
Sbjct  70   GNYFSLSLQGEIWGWTCFYVGVAAVAVGSSYYHLKPDDARLVWDRLPMTVAFTSIIAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE +G +SIIP LL G+ S++YWR FDDLRPYA+V+ VP IAI LMA+ +PP YTH
Sbjct  130  IERIDEWKGTVSIIPLLLAGIISIVYWRFFDDLRPYALVQFVPCIAIPLMAILLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA++ E  D+ +Y+ + H VSGHTLKH+  A++ V LT MLA+R +Q 
Sbjct  190  STYWLWAAGSYLLAKVLEATDEVVYEWTHHIVSGHTLKHLAAAMVPVFLTFMLAKRSVQP  249

Query  158  ERISLLQRWRMS  123
            ER +LL+ WR+S
Sbjct  250  ERQNLLKTWRVS  261



>ref|XP_004971350.1| PREDICTED: uncharacterized protein LOC101773401 [Setaria italica]
Length=295

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 194/261 (74%), Gaps = 4/261 (2%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ + YHDFAD+R  F GIP TL+V SN PF  +G+ GL LC+Y +Y ++
Sbjct  20   VVLMLVTPAIPQNQEYHDFADQRTLFLGIPNTLNVISNIPFFFVGVTGLILCHYKDYFRL  79

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            S QGE+  W++F+ G+  VAFGSSYYHLNPND  LVWDRLPM IA   I++IF+IERVD+
Sbjct  80   SSQGELWSWSLFFAGVTAVAFGSSYYHLNPNDATLVWDRLPMTIAFTSIMAIFIIERVDD  139

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S++YW  FDDLRPYA+V+ VP IAI +MA+ IPP YTHS+YWLW
Sbjct  140  RAGAKSLAPLVIAGALSILYWSYFDDLRPYAIVQFVPCIAIPVMAIVIPPMYTHSSYWLW  199

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  +LA++ E ADKPIYK +   VSGHTLKH+  A++ V L LMLA+R I+ ER+SLL
Sbjct  200  AAGFYVLAKVEEAADKPIYKWTHQIVSGHTLKHLCAAMVPVFLALMLAKRTIEPERVSLL  259

Query  140  QRWR---MSSRNKAKENGTKV  87
            Q+W+   ++ R    E+G  +
Sbjct  260  QKWKIKLITVRESRSEDGKTI  280



>ref|XP_010242820.1| PREDICTED: uncharacterized protein LOC104587065 [Nelumbo nucifera]
Length=268

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 195/264 (74%), Gaps = 1/264 (0%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L++ GV+I   VVL M++TPRIPQP+AYHDFAD+R FFGIP TLDV SN PFL  G+ GL
Sbjct  6    LNIWGVSIASLVVL-MIVTPRIPQPQAYHDFADQRNFFGIPNTLDVVSNVPFLIAGIIGL  64

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
             +CY GNY ++SLQGE+L WT+FY  +A V  GS YYHL PND RLVWDR+PM++ALA +
Sbjct  65   VVCYRGNYFRLSLQGELLAWTIFYISMAAVGLGSGYYHLQPNDPRLVWDRVPMSVALASV  124

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            L+IF+IERVDEK+G +SIIP ++ G+GS++YWR F D+R Y + + +  +AI  MA+ +P
Sbjct  125  LAIFIIERVDEKKGTMSIIPLIMAGLGSILYWRIFRDVRLYILFQLLSCLAIAAMAILLP  184

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
            P YTHS YWLWA    L+ +IGELAD+ IY L+   + GHTLKH+  A+++V  ++MLA+
Sbjct  185  PMYTHSIYWLWAGVFFLIGKIGELADQQIYDLTRQVIGGHTLKHLGLAMVSVFTSIMLAK  244

Query  173  RDIQTERISLLQRWRMSSRNKAKE  102
            R +  +R S+L   R+S      E
Sbjct  245  RSVALKRQSVLDSLRISKSAVKTE  268



>ref|XP_008449408.1| PREDICTED: uncharacterized protein LOC103491304 isoform X1 [Cucumis 
melo]
Length=296

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 207/273 (76%), Gaps = 10/273 (4%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            V+I+CF+VL M++TP IPQ + YHDFAD R+FFGIP TL+V SNFPFL IGL GL LCY+
Sbjct  11   VSIVCFLVL-MIVTPSIPQSQDYHDFADHRQFFGIPNTLNVVSNFPFLIIGLIGLVLCYH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLP--------MAIAL  543
             NY ++SL+GE+ GWT FY G+A VAFGSSYYHL PND RLVWDRLP        M IA 
Sbjct  70   ENYFRLSLRGELYGWTCFYIGVALVAFGSSYYHLKPNDARLVWDRLPVSHFPHCGMTIAF  129

Query  542  AGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMAL  363
              I+SIF+IER+DE +G LSIIP LLVG+ S++YW  FDDLRPYA+V+ VP IAI LM +
Sbjct  130  TSIISIFIIERIDEYKGTLSIIPLLLVGIVSILYWCLFDDLRPYALVQFVPCIAIPLMTI  189

Query  362  WIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLM  183
             +PP YTHSTYWLWAAG  LLA++ E +DK IYK + H VSGHTLKH+  +++ V LTLM
Sbjct  190  LLPPMYTHSTYWLWAAGFYLLAKVEEASDKLIYKWTYHIVSGHTLKHLCASMVPVFLTLM  249

Query  182  LAQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            LA+R I+ +R SL + W+++   K +++  KV 
Sbjct  250  LAKRTIEPDRQSLYKIWKVTLM-KFRDDKNKVE  281



>dbj|BAJ85366.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85951.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 191/259 (74%), Gaps = 1/259 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ + YHDFAD+R  F GIP TL+V SN PFL +GLAGL LC+Y NY ++
Sbjct  21   VVLMLVTPAIPQNEDYHDFADQRSLFLGIPNTLNVLSNIPFLFVGLAGLILCHYKNYFRL  80

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
              QGE+  WT+FY G+  V  GSSYYHLNPND  LVWDRLPM IA   I++IF+IERVD+
Sbjct  81   CSQGELWSWTLFYAGVTAVGVGSSYYHLNPNDSTLVWDRLPMTIAFTSIVAIFIIERVDD  140

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S++YW  FDDLRPYA+++ VP I I +MA+ IPP YTHS+YWLW
Sbjct  141  RAGTKSLAPLVIAGALSILYWSFFDDLRPYAIIQFVPCIVIPVMAIVIPPMYTHSSYWLW  200

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  LLA++ E ADKPIY+ +   VSGHTLKH+  A++ V LTLML++R I+ +R+SLL
Sbjct  201  AAGFYLLAKVEEAADKPIYRWTHDIVSGHTLKHLCAAMVPVFLTLMLSKRTIEPDRVSLL  260

Query  140  QRWRMSSRNKAKENGTKVS  84
            Q W++S R    ++   V 
Sbjct  261  QMWKISWREGGSKDSNTVD  279



>gb|EMS50962.1| hypothetical protein TRIUR3_31964 [Triticum urartu]
Length=294

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 192/259 (74%), Gaps = 1/259 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ + YHDFAD+R  F GIP TL+V SN PFL +GLAGL LC+Y +Y ++
Sbjct  21   VVLMLVTPAIPQDEDYHDFADQRDLFLGIPNTLNVLSNIPFLFVGLAGLILCHYKDYFRL  80

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
              QGE+  WT+FY G+ TV  GSSYYHL PND  LVWDRLPM IA   I++IF+IERVD+
Sbjct  81   CSQGELWSWTLFYAGVTTVGVGSSYYHLYPNDATLVWDRLPMTIAFTSIVAIFIIERVDD  140

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S++YW  FDDLRPYA+++ VP I I +MA+ IPP YTHS+YWLW
Sbjct  141  RAGTKSLAPLVIAGALSILYWSFFDDLRPYAIIQFVPCIVIPVMAIVIPPMYTHSSYWLW  200

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  LLA++ E ADKPIY+ +   VSGHTLKH+  A++ V LTLMLA+R I+ +R+SLL
Sbjct  201  AAGFYLLAKVEEAADKPIYRWTHDIVSGHTLKHLCAAMVPVFLTLMLAKRTIEPDRVSLL  260

Query  140  QRWRMSSRNKAKENGTKVS  84
            Q W++S R +  ++   V 
Sbjct  261  QMWKISWRERGSQDSNTVD  279



>gb|AFW83891.1| membrane protein [Zea mays]
Length=295

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 186/246 (76%), Gaps = 1/246 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ +AYHDFAD+R  F GIP TL+V SN PF  +G+ GL LC++ NY ++
Sbjct  20   VVLMLVTPAIPQDEAYHDFADQRTLFLGIPNTLNVISNIPFFFVGVTGLILCHFNNYFRL  79

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            S QGE+  WT+F+ G+  V FGSSYYHLNPND  LVWDRLPM IA   +++IF+IERVD+
Sbjct  80   SSQGELWSWTLFFAGVTAVGFGSSYYHLNPNDATLVWDRLPMTIAFTSVMAIFIIERVDD  139

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S++YWR FDDLRPYA+V+ VP IA+ +MA+ IPP YTHS+YWLW
Sbjct  140  RAGAKSLAPLVIAGALSIMYWRHFDDLRPYAVVQFVPCIALPVMAIVIPPMYTHSSYWLW  199

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  LLA++ E ADK IY  +   VSGHTLKH+  A++ V L LMLA+R  + ERISLL
Sbjct  200  AAGFYLLAKVEEAADKTIYNWTHQIVSGHTLKHLCAAMVPVFLALMLAKRTTEPERISLL  259

Query  140  QRWRMS  123
            Q+W+ S
Sbjct  260  QKWKTS  265



>emb|CDM86850.1| unnamed protein product [Triticum aestivum]
Length=294

 Score =   309 bits (792),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 191/259 (74%), Gaps = 1/259 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ + YHDFAD+R  F GIP TL+V SN PFL +GLAGL LC+Y NY ++
Sbjct  21   VVLMLVTPAIPQDEDYHDFADQRVLFLGIPNTLNVISNIPFLFVGLAGLILCHYKNYFRL  80

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
              QGE+  WT+FY G+  V  GSSYYHL PND  LVWDRLPM IA   I++IF+IERVD+
Sbjct  81   CSQGELWSWTLFYAGVTAVGVGSSYYHLYPNDATLVWDRLPMTIAFTSIVAIFIIERVDD  140

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S++YW  FDDLRPYA+++ VP I I +MA+ IPP YTHS+YWLW
Sbjct  141  RAGTKSLAPLVIAGALSILYWSFFDDLRPYAIIQFVPCIVIPVMAIVIPPMYTHSSYWLW  200

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  LLA++ E ADKPIY+ +   VSGHTLKH+  A++ V LTLMLA+R I+ +R+SLL
Sbjct  201  AAGFYLLAKVEEAADKPIYRWTHDIVSGHTLKHLCAAMVPVFLTLMLAKRTIEPDRVSLL  260

Query  140  QRWRMSSRNKAKENGTKVS  84
            Q W++S R +  ++   V 
Sbjct  261  QMWKISWRERGSKDSNTVD  279



>ref|NP_001148401.1| LOC100282016 [Zea mays]
 gb|ACG31344.1| membrane protein [Zea mays]
Length=295

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 186/246 (76%), Gaps = 1/246 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ +AYHDFAD+R  F GIP TL+V S+ PF  +G+ GL LC++ NY ++
Sbjct  20   VVLMLVTPAIPQDEAYHDFADQRTLFLGIPNTLNVISDIPFFFVGVTGLILCHFNNYFRL  79

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            S QGE+  WT+F+ G+  V FGSSYYHLNPND  LVWDRLPM IA   +++IF+IERVD+
Sbjct  80   SSQGELWSWTLFFAGVTAVGFGSSYYHLNPNDATLVWDRLPMTIAFTSVMAIFIIERVDD  139

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S++YWR FDDLRPYA+V+ VP IA+ +MA+ IPP YTHS+YWLW
Sbjct  140  RAGAKSLAPLVIAGALSIMYWRHFDDLRPYAVVQFVPCIALPVMAIVIPPMYTHSSYWLW  199

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  LLA++ E ADK IY  +   VSGHTLKH+  A++ V L LMLA+R  + ERISLL
Sbjct  200  AAGFYLLAKVEEAADKTIYNWTHQIVSGHTLKHLCAAMVPVFLALMLAKRTTEPERISLL  259

Query  140  QRWRMS  123
            Q+W+ S
Sbjct  260  QKWKTS  265



>gb|EEC72214.1| hypothetical protein OsI_05309 [Oryza sativa Indica Group]
Length=291

 Score =   303 bits (777),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 190/256 (74%), Gaps = 4/256 (2%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLA  711
            V  VA +   V+LML+TP IPQ + YHDFAD+R+ F GIP TL+V SN PF  +G+ GL 
Sbjct  10   VAWVAAVTIFVVLMLVTPAIPQNEEYHDFADQRRLFLGIPNTLNVISNIPFFFVGVVGLV  69

Query  710  LCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGIL  531
            LC+Y NY +++ QGE+  WT+F+ G+  VAFGSSYYHL PND  LVWDRLPM IA   ++
Sbjct  70   LCHYKNYFRLNSQGELWSWTLFFAGVTAVAFGSSYYHLKPNDATLVWDRLPMTIAFTSVM  129

Query  530  SIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPP  351
            +IF+IERVD++ G  S+ P ++ G  S+++   FDDLRPYA+++ VP IAI +MA+ IPP
Sbjct  130  AIFIIERVDDRAGTKSLAPLVIAGALSIMF---FDDLRPYAVIQFVPCIAIPVMAIVIPP  186

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
             YTHS+YWLWAAG  LLA++ E ADKPIYK +   VSGHTLKH+  A++ V L LMLA+R
Sbjct  187  MYTHSSYWLWAAGFYLLAKVEEAADKPIYKWTHQIVSGHTLKHLAAAMVPVFLALMLAKR  246

Query  170  DIQTERISLLQRWRMS  123
             ++ ER+SL QRW++ 
Sbjct  247  TVEPERVSLFQRWKVK  262



>gb|EMT21492.1| hypothetical protein F775_27479 [Aegilops tauschii]
Length=291

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 191/259 (74%), Gaps = 4/259 (2%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V+LML+TP IPQ + YHDFAD+R  F GIP TL+V SN PFL +GLAGL LC+Y NY ++
Sbjct  21   VVLMLVTPAIPQDEDYHDFADQRDLFLGIPNTLNVLSNIPFLFVGLAGLILCHYKNYFRL  80

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
              QGE+  WT+FY G+  V  GSSYYHL PND  LVWDRLPM IA   I++IF+IERVD+
Sbjct  81   CSQGELWSWTLFYAGVTAVGVGSSYYHLYPNDATLVWDRLPMTIAFTSIVAIFIIERVDD  140

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G  S+ P ++ G  S+++   FDDLRPYA+++ VP I I +MA+ IPP YTHS+YWLW
Sbjct  141  RAGTKSLAPLVIAGALSILF---FDDLRPYAVIQFVPCIVIPVMAIVIPPMYTHSSYWLW  197

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLL  141
            AAG  LLA++ E ADKPIY+ +   VSGHTLKH+  A++ V LTLMLA+R I+ +R+SLL
Sbjct  198  AAGFYLLAKVEEAADKPIYRWTHDIVSGHTLKHLCAAMVPVFLTLMLAKRTIEPDRVSLL  257

Query  140  QRWRMSSRNKAKENGTKVS  84
            Q W++S R +  ++G  V 
Sbjct  258  QMWKISWRERGSQDGNTVD  276



>ref|XP_004504135.1| PREDICTED: uncharacterized protein LOC101501512 [Cicer arietinum]
Length=258

 Score =   300 bits (767),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 182/244 (75%), Gaps = 0/244 (0%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA +  V LLM L+P IPQP+ YHDFADKR+FFGIP  L+V SNFPF+ IGL GL LC++
Sbjct  10   VAAVVSVFLLMKLSPPIPQPQKYHDFADKREFFGIPNALNVISNFPFIIIGLIGLMLCHH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
             NY   SLQGE+ GWT FY  + +V FGSSYYHL PND+ LVWDRLPM++A A +++I +
Sbjct  70   RNYFNFSLQGELWGWTCFYAAVTSVGFGSSYYHLGPNDNGLVWDRLPMSVAFASLMAILI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+D K G +SI P ++  + S +YWR F D+RPY +V+TV  +AI LMAL +PP YTH
Sbjct  130  IERIDVKIGTISIFPLIMAAMISSVYWRLFGDIRPYLLVQTVSCMAIPLMALLLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG   LA + E AD+ IY  + H VSGHTLKH+  A++ +ILT+MLA+R +  
Sbjct  190  STYWLWAAGFYPLAMLQETADRLIYAATFHTVSGHTLKHLSAAMVPLILTVMLAKRSVYL  249

Query  158  ERIS  147
            ER++
Sbjct  250  ERLA  253



>ref|XP_002298170.2| hypothetical protein POPTR_0001s21910g [Populus trichocarpa]
 gb|EEE82975.2| hypothetical protein POPTR_0001s21910g [Populus trichocarpa]
Length=263

 Score =   295 bits (755),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 175/228 (77%), Gaps = 7/228 (3%)
 Frame = -3

Query  833  RIPQPKAYHDFADKRK-FFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            RIP       FAD+R  FFGIP TL+V SNFPFL IG+ GL LC+Y NY ++ L GEV G
Sbjct  23   RIPH------FADQRDLFFGIPNTLNVVSNFPFLVIGVIGLVLCHYRNYFQLRLPGEVWG  76

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            WT F+ G+A VAFGS YYHL P+DDRLVWDRLPM +A   I++IF++ER+DE++G +SII
Sbjct  77   WTCFFVGVAAVAFGSGYYHLKPDDDRLVWDRLPMTVAFTSIVAIFILERIDERKGTVSII  136

Query  476  PSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLA  297
            P LL GV S+ YWR FDDLRPYA+V+ VP IAI LMA+ +PP YTHS YWLWAAG  LLA
Sbjct  137  PLLLAGVISIAYWRFFDDLRPYALVQFVPCIAIPLMAILLPPMYTHSLYWLWAAGFYLLA  196

Query  296  RIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTER  153
            ++ E ADKPIYK + H VSGHTLKH+  A++ V LTLMLA+R I+ ER
Sbjct  197  KVEEAADKPIYKWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRSIEIER  244



>gb|KHG07841.1| Putative alkaline ceramidase dcd3A [Gossypium arboreum]
Length=244

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 176/232 (76%), Gaps = 4/232 (2%)
 Frame = -3

Query  779  GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYH  600
            GIP TL+V SNFPFL IG+ GL LC+Y NY K SLQGE+ GWT F+ G+A V  GSSYYH
Sbjct  2    GIPNTLNVISNFPFLVIGVIGLVLCFYKNYFKFSLQGELWGWTCFFIGVAAVGVGSSYYH  61

Query  599  LNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDL  420
            L+PND RLVWDRLPM IA   I++IF+IER+DE++G +SIIP LL GV S+++   FDDL
Sbjct  62   LDPNDARLVWDRLPMTIAFTSIMAIFIIERIDEQKGTISIIPLLLAGVVSILF---FDDL  118

Query  419  RPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVS  240
            RPYA+V+ VP I I LMA+ +PP YTHSTYWLWAA   LLA++ E  DK IYK + H VS
Sbjct  119  RPYAVVQFVPCIVIPLMAILLPPMYTHSTYWLWAAAFYLLAKVEEAEDKVIYKWTHHIVS  178

Query  239  GHTLKHVFGAILAVILTLMLAQRDIQTERISLLQRWRMSSRNKAKENGTKVS  84
            GHTLKH+  A++ V LTLMLA+R  +T RISLL+ W++ S  K  ENGT+V 
Sbjct  179  GHTLKHLCAAMVPVFLTLMLAKRTTETNRISLLKTWKV-SWTKVNENGTRVE  229



>ref|XP_002987349.1| hypothetical protein SELMODRAFT_426141 [Selaginella moellendorffii]
 gb|EFJ11664.1| hypothetical protein SELMODRAFT_426141 [Selaginella moellendorffii]
Length=289

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 184/262 (70%), Gaps = 3/262 (1%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEV  663
            +TPRIPQ + YHDFAD R   GIP  L+V SNFPFL IG  G+ L   G   ++SL+GEV
Sbjct  22   VTPRIPQDQDYHDFADHRAMLGIPNALNVVSNFPFLVIGAVGMVLTLQGRSFRLSLEGEV  81

Query  662  LGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILS  483
            LGWT F+ G+A  AFGSSYYHL+P+D RLVWDRLPM I+   I+++FVIERVD++ G  S
Sbjct  82   LGWTWFFLGVAATAFGSSYYHLHPDDSRLVWDRLPMTISFTAIMAVFVIERVDDRTGKAS  141

Query  482  IIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLL  303
            + P L  G  SV YWR  DDLRPYA+V+ VP IAI +M L +PP+YTHS YWLWAAGC L
Sbjct  142  VFPLLAAGALSVAYWRFADDLRPYALVQFVPCIAIPVMTLTMPPQYTHSLYWLWAAGCYL  201

Query  302  LARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLLQRWRMS  123
            LA++ E +D  IY+ + H VSGHTLKH+  A++ V + +MLA+R+   +++ ++ + R  
Sbjct  202  LAKVAEASDNQIYRWTGHLVSGHTLKHLLAALVPVFIMIMLARREEAVDKVCIMTKLRNH  261

Query  122  SRNK---AKENGTKVS*HKQNI  66
            SR +    KE G++    + N+
Sbjct  262  SRVRRLCGKEEGSEQDDTEANL  283



>gb|KHN33456.1| hypothetical protein glysoja_005498 [Glycine soja]
Length=269

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 185/265 (70%), Gaps = 21/265 (8%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA++CF+ LLM++TP IPQ + YHDFAD R F GIP  L+V SNFPFL IGL GL LC++
Sbjct  11   VALVCFL-LLMIVTPAIPQSQEYHDFADHRTFLGIPNALNVISNFPFLVIGLVGLVLCHH  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GNY ++SLQGE+ GWT FY G+A VA GSSYYHL P+D RLVWDRLPM +A   I++IF+
Sbjct  70   GNYFRLSLQGELWGWTCFYVGVAAVAVGSSYYHLKPDDARLVWDRLPMTVAFTSIMAIFI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IER+DE++G +SIIP +L                    V+ VP I I LMA+ +PP YTH
Sbjct  130  IERIDERKGTVSIIPLVLA-------------------VQFVPCIVIPLMAILLPPMYTH  170

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            STYWLWAAG  LLA++ E  D  IY+ + H VSGHTLKH+  A++ V LT MLA+R ++ 
Sbjct  171  STYWLWAAGSYLLAKVLEATDDVIYEWAQHIVSGHTLKHLVAAMVPVFLTFMLAKRSVEP  230

Query  158  ERISLLQRWRMSSRNKAKENGTKVS  84
            ER SLL+ WR+ S  K +E  + + 
Sbjct  231  ERQSLLKTWRV-SWTKFREGNSNIE  254



>ref|XP_001765199.1| predicted protein [Physcomitrella patens]
 gb|EDQ69927.1| predicted protein [Physcomitrella patens]
Length=257

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 180/251 (72%), Gaps = 1/251 (0%)
 Frame = -3

Query  905  QGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIG  726
            +G  L+V GVA   F VL M++TP+IPQ + YH FAD+R FFGIP TL+V SNFPFL IG
Sbjct  6    RGQRLAVWGVAAFIFAVL-MIVTPKIPQDQKYHQFADRRNFFGIPNTLNVVSNFPFLVIG  64

Query  725  LAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIA  546
            + GL L  +GN   +SLQGE+LGW++F+ G+   AFGS+YYHL PND RLVWDRLPM +A
Sbjct  65   IVGLVLTLHGNSFGLSLQGELLGWSIFFLGVTATAFGSAYYHLKPNDARLVWDRLPMTVA  124

Query  545  LAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMA  366
             A ++++F+IER+DE  G  SI P L  G GSV YWR  +DLR YA+V+ VP  AI  MA
Sbjct  125  FASVMAVFIIERIDEATGKASIFPLLTAGAGSVAYWRFANDLRLYAIVQFVPCFAIPAMA  184

Query  365  LWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTL  186
            + +PP+Y+HS YWLWAAG  LLA+I E  D   Y+ +   VSGHTLKH+  A++ V+  +
Sbjct  185  ILLPPKYSHSHYWLWAAGWYLLAKIQEALDMKFYRWTYFIVSGHTLKHLSAAMVPVVTIV  244

Query  185  MLAQRDIQTER  153
            ML  R+++ ER
Sbjct  245  MLYCRNVRIER  255



>ref|XP_002989152.1| hypothetical protein SELMODRAFT_427788 [Selaginella moellendorffii]
 gb|EFJ09746.1| hypothetical protein SELMODRAFT_427788 [Selaginella moellendorffii]
Length=289

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 182/262 (69%), Gaps = 3/262 (1%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEV  663
            +TPRIPQ + YHDFAD R   GIP  L+V SNFPFL IG  G+ L   G   ++SL+GEV
Sbjct  22   VTPRIPQDQDYHDFADHRAMLGIPNALNVVSNFPFLVIGAVGMVLTLQGRSFRLSLEGEV  81

Query  662  LGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILS  483
            LGWT F+ G+A   FGSSYYHL+P+D RLVWDRLPM I+   I+++FVIERVD++ G  S
Sbjct  82   LGWTWFFLGVAATTFGSSYYHLHPDDSRLVWDRLPMTISFTAIMAVFVIERVDDRTGKAS  141

Query  482  IIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLL  303
            + P L  G  SV YWR  DDLRPYA+V+ VP IAI +M L +PP+YTHS YWLWAAG  L
Sbjct  142  VFPLLAAGALSVAYWRFADDLRPYALVQFVPCIAIPVMTLTMPPQYTHSLYWLWAAGFYL  201

Query  302  LARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLLQRWRMS  123
            LA++ E AD  IY+ + H VSGHTLKH+  A++ V + +MLA+R+   +++ ++ + R  
Sbjct  202  LAKVAEAADNQIYRWTGHLVSGHTLKHLLAALVPVFIMIMLARREEAVDKVCIMTKLRNH  261

Query  122  SRNK---AKENGTKVS*HKQNI  66
            SR +    KE G++    + N+
Sbjct  262  SRVRRLCGKEEGSEQDHTEANL  283



>ref|XP_006585253.1| PREDICTED: uncharacterized protein LOC100819917 [Glycine max]
Length=258

 Score =   285 bits (728),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 170/230 (74%), Gaps = 0/230 (0%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            TP IPQP+ YHDFADKR+FFGIP  L+V SNF F+ IGL GL LC+  NY  ISLQGE+ 
Sbjct  23   TPSIPQPQRYHDFADKREFFGIPNALNVISNFLFMVIGLIGLVLCHRMNYFNISLQGELW  82

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
            GWT FY  + +VAFGSSYYH  PND  LVWDRLPM++A A +L+I VIER+D K+G +SI
Sbjct  83   GWTCFYVAVTSVAFGSSYYHFGPNDAGLVWDRLPMSVAFASLLAILVIERIDAKKGTISI  142

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
            +  ++ G+ S +YWR F D+R Y + +    IAI LMA  +PP YTHS YWLWA+G  +L
Sbjct  143  VSLIMAGIMSNVYWRFFGDIRLYVLAQGASCIAIPLMATLLPPMYTHSAYWLWASGFYVL  202

Query  299  ARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERI  150
            A + E AD+ IY L+ H VSGHTLKH+  A++ +ILT+MLA+R + +E++
Sbjct  203  AMLQEAADRVIYLLTFHIVSGHTLKHLSAAMVPIILTVMLAKRSVYSEKL  252



>ref|XP_003565126.1| PREDICTED: uncharacterized protein LOC100824275 [Brachypodium 
distachyon]
Length=301

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 181/249 (73%), Gaps = 5/249 (2%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGN---Y  690
            V+LML+TP IPQ + YHDFAD+R  F GIP TL+V S  P  + G  G  L +Y     Y
Sbjct  24   VVLMLVTPAIPQDEDYHDFADQRDLFLGIPNTLNVVSTSPSFSSG-RGTHLVHYKTTLGY  82

Query  689  VKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIER  510
             ++  QGE+  WT+F+ G+  V FGSSYYHLNPN+  LVWDRLPM IA   I++IF+IER
Sbjct  83   FRLCSQGELWSWTLFFAGVTAVGFGSSYYHLNPNNATLVWDRLPMTIAFTSIMAIFIIER  142

Query  509  VDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTY  330
            VD++ G  S+ P +  G  S++YWR FDDLRPYA+++ VP IAI +MA+ IPP YTHS+Y
Sbjct  143  VDDRAGTKSLAPLVFAGALSILYWRFFDDLRPYAVIQFVPCIAIPVMAIVIPPMYTHSSY  202

Query  329  WLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERI  150
            WLWAAG  LLA++ E ADKPIY+ +   VSGHTLKH+  A++ V LTLMLA+R I+ ER+
Sbjct  203  WLWAAGFYLLAKVEEAADKPIYRWTHQIVSGHTLKHLCAAMVPVFLTLMLAKRTIEPERV  262

Query  149  SLLQRWRMS  123
            SLLQ W++S
Sbjct  263  SLLQMWKIS  271



>gb|KEH20750.1| alkaline phytoceramidase (APHC) [Medicago truncatula]
Length=253

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 172/238 (72%), Gaps = 1/238 (0%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+  F  L M LTP IPQP+ YHDFADKR+FFGIP  L+V SN PF+ IGL GL LC+ 
Sbjct  11   VAVASFY-LFMKLTPSIPQPQMYHDFADKRQFFGIPNALNVISNLPFMVIGLIGLMLCHR  69

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
             NY  +S QGE+ GWT FY  + +V FGS+YYHL PND+ LV DRLPM +A   +++I +
Sbjct  70   SNYFNLSSQGELWGWTCFYVAVTSVGFGSAYYHLGPNDNGLVCDRLPMTVAFTSLVAILI  129

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            IERVD K+G +SI P ++  + S +YWR F D+RPY +V+TV  IA+ LMAL +PP YTH
Sbjct  130  IERVDAKKGTISIFPLIMAAMISSVYWRFFGDIRPYLLVQTVSCIAVPLMALLLPPMYTH  189

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            STYWLWAAG   LA + E AD+ IY ++ H VSGH LKH+   ++ +ILT+MLA+R +
Sbjct  190  STYWLWAAGFYPLAMMQETADRLIYAVTFHTVSGHALKHLSAGMVPLILTIMLAKRRL  247



>gb|ADE76923.1| unknown [Picea sitchensis]
Length=303

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 178/259 (69%), Gaps = 1/259 (0%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            TP +PQ + YH FAD+R FF +P TL+V S FPFL IG+ G  LC +GNY  +SL+GEV 
Sbjct  27   TPTVPQSQDYHIFADRRNFF-VPNTLNVISIFPFLIIGVIGFVLCLHGNYFGLSLRGEVW  85

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
            GW  FY G+   AFGS+YYHL P+D RLV DRLP+ IA   I+ IF+IER+DE+ G  S+
Sbjct  86   GWLSFYAGVEATAFGSAYYHLKPDDARLVLDRLPVTIAFISIMVIFIIERIDERTGTASL  145

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
             P L +G+ S+ YWR FDDLRPY +V+ +P IAI  M++ +PP+YTHS YWLW+AG  LL
Sbjct  146  FPLLTLGIASIAYWRLFDDLRPYVLVQFIPFIAIPAMSILLPPKYTHSVYWLWSAGFFLL  205

Query  299  ARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLLQRWRMSS  120
            A I E  DK +YKL+ + +SGHTLKH+  A++ ++LT+ML++R I+ ER     R  +  
Sbjct  206  AEIAEATDKKLYKLTHYIISGHTLKHLSAAMVPILLTIMLSRRSIKIERAIWTLRPVIKE  265

Query  119  RNKAKENGTKVS*HKQNIN  63
             +K     ++V   ++  N
Sbjct  266  LSKPSSKDSRVQGERRRFN  284



>ref|XP_010471127.1| PREDICTED: uncharacterized protein LOC104750967 isoform X2 [Camelina 
sativa]
Length=248

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 176/264 (67%), Gaps = 42/264 (16%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G AI+ F+VL M++TP IPQ +AYHDFAD+R +FG                         
Sbjct  10   GAAIIIFIVL-MIVTPTIPQSQAYHDFADQRSYFG-------------------------  43

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
                           WT FY G+A VAFGSSYYHL+PND  L+WDRLPM IA   I++IF
Sbjct  44   ---------------WTCFYVGVAAVAFGSSYYHLHPNDATLLWDRLPMTIAFTSIMAIF  88

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            VIER+DE +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP YT
Sbjct  89   VIERIDEHKGTYSIVPLLLAGLISILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMYT  148

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA+R +Q
Sbjct  149  HSTYWLWAAGFYLLAKVEEAADKPIYSWTHHIISGHSLKHLCAAMVPVFLTLMLAKRTVQ  208

Query  161  TERISLLQRWRMSSRNKAKENGTK  90
            TERISL   W++ S  ++K NG++
Sbjct  209  TERISLYTTWKV-SWTRSKGNGSE  231



>gb|KHN29019.1| hypothetical protein glysoja_008354 [Glycine soja]
Length=262

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 168/230 (73%), Gaps = 3/230 (1%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            TP IPQP+ YHDFADKR+FFGIP  L+V SNF F+ IGL GL LC+  NY  ISLQGE+ 
Sbjct  23   TPSIPQPQRYHDFADKREFFGIPNALNVISNFLFMVIGLIGLVLCHRMNYFNISLQGELW  82

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
            GWT FY  + +VAFGSSYYH  PND  LVWDRLPM++A A +L+I VIER+D K+G +SI
Sbjct  83   GWTCFYVAVTSVAFGSSYYHFGPNDAGLVWDRLPMSVAFASLLAILVIERIDAKKGTISI  142

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
            +  ++ G+ S ++   F D+R Y + +    IAI LMA  +PP YTHS YWLWA+G  +L
Sbjct  143  VSLIMAGIMSNVF---FGDIRLYVLAQGASCIAIPLMATLLPPMYTHSAYWLWASGFYVL  199

Query  299  ARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERI  150
            A + E AD+ IY L+ H VSGHTLKH+  A++ +ILT+MLA+R + +E++
Sbjct  200  AMLQEAADRVIYLLTFHIVSGHTLKHLSAAMVPIILTVMLAKRSVYSEKL  249



>ref|NP_001185369.1| senescence associated protein 18 [Arabidopsis thaliana]
 gb|AEE35171.1| senescence associated protein 18 [Arabidopsis thaliana]
Length=240

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 173/266 (65%), Gaps = 41/266 (15%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            +S  G AIL F++L M++TP IPQ +AYH+FAD+R F                       
Sbjct  6    MSAWGSAILIFIIL-MIVTPTIPQSQAYHNFADQRSF-----------------------  41

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
                             LGWT FY G+A VAFGSSYYHL+PND  L+WDRLPM IA   I
Sbjct  42   -----------------LGWTCFYIGVAAVAFGSSYYHLHPNDATLLWDRLPMTIAFTSI  84

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            ++IFVIER+DE +G  SI P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +P
Sbjct  85   MAIFVIERIDEHKGTYSIAPLLLAGLVSILYWRFFDDLRPYALVQFVPCIVIPLMAILLP  144

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
            P YTHSTYWLWAAG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA+
Sbjct  145  PMYTHSTYWLWAAGFYLLAKVEEAADKPIYSWTHHIISGHSLKHLCAAMVPVFLTLMLAK  204

Query  173  RDIQTERISLLQRWRMSSRNKAKENG  96
            R +QTERISL + W+  S  +  E+ 
Sbjct  205  RTVQTERISLYKTWKKGSEEERFEHS  230



>ref|XP_007159691.1| hypothetical protein PHAVU_002G259100g [Phaseolus vulgaris]
 gb|ESW31685.1| hypothetical protein PHAVU_002G259100g [Phaseolus vulgaris]
Length=266

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 167/225 (74%), Gaps = 0/225 (0%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            +P IPQP+ YH+FAD R FFGI   L+V SNFPF+ IGL GL LC   NY  ISLQGE+ 
Sbjct  23   SPCIPQPQQYHNFADNRNFFGISNALNVLSNFPFMVIGLIGLVLCNRRNYFNISLQGELW  82

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
            GW  FY G+ +VAFGSSYYHL+P+D RL+WDR+PM +A A +++I +IER+D ++G  +I
Sbjct  83   GWRCFYAGVTSVAFGSSYYHLHPDDARLLWDRIPMTVAFASLMAILIIERIDVRKGTYAI  142

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
            +  +++G+ S +YWR F D+R Y + ++   IAI LMA ++PP YTHSTYWLWA+G  LL
Sbjct  143  VALIMMGIISNLYWRFFGDIRLYVLAQSSSCIAIPLMATFLPPMYTHSTYWLWASGFYLL  202

Query  299  ARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            A + E AD+ IY  + H VSGHTLKH+  A++ VILTLMLA+R +
Sbjct  203  AMLQEGADRVIYVSTFHIVSGHTLKHLSAAMVPVILTLMLAKRSV  247



>ref|XP_010471126.1| PREDICTED: uncharacterized protein LOC104750967 isoform X1 [Camelina 
sativa]
Length=247

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 153/196 (78%), Gaps = 1/196 (1%)
 Frame = -3

Query  677  LQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEK  498
            L+GE +GWT FY G+A VAFGSSYYHL+PND  L+WDRLPM IA   I++IFVIER+DE 
Sbjct  36   LRGEKIGWTCFYVGVAAVAFGSSYYHLHPNDATLLWDRLPMTIAFTSIMAIFVIERIDEH  95

Query  497  RGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWA  318
            +G  SI+P LL G+ S++YWR FDDLRPYA+V+ VP I I LMA+ +PP YTHSTYWLWA
Sbjct  96   KGTYSIVPLLLAGLISILYWRFFDDLRPYALVQFVPCIVIPLMAILLPPMYTHSTYWLWA  155

Query  317  AGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLLQ  138
            AG  LLA++ E ADKPIY  + H +SGH+LKH+  A++ V LTLMLA+R +QTERISL  
Sbjct  156  AGFYLLAKVEEAADKPIYSWTHHIISGHSLKHLCAAMVPVFLTLMLAKRTVQTERISLYT  215

Query  137  RWRMSSRNKAKENGTK  90
             W++ S  ++K NG++
Sbjct  216  TWKV-SWTRSKGNGSE  230



>ref|XP_007042236.1| Senescence associated gene 18 isoform 2, partial [Theobroma cacao]
 gb|EOX98067.1| Senescence associated gene 18 isoform 2, partial [Theobroma cacao]
Length=257

 Score =   253 bits (647),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 155/194 (80%), Gaps = 5/194 (3%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF----GIPYTLDVTSNFPFLAIGLAGL  714
            GVAIL FVVL M++TP IPQ + YHDFAD+R+FF    GIP TL+V SNFPFL IG+ GL
Sbjct  65   GVAILSFVVL-MIVTPAIPQSQEYHDFADQREFFVAFSGIPNTLNVVSNFPFLVIGVVGL  123

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
             LCYY NY K+ LQGE+ GWT F+ G+A V  GSSYYHL PND RLVWDRLPM IA   I
Sbjct  124  VLCYYKNYFKLCLQGELWGWTCFFIGVAAVGVGSSYYHLQPNDARLVWDRLPMTIAFTSI  183

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            ++IF+IER+DE++G +SIIP LL GV S++YWR FDDLRPYA+V+ VP IAI LMA+ +P
Sbjct  184  IAIFIIERIDEQKGTVSIIPLLLAGVISIMYWRFFDDLRPYALVQFVPCIAIPLMAILLP  243

Query  353  PRYTHSTYWLWAAG  312
            P YTHST+WLWAAG
Sbjct  244  PMYTHSTFWLWAAG  257



>ref|XP_010047343.1| PREDICTED: uncharacterized protein LOC104436306 [Eucalyptus grandis]
Length=268

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 166/247 (67%), Gaps = 1/247 (0%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYG  696
            A+LC++  LML TP+IP    +H +AD R F G+P TL+V +NFPFL +G+ G  LC  G
Sbjct  21   ALLCWL-FLMLATPKIPYSPKHHVYADMRNFLGVPNTLNVITNFPFLIVGVLGFVLCLQG  79

Query  695  NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVI  516
            +Y  +SLQGE+LGWT+FY GIA VAFGS+YYHL P+D RL+WD LPM IA + + S F++
Sbjct  80   SYFNVSLQGEILGWTLFYAGIAGVAFGSAYYHLKPDDSRLMWDTLPMMIAYSSLFSSFLV  139

Query  515  ERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHS  336
            ERV ++ G+  +   L     S  Y R F+DLR   M + +P + I  M L  PP+YTHS
Sbjct  140  ERVGKRTGLSFLSLLLFFSFLSAAYERTFNDLRLRMMFQLIPCVVIPFMTLLFPPKYTHS  199

Query  335  TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
             YWLWAAG  LL++    AD+ IY  + + +SGH+L+H+  A+L V+LT+ML  R ++ +
Sbjct  200  RYWLWAAGIYLLSKFEAFADRRIYHANSYIISGHSLEHLCLAMLPVLLTMMLLNRTLRFQ  259

Query  155  RISLLQR  135
            R+  L+ 
Sbjct  260  RLGSLKE  266



>ref|XP_009361937.1| PREDICTED: uncharacterized protein LOC103952133 [Pyrus x bretschneideri]
Length=269

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 170/263 (65%), Gaps = 1/263 (0%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T+Q   +G    + G A+LC+V LLML+TP+I     +H +AD R F G+P TL+V +NF
Sbjct  6    TQQLAIRGKRRRIWGGALLCWV-LLMLVTPKISHSPKHHLYADMRNFVGVPNTLNVITNF  64

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PFL +G+ G  LC  G    ISL GEV GW +FY G+A +AFGS+YYHL P+D R+ WD 
Sbjct  65   PFLVVGVLGFVLCVQGGLFNISLPGEVWGWALFYAGMAGLAFGSAYYHLKPDDIRVTWDT  124

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM IA + + S F++ERV E+ G+  +   L +   S+ Y R ++D+R Y M + +P +
Sbjct  125  LPMMIAYSSLFSSFMVERVGERIGLSCLFALLFIAFLSIAYDRTYNDIRLYMMFQLIPCL  184

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            AI  M+   PP+YTHS YWLWAAG  LLA+   +AD  IY  +   +SGH+L+H+   ++
Sbjct  185  AIPAMSFVFPPKYTHSRYWLWAAGVYLLAKFESVADGKIYHANRFIISGHSLEHLCLVMV  244

Query  203  AVILTLMLAQRDIQTERISLLQR  135
             V+L++ML  R+I+ +RI   + 
Sbjct  245  PVLLSIMLMNRNIKCQRIGTFKE  267



>gb|KCW79227.1| hypothetical protein EUGRSUZ_C00652 [Eucalyptus grandis]
Length=291

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 163/241 (68%), Gaps = 1/241 (0%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYG  696
            A+LC++  LML TP+IP    +H +AD R F G+P TL+V +NFPFL +G+ G  LC  G
Sbjct  21   ALLCWL-FLMLATPKIPYSPKHHVYADMRNFLGVPNTLNVITNFPFLIVGVLGFVLCLQG  79

Query  695  NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVI  516
            +Y  +SLQGE+LGWT+FY GIA VAFGS+YYHL P+D RL+WD LPM IA + + S F++
Sbjct  80   SYFNVSLQGEILGWTLFYAGIAGVAFGSAYYHLKPDDSRLMWDTLPMMIAYSSLFSSFLV  139

Query  515  ERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHS  336
            ERV ++ G+  +   L     S  Y R F+DLR   M + +P + I  M L  PP+YTHS
Sbjct  140  ERVGKRTGLSFLSLLLFFSFLSAAYERTFNDLRLRMMFQLIPCVVIPFMTLLFPPKYTHS  199

Query  335  TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
             YWLWAAG  LL++    AD+ IY  + + +SGH+L+H+  A+L V+LT+ML  R ++ +
Sbjct  200  RYWLWAAGIYLLSKFEAFADRRIYHANSYIISGHSLEHLCLAMLPVLLTMMLLNRTLRFQ  259

Query  155  R  153
            R
Sbjct  260  R  260



>ref|XP_007222903.1| hypothetical protein PRUPE_ppa009985mg [Prunus persica]
 gb|EMJ24102.1| hypothetical protein PRUPE_ppa009985mg [Prunus persica]
Length=269

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 168/263 (64%), Gaps = 1/263 (0%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T++   +G    + G A LC+V  LML+TP+I     +H +AD R F G+P TL+V +NF
Sbjct  6    TQKLAIRGKRRRIWGGAFLCWV-FLMLVTPKISHSPKHHLYADMRNFLGVPNTLNVITNF  64

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PFL +G+ G  LC  G    ISL GEV GW +FY GIA +AFGS+YYHL P+D R+ WD 
Sbjct  65   PFLVVGVLGFVLCCQGGLFNISLPGEVWGWALFYAGIAGLAFGSAYYHLKPDDSRVTWDT  124

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM IA + + S F++ERV E+ G+ S+   L +   S  Y R ++D+R Y M + +P I
Sbjct  125  LPMMIAYSSLFSSFIVERVGERIGLSSLFALLFIAFLSTAYDRTYNDIRLYMMFQLIPCI  184

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            AI  M    PP+YTHS YWLWA G  LL++   +AD  IY  + + +SGH+L+H+   ++
Sbjct  185  AIPGMCFVFPPKYTHSRYWLWAGGVYLLSKFEAVADMKIYHANHYIISGHSLEHLCLVMV  244

Query  203  AVILTLMLAQRDIQTERISLLQR  135
             V+L++ML  R+I+ +RI  ++ 
Sbjct  245  PVLLSIMLMHRNIKCQRIGAIKE  267



>ref|XP_002963991.1| hypothetical protein SELMODRAFT_166507 [Selaginella moellendorffii]
 gb|EFJ34324.1| hypothetical protein SELMODRAFT_166507 [Selaginella moellendorffii]
Length=235

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 156/235 (66%), Gaps = 0/235 (0%)
 Frame = -3

Query  848  MLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQG  669
            MLLTP I + ++ H FAD+R F G P TL+V S FP+L IG  G  LC  GNY   S QG
Sbjct  1    MLLTPAITKNQSQHAFADQRNFLGFPNTLNVFSTFPYLVIGCIGTVLCAQGNYFGFSSQG  60

Query  668  EVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI  489
            EV GWT F+ GI   AFGS+YYHL P+D R VWD LPMA A A I+++FV+E+ DE +G 
Sbjct  61   EVWGWTWFFVGITASAFGSAYYHLRPSDSRFVWDCLPMAYAFASIVAVFVVEKRDELKGP  120

Query  488  LSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGC  309
             S +P LL    +  YW   DD++ +A+++ +P +AI  M + +PP+YT S YW+WAAG 
Sbjct  121  KSFVPLLLAASATATYWWFADDMQLFALLQFIPSVAIPAMTVALPPKYTQSWYWMWAAGM  180

Query  308  LLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISL  144
             LLA++ E  D  +Y  +   VSGHT+KH+  A++ V L +MLA  +++ ER+++
Sbjct  181  YLLAKLAEAFDSRVYHWTRFLVSGHTVKHLSTAMVPVFLMIMLAPPNVKIERLTV  235



>ref|XP_008220479.1| PREDICTED: uncharacterized protein LOC103320560 [Prunus mume]
Length=269

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 168/263 (64%), Gaps = 1/263 (0%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T++   +G    + G A LC+V  LML+TP+I     +H +AD R F G+P TL+V +NF
Sbjct  6    TQKLAIKGVRRRIWGGAFLCWV-FLMLVTPKISHSPKHHLYADMRNFLGVPNTLNVITNF  64

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PFLA+G+ G  LC  G    ISL GEV GW +FY GIA +AFGS+YYHL P+D R+ WD 
Sbjct  65   PFLAVGVLGFVLCCQGGLFNISLPGEVWGWALFYAGIAGLAFGSAYYHLKPDDSRVTWDT  124

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM IA + + S F+IER+ E+ G+  +   L +   S  Y R ++D+R Y M + +P I
Sbjct  125  LPMMIAYSSLFSSFIIERMGERIGLSCLFALLFIACLSTAYDRTYNDIRLYMMFQLIPCI  184

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            AI  M    PP+YTHS YWLWA G  LL++   +AD  IY  + + +SGH+L+H+   ++
Sbjct  185  AIPGMCFVFPPKYTHSRYWLWAGGVYLLSKFEAVADMKIYHANHYIISGHSLEHLCLVMV  244

Query  203  AVILTLMLAQRDIQTERISLLQR  135
             V+L++ML  R+I+ +RI  ++ 
Sbjct  245  PVLLSIMLMHRNIKCQRIGAIKE  267



>ref|XP_008393638.1| PREDICTED: uncharacterized protein LOC103455822 [Malus domestica]
Length=269

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 168/263 (64%), Gaps = 1/263 (0%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T+Q   +G    + G A+LC+V LLML+TP+I     +H +AD R F G+P TL+V +NF
Sbjct  6    TQQLAIRGKRRRIWGGALLCWV-LLMLVTPKISHSPKHHLYADMRNFVGVPXTLNVITNF  64

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PFL +G+ G  LC  G    ISL GEV GW +FY G+A +AFGS+YYHL P+D R+ WD 
Sbjct  65   PFLVVGVLGFVLCXQGGLFNISLPGEVWGWALFYAGMAGLAFGSAYYHLKPDDSRVTWDT  124

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM IA + + S F++ERV E+ G+  +   L +   S+ Y R ++D+R   M + +P +
Sbjct  125  LPMMIAYSSLFSSFIVERVGERIGLSCLFALLFIAFLSIAYDRTYNDIRLSMMFQLIPCM  184

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            AI  M+   PP+YTHS YWLWAAG  LLA+   +AD  IY  +   +SGH+L H+   ++
Sbjct  185  AIPAMSFVFPPKYTHSRYWLWAAGVYLLAKFESVADGKIYHANRFIISGHSLGHLCLVMV  244

Query  203  AVILTLMLAQRDIQTERISLLQR  135
             V+L++ML  R+I+ +RI   + 
Sbjct  245  PVLLSIMLMNRNIKCQRIGAFKE  267



>ref|XP_004292793.1| PREDICTED: uncharacterized protein LOC101307374 [Fragaria vesca 
subsp. vesca]
Length=267

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 163/258 (63%), Gaps = 2/258 (1%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGV-AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSN  747
            TRQ   +G    + G  A LC+V LLML+TP+I     +H +AD R F G+P TL+V +N
Sbjct  8    TRQLSIKGKRRRIWGGGAFLCWV-LLMLVTPKISHSPNHHHYADMRNFLGVPNTLNVITN  66

Query  746  FPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWD  567
            FPFL +G+ G  LC  G +  ISL GEV GW +FY GIA +AFGS+YYHL P+D R+ WD
Sbjct  67   FPFLVVGVLGFVLCLQGGFFNISLPGEVWGWALFYAGIAGLAFGSAYYHLKPDDSRVTWD  126

Query  566  RLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPI  387
             LPM I L+ + S F++ERV E+ G+  +   L +   S  Y R  +D+R Y M E +P 
Sbjct  127  TLPMMITLSSLFSSFLVERVGERIGLSCLFALLFIAFLSTAYERTCNDIRLYMMFELIPC  186

Query  386  IAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAI  207
            IAI  M    PP+YTHS YWLWAAG  +L++    AD  IY  + + +SGH+L+H+   I
Sbjct  187  IAIPGMTFVFPPKYTHSRYWLWAAGAYILSKFEAFADMKIYHANQYTISGHSLEHLCLVI  246

Query  206  LAVILTLMLAQRDIQTER  153
            + V+L++ML  R  + +R
Sbjct  247  VPVLLSIMLMHRTRKCQR  264



>ref|XP_010103903.1| 3-ketoacyl-CoA synthase 7 [Morus notabilis]
 gb|EXB97344.1| 3-ketoacyl-CoA synthase 7 [Morus notabilis]
Length=641

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 152/243 (63%), Gaps = 54/243 (22%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVAI+CFVVL M++TP IPQ +AYHDFAD+R FFGIP  L+V SNFPFL IG+ GL LCY
Sbjct  10   GVAIVCFVVL-MIVTPAIPQSQAYHDFADQRTFFGIPNMLNVVSNFPFLVIGVIGLVLCY  68

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
            YGNY ++SLQGE+ GWT FY G+A VAFGSSYYHL PND RLVWDRLP            
Sbjct  69   YGNYFRLSLQGELWGWTCFYIGVAAVAFGSSYYHLKPNDARLVWDRLPF-----------  117

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
                                                      VP I I +MA+ +PP YT
Sbjct  118  ------------------------------------------VPCIVIPVMAILLPPMYT  135

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HSTYWLWAAG  LLA++ E ADK IY  + H VSGHTLKH+  A++ V LTLMLA+R +Q
Sbjct  136  HSTYWLWAAGFYLLAKVEEAADKVIYGWTHHIVSGHTLKHLCAAMVPVFLTLMLAKRTVQ  195

Query  161  TER  153
            T R
Sbjct  196  TNR  198



>ref|XP_008377686.1| PREDICTED: uncharacterized protein LOC103440765 isoform X1 [Malus 
domestica]
Length=269

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 165/258 (64%), Gaps = 1/258 (0%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T+Q   +G    + G A LC+V LL+L+TP+IP    +H +AD R   G+P TL+V +NF
Sbjct  6    TQQLAIRGKRRRIWGGAFLCWV-LLILVTPKIPHSPKHHLYADMRNLLGVPNTLNVITNF  64

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PFL +G  G  LC  G +  ISL GEV GW +FY G A VAFGS+YYHL P D R+ WD 
Sbjct  65   PFLVVGALGFVLCVQGGFFNISLPGEVWGWALFYAGTAGVAFGSAYYHLKPADSRVAWDT  124

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM IA + + S F++ER+  + G+  +   L +   S+ Y R  +D+R Y M + +P I
Sbjct  125  LPMMIAYSSLFSSFIVERLGGRIGLSCLFALLFIAFLSIAYDRTCNDIRLYMMFQLIPCI  184

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            AI  M+   PP+YTHS YWLWAAG  LL++   +ADK IY+ +   +SGH+L+H+   ++
Sbjct  185  AIPTMSSVFPPKYTHSRYWLWAAGVYLLSKFESVADKKIYRANHFIISGHSLEHLCLVMV  244

Query  203  AVILTLMLAQRDIQTERI  150
             V+L++ML  R I+ +RI
Sbjct  245  PVLLSIMLMNRKIKCQRI  262



>ref|XP_006826760.1| hypothetical protein AMTR_s00136p00077480 [Amborella trichopoda]
 gb|ERM93997.1| hypothetical protein AMTR_s00136p00077480 [Amborella trichopoda]
Length=609

 Score =   246 bits (627),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 170/251 (68%), Gaps = 1/251 (0%)
 Frame = -3

Query  905  QGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIG  726
            +G+   +C    LC+  L ML TPRIP    +H FAD R FFG+P TL+V +NFPFL +G
Sbjct  10   RGNRGRLCIAGFLCWACL-MLATPRIPHFPKHHLFADMRNFFGVPNTLNVITNFPFLVVG  68

Query  725  LAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIA  546
            + GL LC +GNY+ I L+GEV GW +FY GIA+ AFGS+YYHL P D R++WDRLP+ IA
Sbjct  69   VLGLVLCLHGNYLCICLRGEVWGWALFYAGIASTAFGSAYYHLKPEDSRVIWDRLPIMIA  128

Query  545  LAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMA  366
            L  +LS F+IER+DE+ G   ++P L + + S++Y + FDDLR   M   +P +AI  MA
Sbjct  129  LTSLLSSFIIERIDERIGFTCLLPLLTIDLASILYVQMFDDLRLCMMYHLIPCVAIPAMA  188

Query  365  LWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTL  186
               PP+YTHS YW WAAG  LLA+    AD+ IY  + + +SGH+L+H+   ++ + LT+
Sbjct  189  FVFPPKYTHSRYWFWAAGFYLLAKFEAAADRKIYSANRYIISGHSLEHLCLVMVPIFLTV  248

Query  185  MLAQRDIQTER  153
            ML  R+I+  R
Sbjct  249  MLLSRNIKIGR  259



>ref|XP_007012287.1| Alkaline phytoceramidase (aPHC) [Theobroma cacao]
 gb|EOY29906.1| Alkaline phytoceramidase (aPHC) [Theobroma cacao]
Length=269

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 171/263 (65%), Gaps = 2/263 (1%)
 Frame = -3

Query  920  RQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFP  741
             Q   +G    +CG+A+LC++   M++T +IP    +H FAD R F G+P TL+V +NFP
Sbjct  6    NQQVTRGRRCRICGIALLCWL-FFMMVTRKIPLSYRHHLFADMRNFLGVPNTLNVITNFP  64

Query  740  FLAIGLAGLALCYYG-NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            FL +G+ G  L   G ++  ISL+GEV GW +FY GIA+VAFGS+YYHL P+D+R +WD 
Sbjct  65   FLIVGVLGFVLSLGGGSFFNISLKGEVWGWLLFYGGIASVAFGSAYYHLKPDDNRAMWDT  124

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM IA + + S F++ER+ E+ G+  +   L++ V S  Y R F+DLR     + +P I
Sbjct  125  LPMMIAYSSLFSSFILERLGERIGLSCLFSLLVLAVLSTSYARTFNDLRLCMTFQLIPCI  184

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            A+ +M    PP+YTHS YWLW +G  +LA+I  LAD  IY+ + + +SGH+L+H+  AI 
Sbjct  185  ALPIMTFLFPPKYTHSGYWLWTSGVCILAKIEALADMKIYRANNYIISGHSLEHLCSAIA  244

Query  203  AVILTLMLAQRDIQTERISLLQR  135
             V+ T+ML  R  + +R+  ++ 
Sbjct  245  PVLFTVMLMHRSSRFQRLGEIKE  267



>ref|NP_001190292.1| Alkaline phytoceramidase (aPHC) [Arabidopsis thaliana]
 gb|AED91733.1| Alkaline phytoceramidase (aPHC) [Arabidopsis thaliana]
Length=270

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 174/265 (66%), Gaps = 3/265 (1%)
 Frame = -3

Query  929  TNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVT  753
            TN +  R +   + V G + LC+ ++ M +TP++P     +H FADKR F G+P TL+V 
Sbjct  5    TNQQIGRWKRKRILVVG-SFLCWSII-MFITPKVPLDSFRHHIFADKRNFMGVPNTLNVM  62

Query  752  SNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLV  573
            +NFPFL +G+ G  LC  G++  ISL GE+ GWT+FY GIA++AFGS++YHL P+D+R+V
Sbjct  63   TNFPFLIVGVLGFVLCIGGSFFNISLNGEIWGWTLFYAGIASLAFGSAFYHLKPDDNRIV  122

Query  572  WDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETV  393
            WD LP+ IA + + S F++ER  EK G+  +I  L +   SV Y R F+DLR     + +
Sbjct  123  WDTLPILIAYSSLFSSFLVERAGEKVGLSCLILLLFISCLSVAYARVFNDLRLCMTFQLI  182

Query  392  PIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG  213
            P + I +MA+ +PP+YTHS +WLWA     +A+I  LAD  IY  + + +SGH+L+H+  
Sbjct  183  PCLVIPVMAVLLPPKYTHSRFWLWATAAYTIAKIEGLADNKIYNANRYIISGHSLEHLCS  242

Query  212  AILAVILTLMLAQRDIQTERISLLQ  138
            A+  ++LT+ML  R I+  R+  L+
Sbjct  243  AVATLLLTIMLLYRSIRFNRLGDLK  267



>ref|NP_196748.1| Alkaline phytoceramidase (aPHC) [Arabidopsis thaliana]
 emb|CAB87660.1| putative protein [Arabidopsis thaliana]
 gb|AAR24227.1| At5g11870 [Arabidopsis thaliana]
 gb|AAR92361.1| At5g11870 [Arabidopsis thaliana]
 gb|AED91732.1| Alkaline phytoceramidase (aPHC) [Arabidopsis thaliana]
Length=262

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 171/260 (66%), Gaps = 3/260 (1%)
 Frame = -3

Query  929  TNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPK-AYHDFADKRKFFGIPYTLDVT  753
            TN +  R +   + V G + LC+ ++ M +TP++P     +H FADKR F G+P TL+V 
Sbjct  5    TNQQIGRWKRKRILVVG-SFLCWSII-MFITPKVPLDSFRHHIFADKRNFMGVPNTLNVM  62

Query  752  SNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLV  573
            +NFPFL +G+ G  LC  G++  ISL GE+ GWT+FY GIA++AFGS++YHL P+D+R+V
Sbjct  63   TNFPFLIVGVLGFVLCIGGSFFNISLNGEIWGWTLFYAGIASLAFGSAFYHLKPDDNRIV  122

Query  572  WDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETV  393
            WD LP+ IA + + S F++ER  EK G+  +I  L +   SV Y R F+DLR     + +
Sbjct  123  WDTLPILIAYSSLFSSFLVERAGEKVGLSCLILLLFISCLSVAYARVFNDLRLCMTFQLI  182

Query  392  PIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG  213
            P + I +MA+ +PP+YTHS +WLWA     +A+I  LAD  IY  + + +SGH+L+H+  
Sbjct  183  PCLVIPVMAVLLPPKYTHSRFWLWATAAYTIAKIEGLADNKIYNANRYIISGHSLEHLCS  242

Query  212  AILAVILTLMLAQRDIQTER  153
            A+  ++LT+ML  R I+  R
Sbjct  243  AVATLLLTIMLLYRSIRFNR  262



>ref|XP_002967933.1| hypothetical protein SELMODRAFT_145064 [Selaginella moellendorffii]
 gb|EFJ31280.1| hypothetical protein SELMODRAFT_145064 [Selaginella moellendorffii]
Length=261

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 153/232 (66%), Gaps = 0/232 (0%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            TP I + ++ H FAD+R F G P TL+V S FP+L IG  G  LC  GNY   S QGEV 
Sbjct  30   TPAITKNQSQHAFADQRNFLGFPNTLNVFSTFPYLVIGCIGTVLCAQGNYFGFSSQGEVW  89

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
            GWT F+ GI   AFGS+YYHL P+D R VWD LPMA A A I+++FV+E+ DE +G  S 
Sbjct  90   GWTWFFVGITASAFGSAYYHLRPSDSRFVWDCLPMAYAFASIVAVFVVEKRDELKGPKSF  149

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
            +P LL    +  YW   DD++ +A+++ +P +AI  M + +PP+YT S YW+WAAG  LL
Sbjct  150  VPLLLAASATATYWWFADDMQLFALLQFIPSVAIPAMTVALPPKYTQSWYWMWAAGMYLL  209

Query  299  ARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISL  144
            A++ E  D  +Y  +   VSGHT+KH+  A++ V L +MLA  +++ ER+++
Sbjct  210  AKLAEAFDSRVYHWTRFLVSGHTVKHLSTAMVPVFLMIMLAPPNVKIERLTV  261



>ref|XP_002871502.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47761.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 172/260 (66%), Gaps = 3/260 (1%)
 Frame = -3

Query  929  TNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPK-AYHDFADKRKFFGIPYTLDVT  753
            TN +  R +   + V G + LC++++ M +TP++P     +H FADKR F G+P TL+V 
Sbjct  5    TNQQIGRWKRKRILVVG-SFLCWLII-MFITPKVPLDSFRHHIFADKRNFMGVPNTLNVM  62

Query  752  SNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLV  573
            +NFPFL IG+ G  LC  G++  ISL+GE+ GWT+FY GIA++AFGS++YHL P+D+R+V
Sbjct  63   TNFPFLIIGVLGFVLCIGGSFFNISLKGEIWGWTLFYAGIASLAFGSAFYHLKPDDNRIV  122

Query  572  WDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETV  393
            WD LP+ IA + + S F++ER  E  G+  +I  L + + SV Y R F+DLR     + +
Sbjct  123  WDTLPILIAYSSLFSSFLVERAGEIVGLSCLIVLLFISLFSVAYARVFNDLRLCMTFQLI  182

Query  392  PIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG  213
            P +AI +M + +PP+Y+HS +WLWA     +ARI  LAD  IY  + + +SGH+L+H+  
Sbjct  183  PCLAIPVMTVLLPPKYSHSRFWLWATAAYTIARIEGLADSKIYNANRYIISGHSLEHLCS  242

Query  212  AILAVILTLMLAQRDIQTER  153
            A   ++LT+ML  R I+  R
Sbjct  243  AAATLLLTIMLCCRSIRLNR  262



>ref|XP_010242225.1| PREDICTED: uncharacterized protein LOC104586633 [Nelumbo nucifera]
Length=267

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 168/250 (67%), Gaps = 1/250 (0%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G A LC+V L ML TP+IP    +H FAD R F G+P TL+V SNFPFL +G+ GL LC 
Sbjct  18   GGAFLCWVCL-MLTTPKIPHSPKHHVFADMRNFLGVPNTLNVISNFPFLVVGVLGLVLCL  76

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
             G+   ISL+GEV GW  FY G+  +AFGS+YYHL P+DDR++WDRLPM +A A + S F
Sbjct  77   QGSLFAISLRGEVWGWAFFYAGVTAMAFGSAYYHLKPDDDRVLWDRLPMMVAYASLFSSF  136

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IERV E+ G++S+   LL+ + S+ Y R F+DLR   M   +P IAI  M    PP+YT
Sbjct  137  IIERVGERVGLISLFLLLLMSLASIAYERSFNDLRLCMMFHLIPCIAIPTMTFVFPPKYT  196

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            HS YWLWAAG  LLA+   + D+ IY  + + +SGH+L+H+   ++ V+L++ML  R I+
Sbjct  197  HSRYWLWAAGVYLLAKFEGIVDRKIYGSNHYIISGHSLEHLCLVMIPVLLSMMLIYRSIK  256

Query  161  TERISLLQRW  132
              R+  L+ W
Sbjct  257  IPRLGELKEW  266



>ref|XP_010262108.1| PREDICTED: uncharacterized protein LOC104600710 isoform X1 [Nelumbo 
nucifera]
Length=267

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 167/258 (65%), Gaps = 1/258 (0%)
 Frame = -3

Query  908  PQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAI  729
            P G    + G A LC+V L ML  P+IP     H FAD R F G+P TL+V SNFPFL +
Sbjct  9    PCGKRTRLWGGAFLCWVCL-MLAMPKIPHSPKQHVFADMRNFLGVPNTLNVISNFPFLVV  67

Query  728  GLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAI  549
            G+ GL LC  G++  ISL+GEV GW  FY  IA +AFGS+YYHL P+D+R++WDRLP  I
Sbjct  68   GVLGLVLCLQGSFSAISLRGEVWGWAFFYAAIAGMAFGSAYYHLKPDDNRVLWDRLPKMI  127

Query  548  ALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLM  369
            A A + S  +IERV E  GI+ +   LL+ + S+ Y R FDDLR   + + +P +AI  M
Sbjct  128  AFASLFSCCIIERVGETIGIICLFLLLLLALASIAYERMFDDLRLCMLFQLIPCVAIPSM  187

Query  368  ALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILT  189
            +   PP+YTHS YWLW  G  LLA    LAD+ IY+ + + +SGH+L+H+   ++ V+L+
Sbjct  188  SFVFPPKYTHSRYWLWTTGVYLLAEFEALADRKIYRTNHYIISGHSLEHLCLVMVPVLLS  247

Query  188  LMLAQRDIQTERISLLQR  135
            +ML  R+I+  R+  L+ 
Sbjct  248  VMLMHRNIKVTRLGGLKE  265



>ref|XP_010262111.1| PREDICTED: uncharacterized protein LOC104600710 isoform X3 [Nelumbo 
nucifera]
Length=264

 Score =   226 bits (576),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 170/263 (65%), Gaps = 7/263 (3%)
 Frame = -3

Query  908  PQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAI  729
            P G    + G A LC+V L ML  P+IP     H FAD R F G+P TL+V SNFPFL +
Sbjct  9    PCGKRTRLWGGAFLCWVCL-MLAMPKIPHSPKQHVFADMRNFLGVPNTLNVISNFPFLVV  67

Query  728  GLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAI  549
            G+ GL LC  G++  ISL+GEV GW  FY  IA +AFGS+YYHL P+D+R++WDRLP  I
Sbjct  68   GVLGLVLCLQGSFSAISLRGEVWGWAFFYAAIAGMAFGSAYYHLKPDDNRVLWDRLPKMI  127

Query  548  ALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLM  369
            A A + S  +IERV E  GI+ +   LL+ + S+ Y R FDDLR   + + +P +AI  M
Sbjct  128  AFASLFSCCIIERVGETIGIICLFLLLLLALASIAYERMFDDLRLCMLFQLIPCVAIPSM  187

Query  368  ALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILT  189
            +   PP+YTHS YWLW  G  LLA    LAD+ IY+ + + +SGH+L+H+   ++ V+L+
Sbjct  188  SFVFPPKYTHSRYWLWTTGVYLLAEFEALADRKIYRTNHYIISGHSLEHLCLVMVPVLLS  247

Query  188  LMLAQRDIQTERISLLQRWRMSS  120
            +ML  R+I+      + RWR+++
Sbjct  248  VMLMHRNIK------VTRWRLNN  264



>ref|XP_006450848.1| hypothetical protein CICLE_v10009178mg [Citrus clementina]
 ref|XP_006475922.1| PREDICTED: uncharacterized protein LOC102625263 [Citrus sinensis]
 gb|ESR64088.1| hypothetical protein CICLE_v10009178mg [Citrus clementina]
Length=271

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 155/242 (64%), Gaps = 1/242 (0%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYG  696
            A LC ++  ML TP+ P  +  H FAD R FFG+P TL+V SNFPFL  G+ G  L   G
Sbjct  21   AFLC-LLFFMLATPKFPSSRESHLFADLRNFFGVPNTLNVLSNFPFLIAGVMGFVLTLQG  79

Query  695  NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVI  516
             +  IS +GEV GW +FY GI  VAFGS+YYHL P+DDR++WD LPM IA A + S  + 
Sbjct  80   IFFNISFRGEVWGWALFYAGITGVAFGSAYYHLKPDDDRVMWDTLPMMIAYASLFSSLLA  139

Query  515  ERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHS  336
            ERVD K G+  +I  + V   S+IY R F+D R     + +P IAI ++    PP+YTHS
Sbjct  140  ERVDAKIGLSCLIALVSVSFLSMIYARTFNDFRLCMTFQLIPTIAIPVVTFLFPPKYTHS  199

Query  335  TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
              WL+A G  LLA+    AD+ IY  + + +SGH+L+H+  AI+ V+L++ML  RD + +
Sbjct  200  RCWLYATGFYLLAKFEAAADRKIYSKTHYIISGHSLEHLCSAIVPVLLSVMLMYRDTKFQ  259

Query  155  RI  150
            R+
Sbjct  260  RL  261



>ref|XP_010491937.1| PREDICTED: uncharacterized protein LOC104769421 [Camelina sativa]
Length=267

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYG  696
            + +C++++ M +TP++P    +H FADKR F G+P TL+V +NFPFL IG+ G  LC  G
Sbjct  22   SFMCWLII-MFITPKVPL--RHHLFADKRNFMGVPNTLNVITNFPFLIIGVLGFVLCLGG  78

Query  695  NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVI  516
            ++  ISL+GE+ GWT+FY GIA+ AFGS++YHL P+D+R+VWD LP+ IA + + S F++
Sbjct  79   SFFNISLKGEIWGWTLFYAGIASFAFGSAFYHLKPDDNRIVWDTLPILIAYSSLFSSFLV  138

Query  515  ERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHS  336
            ER  E+ G+  +I  L     S+ Y R F+DLR     + +P + I +M + +PP+YTHS
Sbjct  139  ERAGERVGLSCLILLLFTSFLSIAYARVFNDLRLCMTFQLIPCLVIPVMTVLLPPKYTHS  198

Query  335  TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
             +WLWA     +A+I  LAD  IY  + + +SGH+L H+  A+  ++LT+ML  R I+  
Sbjct  199  RFWLWATAAYAIAKIQGLADNKIYNTNRYIISGHSLGHLCSAVATLLLTIMLLYRSIRFH  258

Query  155  RISLLQ  138
            R+  L+
Sbjct  259  RLGDLK  264



>gb|KDO80113.1| hypothetical protein CISIN_1g024361mg [Citrus sinensis]
Length=268

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 154/241 (64%), Gaps = 1/241 (0%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYG  696
            A LC ++  ML TP+ P  +  H FAD R FFG+P TL+V SNFPFL  G+ G  L   G
Sbjct  21   AFLC-LLFFMLATPKFPSSRESHLFADLRNFFGVPNTLNVLSNFPFLIAGVMGFVLTLQG  79

Query  695  NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVI  516
             +  IS +GEV GW +FY GI  VAFGS+YYHL P+DDR++WD LPM IA A + S  + 
Sbjct  80   IFFNISFRGEVWGWALFYAGITGVAFGSAYYHLKPDDDRVMWDTLPMMIAYASLFSSLLA  139

Query  515  ERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHS  336
            ERVD K G+  +I  + V   S+IY R F+D R     + +P IAI ++    PP+YTHS
Sbjct  140  ERVDAKIGLSCLIALVSVSFLSMIYARTFNDFRLCMTFQLIPTIAIPVVTFLFPPKYTHS  199

Query  335  TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
              WL+A G  LLA+    AD+ IY  + + +SGH+L+H+  AI+ V+L++ML  RD + +
Sbjct  200  RCWLYATGFYLLAKFEAAADRKIYSKTHYIISGHSLEHLCSAIVPVLLSVMLMYRDTKFQ  259

Query  155  R  153
            R
Sbjct  260  R  260



>ref|XP_010519849.1| PREDICTED: uncharacterized protein LOC104799163 isoform X1 [Tarenaya 
hassleriana]
Length=269

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 163/247 (66%), Gaps = 2/247 (1%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            + LC++  +M +TP++P    ++H FADKR F G+P TL+V +NFPFL +G+ G  LC  
Sbjct  21   SFLCWL-FVMFITPKVPLSSPSHHVFADKRNFLGVPNTLNVMTNFPFLIVGVLGFVLCIG  79

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            G +  ISL+GE+ GW +FY G+A +AFGS+YYHL  +D+R++WD LP+ IA + + S F+
Sbjct  80   GGFFTISLKGEIWGWVLFYAGVAGLAFGSAYYHLKSDDNRIIWDTLPILIAYSSLFSSFL  139

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            +ER  E+ G+  ++  L +   S+ Y   F+DLR     + +P +AI ++ + +PP+YTH
Sbjct  140  VERAGERAGLCCLVSLLFIAFLSIAYAGVFNDLRLCMTFQLIPFVAIPVLTILLPPKYTH  199

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            S YWLWA+G  +L+ I  LAD  IY  + + +SGH+L H+  A   ++LT+ML  R I+ 
Sbjct  200  SKYWLWASGAYILSGIENLADSKIYNANRYLISGHSLGHLCSAAAPILLTIMLLYRSIRF  259

Query  158  ERISLLQ  138
             R+  L+
Sbjct  260  HRLGDLK  266



>ref|XP_009121908.1| PREDICTED: uncharacterized protein LOC103846687 [Brassica rapa]
Length=270

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 166/249 (67%), Gaps = 2/249 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALC  705
            G  ++C+++L M  TP++P     +H FADKR F G+P TL+V +NFPFL IG+ G  LC
Sbjct  20   GSLLICWLIL-MFFTPKVPLHSFRHHVFADKRNFMGVPNTLNVMTNFPFLIIGVLGFVLC  78

Query  704  YYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
              G++  ISL+GE+ GWT+FY  ++++AFGS+YYHL P+D+R+VWD LP+ IA + + S 
Sbjct  79   LGGSFFNISLKGEIWGWTLFYASVSSLAFGSAYYHLKPDDNRIVWDTLPILIAYSSLFSS  138

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            F++ER  E+ G+  ++  L + V SV Y R F+DLR     + +P + I +M + +PP+Y
Sbjct  139  FLVERAGERVGLSCLVLLLFISVFSVAYARVFNDLRLCLTFQLIPCLVIPVMTVLLPPKY  198

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THS +WL A     +++I  LAD  IY  + + +SGH+L H+  A+  V+LT+ML  R I
Sbjct  199  THSRFWLLATAAHAVSKIEGLADSKIYNFNGYTISGHSLGHLCSALAMVLLTVMLLYRSI  258

Query  164  QTERISLLQ  138
            +  R+S L+
Sbjct  259  RFPRLSELK  267



>ref|XP_010262110.1| PREDICTED: uncharacterized protein LOC104600710 isoform X2 [Nelumbo 
nucifera]
Length=266

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 168/258 (65%), Gaps = 2/258 (1%)
 Frame = -3

Query  908  PQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAI  729
            P G    + G A LC+V L ML  P+IP     H FAD R F G+P TL+V SNFPFL +
Sbjct  9    PCGKRTRLWGGAFLCWVCL-MLAMPKIPHSPKQHVFADMRNFLGVPNTLNVISNFPFLVV  67

Query  728  GLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAI  549
            G+ GL LC  G++  ISL+GEV GW  FY  IA +AFGS+YYHL P+D+R++WDRLPM I
Sbjct  68   GVLGLVLCLQGSFSAISLRGEVWGWAFFYAAIAGMAFGSAYYHLKPDDNRVLWDRLPM-I  126

Query  548  ALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLM  369
            A A + S  +IERV E  GI+ +   LL+ + S+ Y R FDDLR   + + +P +AI  M
Sbjct  127  AFASLFSCCIIERVGETIGIICLFLLLLLALASIAYERMFDDLRLCMLFQLIPCVAIPSM  186

Query  368  ALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILT  189
            +   PP+YTHS YWLW  G  LLA    LAD+ IY+ + + +SGH+L+H+   ++ V+L+
Sbjct  187  SFVFPPKYTHSRYWLWTTGVYLLAEFEALADRKIYRTNHYIISGHSLEHLCLVMVPVLLS  246

Query  188  LMLAQRDIQTERISLLQR  135
            +ML  R+I+  R+  L+ 
Sbjct  247  VMLMHRNIKVTRLGGLKE  264



>ref|XP_010419768.1| PREDICTED: uncharacterized protein LOC104705454 [Camelina sativa]
Length=267

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 170/264 (64%), Gaps = 4/264 (2%)
 Frame = -3

Query  929  TNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTS  750
            T+ +  R +   + V G + LC++++ M +TP++P    +H FADKR F G+P TL+V +
Sbjct  5    TDQQIGRWKRKRILVIG-SFLCWLII-MFITPKVPL--RHHLFADKRNFMGVPNTLNVIT  60

Query  749  NFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVW  570
            NFPFL IG+ G  LC  G++  IS +GE+ GWT+FY GIA+ AFGS++YHL P+D R+VW
Sbjct  61   NFPFLIIGVLGFVLCLGGSFFNISFKGEIWGWTLFYAGIASFAFGSAFYHLKPDDSRIVW  120

Query  569  DRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVP  390
            D LP+ IA + + S F++ER  E  G+  ++  L     SV Y R F+DLR     + +P
Sbjct  121  DTLPILIAYSSLFSSFLVERAGETVGLSCLVLLLFTSFLSVAYARVFNDLRLCMTFQLIP  180

Query  389  IIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
             + I +M + +PP+YTHS +WLWA     +A+I  LAD  IY  + + +SGH+L+H+  A
Sbjct  181  CLVIPVMTVLLPPKYTHSRFWLWATAAYAIAKIEGLADNKIYNANRYIISGHSLEHLCSA  240

Query  209  ILAVILTLMLAQRDIQTERISLLQ  138
            +  ++LT+ML  R I+  R+  L+
Sbjct  241  VATLLLTIMLLYRSIRFHRLGDLK  264



>emb|CDX97150.1| BnaC09g44750D [Brassica napus]
Length=270

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 166/249 (67%), Gaps = 2/249 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALC  705
            G   +C+++L M  TP++P     +H FADKR F G+P TL+V +NFPFL IG+ G  LC
Sbjct  20   GSLFICWLIL-MFFTPKVPLHSFRHHVFADKRNFMGVPNTLNVMTNFPFLIIGVLGFVLC  78

Query  704  YYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
              G++  ISL+GE+ GWT+FY  ++++AFGS+YYHL P+D+R+VWD LP+ IA + + S 
Sbjct  79   LGGSFFNISLKGEIWGWTLFYASVSSLAFGSAYYHLKPDDNRIVWDTLPILIAYSSLFSS  138

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            F++ER  E+ G+  ++  L + V SV Y R F+DLR     + +P +AI +M + +PP+Y
Sbjct  139  FLVERAGERVGLSCLVLLLFISVLSVAYARVFNDLRLCLTFQLIPCLAIPVMTVLLPPKY  198

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THS +WL A     +++I  LAD  IY  + + +SGH+L H+  A+  ++LT+ML  R I
Sbjct  199  THSRFWLLATAAHAVSKIEGLADSKIYNFNGYTISGHSLGHLCSALAMLLLTVMLLYRSI  258

Query  164  QTERISLLQ  138
            +  R+S L+
Sbjct  259  RFPRLSELK  267



>ref|XP_010453247.1| PREDICTED: uncharacterized protein LOC104735201 [Camelina sativa]
Length=267

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 170/264 (64%), Gaps = 4/264 (2%)
 Frame = -3

Query  929  TNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTS  750
            T+ +  R +   + V G + LC++++ M +TP++P    +H FADKR F G+P TL+V +
Sbjct  5    TDQQIGRWKRKRILVVG-SFLCWLII-MFITPKVPL--RHHLFADKRNFMGVPNTLNVIT  60

Query  749  NFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVW  570
            NFPFL IG+ G  LC  G++  ISL+GE+ GWT+FY GIA+ AFGS++YHL P+D+R+VW
Sbjct  61   NFPFLIIGVLGFVLCLGGSFFNISLKGEIWGWTLFYAGIASFAFGSAFYHLKPDDNRIVW  120

Query  569  DRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVP  390
            D LP+ IA + + S F++ER  E  G+  +   L     SV Y R F+DLR     + +P
Sbjct  121  DTLPILIAYSSLFSSFLVERAGETVGLSCLALLLFTSFLSVAYARVFNDLRLCMTFQLIP  180

Query  389  IIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
             + I +M + +PP+YTHS +WLWA     +A+I  LAD  IY  + + +SGH+L H+  A
Sbjct  181  CLVIPVMTVLLPPKYTHSRFWLWATAAYAIAKIEGLADHKIYNANRYIISGHSLGHLCSA  240

Query  209  ILAVILTLMLAQRDIQTERISLLQ  138
            +  ++LT+ML  R I+  R+  L+
Sbjct  241  VATLLLTIMLLYRSIRFHRLGDLK  264



>ref|XP_006286801.1| hypothetical protein CARUB_v10003547mg [Capsella rubella]
 gb|EOA19699.1| hypothetical protein CARUB_v10003547mg [Capsella rubella]
Length=270

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 170/265 (64%), Gaps = 3/265 (1%)
 Frame = -3

Query  929  TNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVT  753
            T+ +  R +   + V G + LC++ ++M +TP++P     +H FADKR F G+P TL+V 
Sbjct  5    TDQQIGRWKRKRILVVG-SFLCWL-MIMFITPKVPLDSFRHHVFADKRNFMGVPNTLNVM  62

Query  752  SNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLV  573
            +NFPFL IG+ G  LC  G++  ISL+GE+ GWT+FY GIA+ AFGS++YHL P+D R+V
Sbjct  63   TNFPFLIIGVLGFVLCIGGSFFSISLKGEIWGWTLFYAGIASFAFGSAFYHLKPDDSRIV  122

Query  572  WDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETV  393
            WD LP+ IA + + S F++ERV +  G+  +   L     SV Y R F+DLR     + +
Sbjct  123  WDTLPILIAYSSLFSSFLVERVGDTVGLSCLALLLFTSFLSVAYARVFNDLRLCMTFQLL  182

Query  392  PIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG  213
            P + I +M + +PP+YTHS +WLWA     +A+I  LAD  IY  + + +SGH+L H+  
Sbjct  183  PCLVIPVMTVLLPPKYTHSRFWLWATAAYTIAKIEGLADNKIYNANRYIISGHSLGHLCS  242

Query  212  AILAVILTLMLAQRDIQTERISLLQ  138
            A+  ++LT+ML  R I+  R+  L+
Sbjct  243  AVATLLLTIMLLYRSIRFHRLGDLK  267



>ref|XP_006399706.1| hypothetical protein EUTSA_v10014390mg [Eutrema salsugineum]
 gb|ESQ41159.1| hypothetical protein EUTSA_v10014390mg [Eutrema salsugineum]
Length=269

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 168/247 (68%), Gaps = 2/247 (1%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            + LC+++L M +TP++P     +H FADKR F G+P TL+V +NFPFL IG+ G  LC  
Sbjct  21   SFLCWLIL-MFITPKVPLNSLRHHVFADKRNFMGVPNTLNVMTNFPFLIIGVLGFVLCIG  79

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            G++  ISL+GE+ GWT+FY GIA++AFGS+YYHL P+D+R+VW+ LP+ IA + + S F+
Sbjct  80   GSFFNISLKGEIWGWTLFYGGIASLAFGSAYYHLKPDDNRIVWETLPILIAYSSLFSSFL  139

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            +ER  EK G+  ++  + +   SV Y R F+DLR     + +P +AI +M + +PP+YTH
Sbjct  140  VERAGEKVGLSCLVLLVFISFLSVAYARVFNDLRLCMTFQLIPCLAIPVMTVLLPPKYTH  199

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            S +WLWA     +A+I  LAD  IY  + + +SGH+L H+  A+  ++LTLML  R I+ 
Sbjct  200  SRFWLWATAAYAVAKIEGLADNKIYNANRYIISGHSLGHLCSAVAVLLLTLMLLYRSIRF  259

Query  158  ERISLLQ  138
            +R+  L+
Sbjct  260  QRLGDLK  266



>ref|XP_011019458.1| PREDICTED: uncharacterized protein LOC105122195 [Populus euphratica]
 ref|XP_011019459.1| PREDICTED: uncharacterized protein LOC105122195 [Populus euphratica]
Length=272

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 155/247 (63%), Gaps = 1/247 (0%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYG  696
            A+LC++   M++TP+I        FAD R F G+P TL+V +NFPFL +G+ G  L   G
Sbjct  23   ALLCWLCF-MVVTPKITLSHKPLQFADMRNFLGVPNTLNVITNFPFLLVGVVGFVLSLQG  81

Query  695  NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVI  516
             +  ISL+GEV GW +FY GI  +AFGS+YYHL P+D R++WD LPM IA + + S F+ 
Sbjct  82   CFFNISLKGEVWGWALFYGGIVGLAFGSAYYHLKPDDSRVMWDTLPMMIAYSSLFSSFMA  141

Query  515  ERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHS  336
            ERV ++ G+  +   L   + S  Y R F+DLR   M + +P +AI  M    PP+YTHS
Sbjct  142  ERVGQRAGLSCLFGLLFAVLFSTAYARTFNDLRLCMMFQLIPCVAIPAMTFLYPPKYTHS  201

Query  335  TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
             YWLWAAG  LLA+  +  DK IY  + + +SGH+L+H+  A + V+  +ML  R I+ +
Sbjct  202  RYWLWAAGVCLLAKFEDALDKKIYNANWYLISGHSLEHLCSAAIPVLFAIMLIHRTIRCQ  261

Query  155  RISLLQR  135
            R+  L+ 
Sbjct  262  RLGDLKE  268



>gb|KFK25448.1| hypothetical protein AALP_AA8G116500 [Arabis alpina]
Length=241

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 158/238 (66%), Gaps = 1/238 (0%)
 Frame = -3

Query  848  MLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQ  672
            M +TP++P     +H FADKR F G+P TL+V +NFPFL IG+ G  LC  G++  ISL+
Sbjct  1    MFVTPKVPLNSLRHHVFADKRNFMGVPNTLNVMTNFPFLIIGVLGFVLCIGGSFFNISLK  60

Query  671  GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
            GE+ GWTVFY GIA+ AFGS+YYHL P+D+RLV D LP+ IA + + S F++ERV EK G
Sbjct  61   GEIWGWTVFYGGIASFAFGSAYYHLKPDDNRLVLDTLPILIAYSSLFSSFLVERVGEKVG  120

Query  491  ILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
            +  ++  L V   S+ Y R F+DLR     + +P +AI +M + +PP+YTHS +WLWA  
Sbjct  121  LSCLVLLLFVSFLSIAYARVFNDLRLCMTFQLIPCLAIPIMTVLLPPKYTHSKFWLWATV  180

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLLQ  138
               +A+I   AD  IY  + + +SGH+L+H+  A   +ILT+ML  R I+  R+  L+
Sbjct  181  AYAIAKIEGFADSKIYNANRYIISGHSLEHLCSAAGTLILTVMLLYRSIRCHRLGDLK  238



>ref|XP_002279190.2| PREDICTED: uncharacterized protein LOC100245671 isoform X1 [Vitis 
vinifera]
Length=267

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 153/243 (63%), Gaps = 0/243 (0%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+    + LM  TP+IP    +H FAD R F G+P TL+V +N+PFL +G+ G  LC  
Sbjct  18   VAVCLCWLCLMFATPKIPHSPKHHLFADMRNFLGVPNTLNVITNYPFLVLGVLGFVLCLS  77

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GN   IS + EV GW ++Y G  +VAFGSSYYHL P+D+R++WD+LP+ IA + + + F+
Sbjct  78   GNSFVISSRAEVWGWALYYAGTTSVAFGSSYYHLKPDDNRVIWDKLPIMIAYSSLFASFI  137

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            +ERV E  G+  +    LV +  V   R F+DLR   M + +P IAI  M     P+YTH
Sbjct  138  MERVGEMIGLTCLFTLNLVALVGVACERAFNDLRLCMMFQLIPGIAIPAMTFMFTPKYTH  197

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            S YWL A G  LLA+   +AD  +Y+ + + +SGH+L+H+   I  V+LTLML  R I+T
Sbjct  198  SRYWLCATGVYLLAKFESVADNKVYRATWYLISGHSLEHLCSVIFPVLLTLMLIFRSIKT  257

Query  158  ERI  150
             R+
Sbjct  258  PRL  260



>ref|XP_002309502.1| hypothetical protein POPTR_0006s24510g [Populus trichocarpa]
 gb|EEE93025.1| hypothetical protein POPTR_0006s24510g [Populus trichocarpa]
Length=242

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 149/238 (63%), Gaps = 0/238 (0%)
 Frame = -3

Query  848  MLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQG  669
            M++TP+I        FAD R F G+P TL+V +NFPFL +G+ G  L   G +  ISL+G
Sbjct  1    MVVTPKITLSHKPLQFADMRNFLGVPNTLNVITNFPFLLVGVVGFVLSLQGCFFNISLKG  60

Query  668  EVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI  489
            EV GW +FY GI  +AFGS+YYHL P+D R++WD LPM IA + + S F+ ERV ++ G+
Sbjct  61   EVWGWALFYGGIVGLAFGSAYYHLKPDDSRVMWDTLPMMIAYSSLFSSFMAERVGQRAGL  120

Query  488  LSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGC  309
              +   L   + S  Y R F+DLR   M + +P +AI  M    PP+YTHS YWLWAAG 
Sbjct  121  SCLFGLLFAVLFSTAYARTFNDLRLCMMFQLIPCVAIPAMTFLYPPKYTHSRYWLWAAGV  180

Query  308  LLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLLQR  135
             LLA+  +  DK IY  + + +SGH+L+H+  A + V+  +ML  R I+ +R+  L+ 
Sbjct  181  CLLAKFEDALDKKIYNANRYFISGHSLEHLCSAAIPVLFAIMLIHRTIRCQRLGDLKE  238



>emb|CDX69727.1| BnaA10g20760D [Brassica napus]
Length=263

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 162/245 (66%), Gaps = 3/245 (1%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIP-QPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLAL  708
            G  ++C+++L M  TP++P     +H FADKR F  G+P TL+V +NFPFL IG+ G  L
Sbjct  20   GSLLICWLIL-MFFTPKVPLHSFRHHVFADKRNFMAGVPNTLNVMTNFPFLIIGVLGFVL  78

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            C  G++  ISL+GE+ GWT+FY  ++++AFGS+YYHL P+D+R+VWD LP+ IA + + S
Sbjct  79   CLGGSFFNISLKGEIWGWTLFYASVSSLAFGSAYYHLKPDDNRIVWDTLPILIAYSSLFS  138

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
             F++ER  E+ G+  ++  L + V SV Y R F+DLR     + +P + I +M + +PP+
Sbjct  139  SFLVERAGERVGLSCLVLLLFISVFSVAYARVFNDLRLCLTFQLIPCLVIPVMTVLLPPK  198

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS +WL A     +++I  LAD  IY  + + +SGH+L H+  A+  V+LT+ML  R 
Sbjct  199  YTHSRFWLLATAAHAVSKIEGLADSKIYNFNGYTISGHSLGHLCSALAMVLLTVMLLYRS  258

Query  167  IQTER  153
            I+  R
Sbjct  259  IRFPR  263



>emb|CBI20661.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 152/244 (62%), Gaps = 2/244 (1%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+    + LM  TP+IP    +H FAD R F G+P TL+V +N+PFL +G+ G  LC  
Sbjct  18   VAVCLCWLCLMFATPKIPHSPKHHLFADMRNFLGVPNTLNVITNYPFLVLGVLGFVLCLS  77

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GN   IS + EV GW ++Y G  +VAFGSSYYHL P+D+R++WD+LP+ IA + + + F+
Sbjct  78   GNSFVISSRAEVWGWALYYAGTTSVAFGSSYYHLKPDDNRVIWDKLPIMIAYSSLFASFI  137

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWR--RFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            +ERV E  G+  +    LV +  V   R   F+DLR   M + +P IAI  M     P+Y
Sbjct  138  MERVGEMIGLTCLFTLNLVALVGVACERLVSFNDLRLCMMFQLIPGIAIPAMTFMFTPKY  197

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THS YWL A G  LLA+   +AD  +Y+ + + +SGH+L+H+   I  V+LTLML  R I
Sbjct  198  THSRYWLCATGVYLLAKFESVADNKVYRATWYLISGHSLEHLCSVIFPVLLTLMLIFRSI  257

Query  164  QTER  153
            +T R
Sbjct  258  KTPR  261



>ref|XP_010925422.1| PREDICTED: uncharacterized protein LOC105047961 isoform X3 [Elaeis 
guineensis]
Length=260

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 165/247 (67%), Gaps = 1/247 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G A+L FV  +M+ TPRIP   A H FAD R F G+P TL+V ++FPFL IG+ GL L
Sbjct  15   VWGGALLLFV-FVMVATPRIPHSPALHLFADMRNFLGVPNTLNVLTSFPFLLIGVPGLVL  73

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            C  G+   ISL+GEV GW ++Y G A  AFGS+YYHL P+D+R++WDRLPM I+ + +LS
Sbjct  74   CLSGSCFGISLKGEVWGWALYYAGAAAAAFGSAYYHLKPDDERVIWDRLPMMISASSVLS  133

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
              +IER DE+ GI  +   L++ + S+   R FDDLR   M   VP +AI  M    PP+
Sbjct  134  NLLIERYDERMGITCLFSLLMLVLVSIACERTFDDLRLCMMFYFVPCVAIPAMVFLFPPK  193

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YW WA G  LLAR   +ADK +Y ++ + +SGH+L+H+  A++ ++LTLML  R+
Sbjct  194  YTHSKYWFWATGFYLLARFVAIADKRVYSVTRYAISGHSLEHLCLAMVPMMLTLMLWFRN  253

Query  167  IQTERIS  147
            I+  R S
Sbjct  254  IKIARDS  260



>ref|XP_010925421.1| PREDICTED: uncharacterized protein LOC105047961 isoform X2 [Elaeis 
guineensis]
Length=263

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 164/245 (67%), Gaps = 1/245 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G A+L FV  +M+ TPRIP   A H FAD R F G+P TL+V ++FPFL IG+ GL L
Sbjct  15   VWGGALLLFV-FVMVATPRIPHSPALHLFADMRNFLGVPNTLNVLTSFPFLLIGVPGLVL  73

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            C  G+   ISL+GEV GW ++Y G A  AFGS+YYHL P+D+R++WDRLPM I+ + +LS
Sbjct  74   CLSGSCFGISLKGEVWGWALYYAGAAAAAFGSAYYHLKPDDERVIWDRLPMMISASSVLS  133

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
              +IER DE+ GI  +   L++ + S+   R FDDLR   M   VP +AI  M    PP+
Sbjct  134  NLLIERYDERMGITCLFSLLMLVLVSIACERTFDDLRLCMMFYFVPCVAIPAMVFLFPPK  193

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YW WA G  LLAR   +ADK +Y ++ + +SGH+L+H+  A++ ++LTLML  R+
Sbjct  194  YTHSKYWFWATGFYLLARFVAIADKRVYSVTRYAISGHSLEHLCLAMVPMMLTLMLWFRN  253

Query  167  IQTER  153
            I+  R
Sbjct  254  IKIAR  258



>ref|XP_010925420.1| PREDICTED: uncharacterized protein LOC105047961 isoform X1 [Elaeis 
guineensis]
Length=264

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 164/245 (67%), Gaps = 1/245 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G A+L FV  +M+ TPRIP   A H FAD R F G+P TL+V ++FPFL IG+ GL L
Sbjct  15   VWGGALLLFV-FVMVATPRIPHSPALHLFADMRNFLGVPNTLNVLTSFPFLLIGVPGLVL  73

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            C  G+   ISL+GEV GW ++Y G A  AFGS+YYHL P+D+R++WDRLPM I+ + +LS
Sbjct  74   CLSGSCFGISLKGEVWGWALYYAGAAAAAFGSAYYHLKPDDERVIWDRLPMMISASSVLS  133

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
              +IER DE+ GI  +   L++ + S+   R FDDLR   M   VP +AI  M    PP+
Sbjct  134  NLLIERYDERMGITCLFSLLMLVLVSIACERTFDDLRLCMMFYFVPCVAIPAMVFLFPPK  193

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YW WA G  LLAR   +ADK +Y ++ + +SGH+L+H+  A++ ++LTLML  R+
Sbjct  194  YTHSKYWFWATGFYLLARFVAIADKRVYSVTRYAISGHSLEHLCLAMVPMMLTLMLWFRN  253

Query  167  IQTER  153
            I+  R
Sbjct  254  IKIAR  258



>ref|XP_008793247.1| PREDICTED: uncharacterized protein LOC103709588 isoform X3 [Phoenix 
dactylifera]
Length=260

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 166/247 (67%), Gaps = 1/247 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G A+L FV  +M+ TPRIP   ++H FAD R F G+P TL+V ++FPFL +G+ GL L
Sbjct  15   VWGGALLLFV-FVMVATPRIPHSPSFHLFADMRNFLGVPNTLNVLTSFPFLLVGVPGLVL  73

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            C  G+   ISL+GEV GW ++Y G A  AFGS+YYHL P+D+R++WDRLP+ I+ + ILS
Sbjct  74   CLSGSCFGISLKGEVWGWALYYAGAAAAAFGSAYYHLKPDDERVIWDRLPVMISASSILS  133

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
              +IER DE+ GI  +   L++ + S+   R FDDLR   M   +P +AI  M    PP+
Sbjct  134  NLLIERYDERTGITCLFSLLMLVLVSIACERTFDDLRLCMMFHFIPCVAIPAMVFLFPPK  193

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YW WA G  LLAR   +ADK +Y ++ + +SGH+L+H+  A++ ++LTLML  R+
Sbjct  194  YTHSKYWFWATGFYLLARFVAIADKKVYSVTRYVISGHSLEHLCLAMVPLMLTLMLWFRN  253

Query  167  IQTERIS  147
            I+  R S
Sbjct  254  IKIARDS  260



>ref|XP_008793245.1| PREDICTED: uncharacterized protein LOC103709588 isoform X1 [Phoenix 
dactylifera]
Length=264

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G A+L FV  +M+ TPRIP   ++H FAD R F G+P TL+V ++FPFL +G+ GL L
Sbjct  15   VWGGALLLFV-FVMVATPRIPHSPSFHLFADMRNFLGVPNTLNVLTSFPFLLVGVPGLVL  73

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            C  G+   ISL+GEV GW ++Y G A  AFGS+YYHL P+D+R++WDRLP+ I+ + ILS
Sbjct  74   CLSGSCFGISLKGEVWGWALYYAGAAAAAFGSAYYHLKPDDERVIWDRLPVMISASSILS  133

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
              +IER DE+ GI  +   L++ + S+   R FDDLR   M   +P +AI  M    PP+
Sbjct  134  NLLIERYDERTGITCLFSLLMLVLVSIACERTFDDLRLCMMFHFIPCVAIPAMVFLFPPK  193

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YW WA G  LLAR   +ADK +Y ++ + +SGH+L+H+  A++ ++LTLML  R+
Sbjct  194  YTHSKYWFWATGFYLLARFVAIADKKVYSVTRYVISGHSLEHLCLAMVPLMLTLMLWFRN  253

Query  167  IQTER  153
            I+  R
Sbjct  254  IKIAR  258



>ref|XP_008793246.1| PREDICTED: uncharacterized protein LOC103709588 isoform X2 [Phoenix 
dactylifera]
Length=263

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            V G A+L FV  +M+ TPRIP   ++H FAD R F G+P TL+V ++FPFL +G+ GL L
Sbjct  15   VWGGALLLFV-FVMVATPRIPHSPSFHLFADMRNFLGVPNTLNVLTSFPFLLVGVPGLVL  73

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            C  G+   ISL+GEV GW ++Y G A  AFGS+YYHL P+D+R++WDRLP+ I+ + ILS
Sbjct  74   CLSGSCFGISLKGEVWGWALYYAGAAAAAFGSAYYHLKPDDERVIWDRLPVMISASSILS  133

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
              +IER DE+ GI  +   L++ + S+   R FDDLR   M   +P +AI  M    PP+
Sbjct  134  NLLIERYDERTGITCLFSLLMLVLVSIACERTFDDLRLCMMFHFIPCVAIPAMVFLFPPK  193

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YW WA G  LLAR   +ADK +Y ++ + +SGH+L+H+  A++ ++LTLML  R+
Sbjct  194  YTHSKYWFWATGFYLLARFVAIADKKVYSVTRYVISGHSLEHLCLAMVPLMLTLMLWFRN  253

Query  167  IQTER  153
            I+  R
Sbjct  254  IKIAR  258



>ref|XP_009390127.1| PREDICTED: uncharacterized protein LOC103976585 [Musa acuminata 
subsp. malaccensis]
Length=269

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 149/231 (65%), Gaps = 0/231 (0%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            TPRI    A+H FAD R F G+P TL+V + FPFL +G+ GL LC  G    ISL+GE+ 
Sbjct  39   TPRISHSHAFHLFADMRNFLGVPNTLNVLTTFPFLLVGVPGLVLCLSGCCFGISLRGEMW  98

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
            GW  FY   AT AFGS+YYHL P+DDR+VWD+LPM  + + +LSI VIER+DE+ GI  +
Sbjct  99   GWAFFYAATATAAFGSAYYHLRPDDDRVVWDKLPMMTSASSLLSILVIERIDERMGISCL  158

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
               + + + S+   R FDDLR   M   VP IAI  +    PP+YTHS +W  A G  LL
Sbjct  159  SSLITLVLVSIACERTFDDLRLCMMFHIVPCIAIPALLFLFPPKYTHSRFWFCATGFYLL  218

Query  299  ARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERIS  147
            AR   +ADK IY  S + +SGH+L+H+  A++ +ILT+ML  R I+  R S
Sbjct  219  ARFEAIADKKIYSASRYIISGHSLEHLCLAMVPIILTVMLWFRSIKIARDS  269



>ref|XP_003565460.1| PREDICTED: uncharacterized protein LOC100837666 [Brachypodium 
distachyon]
Length=279

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 162/256 (63%), Gaps = 2/256 (1%)
 Frame = -3

Query  911  RPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLA  732
            R +    ++ G A+L    LL++ TPR+    A H FAD R   G+P TL+V + +P L 
Sbjct  25   RTENRRRAIAGCAVLA-SALLLVATPRLRHSPALHLFADMRNLLGVPNTLNVLTAYPLLL  83

Query  731  IGLAGLALCYYGN-YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPM  555
            +G+ GL LC  G+    ISL+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM
Sbjct  84   VGVPGLVLCLCGSGCFGISLRWEALGWFLFYAGNIGAAFGSAYYHLKPDDDRLIWDRLPM  143

Query  554  AIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIV  375
             I+ + +LSI VIERVDE  G+  +I  L + + S    R  DD+R + ++  +P +AI 
Sbjct  144  MISASSLLSILVIERVDEGAGLSCLISLLSLLLVSSACERVLDDMRLWVVLNFIPCVAIP  203

Query  374  LMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVI  195
             M    PP+YTHS +W  A G  LLAR   LAD+ +Y ++ + +SGH+L+H+  A++ +I
Sbjct  204  AMLFLFPPKYTHSRFWFLATGFYLLARFEGLADRKVYSVNRYFISGHSLEHLCFAMVTLI  263

Query  194  LTLMLAQRDIQTERIS  147
            LT+ML+ R+I+  R S
Sbjct  264  LTVMLSFRNIKIARDS  279



>gb|KHN06541.1| hypothetical protein glysoja_010885 [Glycine soja]
Length=210

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 123/197 (62%), Gaps = 25/197 (13%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            TP IPQP+ YHDFA+KR+FFG+P   +V +NFPF+ IGL GL LC+  NY  ISLQGE+ 
Sbjct  23   TPSIPQPQRYHDFAEKREFFGLPNAPNVVANFPFMVIGLIGLVLCHRRNYFNISLQGELW  82

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
            GWT FY  + +VAFGSSYYHL P+D  LVWDR PM++A   +L+I +I R          
Sbjct  83   GWTCFYVAVTSVAFGSSYYHLGPDDAGLVWDRFPMSVAFVSLLAILIIVRF---------  133

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
                            F D+R Y + +    IAI LMA  +PP YTHSTYWLW +G  LL
Sbjct  134  ----------------FGDIRLYVLAQGASCIAIPLMATLLPPMYTHSTYWLWTSGFYLL  177

Query  299  ARIGELADKPIYKLSLH  249
            A + E AD+ IY L+ H
Sbjct  178  ATLQEAADRVIYILTFH  194



>ref|XP_007136829.1| hypothetical protein PHAVU_009G077800g [Phaseolus vulgaris]
 gb|ESW08823.1| hypothetical protein PHAVU_009G077800g [Phaseolus vulgaris]
Length=270

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 151/246 (61%), Gaps = 1/246 (0%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            VCG   LC  + L+  TP IP+   +H F D R   G+P TL+V +NFPFL +G+ GL L
Sbjct  19   VCGATFLC-CMCLIFFTPTIPRSPKHHQFVDMRNLLGVPNTLNVMTNFPFLIVGILGLVL  77

Query  707  CYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
               G    IS QGEV  W +FY GIA VAFGS+YYHL P+D R++WD LPM +A + + S
Sbjct  78   ALEGGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRVLWDTLPMMVAFSSLFS  137

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPR  348
              V+ER  ++ G+  +   ++     ++Y R ++D+R   + +    + I ++AL    +
Sbjct  138  SLVVERFGQRIGLCCLFALIVAAFLCLVYERIYNDIRFCVIFQLTLPLTIPVIALMYRSK  197

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTHS YW  + G  LLA+   + DK +Y ++ + +SGH+L+H+  A++ + LT+ML  R+
Sbjct  198  YTHSRYWFLSTGIYLLAKFEGVTDKKLYHVNNYVISGHSLEHLCLALIPISLTVMLIYRE  257

Query  167  IQTERI  150
            ++ +R+
Sbjct  258  LKFKRV  263



>ref|NP_001042300.2| Os01g0197500 [Oryza sativa Japonica Group]
 dbj|BAF04214.2| Os01g0197500 [Oryza sativa Japonica Group]
Length=906

 Score =   204 bits (518),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 158/244 (65%), Gaps = 2/244 (1%)
 Frame = -3

Query  890  SVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLA  711
            ++ G A+L    LL++ TPR+    A H FAD R   G+P TL+V + +P L  G+ GL 
Sbjct  39   ALAGGAVLA-SALLLVATPRLRHSPALHLFADMRNLLGVPNTLNVLTAYPLLLAGVPGLV  97

Query  710  LCYYGNYV-KISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
            LC  G+    ISL+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM I+ + +
Sbjct  98   LCLCGSGCFGISLRWEALGWFLFYAGNVAAAFGSAYYHLKPDDDRLIWDRLPMMISASSM  157

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            LSI VIERVDE+ G+  ++  L + + S    R  DD+R + ++ + P IAI  M    P
Sbjct  158  LSILVIERVDERAGLSCLLSLLSLILVSSACERVLDDMRLWVVLNSAPCIAIPAMLFLFP  217

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
            P+YTHS +W  A G  LLAR   LAD+ +Y ++ + +SGH+L+H+  A++ +ILT+ML+ 
Sbjct  218  PKYTHSRFWFLATGFYLLARFEGLADRKVYSVNRYFISGHSLEHLCFAMVTLILTVMLSF  277

Query  173  RDIQ  162
            R+++
Sbjct  278  RNVK  281



>gb|AES73402.2| alkaline phytoceramidase (APHC) [Medicago truncatula]
Length=272

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 154/263 (59%), Gaps = 0/263 (0%)
 Frame = -3

Query  938  DINTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLD  759
            D  TN R  R + +       A     + L L TP IP+    H FAD R   G+P TL+
Sbjct  3    DYVTNHRFKRWKRNHRIWGATATFLCCICLFLFTPTIPRSSNQHQFADVRNLLGVPNTLN  62

Query  758  VTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDR  579
            V +NFPFL +G+ G      G++  IS QGEV GW VFY G+  VAFGS+YYHL P++ R
Sbjct  63   VMTNFPFLVVGVLGFVFALDGSFFNISSQGEVWGWVVFYGGMIGVAFGSAYYHLKPDNHR  122

Query  578  LVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVE  399
            ++WD LPM +A + ++S  + ER  ++ G+  +   L+  +  V++ R ++D+R   M +
Sbjct  123  VLWDTLPMMVAFSSLMSCLIFERFSQRTGLCCMSALLVSAILCVLHERIYNDIRFCMMFQ  182

Query  398  TVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHV  219
             +  +AI  +A     +YTHS YW  + G  LLA+   + D+ + ++S + ++GH+L+H+
Sbjct  183  LILPLAIPAVAFMYRSKYTHSGYWFLSTGIYLLAKFEGVTDRKLCRISTYFITGHSLEHL  242

Query  218  FGAILAVILTLMLAQRDIQTERI  150
              A++ + L +ML  R+++ +R+
Sbjct  243  CLALIPISLGIMLIYRELKFQRL  265



>ref|XP_009406112.1| PREDICTED: uncharacterized protein LOC103989082 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=171

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = -3

Query  905  QGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAI  729
            +G  L   G A+L FVVL M++TP IPQ + YH+FAD+R+ F GIP TL+V SN PFL +
Sbjct  3    RGKQLCAWGAAVLIFVVL-MVVTPAIPQSEEYHNFADQRELFLGIPNTLNVISNIPFLFV  61

Query  728  GLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAI  549
            G+ GL LC+Y NY ++ LQGE+ GW++F+ G+  VAFGSSYYHL PND RLVWDRLPM +
Sbjct  62   GVVGLTLCFYRNYFRLRLQGEIWGWSIFFLGVTAVAFGSSYYHLKPNDARLVWDRLPMTV  121

Query  548  ALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIY  441
            A   I++IF+IERVDEK G  SI P L++   S+IY
Sbjct  122  AFTSIMAIFIIERVDEKTGTTSIAP-LVIADFSMIY  156



>ref|XP_006581293.1| PREDICTED: uncharacterized protein LOC100806703 isoform X2 [Glycine 
max]
Length=274

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 159/259 (61%), Gaps = 2/259 (1%)
 Frame = -3

Query  926  NTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSN  747
            N RQ R + +   + G   LC  + L+  TPRIP+   +H F D R   G+P TL+V +N
Sbjct  11   NNRQCR-RWTTSRIWGATFLC-CMCLIFFTPRIPRSPKHHQFVDMRNLLGVPNTLNVMTN  68

Query  746  FPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWD  567
            FPFL +G+ GL L   G    IS QGEV  W +FY GIA VAFGS+YYHL P+D R++WD
Sbjct  69   FPFLVVGVLGLVLALEGGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRVLWD  128

Query  566  RLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPI  387
             LPM +A + +LS  V+ER+ ++ G+  +    L     V+Y R ++D+R   M +    
Sbjct  129  TLPMMVAFSSLLSSLVVERLGQRIGLCCMFALNLAAFLCVVYERIYNDIRFCMMFQLTLP  188

Query  386  IAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAI  207
            +AI ++A+    +YTHS YW  + G  LLA+     D+ +Y ++ + +SGH+L+H+  A+
Sbjct  189  LAIPVIAVLYRSKYTHSRYWFISTGIYLLAKFEGATDRKLYHVNNYIISGHSLEHLCLAL  248

Query  206  LAVILTLMLAQRDIQTERI  150
            + ++L++ML  R+++ +R+
Sbjct  249  IPILLSVMLIHRELKFQRL  267



>ref|XP_008784258.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103703256, 
partial [Phoenix dactylifera]
Length=168

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -3

Query  779  GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYH  600
            GI  TL+V S FP L IG+ GL LC +G++ ++SLQGEV GW  F+ G+A V FGSSY+H
Sbjct  4    GIRNTLNVISFFPSLVIGIVGLVLCLHGSF-RLSLQGEVWGWPCFFIGVAAVVFGSSYHH  62

Query  599  LNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDL  420
            L PND RLVWDRLPM +AL  I++IF+IER+DEK G  SI+P ++ G+ S++YWR FDDL
Sbjct  63   LKPNDARLVWDRLPMTLALTSIMAIFIIERIDEKTGTTSIVPLVMAGILSILYWRFFDDL  122

Query  419  RPYAMVETVPIIAIVLMALWIPPRYTHSTYWL  324
            R YA+V  VP I I  MA+ IPP YTHS +WL
Sbjct  123  RLYALVXFVPCIIIPXMAILIPPVYTHSAHWL  154



>dbj|BAD73218.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD73325.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 163/289 (56%), Gaps = 35/289 (12%)
 Frame = -3

Query  911  RPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLA  732
            R +    ++ G A+L    LL++ TPR+    A H FAD R   G+P TL+V + +P L 
Sbjct  32   RREHRRRALAGGAVLA-SALLLVATPRLRHSPALHLFADMRNLLGVPNTLNVLTAYPLLL  90

Query  731  IGLAGLALCYYGN----------YVKISLQG------------------------EVLGW  654
             G+ GL LC  G+           +K  ++G                        E LGW
Sbjct  91   AGVPGLVLCLCGSGCFGISEGRAVIKAGIEGMMLKEIFLFCYPYLTEKQISSLRWEALGW  150

Query  653  TVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIP  474
             +FY G    AFGS+YYHL P+DDRL+WDRLPM I+ + +LSI VIERVDE+ G+  ++ 
Sbjct  151  FLFYAGNVAAAFGSAYYHLKPDDDRLIWDRLPMMISASSMLSILVIERVDERAGLSCLLS  210

Query  473  SLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLAR  294
             L + + S    R  DD+R + ++ + P IAI  M    PP+YTHS +W  A G  LLAR
Sbjct  211  LLSLILVSSACERVLDDMRLWVVLNSAPCIAIPAMLFLFPPKYTHSRFWFLATGFYLLAR  270

Query  293  IGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERIS  147
               LAD+ +Y ++ + +SGH+L+H+  A++ +ILT+ML+ R+++  R S
Sbjct  271  FEGLADRKVYSVNRYFISGHSLEHLCFAMVTLILTVMLSFRNVKIVRSS  319



>ref|XP_003523644.2| PREDICTED: uncharacterized protein LOC100796199 isoform X1 [Glycine 
max]
Length=273

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 160/259 (62%), Gaps = 2/259 (1%)
 Frame = -3

Query  926  NTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSN  747
            N +Q R + + + + G   +C  + L+  TPRIP+   +H F D R   G+P TL+V +N
Sbjct  10   NNQQCR-RWTTIRIWGATFIC-CMCLIFFTPRIPRSPKHHQFVDMRNLLGVPNTLNVMTN  67

Query  746  FPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWD  567
            FPFL +G+ GL L        IS QGEV  W +FY GIA VAFGS+YYHL P+D R++WD
Sbjct  68   FPFLVVGVLGLVLALEEGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRVLWD  127

Query  566  RLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPI  387
             LPM +A + +LS  V+ER+ ++ G+  +    L     VIY R ++D+R   M +    
Sbjct  128  TLPMMVAFSSLLSSLVVERLGQRIGLCCMFALNLAAFLCVIYERIYNDVRFCMMFQLTLP  187

Query  386  IAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAI  207
            +AI ++A+    +YTHS YW ++ G  LLA+     D+ +Y ++ + +SGH+L+H+  A+
Sbjct  188  LAIPVIAVLYRSKYTHSRYWFFSTGIYLLAKFEGATDRKLYHVNNYIISGHSLEHLCLAL  247

Query  206  LAVILTLMLAQRDIQTERI  150
            + ++L++ML  R+++ +R+
Sbjct  248  IPILLSVMLINRELKFQRL  266



>ref|XP_002455004.1| hypothetical protein SORBIDRAFT_03g002820 [Sorghum bicolor]
 gb|EES00124.1| hypothetical protein SORBIDRAFT_03g002820 [Sorghum bicolor]
Length=284

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/237 (46%), Positives = 151/237 (64%), Gaps = 1/237 (0%)
 Frame = -3

Query  854  LLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN-YVKIS  678
            LL++ TPR     A H FAD R   G+P TL+V + +P L  G+ GL LC  G+    +S
Sbjct  48   LLLVATPRFRHTPALHLFADMRNLLGVPNTLNVLTAYPLLLAGVPGLVLCICGSGCFGVS  107

Query  677  LQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEK  498
            L+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM I+ + +LSI VIERVDE+
Sbjct  108  LRWEALGWFLFYAGNVAAAFGSAYYHLKPDDDRLIWDRLPMMISSSSLLSILVIERVDER  167

Query  497  RGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWA  318
             G+  +I  L + + S    R  DD+R + ++  VP IAI  M    PP+YTHS +W  A
Sbjct  168  VGLSCLISLLSLVLVSSACERVLDDMRLWVILNFVPCIAIPAMLFLFPPKYTHSRFWFLA  227

Query  317  AGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERIS  147
             G  LLAR   LAD+ +Y ++ + +SGH+L+H+  A++  ILT+ML  R+I+  R S
Sbjct  228  TGFYLLARFEGLADRKVYSVNRYFISGHSLEHLCFALVTFILTVMLTFRNIKIARDS  284



>ref|XP_003527749.1| PREDICTED: uncharacterized protein LOC100806703 isoform X1 [Glycine 
max]
Length=277

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/262 (39%), Positives = 159/262 (61%), Gaps = 5/262 (2%)
 Frame = -3

Query  926  NTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF---GIPYTLDV  756
            N RQ R + +   + G   LC  + L+  TPRIP+   +H F D R      G+P TL+V
Sbjct  11   NNRQCR-RWTTSRIWGATFLC-CMCLIFFTPRIPRSPKHHQFVDMRNLLDSPGVPNTLNV  68

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRL  576
             +NFPFL +G+ GL L   G    IS QGEV  W +FY GIA VAFGS+YYHL P+D R+
Sbjct  69   MTNFPFLVVGVLGLVLALEGGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRV  128

Query  575  VWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVET  396
            +WD LPM +A + +LS  V+ER+ ++ G+  +    L     V+Y R ++D+R   M + 
Sbjct  129  LWDTLPMMVAFSSLLSSLVVERLGQRIGLCCMFALNLAAFLCVVYERIYNDIRFCMMFQL  188

Query  395  VPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVF  216
               +AI ++A+    +YTHS YW  + G  LLA+     D+ +Y ++ + +SGH+L+H+ 
Sbjct  189  TLPLAIPVIAVLYRSKYTHSRYWFISTGIYLLAKFEGATDRKLYHVNNYIISGHSLEHLC  248

Query  215  GAILAVILTLMLAQRDIQTERI  150
             A++ ++L++ML  R+++ +R+
Sbjct  249  LALIPILLSVMLIHRELKFQRL  270



>ref|XP_006645604.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g17630-like, partial [Oryza brachyantha]
Length=800

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 152/233 (65%), Gaps = 1/233 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYV-KI  681
             LL++ TPR+    A H FAD R   G+P TL+V S +P L  G+ GL LC  G+    I
Sbjct  20   ALLLVATPRLRHSPALHLFADMRNLLGVPNTLNVFSAYPLLLAGVPGLVLCLCGSGCFGI  79

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            SL+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM ++ + +LSI VIERVDE
Sbjct  80   SLRWEALGWFLFYAGNVAAAFGSAYYHLKPDDDRLIWDRLPMMLSASSLLSILVIERVDE  139

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G+  ++  L + + S    R  DD+R + ++  VP +AI  M    PP+YTHS +W  
Sbjct  140  RAGLSCLLSLLSLILVSSACERVLDDMRLWVVLNFVPCVAIPAMLFLFPPKYTHSRFWFL  199

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            A G  LLAR   LAD+ +Y ++ + +SGH+L+H+  A++++IL +ML+ R+++
Sbjct  200  ATGFYLLARFEGLADRKVYSVNRYFISGHSLEHLCFAVVSLILNVMLSFRNVK  252



>ref|XP_006578079.1| PREDICTED: uncharacterized protein LOC100796199 isoform X2 [Glycine 
max]
Length=276

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 160/262 (61%), Gaps = 5/262 (2%)
 Frame = -3

Query  926  NTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF---GIPYTLDV  756
            N +Q R + + + + G   +C  + L+  TPRIP+   +H F D R      G+P TL+V
Sbjct  10   NNQQCR-RWTTIRIWGATFIC-CMCLIFFTPRIPRSPKHHQFVDMRNLLDSPGVPNTLNV  67

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRL  576
             +NFPFL +G+ GL L        IS QGEV  W +FY GIA VAFGS+YYHL P+D R+
Sbjct  68   MTNFPFLVVGVLGLVLALEEGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRV  127

Query  575  VWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVET  396
            +WD LPM +A + +LS  V+ER+ ++ G+  +    L     VIY R ++D+R   M + 
Sbjct  128  LWDTLPMMVAFSSLLSSLVVERLGQRIGLCCMFALNLAAFLCVIYERIYNDVRFCMMFQL  187

Query  395  VPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVF  216
               +AI ++A+    +YTHS YW ++ G  LLA+     D+ +Y ++ + +SGH+L+H+ 
Sbjct  188  TLPLAIPVIAVLYRSKYTHSRYWFFSTGIYLLAKFEGATDRKLYHVNNYIISGHSLEHLC  247

Query  215  GAILAVILTLMLAQRDIQTERI  150
             A++ ++L++ML  R+++ +R+
Sbjct  248  LALIPILLSVMLINRELKFQRL  269



>gb|KHN29720.1| hypothetical protein glysoja_016342 [Glycine soja]
Length=278

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/261 (38%), Positives = 159/261 (61%), Gaps = 5/261 (2%)
 Frame = -3

Query  926  NTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF---GIPYTLDV  756
            N +Q R + + + + G   +C  + L+  TPRIP+   +H F D R      G+P TL+V
Sbjct  10   NNQQCR-RWTTIRIWGATFIC-CMCLIFFTPRIPRSPKHHQFVDMRNLLDSPGVPNTLNV  67

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRL  576
             +NFPFL +G+ GL L        IS QGEV  W +FY GIA VAFGS+YYHL P+D R+
Sbjct  68   MTNFPFLVVGVLGLVLALEEGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRV  127

Query  575  VWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVET  396
            +WD LPM +A + +LS  V+ER+ ++ G+  +    L     VIY R ++D+R   M + 
Sbjct  128  LWDTLPMMVAFSSLLSSLVVERLGQRIGLCCMFALNLAAFLCVIYERIYNDVRFCMMFQL  187

Query  395  VPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVF  216
               +AI ++A+    +YTHS YW ++ G  LLA+     D+ +Y ++ + +SGH+L+H+ 
Sbjct  188  TLPLAIPVIAVLYRSKYTHSRYWFFSTGIYLLAKFEGATDRKLYHVNNYIISGHSLEHLC  247

Query  215  GAILAVILTLMLAQRDIQTER  153
             A++ ++L++ML  R+++ +R
Sbjct  248  LALIPILLSVMLINRELKFQR  268



>ref|XP_006578080.1| PREDICTED: uncharacterized protein LOC100796199 isoform X3 [Glycine 
max]
Length=268

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 158/260 (61%), Gaps = 5/260 (2%)
 Frame = -3

Query  926  NTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF---GIPYTLDV  756
            N +Q R + + + + G   +C  + L+  TPRIP+   +H F D R      G+P TL+V
Sbjct  10   NNQQCR-RWTTIRIWGATFIC-CMCLIFFTPRIPRSPKHHQFVDMRNLLDSPGVPNTLNV  67

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRL  576
             +NFPFL +G+ GL L        IS QGEV  W +FY GIA VAFGS+YYHL P+D R+
Sbjct  68   MTNFPFLVVGVLGLVLALEEGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRV  127

Query  575  VWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVET  396
            +WD LPM +A + +LS  V+ER+ ++ G+  +    L     VIY R ++D+R   M + 
Sbjct  128  LWDTLPMMVAFSSLLSSLVVERLGQRIGLCCMFALNLAAFLCVIYERIYNDVRFCMMFQL  187

Query  395  VPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVF  216
               +AI ++A+    +YTHS YW ++ G  LLA+     D+ +Y ++ + +SGH+L+H+ 
Sbjct  188  TLPLAIPVIAVLYRSKYTHSRYWFFSTGIYLLAKFEGATDRKLYHVNNYIISGHSLEHLC  247

Query  215  GAILAVILTLMLAQRDIQTE  156
             A++ ++L++ML  R+++ +
Sbjct  248  LALIPILLSVMLINRELKFQ  267



>ref|XP_008377687.1| PREDICTED: uncharacterized protein LOC103440765 isoform X2 [Malus 
domestica]
Length=216

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/263 (37%), Positives = 138/263 (52%), Gaps = 54/263 (21%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T+Q   +G    + G A LC+V LL+L+TP+IP    +H +AD R   G+P TL+V +NF
Sbjct  6    TQQLAIRGKRRRIWGGAFLCWV-LLILVTPKIPHSPKHHLYADMRNLLGVPNTLNVITNF  64

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PFL +G  G  LC  G +  ISL GEV GW +FY G A VAFGS+YYHL P D R+ WD 
Sbjct  65   PFLVVGALGFVLCVQGGFFNISLPGEVWGWALFYAGTAGVAFGSAYYHLKPADSRVAWDT  124

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LP+                         IP + +   S ++                   
Sbjct  125  LPL-------------------------IPCIAIPTMSSVF-------------------  140

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
                     PP+YTHS YWLWAAG  LL++   +ADK IY+ +   +SGH+L+H+   ++
Sbjct  141  ---------PPKYTHSRYWLWAAGVYLLSKFESVADKKIYRANHFIISGHSLEHLCLVMV  191

Query  203  AVILTLMLAQRDIQTERISLLQR  135
             V+L++ML  R I+ +RI   + 
Sbjct  192  PVLLSIMLMNRKIKCQRIDAXKE  214



>ref|XP_010519850.1| PREDICTED: uncharacterized protein LOC104799163 isoform X2 [Tarenaya 
hassleriana]
Length=241

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 144/247 (58%), Gaps = 30/247 (12%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIP-QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            + LC++  +M +TP++P    ++H FADKR F G                          
Sbjct  21   SFLCWL-FVMFITPKVPLSSPSHHVFADKRNFLG--------------------------  53

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
              +  ISL+GE+ GW +FY G+A +AFGS+YYHL  +D+R++WD LP+ IA + + S F+
Sbjct  54   --FFTISLKGEIWGWVLFYAGVAGLAFGSAYYHLKSDDNRIIWDTLPILIAYSSLFSSFL  111

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
            +ER  E+ G+  ++  L +   S+ Y   F+DLR     + +P +AI ++ + +PP+YTH
Sbjct  112  VERAGERAGLCCLVSLLFIAFLSIAYAGVFNDLRLCMTFQLIPFVAIPVLTILLPPKYTH  171

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQT  159
            S YWLWA+G  +L+ I  LAD  IY  + + +SGH+L H+  A   ++LT+ML  R I+ 
Sbjct  172  SKYWLWASGAYILSGIENLADSKIYNANRYLISGHSLGHLCSAAAPILLTIMLLYRSIRF  231

Query  158  ERISLLQ  138
             R+  L+
Sbjct  232  HRLGDLK  238



>ref|XP_004498885.1| PREDICTED: uncharacterized protein LOC101503202 isoform X2 [Cicer 
arietinum]
Length=287

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 143/233 (61%), Gaps = 0/233 (0%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            P+IP+    H FAD R   G+P TL+V +NFPFL +G+ GL L   G +  IS Q EV  
Sbjct  52   PKIPRSPNTHQFADLRNLLGVPNTLNVITNFPFLVVGVLGLVLALEGGFFSISYQAEVWT  111

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            W +FY GI  VAFGS YYHL P+++R+VWD LPM +A + + S  ++ER+ ++ G+  + 
Sbjct  112  WALFYAGITGVAFGSVYYHLKPDNNRVVWDTLPMMVACSSLFSSLIVERIGQRIGLCCMC  171

Query  476  PSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLA  297
              +      V+Y R +DD R   M + +  +AI + A   P  YTHS YW  + G  LLA
Sbjct  172  ALVFTAFTCVVYERIYDDTRLCLMFQLILPLAIAVAAFVYPSNYTHSRYWFLSVGIYLLA  231

Query  296  RIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERISLLQ  138
            +   +AD+ +Y+ + + +SGH+L+H+  A++  +L++ML  R+ + +R+  L+
Sbjct  232  KFEAIADRKLYRTNDYVISGHSLEHLSLALIPFLLSVMLLYRERKFKRLGDLK  284



>ref|XP_004498884.1| PREDICTED: uncharacterized protein LOC101503202 isoform X1 [Cicer 
arietinum]
Length=292

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 140/228 (61%), Gaps = 0/228 (0%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            P+IP+    H FAD R   G+P TL+V +NFPFL +G+ GL L   G +  IS Q EV  
Sbjct  52   PKIPRSPNTHQFADLRNLLGVPNTLNVITNFPFLVVGVLGLVLALEGGFFSISYQAEVWT  111

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            W +FY GI  VAFGS YYHL P+++R+VWD LPM +A + + S  ++ER+ ++ G+  + 
Sbjct  112  WALFYAGITGVAFGSVYYHLKPDNNRVVWDTLPMMVACSSLFSSLIVERIGQRIGLCCMC  171

Query  476  PSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLA  297
              +      V+Y R +DD R   M + +  +AI + A   P  YTHS YW  + G  LLA
Sbjct  172  ALVFTAFTCVVYERIYDDTRLCLMFQLILPLAIAVAAFVYPSNYTHSRYWFLSVGIYLLA  231

Query  296  RIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTER  153
            +   +AD+ +Y+ + + +SGH+L+H+  A++  +L++ML  R+ + +R
Sbjct  232  KFEAIADRKLYRTNDYVISGHSLEHLSLALIPFLLSVMLLYRERKFKR  279



>ref|XP_004971741.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g17630-like [Setaria italica]
Length=938

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 153/233 (66%), Gaps = 1/233 (0%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYV-KI  681
             LL++ TPR+    A H FAD R   G+P TL+V + +P L  G+ GL LC  G+    +
Sbjct  47   ALLLVATPRLRHSPALHLFADMRNLLGVPNTLNVLTAYPLLLAGVPGLILCLCGSGCFGV  106

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            SL+ E LGW +FY G A  AFGS+YYHL P+DDRL+WDRLPM I+ + +LSI VIERVDE
Sbjct  107  SLRWEALGWFLFYAGNAAAAFGSAYYHLKPDDDRLIWDRLPMMISSSSLLSILVIERVDE  166

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G+  +I  L + + S    R  DD+R + ++  VP IAI  +    PP+YTHS +W  
Sbjct  167  RVGLSCLISLLSLILVSSACERVLDDMRLWVILNFVPCIAIPAILFLFPPKYTHSRFWFL  226

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            A G  LLAR   LAD+ +Y ++ + +SGH+L+H+  A++ +ILT+ML+ R+I+
Sbjct  227  ATGFYLLARFEGLADRKVYSVNRYFISGHSLEHLCFAMVTLILTVMLSFRNIK  279



>ref|XP_002516438.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45779.1| conserved hypothetical protein [Ricinus communis]
Length=231

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 128/204 (63%), Gaps = 0/204 (0%)
 Frame = -3

Query  905  QGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIG  726
            +G   S   V  L F VLLM  TP+IP    +H FAD R F G+P TL+V + FPFL +G
Sbjct  14   KGKKRSQKWVLGLLFWVLLMFATPKIPLSHKHHLFADMRNFLGVPNTLNVITIFPFLVVG  73

Query  725  LAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIA  546
            + G  L   G++  ISL+GEV GW +FY GI  VAFGS+YYHL P+D R +WD LPM IA
Sbjct  74   VVGFVLSIRGSFFNISLRGEVWGWVMFYGGIMGVAFGSAYYHLKPDDSRFMWDTLPMMIA  133

Query  545  LAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMA  366
             + + S FV+ERV ++ G+  +   L+V + S  Y R F+DLR   M + +P IAI  M 
Sbjct  134  YSSLFSSFVVERVGKRVGLSCLFGLLVVILLSTAYARIFNDLRLCMMFQLIPCIAIPGMT  193

Query  365  LWIPPRYTHSTYWLWAAGCLLLAR  294
               PP+YTHS YWLWAA   L+ +
Sbjct  194  FLYPPKYTHSIYWLWAAALTLVFK  217



>ref|XP_006450849.1| hypothetical protein CICLE_v10009178mg [Citrus clementina]
 gb|ESR64089.1| hypothetical protein CICLE_v10009178mg [Citrus clementina]
Length=201

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 121/190 (64%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  GLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALA  540
            G  L   G +  IS +GEV GW +FY GI  VAFGS+YYHL P+DDR++WD LPM IA A
Sbjct  2    GFVLTLQGIFFNISFRGEVWGWALFYAGITGVAFGSAYYHLKPDDDRVMWDTLPMMIAYA  61

Query  539  GILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALW  360
             + S  + ERVD K G+  +I  + V   S+IY R F+D R     + +P IAI ++   
Sbjct  62   SLFSSLLAERVDAKIGLSCLIALVSVSFLSMIYARTFNDFRLCMTFQLIPTIAIPVVTFL  121

Query  359  IPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLML  180
             PP+YTHS  WL+A G  LLA+    AD+ IY  + + +SGH+L+H+  AI+ V+L++ML
Sbjct  122  FPPKYTHSRCWLYATGFYLLAKFEAAADRKIYSKTHYIISGHSLEHLCSAIVPVLLSVML  181

Query  179  AQRDIQTERI  150
              RD + +R+
Sbjct  182  MYRDTKFQRL  191



>ref|WP_036050418.1| hypothetical protein, partial [Bradyrhizobium sp. Tv2a-2]
Length=229

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 134/221 (61%), Gaps = 13/221 (6%)
 Frame = -3

Query  869  LCFVVLLMLL-TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            L F+ L+ L+  P + Q + YH FAD+R+ FGIP   +V SN PF+AIG AGL L ++ N
Sbjct  18   LMFISLIALMPLPPLLQNQDYHQFADQRELFGIPNFWNVVSNLPFIAIGAAGL-LRFHHN  76

Query  692  YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
             + +          V +TGI    FGSSYYHLNPND  L WDRLPM +  A ILS  V E
Sbjct  77   AITL----------VLFTGIFLTGFGSSYYHLNPNDSTLFWDRLPMTLCFAAILSAVVEE  126

Query  512  RVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHST  333
            RVD + G + + P L +G+ S++ WR  DDLR YA  +  P + +VL+  + PP++T ++
Sbjct  127  RVDARAGAMLLRPLLAIGIFSLLLWRWTDDLRLYAWAQFFPFVVLVLILQFFPPKFTGTS  186

Query  332  YWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
            YW+ AA    LA++ E  D  +Y      +SGHTLKH+  A
Sbjct  187  YWVAAATLYALAKLLEYYDHEVYSFG-GILSGHTLKHLAAA  226



>ref|XP_003603151.1| hypothetical protein MTR_3g104420 [Medicago truncatula]
Length=265

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/263 (35%), Positives = 149/263 (57%), Gaps = 6/263 (2%)
 Frame = -3

Query  938  DINTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLD  759
            D  TN R  R + +       A     + L L TP IP+    H FAD R   G+P TL+
Sbjct  2    DYVTNHRFKRWKRNHRIWGATATFLCCICLFLFTPTIPRSSNQHQFADVRNLLGVPNTLN  61

Query  758  VTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDR  579
            V +NFPFL +G+ G      G++  IS QGEV GW VFY G+  VAFGS+YYHL P++ R
Sbjct  62   VMTNFPFLVVGVLGFVFALDGSFFNISSQGEVWGWVVFYGGMIGVAFGSAYYHLKPDNHR  121

Query  578  LVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVE  399
            ++WD LP+++ L  IL         ++ G+  +   L+  +  ++  R ++D+R   M +
Sbjct  122  VLWDTLPVSVTLQLILVF------SQRTGLCCMSALLVSAILCLVGCRIYNDIRFCMMFQ  175

Query  398  TVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHV  219
             +  +AI  +A     +YTHS YW  + G  LLA+   + D+ + ++S + ++GH+L+H+
Sbjct  176  LILPLAIPAVAFMYRSKYTHSGYWFLSTGIYLLAKFEGVTDRKLCRISTYFITGHSLEHL  235

Query  218  FGAILAVILTLMLAQRDIQTERI  150
              A++ + L +ML  R+++ +R+
Sbjct  236  CLALIPISLGIMLIYRELKFQRL  258



>ref|XP_003588985.1| hypothetical protein MTR_1g016080 [Medicago truncatula]
 gb|AES59236.1| alkaline phytoceramidase (APHC) [Medicago truncatula]
Length=280

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 141/229 (62%), Gaps = 0/229 (0%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            P+IP+   +H FAD R   G+P TL+V +NFPFL +G+ GL L   G +  IS Q E   
Sbjct  45   PKIPRSPTHHQFADLRNLLGVPNTLNVITNFPFLVVGVLGLVLTLEGGFFTISSQAETWA  104

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            W +FY GI  VAFGS YYHL P+++R++WD LPM +A + + S  VIER+ ++ G+  + 
Sbjct  105  WILFYAGIIGVAFGSVYYHLKPDNNRVLWDTLPMMVAYSSLFSSLVIERIGQRIGLCCMC  164

Query  476  PSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLA  297
              L      V+Y R +DD+R   M + +  +AI   A   P  YTH+ YW  + G  LLA
Sbjct  165  ALLFAAFTCVLYERIYDDIRLCLMFQFILPLAIAAAAFVYPSNYTHARYWFSSIGVYLLA  224

Query  296  RIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERI  150
            +   ++DK +Y+ + + +SGH+L+H+  A++  +L++ML  R+ + +R+
Sbjct  225  KFEAVSDKKLYRANNYVISGHSLEHLCLALIPFLLSVMLIYRERKLKRL  273



>ref|WP_031435672.1| hypothetical protein [Methylomarinum vadi]
Length=250

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 144/252 (57%), Gaps = 7/252 (3%)
 Frame = -3

Query  923  TRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNF  744
            T +A      L + G  +L F+ ++    P +PQ  AYH FADKR +  +P   D+ SN 
Sbjct  3    TNKANRSSVVLLLIGFIVL-FIAIVQTTDP-LPQDNAYHQFADKRPWLSLPNFFDIISNL  60

Query  743  PFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDR  564
            PF  IG+AGL LC   N   I     ++ W+VF+TG+  V  GSSYYH  PN+  L WDR
Sbjct  61   PFAGIGVAGLILCLKDNPRLI-----IVSWSVFFTGLTLVCIGSSYYHWQPNNATLFWDR  115

Query  563  LPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPII  384
            LPM I+   +L+  + E V  +R  L +  +LL+G+ SV+YWR   DLR YA V+   ++
Sbjct  116  LPMTISFMALLAALLTENVWPRREQLLLPCALLLGLSSVVYWRVSHDLRFYAFVQFGTLL  175

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
            AI L+ +    RYTH  Y L+     +LA++ EL D+ I++L+   +SGHTLKH+  A  
Sbjct  176  AIPLVVMVGKKRYTHRHYLLYGLLFYILAKLFELNDREIFRLTGQSLSGHTLKHLAAAAA  235

Query  203  AVILTLMLAQRD  168
               +  ML QR 
Sbjct  236  TYCVYRMLKQRS  247



>gb|ACN27189.1| unknown [Zea mays]
Length=167

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            ++IF+IERVD++ G  S+ P ++ G  S++YWR FDDLRPYA+V+ VP IA+ +MA+ IP
Sbjct  1    MAIFIIERVDDRAGAKSLAPLVIAGALSIMYWRHFDDLRPYAVVQFVPCIALPVMAIVIP  60

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
            P YTHS+YWLWAAG  LLA++ E ADK IY  +   VSGHTLKH+  A++ V L LMLA+
Sbjct  61   PMYTHSSYWLWAAGFYLLAKVEEAADKTIYNWTHQIVSGHTLKHLCAAMVPVFLALMLAK  120

Query  173  RDIQTERISLLQRWRMS  123
            R  + ERISLLQ+W+ S
Sbjct  121  RTTEPERISLLQKWKTS  137



>emb|CDH46891.1| conserved membrane hypothetical protein [Candidatus Contendobacter 
odensis Run_B_J11]
Length=278

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 138/242 (57%), Gaps = 8/242 (3%)
 Frame = -3

Query  872  ILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            ILC V  L+L  P +PQ   YH FAD R   GI   LDV SN  FL +G+AGL + + G 
Sbjct  13   ILCIVAALLL--PAVPQSPEYHHFADHRDLLGIANFLDVVSNLGFLIVGIAGLVIVF-GG  69

Query  692  YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
              +   + E   + VF+ G    A GS YYHL P+++ L WDRLPM IA  G+++  +++
Sbjct  70   RAQFEFRSERWPYAVFFLGALLTALGSGYYHLAPDNESLFWDRLPMTIAFMGLVASQIVD  129

Query  512  RVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPR  348
            R++ + G+  ++P LL+G  SVIYWR  +     ++ PY +++   ++ ++L+A+  P R
Sbjct  130  RINIRAGLALLVPMLLIGAASVIYWRATERAGAGNVIPYGILQGYSVVIVLLLAMLSPSR  189

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YT      W  G  +L++I E  D  +       VSGHTLKH+  A+  + +  ML +R 
Sbjct  190  YTRGNDLYWVFGWYVLSKILETFDAQVLDYLGGVVSGHTLKHIAAALAGLTVCSMLVRRT  249

Query  167  IQ  162
            ++
Sbjct  250  LK  251



>ref|WP_034435626.1| hypothetical protein, partial [Candidatus Contendobacter odensis]
Length=250

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 137/241 (57%), Gaps = 8/241 (3%)
 Frame = -3

Query  872  ILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            ILC V  L+L  P +PQ   YH FAD R   GI   LDV SN  FL +G+AGL + + G 
Sbjct  13   ILCIVAALLL--PAVPQSPEYHHFADHRDLLGIANFLDVVSNLGFLIVGIAGLVIVF-GG  69

Query  692  YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
              +   + E   + VF+ G    A GS YYHL P+++ L WDRLPM IA  G+++  +++
Sbjct  70   RAQFEFRSERWPYAVFFLGALLTALGSGYYHLAPDNESLFWDRLPMTIAFMGLVASQIVD  129

Query  512  RVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPR  348
            R++ + G+  ++P LL+G  SVIYWR  +     ++ PY +++   ++ ++L+A+  P R
Sbjct  130  RINIRAGLALLVPMLLIGAASVIYWRATERAGAGNVIPYGILQGYSVVIVLLLAMLSPSR  189

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YT      W  G  +L++I E  D  +       VSGHTLKH+  A+  + +  ML +R 
Sbjct  190  YTRGNDLYWVFGWYVLSKILETFDAQVLDYLGGVVSGHTLKHIAAALAGLTVCSMLVRRT  249

Query  167  I  165
            +
Sbjct  250  L  250



>gb|EAZ10900.1| hypothetical protein OsJ_00743 [Oryza sativa Japonica Group]
Length=202

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 120/178 (67%), Gaps = 0/178 (0%)
 Frame = -3

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            SL+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM I+ + +LSI VIERVDE
Sbjct  21   SLRWEALGWFLFYAGNVAAAFGSAYYHLKPDDDRLIWDRLPMMISASSMLSILVIERVDE  80

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G+  ++  L + + S    R  DD+R + ++ + P IAI  M    PP+YTHS +W  
Sbjct  81   RAGLSCLLSLLSLILVSSACERVLDDMRLWVVLNSAPCIAIPAMLFLFPPKYTHSRFWFL  140

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERIS  147
            A G  LLAR   LAD+ +Y ++ + +SGH+L+H+  A++ +ILT+ML+ R+++  R S
Sbjct  141  ATGFYLLARFEGLADRKVYSVNRYFISGHSLEHLCFAMVTLILTVMLSFRNVKIVRSS  198



>gb|EEC70111.1| hypothetical protein OsI_00770 [Oryza sativa Indica Group]
Length=274

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 120/178 (67%), Gaps = 0/178 (0%)
 Frame = -3

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            SL+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM I+ + +LSI VIERVDE
Sbjct  93   SLRWEALGWFLFYAGNVAAAFGSAYYHLKPDDDRLIWDRLPMMISASSMLSILVIERVDE  152

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
            + G+  ++  L + + S    R  DD+R + ++ + P IAI  M    PP+YTHS +W  
Sbjct  153  RAGLSCLLSLLSLILVSSACERVLDDMRLWVVLNSAPCIAIPAMLFLFPPKYTHSRFWFL  212

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTERIS  147
            A G  LLAR   LAD+ +Y ++ + +SGH+L+H+  A++ +ILT+ML+ R+++  R S
Sbjct  213  ATGFYLLARFEGLADRKVYSVNRYFISGHSLEHLCFAMVTLILTVMLSFRNVKIVRSS  270



>ref|WP_035665038.1| hypothetical protein [Bradyrhizobium sp. Ec3.3]
Length=248

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 128/218 (59%), Gaps = 15/218 (7%)
 Frame = -3

Query  824  QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVF  645
            Q ++YH FAD+R+ FG+P   +V SN PF+A+G  GLA        +I          V 
Sbjct  34   QDQSYHQFADQRELFGVPNFWNVASNLPFIAVGAFGLA--------QIRRDATTF---VL  82

Query  644  YTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLL  465
            + GI    FGSSYYHL+PNDD L WDRLPM +  A IL+  V ERVD K G + + P L 
Sbjct  83   FAGIFLTGFGSSYYHLDPNDDTLFWDRLPMTLCFAAILAAVVEERVDAKAGAMLLRPLLA  142

Query  464  VGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGE  285
            +G+ S++ WR  DDLR YA  +  P +A++L+    P +YT + +W+ AAG   LA++ E
Sbjct  143  IGIFSLLLWRWTDDLRLYAWAQFFPFLALLLILSLFPAKYTGTPFWVGAAGLYALAKLLE  202

Query  284  LADKPIYKLSLHRV-SGHTLKHVFGAILAVILTLMLAQ  174
              D  +Y  S  R+ SGHTLKH+  A  A    LML Q
Sbjct  203  YYDHEVY--SFGRILSGHTLKHL-SAAAACFAILMLFQ  237



>gb|KHG02301.1| Cholinephosphotransferase 1 [Gossypium arboreum]
Length=220

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 131/241 (54%), Gaps = 55/241 (23%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            GVA+LC++  +ML+TP+IP     H +AD R F G+P TL+V +NFPFL +G+ G  LC 
Sbjct  18   GVALLCWL-FIMLVTPKIPLSYRNHLYADMRNFVGVPNTLNVITNFPFLIVGVLGFVLCL  76

Query  701  YG-NYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
             G ++  I L GE+ GW +FY G A+VAFGS+YYHL P+D+R++ D LP+          
Sbjct  77   GGGSFFNIRLPGEMWGWLLFYGGTASVAFGSAYYHLRPDDNRVLLDTLPL----------  126

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
                           IP +                            AI +M    PP+Y
Sbjct  127  ---------------IPCI----------------------------AIPIMTFLFPPKY  143

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            THS YWLW  G  +LA++  LAD  IY+ + + +SGH+L+H+  AI  V++T+ML  R  
Sbjct  144  THSRYWLWTVGVFILAKMEALADMKIYRANNYIISGHSLEHLCSAIAPVLVTVMLMHRSC  203

Query  164  Q  162
            +
Sbjct  204  R  204



>gb|AFO66499.1| putative membrane protein [Brassica napus]
Length=202

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 116/175 (66%), Gaps = 0/175 (0%)
 Frame = -3

Query  677  LQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEK  498
            L+GE+ GWT+FY  ++++AFGS+YYHL P+D+R+VWD LP+ IA + + S F++ER  E+
Sbjct  28   LKGEIWGWTLFYASVSSLAFGSAYYHLKPDDNRIVWDTLPILIAYSSLFSSFLVERAGER  87

Query  497  RGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWA  318
             G+  ++  L + V SV Y R F+DLR     + +P + I +M + +PP+YTHS +WL A
Sbjct  88   VGLSCLVLLLFISVFSVAYARVFNDLRLCLTFQLIPCLVIPVMTVLLPPKYTHSRFWLLA  147

Query  317  AGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTER  153
                 +++I  LAD  IY  + + +SGH+L H+  A+  V+LT+ML  R I+  R
Sbjct  148  TAAHAVSKIEGLADSKIYNFNGYTISGHSLGHLCSALAMVLLTVMLLYRSIRFPR  202



>gb|EMT24036.1| hypothetical protein F775_07873 [Aegilops tauschii]
Length=244

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 120/194 (62%), Gaps = 2/194 (1%)
 Frame = -3

Query  890  SVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLA  711
            ++ G A+L    LL++ TPR+    A H FAD R   G+P TL+V + +P L  G+ GL 
Sbjct  33   AIAGGAVLA-SALLLVATPRLRHSPALHLFADMRNLLGVPNTLNVLTAYPLLLAGVPGLI  91

Query  710  LCYYGN-YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
            LC +G     ISL+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM ++ + +
Sbjct  92   LCLFGGGCFGISLRWEALGWFLFYVGNVGAAFGSAYYHLKPDDDRLIWDRLPMMMSASSL  151

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            LSI VIERVDE+ G+  +I  L + + S    R  DD+R + ++  VP +AI  M     
Sbjct  152  LSILVIERVDERAGLSCLISLLSLLLVSSACERILDDMRLWVVLNLVPCVAIPAMLFLFA  211

Query  353  PRYTHSTYWLWAAG  312
            P+YTHS +W  A G
Sbjct  212  PKYTHSRFWFLATG  225



>emb|CAN80191.1| hypothetical protein VITISV_042374 [Vitis vinifera]
Length=297

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 111/174 (64%), Gaps = 0/174 (0%)
 Frame = -3

Query  674  QGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKR  495
            + EV GW ++Y G  +VAFGSSYYHL P+D+R++WD+LP+ IA + + + F++ERV E  
Sbjct  101  RAEVWGWALYYAGTTSVAFGSSYYHLKPDDNRVIWDKLPIMIAYSSLFASFIMERVGEMI  160

Query  494  GILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAA  315
            G+  +    LV +  V   R F+DLR   M + +P IAI  M     P+YTHS YWL A 
Sbjct  161  GLTCLFTLNLVALVGVACERAFNDLRLCMMFQLIPGIAIPAMTFMFTPKYTHSRYWLCAT  220

Query  314  GCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTER  153
            G  LLA+   +AD  +Y+ + + +SGH+L+H+   I  V+LTLML  R I+T R
Sbjct  221  GVYLLAKFESVADNKVYRATWYLISGHSLEHLCSVIFPVLLTLMLIFRSIKTPR  274



>ref|WP_011381118.1| hypothetical protein [Nitrosospira multiformis]
 ref|YP_412490.1| hypothetical protein Nmul_A1801 [Nitrosospira multiformis ATCC 
25196]
 gb|ABB75098.1| conserved hypothetical protein [Nitrosospira multiformis ATCC 
25196]
Length=256

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 139/241 (58%), Gaps = 12/241 (5%)
 Frame = -3

Query  860  VVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLA--LCYYGNYV  687
            ++LL  + P IPQP +YH FAD R  FGIP   +V SNF FL +G+AGL   L   G+  
Sbjct  1    MLLLATIVPPIPQPSSYHHFADSRDCFGIPNCFNVISNFAFLFVGVAGLVFLLNSRGSCA  60

Query  686  --KISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
                +L  E   + + +  +A V FGS+YYHL P++DRL+WDRLP+AI +  +L+  + +
Sbjct  61   AKTFTLPSERWPFMILFLNVALVCFGSAYYHLAPDNDRLIWDRLPIAIGIMALLAATIND  120

Query  512  RVDEKRGILSIIPSLL-VGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPP  351
            R+  K G   ++P L+ +G G+V+ W     R   +L  Y +V+   ++ IVL+ ++   
Sbjct  121  RIGPKAGT-RLLPVLIAIGAGTVLNWYWSEQRGVGNLNFYVVVQFYSLLVIVLLGVFFRS  179

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
            RYT       A G   LA++ E  D+PIY L  H +SGH++KH+  A     +  ML +R
Sbjct  180  RYTRGRDIYTALGLYALAKVAEFTDRPIYALG-HAISGHSVKHLLAACAIYWVLRMLRKR  238

Query  170  D  168
            +
Sbjct  239  E  239



>ref|WP_036576277.1| alkaline phytoceramidase [Nitrosospira briensis]
Length=270

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 136/246 (55%), Gaps = 12/246 (5%)
 Frame = -3

Query  854  LLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL----CYYGNYV  687
            L+  + P IPQP+AYH FAD R FFGIP   DVTS   FL +G+AGL      C +G   
Sbjct  17   LIAAIVPPIPQPQAYHQFADARYFFGIPNFCDVTSGVAFLFVGVAGLRFLLDPCGWGAAG  76

Query  686  KISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERV  507
                  E   + + +  +A   FGS YYHL P++DRL+WDRLP+AI +  +L+  + ER+
Sbjct  77   AFVEPSERWPYLILFLSVAMACFGSGYYHLMPDNDRLMWDRLPIAIGITALLAATLNERI  136

Query  506  DEKRGILSIIPSLL-VGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRY  345
            + K G   ++P L+ +G G+V++W     R   +L  Y  V+   ++ ++L+A++   RY
Sbjct  137  NPKLGS-RLLPVLVAIGAGTVVHWHWSEQRGIGNLNFYVFVQFYSLLTVILLAIFFQSRY  195

Query  344  THSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
            T       A      A++ EL D+ IY L  H +SGHT KH+  A     +  ML +R+ 
Sbjct  196  TRGADIYVALALYGFAKLAELEDQEIYDLG-HVISGHTAKHLLAAAGVYCILHMLGKREP  254

Query  164  QTERIS  147
              E++ 
Sbjct  255  LPEKLE  260



>ref|WP_028108575.1| hypothetical protein [Ferrimonas futtsuensis]
Length=253

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 136/249 (55%), Gaps = 7/249 (3%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L V    +L   VLL+ L P I Q  +YHDFAD R+  GIP  LDV S+  F  +G+ G+
Sbjct  10   LGVLAAVMLVPFVLLVGLAP-IQQDPSYHDFADTREVLGIPNGLDVLSSLAFSLVGVLGV  68

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
                  ++V+  L+     W   +  +  V  GS+YYH  P+D  LVWDRLPMA+   G+
Sbjct  69   I-----HFVRGRLEACRGAWPAVFVSLVLVGLGSAYYHWRPSDATLVWDRLPMALGFMGV  123

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            L   + E +  +   L ++P+L++G+ SV YW   +DL  Y  V+ +P++ I L+ +  P
Sbjct  124  LVALLSEHLHARVATL-LVPALVLGLASVSYWYWREDLWLYVWVQLMPVLIIPLVVVLFP  182

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQ  174
              Y+H    L   GC LLA++ EL D  ++  +   +SGHTLKH+  A+    + LML Q
Sbjct  183  SGYSHQWLLLVCFGCYLLAKVAELYDGAVFGATAGWISGHTLKHLLAAMGGYAILLMLKQ  242

Query  173  RDIQTERIS  147
            R      +S
Sbjct  243  RRPSQGMVS  251



>ref|WP_011685468.1| hypothetical protein [Candidatus Solibacter usitatus]
 ref|YP_824994.1| hypothetical protein Acid_3738 [Candidatus Solibacter usitatus 
Ellin6076]
 gb|ABJ84709.1| conserved hypothetical protein [Candidatus Solibacter usitatus 
Ellin6076]
Length=241

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 127/226 (56%), Gaps = 8/226 (4%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQG--  669
              P I Q   YH+FAD+R  FGIPY  +V SN PFL + L GL     G   K + +   
Sbjct  19   FVPPIAQDAGYHNFADQRTLFGIPYFWNVVSNLPFLLVALWGLR----GLRSKTAFEETW  74

Query  668  EVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI  489
            E + + +F  GIA VAFGSSYYH  PN+D LVWDRLPM I    +LSI + ER+  + G 
Sbjct  75   ERVAYGIFLFGIALVAFGSSYYHARPNNDMLVWDRLPMTIGFMSLLSIAIGERISSRAGR  134

Query  488  LSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGC  309
            + + P + VG+ SV++W+   DLR Y  V+   ++A+ LM    PPRYT +   +  A  
Sbjct  135  MLLFPLIAVGIASVLFWQSSGDLRFYGFVQFYTLLALPLMVALFPPRYTGTGGLVALAAF  194

Query  308  LLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
             ++A++ E  D  I ++ +    GH  KHV  AI  +   + + +R
Sbjct  195  YVVAKLLESFDHTIGRVIV--TGGHPWKHVAAAIGVLCYVISVERR  238



>ref|WP_036503285.1| hypothetical protein [Nitrosococcus oceani]
 gb|KFI21408.1| hypothetical protein HW44_15265 [Nitrosococcus oceani]
Length=258

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 140/264 (53%), Gaps = 18/264 (7%)
 Frame = -3

Query  935  INTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDV  756
            + TN+      G  L++     L  + L+ LL P IPQ  AYH F D+R F GIP   DV
Sbjct  1    METNSSSVGATGWRLAILLGFFLSTIGLMFLLAP-IPQDLAYHAFVDRRSFLGIPNFFDV  59

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISLQG---EVL-GWTVFYTGIATVAFGSSYYHLNPN  588
             SN PF+ IG+ G         V+ SL     +VL  W  F+  ++ V  GS+YYH  P+
Sbjct  60   VSNLPFVLIGIFG---------VRASLGRLPRDVLPAWLTFFIAVSLVGVGSAYYHWAPD  110

Query  587  DDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYA  408
            +D LVWDRLPM +   G+    + E +D +     + P++L+G  SVIYW   DDLR YA
Sbjct  111  NDTLVWDRLPMTVGFMGLFVALLGEYLDRRLVQRLLYPAVLIGACSVIYWHLMDDLRFYA  170

Query  407  MVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTL  228
             V+ +P+  I ++      R+  +   L A G  +LA++ E  D  I++L    +SGHTL
Sbjct  171  WVQFMPLAMIAMLLTLYRSRFEQNGLLLIALGFYVLAKVVEYYDAEIFQLLGENLSGHTL  230

Query  227  KHVFGA----ILAVILTLMLAQRD  168
            KH+  +     +AV++T    + D
Sbjct  231  KHLLASAGCLTIAVLVTKWNGKHD  254



>ref|WP_002812888.1| hypothetical protein [Nitrosococcus oceani]
 ref|YP_344915.1| hypothetical protein Noc_2940 [Nitrosococcus oceani ATCC 19707]
 gb|ABA59385.1| conserved hypothetical protein [Nitrosococcus oceani ATCC 19707]
 gb|EDZ65868.1| hypothetical protein NOC27_2548 [Nitrosococcus oceani AFC27]
 gb|KFI18122.1| hypothetical protein IB75_15610 [Nitrosococcus oceani C-27]
Length=258

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/264 (36%), Positives = 140/264 (53%), Gaps = 18/264 (7%)
 Frame = -3

Query  935  INTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDV  756
            + TN+      G  L++     L  + L+ LL P IPQ  AYH F D+R F GIP   DV
Sbjct  1    METNSSSVGATGWRLAILLGFFLSTIGLMFLLAP-IPQDLAYHAFVDRRSFLGIPNFFDV  59

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISLQG---EVL-GWTVFYTGIATVAFGSSYYHLNPN  588
             SN PF+ IG+ G         V+ SL     +VL  W  F+  ++ V  GS+YYH  P+
Sbjct  60   VSNLPFVLIGIFG---------VRASLGRLPRDVLPAWLAFFIAVSFVGVGSAYYHWAPD  110

Query  587  DDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYA  408
            +D LVWDRLPM +   G+    + E +D +     + P++L+G  SV+YW   DDLR YA
Sbjct  111  NDTLVWDRLPMTVGFMGLFVALLGEYLDRRLVQRLLYPAILIGACSVVYWHLMDDLRFYA  170

Query  407  MVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTL  228
             V+ +P+  I ++      R+  +   L A G  +LA++ E  D  I++L    +SGHTL
Sbjct  171  WVQFMPLAMIAMLLTLYRSRFEQNGLLLIALGFYVLAKVVEYYDAEIFQLLGENLSGHTL  230

Query  227  KHVFGA----ILAVILTLMLAQRD  168
            KH+  +     +AV++T    + D
Sbjct  231  KHLLASAGCLTIAVLVTKWNGKHD  254



>ref|WP_012325438.1| hypothetical protein [Shewanella woodyi]
 ref|YP_001761197.1| hypothetical protein Swoo_2827 [Shewanella woodyi ATCC 51908]
 gb|ACA87102.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908]
Length=270

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 133/236 (56%), Gaps = 10/236 (4%)
 Frame = -3

Query  869  LCFVVLLMLLTPR-IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            + FV LL + +   IPQP  YH+FAD+R    +P  ++V SN PFL IG+ GL       
Sbjct  25   IVFVPLLWIFSLEPIPQPSVYHEFADQRDLIYLPNFMNVLSNIPFLIIGVLGL-------  77

Query  692  YVKISL-QGEVL-GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            Y  +S+ Q  VL GWT+ + GI  V  GSSYYH +P+++ LVWDRLPM     G+    +
Sbjct  78   YQTMSIYQWRVLNGWTLLFIGILLVFAGSSYYHWSPSNNSLVWDRLPMTFGFMGLFVALI  137

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTH  339
             E V  K   + ++P+L +G+ SV YW   DDLR Y  V+ VP++ + ++ L  P  Y+H
Sbjct  138  GEYVSSKLSEMILLPALFIGILSVSYWHWTDDLRFYYWVQLVPLLTLPIILLLFPRIYSH  197

Query  338  STYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
                  A  C +LA+I E+ D  I+  +   +SGHT+KH+  A     +  ML  R
Sbjct  198  HKLLFLAFACYVLAKIAEVYDLNIFLATGELISGHTVKHLLAASGCYFILCMLRNR  253



>ref|WP_013221742.1| hypothetical protein [Nitrosococcus watsonii]
 ref|YP_003762000.1| hypothetical protein Nwat_2942 [Nitrosococcus watsonii C-113]
 gb|ADJ29679.1| conserved hypothetical protein [Nitrosococcus watsonii C-113]
Length=258

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 130/246 (53%), Gaps = 14/246 (6%)
 Frame = -3

Query  935  INTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDV  756
            + TN+      G  L+V  +      + LM     IPQ  AYH FAD+R   GIP   DV
Sbjct  1    METNSLSVGATGWRLAVL-LGFFFGTMALMFWVAPIPQDLAYHAFADRRSLLGIPNFFDV  59

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISL----QGEVLGWTVFYTGIATVAFGSSYYHLNPN  588
             SN PF+ IG+ G         V++SL    +  +  W +F+  ++ V  GS+YYH  P+
Sbjct  60   ISNLPFVLIGILG---------VRVSLGRLPRAILPAWLMFFMAVSLVGVGSAYYHWAPD  110

Query  587  DDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYA  408
            +D LVWDRLPM +    +    + E +D +     + P++L+G  SV+YW   DDLR YA
Sbjct  111  NDTLVWDRLPMTVGFMSLFVALLGEYLDRRLVQRLLYPAVLIGACSVVYWHFMDDLRFYA  170

Query  407  MVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTL  228
             V+ +P+  I ++      R+  +   L A GC +LA++ E  D  I++L    VSGHTL
Sbjct  171  WVQFMPLTMIAMLLTLYRSRFEQNGLLLIALGCYVLAKVVEYYDAEIFQLLGATVSGHTL  230

Query  227  KHVFGA  210
            KH+  +
Sbjct  231  KHLLAS  236



>ref|WP_040524243.1| hypothetical protein [Legionella shakespearei]
Length=250

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 138/247 (56%), Gaps = 15/247 (6%)
 Frame = -3

Query  878  VAILCF-VVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAG-LALC  705
            +A++ F + L++L TPRIPQ   YH FAD R F+GIP   +V SN PF+ I + G ++L 
Sbjct  4    IALIVFSLTLIVLFTPRIPQWPDYHHFADTRTFWGIPNFWNVISNLPFILISILGFISLK  63

Query  704  YYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
               +Y+    + E + + + + G   +  GSSYYH  P+++ LVWDR+PM +    +LS+
Sbjct  64   KQADYLN---KKERIVFFILFLGAFFIGLGSSYYHWAPDNNTLVWDRIPMTVVFMSLLSL  120

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALW  360
             ++ERV+   G   +IP +  G+ SV+YW   +     D+R YA+ +   +  I+ + L 
Sbjct  121  TIMERVNLNLGFWLLIPLIAFGICSVLYWHHTELTGQGDIRLYAITQFYSMFVIMFVLLL  180

Query  359  IPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA----ILAVIL  192
             P  Y     +LW      LA++ E  D+PIY L  H +SGHTLKH   A     + VIL
Sbjct  181  FPKPYPPLNRYLWMFLFYGLAKMAEYFDRPIYNLG-HVLSGHTLKHFLAATSVYFVVVIL  239

Query  191  TLMLAQR  171
               L +R
Sbjct  240  NDSLVKR  246



>gb|KHN32207.1| hypothetical protein glysoja_035300 [Glycine soja]
Length=217

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 122/208 (59%), Gaps = 5/208 (2%)
 Frame = -3

Query  926  NTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF---GIPYTLDV  756
            N RQ R + +   + G   LC  + L+  TPRIP+   +H F D R      G+P TL+V
Sbjct  10   NNRQCR-RWTTSRIWGATFLC-CMCLIFFTPRIPRSPKHHQFVDMRNLLDSPGVPNTLNV  67

Query  755  TSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRL  576
             +NFPFL +G+ GL L   G    IS QGEV  W +FY GIA VAFGS+YYHL P+D R+
Sbjct  68   MTNFPFLVVGVLGLVLALEGGVFNISSQGEVWTWALFYAGIAGVAFGSAYYHLKPDDHRV  127

Query  575  VWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVET  396
            +WD LPM +A + +LS  V+ER+ ++ G+  +    L     V+Y R ++D+R   M + 
Sbjct  128  LWDTLPMMVAFSSLLSSLVVERLGQRIGLCCMFALNLAAFLCVVYERIYNDIRFCMMFQL  187

Query  395  VPIIAIVLMALWIPPRYTHSTYWLWAAG  312
               +AI ++A+    +YTHS YW  + G
Sbjct  188  TLPLAIPVIAVLYRSKYTHSRYWFISTG  215



>emb|CDM86752.1| unnamed protein product [Triticum aestivum]
Length=525

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 129/242 (53%), Gaps = 55/242 (23%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            ++LML+ P IP  + YHDFAD+R  F GIP TL+V S  PF+ +GLAGL L    N+ + 
Sbjct  17   IVLMLVIPAIPHDEDYHDFADQRTLFLGIPNTLNVISIIPFIFVGLAGLIL----NHCES  72

Query  680  SLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            S +G    +T+F+ G++ V FGS +YHLNP +D L WD LPM +      +IF+IER D+
Sbjct  73   SQRGL---YTIFFAGVSVVGFGSFFYHLNPKNDSLFWDTLPMMVTFTSFEAIFIIERFDD  129

Query  500  KRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
              G  S                                             +  ++YWL 
Sbjct  130  LAGTKS---------------------------------------------FASTSYWLC  144

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD--IQTERIS  147
            AAG  +LAR+ E+ADKPIY  +LH VSGHTL H+  A++ +   L+L +R   IQ ER  
Sbjct  145  AAGFYVLARVQEVADKPIYTWTLHIVSGHTLGHLCAAMVPLFYILLLEKRTRPIQPERHM  204

Query  146  LL  141
            +L
Sbjct  205  IL  206



>ref|WP_029448136.1| hypothetical protein [Candidatus Odyssella thessalonicensis]
Length=251

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 128/240 (53%), Gaps = 12/240 (5%)
 Frame = -3

Query  872  ILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            I CF        P I QP  YH+FAD+R ++ IPY  +V SN  FL +G+ GL      +
Sbjct  11   IFCF-------CPAISQPLDYHNFADQRTYYNIPYFYNVLSNLGFLIVGVMGLIFLNVSS  63

Query  692  YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
                    E     +F+  +   A+GS+YYH NPN+  L WDRLP+AIAL    +  + +
Sbjct  64   MHGFKDAKEKRMHKLFFLALILGAYGSAYYHWNPNNLTLFWDRLPVAIALMIFQAAIIGD  123

Query  512  RVDEKRGILSIIPSLLVGVGSVIYWR-----RFDDLRPYAMVETVPIIAIVLMALWIPPR  348
             V  + G   ++P +L+G  SVIYW+     +  DLR Y +V+ +P + I +M   +P R
Sbjct  124  HVTTQLGHRMLVPLMLLGAASVIYWQYTEMNQHGDLRFYGLVQLLPSLIIPIMLWKLPSR  183

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            YTH+ Y   A   + L R  E  D  IY LS + +SGHT+KH+  A  +  +   L +R+
Sbjct  184  YTHTCYLWGAVAYMSLGRAAEFLDHQIYALSGNLISGHTVKHLSLAAASYAILQHLRKRE  243



>ref|WP_005010110.1| hypothetical protein [Nitrospina gracilis]
 emb|CCQ91429.1| conserved membrane hypothetical protein [Nitrospina gracilis 
3/211]
Length=262

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 131/248 (53%), Gaps = 7/248 (3%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALC--  705
            +A+  F VL +   P +PQ   YH+FAD     GIP   DVTSN  F+A+GL GLA+   
Sbjct  11   LAVTVFGVLAVFSFPPVPQDPDYHNFADTYSLLGIPNFGDVTSNLVFVAVGLMGLAVLTR  70

Query  704  YYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
              G      L  E   + + + G   + FGS YYH +P+D  L+WDRLPM +    + ++
Sbjct  71   VSGRQEVFYLPQEKWMFVLTFGGTIFIGFGSMYYHWSPDDANLLWDRLPMTVVFVSVFAL  130

Query  524  FVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALW  360
             + +R+  + G+ ++ P + VG+ SV+YW   +     DLRPY +V+ +P+I I L+   
Sbjct  131  VLADRLGPQVGVAALGPLVFVGLTSVLYWDHTERLGQGDLRPYVLVQFLPMILIPLLFFL  190

Query  359  IPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLML  180
             PPRY+ S  ++      ++A++ E  D  IY  +   VSGHTLKH+        L   L
Sbjct  191  FPPRYSGSVAFVSVLAWYVVAKVFEHFDAWIYSGTAEIVSGHTLKHIISGAALFFLVPYL  250

Query  179  AQRDIQTE  156
              R    E
Sbjct  251  QNRKRLKE  258



>ref|XP_010272339.1| PREDICTED: uncharacterized protein LOC104608144 [Nelumbo nucifera]
Length=176

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = -3

Query  620  FGSSYYHLNPNDDRL--VWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSV  447
            F S   H   N   L  +     M +A   I+SIF+IER+D+K+G +SIIP +L G+ S+
Sbjct  18   FESEGNHCTTNKSGLQTIESAYLMTLAFTSIMSIFIIERIDDKKGTVSIIPLVLTGIISI  77

Query  446  IYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPI  267
             YWR+  + + YA+V+ VP + I +MA+ +PP YTHS YWLWAA   LLA+I E  DKPI
Sbjct  78   FYWRQ--ECKIYALVQFVPCVVIPIMAILLPPMYTHSDYWLWAAAFYLLAKI-EAEDKPI  134

Query  266  YKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTER  153
            YK + H V+ HTLKH+F A++ + LTLML++R I  ER
Sbjct  135  YKWTSHVVNEHTLKHLFAAMVPLFLTLMLSKRRIAPER  172



>ref|WP_010960302.1| hypothetical protein [Methylococcus capsulatus]
 ref|YP_113477.1| hypothetical protein MCA1000 [Methylococcus capsulatus str. Bath]
 gb|AAU92939.1| conserved hypothetical protein [Methylococcus capsulatus str. 
Bath]
Length=262

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 135/233 (58%), Gaps = 12/233 (5%)
 Frame = -3

Query  845  LLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGE  666
            L  P IPQ  AYH FAD    FGIP   +V SN PFLA+GLAG+   Y G   + ++ GE
Sbjct  20   LFVPPIPQDPAYHRFADGTARFGIPNFWNVVSNLPFLAVGLAGVLDVYRG---RPAILGE  76

Query  665  V-LGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI  489
              + + +F+  +A VA GS+YYHLNP++  LVWDRLPM +A   + SI + E V    G 
Sbjct  77   FHIAYLIFFAAVALVAPGSAYYHLNPDNATLVWDRLPMTVAFMALFSIVLAEYVSVALGR  136

Query  488  LSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWL  324
              + P L++GV SV+YW   +     DLR Y +V+ +P++ I  + L    R+  + Y L
Sbjct  137  RLLWPLLVIGVVSVVYWDFTEAQGRGDLRLYGLVQFLPMLLIPPILLLFRSRFGGTAY-L  195

Query  323  WAA-GCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            WA  G   +A+  EL D+PI+++  H +SGH LKH+  A+   +    + +R 
Sbjct  196  WAVLGAYAVAKAAELLDEPIFRI-FHPLSGHALKHLLAALGVYVFLAAIRRRS  247



>ref|WP_011524850.1| hypothetical protein [Candidatus Koribacter versatilis]
 ref|YP_593125.1| hypothetical protein Acid345_4051 [Candidatus Koribacter versatilis 
Ellin345]
 gb|ABF43051.1| conserved hypothetical protein [Candidatus Koribacter versatilis 
Ellin345]
Length=238

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 133/232 (57%), Gaps = 8/232 (3%)
 Frame = -3

Query  848  MLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQG  669
            ++L PR+ QP  YHDFADKR   GIP   DV SN PF AI      +    +  +   + 
Sbjct  6    VMLVPRVAQPAWYHDFADKRGLLGIPNFGDVASNIPF-AILGVLGLVFLLQHRERFVDRR  64

Query  668  EVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI  489
            E   +   + G+     GSSYYHL P++ RL+WDR+PM I   G+++  + ER+  K G+
Sbjct  65   EQWPYLAVFVGLVLTCVGSSYYHLAPDNARLLWDRIPMTIVFMGMVASVIAERISLKAGL  124

Query  488  LSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWL  324
            +++   L +GV SV+ W R +     DLR YA V+ +   AI+L+AL + P+YT S+   
Sbjct  125  VALPFLLALGVLSVLQWYRSELLGAGDLRFYASVQ-IYAGAILLVALLLRPKYTRSSDLA  183

Query  323  WAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
               G  ++A++ E  DKPI+ +  H VSGHTLKH+ GA     +  ML +R+
Sbjct  184  IVVGWYVVAKLLESFDKPIFSVG-HIVSGHTLKHLAGAAAGFWILRMLQRRE  234



>ref|WP_017842421.1| Alkaline phytoceramidase (aPHC) [Methylomicrobium buryatense]
Length=256

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 138/236 (58%), Gaps = 9/236 (4%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKIS  678
            V+LM   P IPQ + YH+FAD+R+  GI +  +V SN PF+ +GL G+   +  +  KI 
Sbjct  21   VILMFFFPAIPQDRFYHEFADQRELLGIKHFFNVVSNLPFILVGLVGIKTLFSVDRSKIV  80

Query  677  LQGEVL-GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDE  501
            +   VL  + +F++ +A V FGS YYHL+PN+  L+WDRLP+ +A     S+ V E + E
Sbjct  81   VV--VLPSYILFFSSVALVGFGSIYYHLDPNNRTLIWDRLPITLAFMSFFSVIVGEYISE  138

Query  500  KRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHS  336
            +     + P LL G+ SV YW   +     DLR Y +V+ +P++ + L+ +   PR+TH 
Sbjct  139  EVASKLLYPLLLTGLVSVFYWYYSELQGRGDLRLYGLVQFLPLLLMPLILVMYKPRFTHG  198

Query  335  TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
              + +  G   +A+  E+AD P+Y   L+ +SGHTLKH+  A+   +    +A+R 
Sbjct  199  RAYWFFLGLYGVAKTFEVADSPVYHW-LYGISGHTLKHLLAALGCYVFLRQIAERQ  253



>gb|AEC33262.1| hypothetical protein 400.2 [Triticum aestivum]
Length=286

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 127/260 (49%), Gaps = 54/260 (21%)
 Frame = -3

Query  962  PFSLNMQRDINTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKF  783
            PF+  + R    N R+A   G+ L+           LL++ TPR+    A H FAD R  
Sbjct  19   PFAAAVLR--TDNRRRAIAGGAVLAS---------ALLLVATPRLRHSPALHLFADMRNL  67

Query  782  FGIPYTLDVTSNFPFLAIGLAGLALCYYGN------------------------------  693
             G+P TL+V + +P L  G+ GL LC +G                               
Sbjct  68   LGVPNTLNVLTAYPLLLAGVPGLILCLFGGGCFGISCHVAELQLPCRTTTVAMVARNSSC  127

Query  692  -------------YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMA  552
                            +SL+ E LGW +FY G    AFGS+YYHL P+DDRL+WDRLPM 
Sbjct  128  HVAELQLPWLLDCSCHLSLRWEALGWFLFYVGNVGAAFGSAYYHLKPDDDRLIWDRLPMM  187

Query  551  IALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVL  372
            ++ + +LSI VIERVDE+ G+  +I  L + + S    R  DD+R + ++  VP +AI  
Sbjct  188  MSASSLLSILVIERVDERAGLSCLISLLSLLLVSSACERILDDMRLWVVLNLVPCVAIPA  247

Query  371  MALWIPPRYTHSTYWLWAAG  312
            M     P+YTHS +W  A G
Sbjct  248  MLFLFAPKYTHSRFWFLATG  267



>ref|WP_026045863.1| alkaline phytoceramidase [Methylococcus capsulatus]
Length=254

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 131/233 (56%), Gaps = 12/233 (5%)
 Frame = -3

Query  845  LLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGE  666
            L  P IPQ  AYH FAD    FGIP   +V SN PFLA+GLAG+   Y G   + ++ GE
Sbjct  20   LFVPAIPQDPAYHRFADGTARFGIPNFWNVVSNLPFLAVGLAGVLEVYRG---RPAILGE  76

Query  665  V-LGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI  489
                + VF+  +A VA GS+YYHLNP++  LVWDRLPM +A   + SI + E V    G 
Sbjct  77   FRAAYLVFFAAVALVAPGSAYYHLNPDNATLVWDRLPMTVAFMALFSIVLAEYVSVALGR  136

Query  488  LSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWL  324
              + P L +G+ SV YW     R   DLR Y +V+ +P++ I  + L    R+  + Y L
Sbjct  137  RLLWPLLAIGIASVFYWDFTEARGRGDLRLYGLVQFLPMLLIPPILLLFRSRFGGTAY-L  195

Query  323  WAA-GCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            WA  G    A+  EL D+PI+++  H +SGH LKH+  A+   +    + +R 
Sbjct  196  WAVLGAYAAAKAAELLDEPIFRM-FHPLSGHALKHLLAALGVYVFLAAIRRRS  247



>ref|WP_008166542.1| hypothetical protein [Achromobacter arsenitoxydans]
 gb|EHK64106.1| hypothetical protein KYC_22231 [Achromobacter arsenitoxydans 
SY8]
Length=249

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 134/248 (54%), Gaps = 19/248 (8%)
 Frame = -3

Query  872  ILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            ++  V L M L   I Q + YHDFADKR + GIP   DV SN  F  +G  GL L     
Sbjct  9    VMALVALAMALYGPIAQLEHYHDFADKRAWLGIPNACDVLSNAGFAVVGWYGLVL-----  63

Query  692  YVKISLQGEVL-----GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
             V+ S     L     G+TVF+  +   AFGS +YHL P++DRL+WDRLP+A+  AGILS
Sbjct  64   -VRRSRHNPALDVIRPGYTVFFFALLLTAFGSGWYHLMPDNDRLIWDRLPIALLCAGILS  122

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMAL  363
                E V + R +  +  ++L  V SV +WR  D     DLRPY  V+ +P++ + L+  
Sbjct  123  AVWRETVGDGRWV-DVFWTVL-AVASVAWWRYTDNYATGDLRPYLFVQFMPLLLVPLLQW  180

Query  362  WIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLM  183
                      Y+  A GC +LA+  EL D  I++  +  +SGHTLKH+   +  +I+TL 
Sbjct  181  RNGTPLRERLYFGAAIGCYVLAKAAELLDYQIFQ-HVEYLSGHTLKHLASVLAGLIVTLN  239

Query  182  LAQRDIQT  159
             A R  + 
Sbjct  240  FAHRKREA  247



>ref|XP_010648353.1| PREDICTED: uncharacterized protein LOC100245671 isoform X2 [Vitis 
vinifera]
Length=196

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 104/175 (59%), Gaps = 8/175 (5%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VA+    + LM  TP+IP    +H FAD R F G+P TL+V +N+PFL +G+ G  LC  
Sbjct  18   VAVCLCWLCLMFATPKIPHSPKHHLFADMRNFLGVPNTLNVITNYPFLVLGVLGFVLCLS  77

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
            GN   IS + EV GW ++Y G  +VAFGSSYYHL P+D+R++WD+LP+ IA + + + F+
Sbjct  78   GNSFVISSRAEVWGWALYYAGTTSVAFGSSYYHLKPDDNRVIWDKLPIMIAYSSLFASFI  137

Query  518  IERVDEKRGILSIIP---SLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMAL  363
            +ERV E  G+  +       LVGV    Y     D+  +  + +  I+A+    L
Sbjct  138  MERVGEMIGLTCLFTLNLVALVGVACESY-----DIYVHTKIYSFEILALCYWCL  187



>ref|WP_034393606.1| hypothetical protein [Comamonas testosteroni]
 gb|KGH03470.1| hypothetical protein P608_25190 [Comamonas testosteroni]
 gb|KGH17359.1| hypothetical protein P607_17095 [Comamonas testosteroni]
 gb|KGH18781.1| hypothetical protein P606_24305 [Comamonas testosteroni]
Length=266

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 126/227 (56%), Gaps = 4/227 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G+A+L  + LLM   P + QP+ YH FAD+R + G+P+  DV SN  F+  GLAG     
Sbjct  31   GMALLFTLALLM---PGMAQPEHYHAFADRRGWLGVPHAADVLSNLGFVLAGLAGWVALA  87

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
              +Y K++     L   +F+TG+     GS+YYH  P D  LVWDRL M++A AG+LS+ 
Sbjct  88   RADYQKLNGTARALC-ALFFTGLLCSGAGSAYYHWAPQDSSLVWDRLGMSLAFAGLLSLA  146

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            V  R+D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+ 
Sbjct  147  VQTRIDDISARITAGVLLVAAPASVAVWAQTSNVLPWVLVQGGGMLTLLWLAFVAPRRHA  206

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILA  201
                  W  G  L+A++ E +D  ++ ++ H +SGH+LKH   A  A
Sbjct  207  LPMELGWVLGLYLVAKLLEFSDGDVFDVTAHSISGHSLKHWMAAAAA  253



>ref|WP_035416441.1| hypothetical protein [Ferrimonas kyonanensis]
Length=264

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 122/224 (54%), Gaps = 6/224 (3%)
 Frame = -3

Query  851  LMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQ  672
            L+ L P I Q  AYH FAD R   G+   L+V S+ PFL +G+ GL  C     ++    
Sbjct  28   LLTLAP-IAQSLAYHSFADVRTLLGVANGLNVLSSLPFLIVGILGLRYC-----LRTPSG  81

Query  671  GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
                 W   + G+A V   S+YYHLNP++  LVWDRL M I    +      E +  +  
Sbjct  82   PAYPPWWWLFAGVALVGLTSAYYHLNPSNATLVWDRLSMTIGFMALFIALTSEYLASRLI  141

Query  491  ILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
               ++P+LL+G  +V YW   DDLRPY  V+ +P++ I ++ +     Y+H    + A G
Sbjct  142  PKLLVPALLLGAATVAYWHWRDDLRPYIWVQLLPLLTIPVLMMLFSSGYSHQGVLVLAWG  201

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLML  180
            C L+A++ EL D+ I+  +   VSGHTLKH+F A+   ++  ML
Sbjct  202  CYLVAKVAELYDEAIFFSTQGVVSGHTLKHLFAAMGCYLILRML  245



>ref|WP_029049308.1| hypothetical protein [Cupriavidus sp. amp6]
Length=264

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 122/235 (52%), Gaps = 7/235 (3%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQ-GE  666
            L PRI QP  YH FAD    FG+P+ LD+ SN  FL  G AGL         +  +   E
Sbjct  29   LLPRIAQPPQYHRFADPYVCFGMPHCLDIGSNLLFLLAGAAGLRYLATSTGSRAFIAPAE  88

Query  665  VLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGIL  486
               + V +  +  V  GS+YYHL P++ RLVWDR P+A+AL   L   V ER   K G+ 
Sbjct  89   AWPYRVLFLAVFLVGLGSAYYHLAPDNQRLVWDRAPLALALMAWLGANVCERASLKAGLR  148

Query  485  SIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
             +   L+VG  SV YW     R   DLRPY +++   I+ + L+     PRYT     L 
Sbjct  149  LLPLLLIVGPASVGYWAWSEARGSGDLRPYLLIQACAIVVVPLLLCLYAPRYTGDRDVLA  208

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
              GC +LA + ++ D  I  L+   VSGHTLKHV  A+    + L L +R +  E
Sbjct  209  ITGCYVLALVCDVLDHQIAALT-GLVSGHTLKHVIAALAVYGVVLRLKRRRLVEE  262



>ref|XP_006580247.1| PREDICTED: uncharacterized protein LOC100783174 [Glycine max]
Length=134

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -3

Query  839  TPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVL  660
            TP IPQP+ YHDFA+KR+FFG+P   +V +NFPF+ IGL GL LC+  NY  ISLQGE+ 
Sbjct  23   TPSIPQPQRYHDFAEKREFFGLPNAPNVVANFPFMVIGLIGLVLCHRRNYFNISLQGELW  82

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIA  546
            GWT FY  + +VAFGSSYYHL P+D  LVWDR P  I 
Sbjct  83   GWTCFYVAVTSVAFGSSYYHLGPDDAGLVWDRFPFVIG  120



>ref|WP_033076902.1| hypothetical protein [Thalassotalea sp. ND16A]
 gb|KGJ99037.1| hypothetical protein ND16A_0425 [Thalassotalea sp. ND16A]
Length=251

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 123/226 (54%), Gaps = 7/226 (3%)
 Frame = -3

Query  872  ILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            I  FV+L  + TP + Q   YH FAD+  F+ IP TL+V SN PF+A+GL  L+     N
Sbjct  12   ITSFVILFFIFTPALSQSIEYHSFADQGNFYAIPNTLNVLSNLPFIAVGLYALSKIS-NN  70

Query  692  YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
              ++      L + +F+ G+     GSS+YHLNP +  L++DRL +A +   I S  + E
Sbjct  71   STRLFDHHLALNYQLFFAGLIATGIGSSFYHLNPTNFTLIFDRLGIAFSFMAIFSALLGE  130

Query  512  RVDEKRGILSIIPSLLVGVGSVIYW---RRFD--DLRPYAMVETVPIIAIVLMALWIPPR  348
             V  K G   ++P + +G+ SVIYW     F   DLR Y +V+ +P+I + ++ L     
Sbjct  131  FVSVKLGKKCLLPFIFIGIASVIYWGISEHFQQGDLRGYLLVQYLPMIILPIIVLTKTWP  190

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
            YT             +A++ EL D  +Y + +  VSGHTLKH+F A
Sbjct  191  YTDKNQCFTLITIYFIAKLCELFDNELYAV-IQIVSGHTLKHLFAA  235



>gb|AHE98487.1| hypothetical protein THITH_09665 [Thioalkalivibrio thiocyanoxidans 
ARh 4]
Length=237

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 123/219 (56%), Gaps = 14/219 (6%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY------YGNYVKISLQG  669
            +PQP+ YH FA     FG+P+  DV SN PFL +G+AGLA  +       G +++ S   
Sbjct  1    MPQPEEYHRFAATATVFGVPHFADVISNLPFLLVGIAGLAWTWRQRGQSSGPFIRAS---  57

Query  668  EVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI  489
            E   + V +  IA V  GS+YYH  P ++RL WDRLPM+IA   I +  + ER++ + G+
Sbjct  58   ERWPYIVLFGAIALVGIGSAYYHWAPTNERLFWDRLPMSIAFMAIFAAILSERIEYRLGL  117

Query  488  LSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWL  324
             ++   +L GV +  YW   +     DLR Y +V+ VPI+   L+ L    RY     ++
Sbjct  118  AALPGLVLAGVAATTYWLFSERAGAGDLRLYLLVQAVPIVIGPLLILLYGSRYDRGRDFV  177

Query  323  WAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAI  207
             AAG  LLA + E  D  ++ L+   +SGHTLKH+  A+
Sbjct  178  IAAGWYLLALLAESLDHTLHALTEGWLSGHTLKHLLAAV  216



>ref|WP_003065637.1| hypothetical protein [Comamonas testosteroni]
 gb|EFI61693.1| hypothetical protein CTS44_11140 [Comamonas testosteroni S44]
Length=266

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 135/259 (52%), Gaps = 11/259 (4%)
 Frame = -3

Query  977  SSIPLPFSLNMQRDINTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFA  798
            SSIP   ++ M     + T + R      ++ G   L F   L LL P + QP+ YH FA
Sbjct  6    SSIP---AVEMTSPETSGTLEQR-----FALFGCMALLFT--LALLMPGMAQPEHYHAFA  55

Query  797  DKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAF  618
            D+R + G+P+  DV SN  F+  GLAG       +Y K++     L   +F+TG+     
Sbjct  56   DRRGWLGVPHAADVLSNLGFVLAGLAGWVALARADYQKLNGTARALC-ALFFTGLLCSGA  114

Query  617  GSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYW  438
            GS+YYH  P D  LVWDRL M++A AG+L + V  R+D+    ++    L+    SV  W
Sbjct  115  GSAYYHWAPQDSSLVWDRLGMSLAFAGLLGLAVQTRIDDISARITAGVLLVAAPASVAVW  174

Query  437  RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKL  258
             +  ++ P+ +V+   ++ ++ +A   P R+       W  G  L+A++ E +D  ++ +
Sbjct  175  AQTSNVLPWVLVQGGGMLTLLWLAFVAPRRHALPMELGWVLGLYLVAKLLEFSDGDVFDV  234

Query  257  SLHRVSGHTLKHVFGAILA  201
            + H +SGH+LKH   A  A
Sbjct  235  TAHSISGHSLKHWMAAAAA  253



>gb|ADI21825.1| hypothetical protein [uncultured nuHF1 cluster bacterium HF0130_24M16]
 gb|ADI17783.1| hypothetical protein [uncultured nuHF1 cluster bacterium HF0130_31E21]
Length=255

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 129/233 (55%), Gaps = 10/233 (4%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            P IPQ  +YH F D R FF I    +VTSN  F+A+G  GL   +        L  +++ 
Sbjct  23   PPIPQWNSYHQFPDNRTFFSITNFANVTSNIGFVAVGFFGLFTIFSKKLFNQKL--DLIP  80

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            + VF++ I  V  GS+YYHLNP  + L WDRLPM+I+     +  + +R+++  G   ++
Sbjct  81   YAVFFSSIILVGVGSAYYHLNPTTETLFWDRLPMSISFMSFFAAIICDRINKITGTYVLL  140

Query  476  PSL-LVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPP-RYTHSTYWLWA  318
            P+L L G+ SVI+W++ +     DLR Y +V+  P+ AI ++ L  P  +YT      WA
Sbjct  141  PTLILAGIYSVIHWQQTEISGEGDLRLYVLVQYFPMFAIPIIMLLFPRYKYTPPVPIYWA  200

Query  317  AGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAV-ILTLMLAQRDIQ  162
                L+A++ E  D  I  L  +  SGHTLKH+   +  + IL +++  + +Q
Sbjct  201  LAWYLIAKLFEYFDLDILNLLSNFSSGHTLKHIAATVTVICILKMLINSKKLQ  253



>ref|WP_011468221.1| protein phosphatase 2C-like protein [Saccharophagus degradans]
 ref|YP_527213.1| conserved hypothetical protein [Saccharophagus degradans 2-40]
 gb|ABD81001.1| conserved hypothetical protein [Saccharophagus degradans 2-40]
Length=256

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/254 (37%), Positives = 132/254 (52%), Gaps = 14/254 (6%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L + G+ IL  V    L  P I Q   YH F+D   +FGIP+  +  SN PFL +G  GL
Sbjct  9    LLIGGICILAIVA--ALFAPPIAQDLNYHLFSDTHTYFGIPHFWNTVSNAPFLLVGAYGL  66

Query  713  ALCYYGNYVKISLQGEV-LGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAG  537
                   + K+++  E+     +FYTG+  V  GS YYHLNPN+  LVWDRLPM I    
Sbjct  67   HKL---THNKLNVAAELRAALYIFYTGVLFVGLGSGYYHLNPNNVTLVWDRLPMTIGFMA  123

Query  536  ILSIFVIERVDEKRGILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVL  372
            +  + + E +  K     + P +L G+ SV YW      +  DLRPYA+V+ +P++ I L
Sbjct  124  LFCVVIAEYIAVKPAKALLAPLILGGIASVAYWYTTETHQQGDLRPYALVQFLPMLVIPL  183

Query  371  MALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVIL  192
            + L     + H+  + W   C  +A++ E  D  I+ L L  +SGH LKHV  A+   + 
Sbjct  184  ILLTYKHPFNHAKGYWWLITCYGVAKLLEHFDPQIHGL-LGFMSGHALKHVIAALGIGLF  242

Query  191  TLMLAQRDI--QTE  156
            T  L  R    QTE
Sbjct  243  TQHLITRLTIDQTE  256



>emb|CCU62598.1| hypothetical protein EBAPG3_16310 [Nitrosospira sp. APG3]
Length=246

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/240 (36%), Positives = 139/240 (58%), Gaps = 12/240 (5%)
 Frame = -3

Query  860  VVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLA--LCYYGNYV  687
            ++L+  + P I QP  YH FAD+R +FGI    +V SN  FL +G+AGL   L  +G+  
Sbjct  1    MLLVAAIAPPISQPVEYHQFADQRTYFGISNFFNVASNIIFLFVGIAGLMFLLNVHGSIA  60

Query  686  -KISLQ-GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
             K+ ++  E   + V +  +     GS YYHL P+++RLVWDRLP+A+ +  +L+  + E
Sbjct  61   SKVFIEPSERWPYLVLFASVTMACIGSIYYHLAPDNNRLVWDRLPIAMGVMALLAATLNE  120

Query  512  RVDEKRGILSIIPSLL-VGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPP  351
            R+  + G+  ++P L+ +G GSV++W     R   +L  Y +V+   ++A++L+ ++ P 
Sbjct  121  RIGPRVGV-PLLPVLIAMGAGSVMHWNWSEQRGAGNLNFYIVVQFYSLLAVILLGIFFPS  179

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
            RYT  T    A     LA++ E+ D+ IY L  H +SGHT KHV  A+    +  ML +R
Sbjct  180  RYTRGTDVYMALALYGLAKLAEIGDRQIYDLG-HVISGHTAKHVVAALAIYWILRMLTKR  238



>ref|WP_012098533.1| hypothetical protein [Anaeromyxobacter sp. Fw109-5]
 ref|YP_001380890.1| hypothetical protein Anae109_3727 [Anaeromyxobacter sp. Fw109-5]
 gb|ABS27906.1| conserved hypothetical protein [Anaeromyxobacter sp. Fw109-5]
Length=273

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 129/227 (57%), Gaps = 9/227 (4%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            PRI Q  AYH FAD+R   GIP   DV S+  FLA+GL GL +    +   ++ + E   
Sbjct  40   PRIAQDPAYHAFADRRALLGIPNAADVLSSLAFLAVGLLGLRVVAARDVSFVNAR-ERAP  98

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            W V + G+   A GS+ YHL+P +  L  DRL M +   G+LS  + ER+   RG L  I
Sbjct  99   WAVTFWGVLLTAVGSAVYHLSPTNASLALDRLAMTVGFMGLLSALIAERLG-ARGPL--I  155

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
            P L++G  +V++W   +     DLRPY  V+  P++AI L+ + + PRYT S + L A  
Sbjct  156  PLLVLGAATVVWWYASEVNGAGDLRPYVAVQAAPLVAIPLLVVLVRPRYTGSAWLLAALA  215

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
              + A++ E+ D  I+  +   VSGHTLKH+  A+    L LML++R
Sbjct  216  LYVAAKLAEVRDAAIFAATAGVVSGHTLKHLLAALGIGALVLMLSRR  262



>ref|WP_040852276.1| alkaline phytoceramidase [Nitrosospira sp. APG3]
Length=262

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/240 (36%), Positives = 139/240 (58%), Gaps = 12/240 (5%)
 Frame = -3

Query  860  VVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLA--LCYYGNYV  687
            ++L+  + P I QP  YH FAD+R +FGI    +V SN  FL +G+AGL   L  +G+  
Sbjct  17   MLLVAAIAPPISQPVEYHQFADQRTYFGISNFFNVASNIIFLFVGIAGLMFLLNVHGSIA  76

Query  686  -KISLQ-GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
             K+ ++  E   + V +  +     GS YYHL P+++RLVWDRLP+A+ +  +L+  + E
Sbjct  77   SKVFIEPSERWPYLVLFASVTMACIGSIYYHLAPDNNRLVWDRLPIAMGVMALLAATLNE  136

Query  512  RVDEKRGILSIIPSLL-VGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPP  351
            R+  + G+  ++P L+ +G GSV++W     R   +L  Y +V+   ++A++L+ ++ P 
Sbjct  137  RIGPRVGV-PLLPVLIAMGAGSVMHWNWSEQRGAGNLNFYIVVQFYSLLAVILLGIFFPS  195

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
            RYT  T    A     LA++ E+ D+ IY L  H +SGHT KHV  A+    +  ML +R
Sbjct  196  RYTRGTDVYMALALYGLAKLAEIGDRQIYDLG-HVISGHTAKHVVAALAIYWILRMLTKR  254



>ref|WP_026609937.1| alkaline phytoceramidase [Methylocaldum szegediense]
Length=261

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 142/253 (56%), Gaps = 11/253 (4%)
 Frame = -3

Query  911  RPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLA  732
             P   P  + G A+  FV++   L P I Q  +YH+FAD+ ++FG+P   +V +N  FL 
Sbjct  6    HPAWKPALILGTAM--FVIIGAFLFPPISQDASYHEFADRERWFGVPNFWNVATNLFFLL  63

Query  731  IGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMA  552
            +GLAGL     G       Q     +  F+ GIA +  GS YYHL PN+  LVWDRLPM 
Sbjct  64   VGLAGLKALRRGMPAGTLAQLRP-SYLAFFIGIALIGPGSVYYHLTPNNATLVWDRLPMT  122

Query  551  IALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPI  387
            +A     SI V E +  + G   + P +L+G+ +++YW   +     DLRPY +V+ +P+
Sbjct  123  VAFMAFFSIIVGEYISHQAGQKLLWPLILLGIAAIVYWHATEKAGHGDLRPYGLVQFLPM  182

Query  386  IAIVLMALWIPPRYTHSTYWLWA-AGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
            + I L+ L  PP +T + Y +WA  G   +A++ EL D+ I++ +L+ +SGH LKHV  A
Sbjct  183  LLIPLILLLYPPSFTGTGY-IWALLGLYGIAKVAELFDESIFQ-ALYPLSGHALKHVLAA  240

Query  209  ILAVILTLMLAQR  171
              A    L L +R
Sbjct  241  SAAYCFLLGLRKR  253



>ref|WP_012836805.1| hypothetical protein [Comamonas testosteroni]
 ref|YP_003276420.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
 gb|ACY31124.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
Length=266

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 120/217 (55%), Gaps = 3/217 (1%)
 Frame = -3

Query  866  CFVVL--LMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGN  693
            C  +L  L LL P + QP+ YH FAD+R + G+P+  DV SN  F+  GLAG       +
Sbjct  31   CMALLFTLALLMPGMAQPEHYHAFADRRGWLGVPHAADVLSNLGFVLAGLAGWVALARAD  90

Query  692  YVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
            Y K++     L   +F+TG+     GS+YYH  P D  LVWDRL M++A AG+L + V  
Sbjct  91   YQKLNGTARALC-ALFFTGLLCSGAGSAYYHWAPQDSSLVWDRLGMSLAFAGLLGLAVQT  149

Query  512  RVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHST  333
            R+D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+    
Sbjct  150  RIDDISARITAGVLLVAAPASVAVWAQTSNVLPWVLVQGGGMLTLLWLAFVAPRRHALPM  209

Query  332  YWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKH  222
               W  G  L+A++ E +D  ++ ++ H +SGH+LKH
Sbjct  210  ELGWVLGLYLVAKLLEFSDGDVFDVTAHSISGHSLKH  246



>ref|WP_011634892.1| hypothetical protein [Nitrosomonas eutropha]
 ref|YP_748054.1| hypothetical protein Neut_1857 [Nitrosomonas eutropha C91]
 gb|ABI60089.1| conserved hypothetical protein [Nitrosomonas eutropha C91]
Length=276

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 119/214 (56%), Gaps = 10/214 (5%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWT  651
            IPQ   Y++FAD R   GIP   DV S+  F+ +G  GLA+    +  + +L+    G+ 
Sbjct  36   IPQDPRYNNFADTRYLLGIPNFYDVASSVAFVLVGAVGLAMLR-SSKSQGALRALRSGYA  94

Query  650  VFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPS  471
            VF+     +  GS+YYHL PN+  LVWDRLPMA A    L I V E + E+ G   +IP 
Sbjct  95   VFFIATIFIGLGSAYYHLEPNNATLVWDRLPMAAAFMAFLCIIVGEHISERYGRNLLIPL  154

Query  470  LLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAA-GC  309
            LL G  SV YW   +     DLR Y +V+ +PI+ + L+ L  P R   ST+ +WA    
Sbjct  155  LLFGSLSVFYWYFTELHGRGDLRFYVLVQYLPIVLVPLIMLLFPSRLKPSTF-MWAPLAA  213

Query  308  LLLARIGELADKPIYKLSLHRVSGHTLKHVFGAI  207
             +LA++ EL D P+Y      +SGHTLKH+   I
Sbjct  214  YVLAKVFELGDMPVYDAI--GISGHTLKHLISCI  245



>ref|WP_034377973.1| hypothetical protein [Comamonas testosteroni]
 gb|KGG96422.1| hypothetical protein P245_05530 [Comamonas testosteroni]
Length=266

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 125/227 (55%), Gaps = 4/227 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G+A+L  + LLM   P + QP+ YH FAD+R + G+P+  DV SN  F+  GLAG     
Sbjct  31   GMALLFTLALLM---PGMAQPEHYHAFADRRGWLGVPHAADVLSNLGFVLAGLAGWVALA  87

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
              +Y K++     L   +F+TG+     GS+YYH  P D  LVWDRL M++A AG+L + 
Sbjct  88   RADYQKLNGTARALC-ALFFTGLLCSGAGSAYYHWAPQDSSLVWDRLGMSLAFAGLLGLA  146

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            V  R+D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+ 
Sbjct  147  VQTRIDDISARITAGVLLVAAPASVAVWVQTSNVLPWVLVQGGGMLILLWLAFVAPRRHA  206

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILA  201
                  W  G  L+A++ EL+D  ++ ++   VSGH+LKH   A  A
Sbjct  207  LPVELGWVIGLYLVAKLMELSDGDVFDVTTQAVSGHSLKHWMAAAAA  253



>ref|WP_034405232.1| hypothetical protein [Comamonas testosteroni]
 gb|KGG89228.1| hypothetical protein P609_04160 [Comamonas testosteroni]
Length=266

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 125/227 (55%), Gaps = 4/227 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G+A+L  + LLM   P + QP+ YH FAD+R + G+P+  DV SN  F+  GLAG     
Sbjct  31   GMALLFTLALLM---PGMAQPEHYHAFADRRGWLGVPHAADVLSNLGFVLAGLAGWVALA  87

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
              +Y K++     L   +F+TG+     GS+YYH  P D  LVWDRL M++A AG+L + 
Sbjct  88   RADYQKLNGTARALC-ALFFTGLLCSGAGSAYYHWAPQDSSLVWDRLGMSLAFAGLLGLA  146

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            V  R+D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+ 
Sbjct  147  VQTRIDDISARITAGVLLVAAPASVAVWVQTSNVLPWVLVQGGGMLILLWLAFVAPRRHA  206

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILA  201
                  W  G  L+A++ EL+D  ++ ++   VSGH+LKH   A  A
Sbjct  207  LPVELGWVIGLYLVAKLLELSDGDVFDVTAQAVSGHSLKHWMAAAAA  253



>ref|WP_010808915.1| hypothetical protein [Ralstonia sp. GA3-3]
 gb|EON21527.1| hypothetical protein C265_00045 [Ralstonia sp. GA3-3]
Length=264

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 121/237 (51%), Gaps = 11/237 (5%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVK---ISLQ  672
            L PRI QP  YH +AD    FG P+ LD+ SN  FL  G AGL   Y G           
Sbjct  29   LLPRIAQPPQYHRYADPYVCFGTPHCLDIGSNLLFLLAGAAGLR--YLGTTAASRAFIAP  86

Query  671  GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
             E   + + +  +  V  GS+YYHL P++ RLVWDR P+A AL   L   + ERV  K G
Sbjct  87   AEAWPFRLLFFAVFLVGLGSAYYHLAPDNQRLVWDRAPLAFALMSWLGANLCERVSLKAG  146

Query  491  ILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYW  327
            +  +   L+ G  SV YW     R   DLRPY +V+   ++ + L+     PRYT     
Sbjct  147  LRLLPLLLIAGPASVAYWAWSEARGIGDLRPYLLVQASAMLVVPLLLCLYAPRYTGDRDV  206

Query  326  LWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
            L   GC +LA   ++ D  I  L+   VSGHTLKHVF A++   + L L +R I  E
Sbjct  207  LAITGCYVLALACDVLDHQIAALT-GLVSGHTLKHVFAALVVYGVLLRLKRRRIVEE  262



>ref|WP_011614983.1| hypothetical protein [Cupriavidus necator]
 ref|YP_725792.1| hypothetical protein H16_A1284 [Ralstonia eutropha H16]
 emb|CAJ92424.1| hypothetical membrane spanning protein [Ralstonia eutropha H16]
Length=264

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 120/237 (51%), Gaps = 11/237 (5%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISL---Q  672
            L PRI QP  YH +AD    FG P+ LD+ SN  FL  G AGL   Y G           
Sbjct  29   LLPRIAQPPQYHRYADPYVCFGTPHCLDIGSNLLFLLAGAAGLR--YLGTTAASRAFIAP  86

Query  671  GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
             E   + + +  +  V  GS+YYHL P++ RLVWDR P+A AL   L   + ERV  K G
Sbjct  87   AEAWPFRLLFLAVFLVGLGSAYYHLAPDNQRLVWDRAPLAFALMSWLGANLCERVSLKAG  146

Query  491  ILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYW  327
            +  +   L+ G  SV YW     R   DLRPY +V+   ++ + L+     PRYT     
Sbjct  147  LRLLPLLLIAGPASVAYWAWSEARGIGDLRPYLLVQASAMLVVPLLLCLYAPRYTGDRDV  206

Query  326  LWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
            L   GC +LA   ++ D  I  L+   VSGHTLKHVF A+    + L L +R I  E
Sbjct  207  LAITGCYVLALACDVLDHQIAALT-GLVSGHTLKHVFAALAVYGVLLRLKRRRIVEE  262



>ref|WP_014147301.1| hypothetical protein [Methylomicrobium alcaliphilum]
 ref|YP_004916094.1| hypothetical protein MEALZ_0806 [Methylomicrobium alcaliphilum 
20Z]
 emb|CCE22500.1| conserved membrane protein of unknown function [Methylomicrobium 
alcaliphilum 20Z]
Length=256

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 141/243 (58%), Gaps = 9/243 (4%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            +AI    V++M   P IPQ + YH+FAD+R+  GI +  +V SN PF+ +GL G+     
Sbjct  14   IAIASASVIVMFFFPAIPQDRFYHEFADQREMLGIKHFFNVVSNLPFILVGLFGVKTLLS  73

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
             +  KI +   +  + +F++ +A +  GS YYHL+PN+  L+WDRLPM +A     S+ V
Sbjct  74   VDRSKI-VDVILPSYMLFFSSVALLGSGSIYYHLDPNNRTLIWDRLPMTLAFMSFFSVIV  132

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIP  354
             E + ++     + P LL G+ SV+YW   +     DLR Y +V+ +P++ + L+ +   
Sbjct  133  GEYISKEVASKLLYPLLLTGLASVLYWHYTESQGHGDLRLYGLVQFLPLLLMPLILVMYK  192

Query  353  PRYTHS-TYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLA  177
            PR+TH   YW++  G   +A+  E+AD P+Y   L+ +SGHTLKH+  A+   +    +A
Sbjct  193  PRFTHGRAYWIF-LGLYGVAKAFEVADSPVYHW-LYGISGHTLKHLLAALGCYVFLRQIA  250

Query  176  QRD  168
            +R 
Sbjct  251  ERQ  253



>ref|WP_034352990.1| hypothetical protein [Comamonas testosteroni]
 gb|KGG93986.1| hypothetical protein P369_06100 [Comamonas testosteroni]
 gb|KGH01153.1| hypothetical protein P367_05215 [Comamonas testosteroni]
 gb|KGH06655.1| hypothetical protein P365_05740 [Comamonas testosteroni]
 gb|KGH14799.1| hypothetical protein P368_04715 [Comamonas testosteroni]
Length=266

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 120/223 (54%), Gaps = 1/223 (0%)
 Frame = -3

Query  869  LCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNY  690
            +  +  L LL P + QP+ YH FAD+R + G+P+  DV SN  F+  GLAG       +Y
Sbjct  32   MALLFTLALLMPGMAQPEHYHAFADRRGWLGLPHAADVLSNLGFVLAGLAGWVALARADY  91

Query  689  VKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIER  510
             K++     L   +F+TG+     GS+YYH  P D  LVWDRL M +A AG+L + V  R
Sbjct  92   QKLNGTARALC-ALFFTGLLCSGAGSAYYHWAPQDSSLVWDRLGMGLAFAGLLGLAVQTR  150

Query  509  VDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTY  330
            +D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+     
Sbjct  151  IDDISARITAGVLLVAAPASVAVWVQTSNVLPWVLVQGGGMLILLWLAFVAPRRHALPVE  210

Query  329  WLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILA  201
              W  G  L+A++ EL+D  ++ ++   VSGH+LKH   A  A
Sbjct  211  LGWVIGLYLVAKLLELSDGDVFDVTTQAVSGHSLKHWMAAAAA  253



>ref|WP_011997153.1| membrane protein [Coxiella burnetii]
 ref|YP_001424900.1| hypothetical membrane spanning protein [Coxiella burnetii Dugway 
5J108-111]
 gb|ABS78412.1| hypothetical membrane spanning protein [Coxiella burnetii Dugway 
5J108-111]
Length=263

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 122/238 (51%), Gaps = 10/238 (4%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYG--NYVKISLQGEVLG  657
            IPQ  AYH FAD+R   GIP   +VTSN  FL IG  GL   +    +Y       E + 
Sbjct  26   IPQDPAYHHFADQRVIAGIPNFFNVTSNIFFLLIGSYGLYFVFKQKTDYQTFLNPAEKIF  85

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            +  F+ G+  V FGS+YYHL P +  LVWDRL ++IA   + S  + ER++ + G+  + 
Sbjct  86   YICFFAGLVFVGFGSAYYHLAPTNKTLVWDRLGISIAFMSLFSAMIAERINLRAGLWLLF  145

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
            P + VG+ SV YW   +     DLR Y  V+ +P++++  + +  P  Y  STY   A  
Sbjct  146  PLIFVGISSVGYWIYSESIGQSDLRFYVAVQFLPLLSMPFILILFPRPYNKSTYIWLALI  205

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD---IQTERIS  147
                    E  D  IY+     +SGHTLKH+  A+ +  +   L  R+    Q+ RI 
Sbjct  206  SYTTGAFVEHHDHEIYRQLHETISGHTLKHLLDALSSYFILHYLKSREPSIFQSSRIK  263



>ref|WP_035819033.1| hypothetical protein [Cupriavidus sp. SK-4]
 gb|EYS93802.1| hypothetical protein CF68_26030 [Cupriavidus sp. SK-4]
Length=264

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 120/237 (51%), Gaps = 11/237 (5%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVK---ISLQ  672
            L PRI QP  YH +AD    FG P+ LD+ SN  FL  G AGL   Y G           
Sbjct  29   LLPRIAQPPQYHRYADPYVCFGTPHCLDIGSNLLFLLAGAAGLR--YLGTTAASRAFIAP  86

Query  671  GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
             E   + + +  +  V  GS+YYHL P++ RLVWDR P+A AL   L   + ERV  K G
Sbjct  87   AEAWPYRLLFFAVFLVGLGSAYYHLAPDNQRLVWDRAPLAFALMCWLDANLCERVSLKAG  146

Query  491  ILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYW  327
            +  +   L+ G  SV YW     R   DLRPY +V+   ++ + L+     PRYT     
Sbjct  147  LRLLPLLLIAGPASVAYWAWSEARGIGDLRPYLLVQAWAMLVVPLLLCLYAPRYTGDRDV  206

Query  326  LWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
            L   GC +LA   ++ D  I  L+   VSGHTLKHVF A+    + L L +R I  E
Sbjct  207  LAITGCYVLALACDVLDHQIAALT-GLVSGHTLKHVFAALAVYGVLLRLKRRRIVEE  262



>gb|EGG99752.1| hypothetical protein imdm_742 [gamma proteobacterium IMCC2047]
Length=249

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 89/236 (38%), Positives = 135/236 (57%), Gaps = 23/236 (10%)
 Frame = -3

Query  893  LSVCGVAILCFVVLL---MLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGL  723
            ++  G+ +L   VL    M L   I Q  AYH FAD+R ++ IP T+DV SN PF+ +GL
Sbjct  1    MTKAGITLLLVTVLAIIGMTLIEPIAQDAAYHLFADRRSWWHIPNTMDVLSNLPFVFVGL  60

Query  722  AGLALCYYGNYVKISLQGEVLGWTVF--YTGIATVAFGSSYYHLNPNDDRLVWDRLPMAI  549
             GL       +  +  +   L W     + G+    FGS+YYH  P +  LVWDRLPM +
Sbjct  61   MGL-------WHIVFHRQHALFWPFLAIFIGVFCTGFGSAYYHWAPANGTLVWDRLPMTV  113

Query  548  ALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPII  384
            A  G+L++ + +R++  R   +++P LLVG+ SV YW     R   DLRPYA+V+ +P++
Sbjct  114  AFMGLLTMVLADRIN-IRWRHALVPLLLVGLASVWYWHTTESRGEGDLRPYALVQFLPVV  172

Query  383  AIVLMALWI--PPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKH  222
             I L ALW+   PR     Y +    C + A++ E  D+P+++L+   +SGH+LKH
Sbjct  173  LIPL-ALWLYPAPRRDVGCY-VGLVSCYVAAKLLEYFDRPVFELT-GSISGHSLKH  225



>ref|WP_005742680.1| protein phosphatase 2C-like [Pseudomonas amygdali]
 gb|EGH82367.1| protein phosphatase 2C-like [Pseudomonas syringae pv. lachrymans 
str. M301315]
Length=286

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 132/247 (53%), Gaps = 12/247 (5%)
 Frame = -3

Query  878  VAILCFV-VLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            VA++C + VL   L+  I Q +AYH F D R  FG+    +V SN PF+ +GL GL  C+
Sbjct  16   VALICGITVLAAALSSPIAQDQAYHAFGDHRHLFGVDNFWNVISNLPFVLVGLLGLHECW  75

Query  701  ---YGNYVKISLQGEVLGWTV-FYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
                G  +   +  E+ G TV F+ G+     GS+YYHL+PN+  L+WDRLPM I+    
Sbjct  76   RQTSGGKMPHVVMYELPGTTVTFFAGVLLTGLGSAYYHLDPNNHTLIWDRLPMTISFMAF  135

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLM  369
             S+ +   V  K   +  IP LL G+GSV+YW   +     DLRPYA+V+ +PI+ I ++
Sbjct  136  FSLIIGCHVSYKVAKIMAIPLLLAGLGSVLYWNYTESLGAGDLRPYALVQFLPILLIPVI  195

Query  368  ALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILT  189
                  +   +       G  +LA+  E  D  IY   +  +SGH +KHV  A LA  + 
Sbjct  196  MTGSGAKALRAAVIWKIIGLYMLAKALEHWDVQIYLALVSEMSGHAIKHV-AASLATFVA  254

Query  188  LMLAQRD  168
            L L  RD
Sbjct  255  L-LEVRD  260



>emb|CDM86619.1| unnamed protein product [Triticum aestivum]
Length=603

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/245 (36%), Positives = 123/245 (50%), Gaps = 51/245 (21%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFF-GIPYTLDVTSNFPFLAIGLAGLALCY  702
            VA    ++++ML+   IP  + YHDFAD+R  F GIP TL+V S  P   +GLAGL L +
Sbjct  122  VAYTGIIIMVMLVMAAIPHDEDYHDFADQRTLFLGIPNTLNVISTIPLFFVGLAGLILNH  181

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
              +Y ++  QG++      + G++   FGS YYHLNP +  L W +LPM        +IF
Sbjct  182  CKSYFRLWSQGDLY---TLFAGVSAAGFGSCYYHLNPENGTLFWHKLPMVTTFTCFEAIF  238

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            +IE  D+                    W R   L                          
Sbjct  239  IIESFDD--------------------WARTKSL-------------------------A  253

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD--  168
             ++YWL AAG  LLAR+ E+ADK IY+ +L  VSGHTL H+  +++ + L LMLA+R   
Sbjct  254  STSYWLRAAGLYLLARVEEVADKQIYRWTLQIVSGHTLGHLCVSMVPLFLILMLAERTRP  313

Query  167  IQTER  153
            I+ ER
Sbjct  314  IELER  318



>ref|WP_013956273.1| hypothetical protein [Cupriavidus necator]
 ref|YP_004685106.1| hypothetical protein CNE_1c12740 [Cupriavidus necator N-1]
 gb|AEI76625.1| hypothetical protein CNE_1c12740 [Cupriavidus necator N-1]
Length=264

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 120/237 (51%), Gaps = 11/237 (5%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVK---ISLQ  672
            L PRI QP  YH +AD    FG P+ LD+ SN  FL  G AGL   Y G           
Sbjct  29   LLPRIAQPPQYHRYADPYVCFGTPHCLDIGSNLLFLLAGAAGLR--YLGTTAASRAFIAP  86

Query  671  GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
             E   + + +  +  V  GS+YYHL P++ RLVWDR P+A AL   L   + ERV  K G
Sbjct  87   AEAWPYRLLFFAVFLVGLGSAYYHLAPDNQRLVWDRAPLAFALMSWLGANLCERVSLKAG  146

Query  491  ILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYW  327
            +  +   L+ G  SV YW     R   DLRPY +V+   ++ + L+     PRYT     
Sbjct  147  LRLLPLLLIAGPASVGYWAWSEARGIGDLRPYLLVQAWAMLVVPLLLCLYAPRYTGDWDV  206

Query  326  LWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
            L   GC +LA   ++ D  I  L+   VSGHTLKHVF A+    + L L +R I  E
Sbjct  207  LAITGCYVLALACDVLDHQIAALT-GLVSGHTLKHVFAALAVYGVLLRLKRRRIVEE  262



>ref|WP_005771218.1| membrane protein [Coxiella burnetii]
 ref|NP_819546.1| hypothetical protein CBU_0514 [Coxiella burnetii RSA 493]
 ref|YP_002305662.1| hypothetical membrane spanning protein [Coxiella burnetii CbuK_Q154]
 gb|AAO90060.1| hypothetical membrane spanning protein [Coxiella burnetii RSA 
493]
 gb|EAX32880.1| putative membrane protein [Coxiella burnetii 'MSU Goat Q177']
 gb|EDR35785.1| putative membrane protein [Coxiella burnetii Q321]
 gb|ACJ20517.1| hypothetical membrane spanning protein [Coxiella burnetii CbuK_Q154]
Length=263

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 121/238 (51%), Gaps = 10/238 (4%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISL--QGEVLG  657
            IPQ  AYH FAD+R   GIP   +VTSN  FL IG  GL   +       +     E + 
Sbjct  26   IPQDPAYHHFADQRVIAGIPNFFNVTSNIFFLLIGSYGLYFVFKQKTDSQTFLNPAEKIF  85

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            +  F+ G+  V FGS+YYHL P +  LVWDRL ++IA   + S  + ER++ + G+  + 
Sbjct  86   YICFFAGLVFVGFGSAYYHLAPTNKTLVWDRLGISIAFMSLFSAMIAERINLRAGLWLLF  145

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
            P + VG+ SV YW   +     DLR Y  V+ +P++++  + +  P  Y  STY   A  
Sbjct  146  PLIFVGISSVGYWIYSESIGQSDLRFYVAVQFLPLLSMPFILILFPRPYNKSTYIWLALI  205

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD---IQTERIS  147
                    E  D  IY+     +SGHTLKH+  A+ +  +   L  R+    Q+ RI 
Sbjct  206  SYTTGAFVEHHDHEIYRQLHETISGHTLKHLLDALSSYFILHYLKSREPSIFQSSRIK  263



>ref|WP_039669478.1| membrane protein [Coxiella burnetii]
 gb|AIT63588.1| Putative membrane protein [Coxiella burnetii str. Namibia]
Length=263

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 121/238 (51%), Gaps = 10/238 (4%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISL--QGEVLG  657
            IPQ  AYH FAD+R   GIP   +VTSN  FL IG  GL   +       +     E + 
Sbjct  26   IPQDPAYHHFADQRVIAGIPNFFNVTSNIFFLLIGSYGLYFVFKQKTDSQTFLNPAEKIF  85

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            +  F+ G+  V FGS+YYHL P +  LVWDRL ++IA   + S  + ER++ + G+  + 
Sbjct  86   YICFFAGLVFVGFGSAYYHLAPTNKTLVWDRLGISIAFMSLFSAMIAERINLRAGLWLLF  145

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
            P + VG+ SV YW   +     DLR Y  V+ +P++++  + +  P  Y  STY   A  
Sbjct  146  PLIFVGISSVGYWIYSESIGQSDLRFYVAVQFLPLLSMPFILILFPRPYNKSTYIWLALI  205

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD---IQTERIS  147
                    E  D  IY+     +SGHTLKH+  A+ +  +   L  R+    Q+ RI 
Sbjct  206  SYTTGAFVEHHDHEIYRQLHETISGHTLKHLLDALSSYFILHYLKSREPSIFQSSRIK  263



>ref|WP_003059304.1| hypothetical protein [Comamonas testosteroni]
 gb|EED69769.1| conserved hypothetical protein [Comamonas testosteroni KF-1]
Length=266

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 127/241 (53%), Gaps = 8/241 (3%)
 Frame = -3

Query  929  TNTRQARPQGSP-----LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYT  765
            TN     P+ S       ++ G   L F   L LL P + QP+ YH FAD+R + G+P+ 
Sbjct  9    TNVEMTSPETSDTLEQRFALFGGMALLFT--LALLMPGMAQPEHYHAFADRRGWLGLPHA  66

Query  764  LDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPND  585
             DV SN  F+  GLAG       +Y K++     L   +F+ G+     GS++YH  P D
Sbjct  67   ADVLSNLGFVLAGLAGGHALRRADYQKLNGTARALC-ALFFAGLLCSGAGSAWYHWAPQD  125

Query  584  DRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAM  405
              LVWDRL M++A AG+L + V  R+D+    ++    L+    SV  W +  ++ P+ +
Sbjct  126  SSLVWDRLGMSLAFAGLLGLAVQTRIDDISARITAGVLLVAAPVSVAVWAQTSNVLPWVL  185

Query  404  VETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLK  225
            V+   ++ ++ +A   P R+       W  G  L+A++ EL+D  ++ ++ H +SGH+LK
Sbjct  186  VQGGGMLVLLWLAFVAPRRHALPVELGWVIGLYLVAKLLELSDGDVFDVTAHAISGHSLK  245

Query  224  H  222
            H
Sbjct  246  H  246



>gb|AIJ44580.1| hypothetical protein O987_01955 [Comamonas testosteroni TK102]
Length=266

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 127/241 (53%), Gaps = 8/241 (3%)
 Frame = -3

Query  929  TNTRQARPQGSP-----LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYT  765
            TN     P+ S       ++ G   L F   L LL P + QP+ YH FAD+R + G+P+ 
Sbjct  9    TNVEMTSPETSGTLEQRFALFGGMALLFT--LALLMPGMAQPEHYHAFADRRGWLGLPHA  66

Query  764  LDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPND  585
             DV SN  F+  GLAG       +Y K++     L   +F+ G+     GS++YH  P D
Sbjct  67   ADVLSNLGFVLAGLAGGHALRRADYQKLNGTARALC-ALFFAGLLCSGAGSAWYHWAPQD  125

Query  584  DRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAM  405
              LVWDRL M++A AG+L + V  R+D+    ++    L+    SV  W +  ++ P+ +
Sbjct  126  SSLVWDRLGMSLAFAGLLGLAVQTRIDDISARITAGVLLVAAPVSVAVWAQTSNVLPWVL  185

Query  404  VETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLK  225
            V+   ++ ++ +A   P R+       W  G  L+A++ EL+D  ++ ++ H +SGH+LK
Sbjct  186  VQGGGMLVLLWLAFVAPRRHALPVELGWVIGLYLVAKLLELSDGDVFDVTAHAISGHSLK  245

Query  224  H  222
            H
Sbjct  246  H  246



>ref|WP_012570288.1| membrane protein [Coxiella burnetii]
 ref|YP_002303936.1| hypothetical membrane spanning protein [Coxiella burnetii CbuG_Q212]
 gb|ACJ18791.1| hypothetical membrane spanning protein [Coxiella burnetii CbuG_Q212]
Length=263

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 121/238 (51%), Gaps = 10/238 (4%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISL--QGEVLG  657
            IPQ  AYH FAD+R   GIP   +VTSN  FL IG  GL   +       +     E + 
Sbjct  26   IPQDPAYHHFADQRVIAGIPNFFNVTSNIFFLLIGSYGLYFVFKQKTDSQTFLNPAEKIF  85

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            +  F+ G+  V FGS+YYHL P +  LVWDRL ++IA   + S  + ER++ + G+  + 
Sbjct  86   YICFFAGLVFVGFGSAYYHLAPTNRTLVWDRLGISIAFMSLFSAMIAERINLRAGLWLLF  145

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
            P + VG+ SV YW   +     DLR Y  V+ +P++++  + +  P  Y  STY   A  
Sbjct  146  PLIFVGISSVGYWIYSESIGQSDLRFYVAVQFLPLLSMPFILILFPRPYNKSTYIWLALI  205

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD---IQTERIS  147
                    E  D  IY+     +SGHTLKH+  A+ +  +   L  R+    Q+ RI 
Sbjct  206  SYTTGAFVEHHDHEIYRQLHETISGHTLKHLLDALSSYFILHYLKSREPSIFQSSRIK  263



>ref|WP_022535145.1| hypothetical protein [Ralstonia pickettii]
 ref|YP_008595890.1| hypothetical protein N234_10475 [Ralstonia pickettii DTP0602]
 gb|AGW90456.1| hypothetical protein N234_10475 [Ralstonia pickettii DTP0602]
Length=264

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 119/232 (51%), Gaps = 11/232 (5%)
 Frame = -3

Query  842  LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISL---Q  672
            L PRI QP  YH +AD    FG P+ LD+ SN  FL  G AGL   Y G           
Sbjct  29   LLPRIAQPPQYHRYADPYVCFGTPHCLDIGSNLLFLLAGAAGLR--YLGTTAASRAFIAP  86

Query  671  GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
             E   + + +  +  V  GS YYHL P++ RLVWDR P+A+AL   L+  + ER   K G
Sbjct  87   AEAWPYRLLFFAVFLVGLGSGYYHLAPDNQRLVWDRAPLALALMSWLAANLCERASLKAG  146

Query  491  ILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYW  327
            +  +   L+ G  SV YW     R   DLRPY +V+   ++ + L+     PRYT     
Sbjct  147  LRLLPLLLIAGPASVGYWAWSEARGIGDLRPYLLVQAWAMLVVPLLLCLYAPRYTGDRDV  206

Query  326  LWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
            L   GC +LA + ++ D  I  L+   VSGHTLKHVF A+    + L L +R
Sbjct  207  LAITGCYVLALVCDVLDHQIAALT-GLVSGHTLKHVFAALAVYGVLLRLKRR  257



>ref|WP_003078072.1| hypothetical protein [Comamonas testosteroni]
 gb|EHN64667.1| hypothetical protein CTATCC11996_16659 [Comamonas testosteroni 
ATCC 11996]
Length=266

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 126/227 (56%), Gaps = 4/227 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G+A+L  + LLM   P + QP+ YH FA++R + G+P   DV SN  F+  GLAG     
Sbjct  31   GMALLFTLALLM---PGMAQPEHYHAFANQRGWLGVPNAADVLSNLGFVLAGLAGWVALG  87

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
              +Y K++     L   +F+TG+   + GS+YYH  P D  LVWDRL M++A AG+L + 
Sbjct  88   RADYQKLNGTARALC-ALFFTGLLCSSAGSAYYHWAPQDSSLVWDRLGMSLAFAGLLGLA  146

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            V  R+D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+ 
Sbjct  147  VQTRIDDISARITAGVLLVAAPVSVAVWAQTSNVLPWVLVQGGGMLTLLWLAFVAPRRHA  206

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILA  201
                  W  G   +A++ EL+D  ++ ++ + +SGH+LKH+  A  A
Sbjct  207  LPVELGWVIGLYFVAKLLELSDGDVFDVTAYAISGHSLKHLVAAAAA  253



>ref|WP_012220243.1| membrane protein [Coxiella burnetii]
 ref|YP_001596445.1| hypothetical protein COXBURSA331_A0626 [Coxiella burnetii RSA 
331]
 gb|ABX77514.1| putative membrane protein [Coxiella burnetii RSA 331]
Length=263

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 121/238 (51%), Gaps = 10/238 (4%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISL--QGEVLG  657
            IPQ  AYH FAD++   GIP   +VTSN  FL IG  GL   +       +     E + 
Sbjct  26   IPQDPAYHHFADQKVIAGIPNFFNVTSNIFFLLIGSYGLYFVFKQKTDSQTFLNPAEKIF  85

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            +  F+ G+  V FGS+YYHL P +  LVWDRL ++IA   + S  + ER++ + G+  + 
Sbjct  86   YICFFAGLVFVGFGSAYYHLAPTNKTLVWDRLGISIAFMSLFSAMIAERINLRAGLWLLF  145

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
            P + VG+ SV YW   +     DLR Y  V+ +P++++  + +  P  Y  STY   A  
Sbjct  146  PLIFVGISSVGYWIYSESIGQSDLRFYVAVQFLPLLSMPFILILFPRPYNKSTYIWLALI  205

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD---IQTERIS  147
                    E  D  IY+     +SGHTLKH+  A+ +  +   L  R+    Q+ RI 
Sbjct  206  SYTTGAFVEHHDHEIYRQLHETISGHTLKHLLDALSSYFILHYLKSREPSIFQSSRIK  263



>ref|WP_013033994.1| hypothetical protein [Nitrosococcus halophilus]
 ref|YP_003528531.1| hypothetical protein Nhal_3092 [Nitrosococcus halophilus Nc 4]
 gb|ADE16144.1| conserved hypothetical protein [Nitrosococcus halophilus Nc 4]
Length=261

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 93/253 (37%), Positives = 138/253 (55%), Gaps = 23/253 (9%)
 Frame = -3

Query  887  VCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLAL  708
            +CG+ IL       LL P IPQ   YH FAD R +FGIP+ L+V SNFP + +G+ GL  
Sbjct  18   ICGLGIL-------LLDP-IPQDPNYHRFADDRPYFGIPHFLNVISNFPLMLVGIVGL--  67

Query  707  CYYGNYVKISLQGE----VLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALA  540
               G  +K+         +L + +F+ G+     GS YYH+ P++  LVWDR PM +A  
Sbjct  68   ---GWALKVRNVAPDPLLLLPYGIFFAGVFLTGVGSCYYHVFPDNKTLVWDRYPMTLAFM  124

Query  539  GILSIFVIERVDEKRGILSIIPSLLVGVGSVIYW---RRFD--DLRPYAMVETVPIIAIV  375
             + S  ++E V  K G++ +   LL+G  SV YW    R D  DLR Y  V+ VP++ I 
Sbjct  125  ALFSAILMEHVSRKGGMILLPGLLLLGFFSVWYWGHTERLDLGDLRLYGGVQFVPLLLIP  184

Query  374  LMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVI  195
             +  W    Y+   Y+ +A G   LA++ E  D+ I++ +   VSGH+LKH+  A+ A +
Sbjct  185  FILAWFRSGYSKRHYFFYALGFYGLAKVLEHFDREIFQ-ATGVVSGHSLKHLAAALAAFV  243

Query  194  LTLMLAQRDIQTE  156
            +  ML  R  Q +
Sbjct  244  ILFMLCHRQSQEK  256



>ref|WP_013819846.1| hypothetical protein [Methylomonas methanica]
 ref|YP_004514118.1| hypothetical protein [Methylomonas methanica MC09]
 gb|AEG01619.1| hypothetical protein Metme_3247 [Methylomonas methanica MC09]
Length=251

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 119/230 (52%), Gaps = 11/230 (5%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            + + G+  L  VV L ++ P I Q   YH FAD R   G+    +V SN PFL +G  GL
Sbjct  8    VGILGLVSLAAVVSLFVIEP-IAQDPNYHQFADPRSLRGLSNFWNVVSNLPFLVVGGLGL  66

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
            +      Y ++S      G+ V   G+  V FGS+YYH NP++D L+WDRLPM +A   +
Sbjct  67   S-----RYERLSQPASAEGFRVMCWGVLLVGFGSAYYHANPSNDTLLWDRLPMTVAFMAL  121

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLM  369
             S+ + ERV   +    +   +  GV SV YW   +     DLRPY +V+ +PI+ +  +
Sbjct  122  FSLMLGERVLRSQNRYCLWLLVAAGVASVFYWSWTESLGRGDLRPYLLVQFLPIMLMPFI  181

Query  368  ALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHV  219
                P RY  +     A G   +A++ E  D  I+ +S   + GH +KHV
Sbjct  182  LFMFPERYLSNVLLSAAFGLYFIAKMLEYFDGRIFSVSGGTIGGHAIKHV  231



>ref|WP_020158235.1| MULTISPECIES: hypothetical protein [Methylobacter]
Length=265

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 125/235 (53%), Gaps = 15/235 (6%)
 Frame = -3

Query  875  AILCFVVLLML--------LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLA  720
            +IL F+ L  +        L P+IPQ  +YH F D+++  GIP   +V +N PFL +G  
Sbjct  4    SILIFIALFSIVASIAVFTLVPKIPQDLSYHYFGDQKQILGIPNFWNVMTNLPFLVVGFM  63

Query  719  GLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALA  540
            G+      N +   L      +  F+ G+  V  GS YYHL+P+++ L+WDRLPM IA  
Sbjct  64   GIQQII-NNRLDGGLPQLRPAYLTFFIGVFLVGLGSGYYHLDPDNESLIWDRLPMTIAFM  122

Query  539  GILSIFVIERVDEKRGILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIV  375
             + S  V E +  + G   + P +L G+ SVIYW     +   DLR Y +V+ +P++ I 
Sbjct  123  ALFSAVVGEFLSVEWGRRLLYPLVLAGMLSVIYWHWSEQQGHGDLRFYGLVQFLPMVLIP  182

Query  374  LMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
            +M ++   R++ + Y     G    A++ E  D  IY+  L  +SGH+LKH+  A
Sbjct  183  VMLIYCQSRFSGNGYLWGLVGIYAAAKLAESGDVVIYE-HLRFLSGHSLKHLLAA  236



>ref|WP_024303176.1| hypothetical protein [Pseudogulbenkiania sp. MAI-1]
Length=266

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 120/230 (52%), Gaps = 9/230 (4%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            P + QP AYH FAD+R   G+P  LDV +N PFL +GLAGL +   G     +       
Sbjct  28   PPVAQPLAYHHFADQRPLLGLPRALDVATNLPFLLVGLAGLVVVL-GPKAATAFARPAEK  86

Query  656  W--TVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILS  483
            W   +F+  +A  + GS YYHL P++ RLVWDRLPM++    +L+  + ER+D   G   
Sbjct  87   WPYMLFFLAVALTSVGSVYYHLAPDNARLVWDRLPMSMGFMALLAALISERIDLAAGQRL  146

Query  482  IIPSLLVGVGSVIYWR-----RFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWA  318
            ++P   +G+ SV YW        +++ PY  V+      ++L+A   P  YT      W 
Sbjct  147  LLPLTALGMASVGYWHWSAQAGNENVLPYVAVQFGTAALVLLIAALFPSPYTRERDIYWM  206

Query  317  AGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
            A     +++ E  D  ++ L    +SGH+LKH+  A  A  L  ML +R+
Sbjct  207  AALYFASKVAEGLDTELFTLG-SLLSGHSLKHLLAAGAAYRLVSMLRRRE  255



>ref|WP_015258209.1| alkaline phytoceramidase [Thioalkalivibrio nitratireducens]
 ref|YP_007216554.1| alkaline phytoceramidase [Thioalkalivibrio nitratireducens DSM 
14787]
 gb|AGA33073.1| alkaline phytoceramidase [Thioalkalivibrio nitratireducens DSM 
14787]
Length=264

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 121/220 (55%), Gaps = 14/220 (6%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY------GNYVKISL  675
            P IPQP+ YH FA     FGIP+  DV SN PFL +GL GL   +       G ++  S 
Sbjct  25   PAIPQPQEYHQFAATATVFGIPHFADVISNLPFLVVGLTGLTWTWSQRPRPDGPFIHASE  84

Query  674  QGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKR  495
            +   L   V +  IA V+ GS+YYH  P  +RL WDRLPM++A   I +  + ER+D + 
Sbjct  85   RWPYL---VVFGAIALVSIGSAYYHWAPTHERLFWDRLPMSVAFMAIFAAILGERIDHRV  141

Query  494  GILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTY  330
            G+ ++   +L G  +  +W   +     DLRPY MV+ VPI+  +L+ L    RY   T 
Sbjct  142  GLAALPALILAGTAATTWWLLSERMGAGDLRPYVMVQVVPIVVGILLILLYRSRYDRGTD  201

Query  329  WLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
            ++ AA   LLA   E  D PI+ L+   +SGHTLKH+  A
Sbjct  202  FIAAATWYLLALAAETLDHPIHDLTGGWLSGHTLKHLLAA  241



>ref|WP_036243865.1| alkaline phytoceramidase, partial [Methylobacter luteus]
Length=217

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 118/217 (54%), Gaps = 7/217 (3%)
 Frame = -3

Query  845  LLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGE  666
            LL P+IPQ   YH F D+++  G+    +V +N PFL +GL G+      N +   +   
Sbjct  1    LLVPKIPQDLNYHYFGDQKQMLGVSNFWNVMTNLPFLIVGLMGIRRVM-ANRLGGGMPQL  59

Query  665  VLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGIL  486
               + +F+ G+  V  GS YYHL+P++  L+WDRLPM IA   + S  V E +    G  
Sbjct  60   RPAYLIFFIGVFLVGLGSGYYHLDPDNGTLIWDRLPMTIAFMALFSAIVGEYLSITWGRR  119

Query  485  SIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW  321
             + P +L+G+ SV+YW     +   DLR YA+V+ +P+  I +M ++  PR + + Y   
Sbjct  120  LLYPLVLIGMASVVYWHWSEQQGHGDLRFYALVQFLPMFLIPVMLVFCQPRLSGNGYLWG  179

Query  320  AAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
              G    A++ E  D  IY+  L  +SGH+LKH+  A
Sbjct  180  IIGIYAAAKLAETGDVVIYE-HLRFLSGHSLKHLLAA  215



>ref|WP_036247916.1| alkaline phytoceramidase [Methylobacter sp. BBA5.1]
Length=265

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 125/235 (53%), Gaps = 15/235 (6%)
 Frame = -3

Query  875  AILCFVVLLML--------LTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLA  720
            +IL F+ L  +        L P+IPQ  +YH F D+++  GIP   +V +N PFL +G  
Sbjct  4    SILIFIALFSIVASIAVFTLVPKIPQDLSYHYFGDQKQILGIPNFWNVMTNLPFLVVGFM  63

Query  719  GLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALA  540
            G+      N +   L      +  F+ G+  V  GS YYHL+P+++ L+WDRLPM IA  
Sbjct  64   GIQQII-NNPLDGGLPQLRPAYLTFFIGVFLVGLGSGYYHLDPDNESLIWDRLPMTIAFM  122

Query  539  GILSIFVIERVDEKRGILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIV  375
             + S  V E +  + G   + P +L G+ SVIYW     +   DLR Y +V+ +P++ I 
Sbjct  123  ALFSAVVGEFLSVEWGRRLLYPLVLAGMLSVIYWHWSEQQGHGDLRFYGLVQFLPMVLIP  182

Query  374  LMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGA  210
            +M ++   R++ + Y     G    A++ E  D  IY+  L  +SGH+LKH+  A
Sbjct  183  VMLIYCQSRFSGNGYLWGLVGIYAAAKLAESGDVVIYE-HLRFLSGHSLKHLLAA  236



>ref|WP_032124352.1| hypothetical protein [Chlamydia sp. 'Diamant']
Length=246

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 118/227 (52%), Gaps = 6/227 (3%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWT  651
            IPQP+AYH+FAD+R    I   L+V SN PF+  G+ GL +  +   +    + E   W 
Sbjct  10   IPQPQAYHNFADQRTVLAIANGLNVISNLPFVLAGMWGLYILSFPTKIGFVDKREKWPWI  69

Query  650  VFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGI-----L  486
                G+     GSSYYHL P++ RLVWDRLPM I    +++  + ER++ + G+     L
Sbjct  70   GVSIGLMLTGIGSSYYHLMPDNSRLVWDRLPMTITFMSLVAALLCERINLRLGLWLWPFL  129

Query  485  SIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCL  306
              I  + V +     WR   DLR Y  ++   I+ +++M L+ P  YT +     AA C 
Sbjct  130  IAIGFIAVFMWKASEWRGASDLRFYIGLQIFTIVVMLIM-LFAPSPYTRTRDLAIAAVCY  188

Query  305  LLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
             LA   E  D PIY  S   +SGHTLKH+   +    L  M+ +R I
Sbjct  189  GLAIGFERMDHPIYTFSGGIISGHTLKHLTAGLAGAWLIRMIWKRKI  235



>ref|WP_022949955.1| Alkaline phytoceramidase (aPHC) [Methylohalobius crimeensis]
Length=237

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 129/233 (55%), Gaps = 17/233 (7%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL-ALC  705
            GV +L  VV    L   IPQ  AYH FAD R    IP  L+V SN  F  +G  GL ++ 
Sbjct  12   GVVLLAMVV--AALVGPIPQDPAYHRFADSRACGLIPNCLNVLSNLAFWVVGGMGLQSVS  69

Query  704  YYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSI  525
            ++   ++ +       W VF+ G+    FGS++YH  P+D RLVWDRLPM +A  G+ S 
Sbjct  70   HWPAALRPA-------WRVFWWGVFLTGFGSAWYHWAPDDVRLVWDRLPMTLAFMGLFSA  122

Query  524  FVIERVDEKRGILSIIPSL-LVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPP-  351
             +I++    R +L   PSL L G+ S+  W  FDDLR Y +V+ +P I I+L+  + PP 
Sbjct  123  VLIDQFQLARWVL---PSLVLTGLASIGVWLAFDDLRLYGLVQFLPPILILLIFAFFPPG  179

Query  350  RYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVIL  192
            R +    +L   G    A+  EL D  I+ L+ + +SGH+LKH+  A+  V L
Sbjct  180  RISRRAIYL-GLGFYAAAKGAELLDGEIFALT-NWISGHSLKHLLAAVATVWL  230



>ref|WP_040523192.1| hypothetical protein [Legionella anisa]
Length=246

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 121/229 (53%), Gaps = 6/229 (3%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            P IPQP++YH FA++R +FGI  T DV SN PF  +G+ GL L +    ++     E   
Sbjct  18   PPIPQPQSYHHFAEQRTWFGINNTWDVLSNLPFALVGVWGLFLLFSHRKIQFIECSERWI  77

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            W     G+  VA GS YYHL P++ RLVWDRLP+ +     ++  + +R++ +  +    
Sbjct  78   WVGISLGLILVALGSGYYHLAPDNHRLVWDRLPITVVFMSFVAALISDRINSRLALWFWP  137

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
              L +G+ SV+ W   +     DLR YA V+   ++   +M L +P  YT S      A 
Sbjct  138  FLLFIGIHSVLQWYLSELHGTGDLRLYAAVQAYTVLVAFVMLL-LPSHYTRSRDVAIVAL  196

Query  311  CLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
               L+++ E  D  IY+      SGHTLKH+  A+ A  L  M+ +R I
Sbjct  197  LYSLSKVLEAYDNQIYRFFGGITSGHTLKHLAAALAAFWLIRMMWKRHI  245



>ref|WP_011043229.1| hypothetical protein [Colwellia psychrerythraea]
 ref|YP_269135.1| hypothetical protein CPS_2419 [Colwellia psychrerythraea 34H]
 gb|AAZ27511.1| putative membrane protein [Colwellia psychrerythraea 34H]
Length=268

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 136/237 (57%), Gaps = 10/237 (4%)
 Frame = -3

Query  848  MLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQG  669
            +LL   I Q   YHDFAD R F  IP   +V SN PF+ +G  G+   +  N  KI+   
Sbjct  32   VLLQEPIAQSLEYHDFADNRSFLSIPNFYNVLSNIPFIIVGFMGIHSLFISN--KITKLD  89

Query  668  EV-LGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRG  492
            E+ +G+   + G+  + FGS YYHL P++  LVWDRLPM +A   +++I + E +  + G
Sbjct  90   ELKVGYCFLFLGLLLIGFGSGYYHLWPSNHTLVWDRLPMTLAFMALIAIIIAEYLSVELG  149

Query  491  ILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYW  327
               + P L++G  SV+YW   +     DLR Y +V+ +P+IA+ L+ L++ P +++   +
Sbjct  150  KRLLYPLLIIGGASVLYWDYTESNGAGDLRYYILVQFLPLIAVPLILLFMKPAFSYGNRY  209

Query  326  LWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTE  156
             W     +LA++ E  D  I+++ L  +SGHTLKH+  A L ++L L   +R  + E
Sbjct  210  WWLFLTYILAKLFEHFDTYIFEV-LTAISGHTLKHLIAA-LGMLLLLNGYKRRKKIE  264



>ref|WP_034370065.1| hypothetical protein [Comamonas testosteroni]
 gb|KGH29118.1| hypothetical protein P353_13910 [Comamonas testosteroni]
Length=266

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 121/216 (56%), Gaps = 1/216 (0%)
 Frame = -3

Query  869  LCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNY  690
            + F+  L LL P I QP+ YH FA++R + G+P   DV SN  F+  GLAG    +  +Y
Sbjct  32   MAFMFTLALLMPGIAQPEHYHAFANQRGWLGVPNAADVLSNLGFVLAGLAGGLALWRVDY  91

Query  689  VKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIER  510
             K++     L   +F+ G+     GS+YYH  P+D  LVWDRL M++A AG+L + V  R
Sbjct  92   QKLNGTARALC-ALFFAGLLCSGAGSAYYHWAPHDSSLVWDRLGMSLAFAGLLGLAVQTR  150

Query  509  VDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTY  330
            +D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+     
Sbjct  151  IDDISARITAGVLLVAAPASVAVWAQTSNVLPWVLVQGGGMLTLLWLAFVAPRRHALPVE  210

Query  329  WLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKH  222
              W  G  ++A++ EL+D  ++ ++ H +SGH+LKH
Sbjct  211  LGWVIGLYVVAKLLELSDGDVFDVTAHAISGHSLKH  246



>ref|WP_013646336.1| alkaline phytoceramidase [Nitrosomonas sp. AL212]
 ref|YP_004293423.1| alkaline phytoceramidase [Nitrosomonas sp. AL212]
 gb|ADZ25261.1| Alkaline phytoceramidase [Nitrosomonas sp. AL212]
Length=267

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/239 (36%), Positives = 126/239 (53%), Gaps = 9/239 (4%)
 Frame = -3

Query  860  VVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKI  681
            V++  +L P IPQ   YH FAD+R F GIP   DV SN  FL  G AGL L +    +  
Sbjct  8    VIIAAMLLPPIPQSVGYHLFADRRDFLGIPNFSDVVSNLGFLFSGGAGLMLLWRVQRMPT  67

Query  680  SLQ----GEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIE  513
                    E L + V ++ I  VAFGS YYH  P+  RL+WDR+P+ IA+A +LS  +IE
Sbjct  68   QTTFHHGKESLPYWVLFSSIVMVAFGSIYYHWAPDIHRLLWDRIPIVIAIAALLSATLIE  127

Query  512  RVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPR  348
            R     G+  +   +++ V SV+YW   +     +L  Y +++   I+ IV ++L    R
Sbjct  128  RGSVNIGLRLLPLLVILAVLSVLYWYSTEQQGRGNLNFYIVMQFYLILLIVWISLRFSSR  187

Query  347  YTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
            Y+H             A++ EL D+ I+  +   VSGHTLKH+  A  A  +  +L +R
Sbjct  188  YSHGGDIYQVIALYAFAKVAELLDRSIFAWTDGWVSGHTLKHLIAAYAAYRIVQILQKR  246



>ref|WP_013964857.1| alkaline phytoceramidase [Nitrosomonas sp. Is79A3]
 ref|YP_004693958.1| alkaline phytoceramidase [Nitrosomonas sp. Is79A3]
 gb|AEJ00559.1| alkaline phytoceramidase [Nitrosomonas sp. Is79A3]
Length=261

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 127/246 (52%), Gaps = 9/246 (4%)
 Frame = -3

Query  875  AILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLA--LCY  702
             I   VV   ++ P +PQP  YH FAD+R F GIP   DV SN  F   G AGL   L  
Sbjct  12   GITVLVVAAAMILPPVPQPANYHQFADQRSFSGIPNFNDVISNLAFFLSGSAGLVFLLRV  71

Query  701  YGNYVKISLQG--EVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILS  528
            Y    + +     E L + V +  +   A GS YYH  P+ D L+WDRLP+ I +A +LS
Sbjct  72   YRAPSQTTFHDLKECLPYGVLFFSVTAAALGSMYYHWTPDVDHLMWDRLPIVIGIAALLS  131

Query  527  IFVIERVDEKRGILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMAL  363
              +++R+    G+ ++   ++  V SV+YW     +   +L  Y +++   I+ IV ++L
Sbjct  132  ATLVDRISPAAGLWALPLLVVSAVFSVLYWYWTELQGTGNLNFYIVMQFYSILLIVWISL  191

Query  362  WIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLM  183
              P RYT  +Y         +A++ E+ D  I+  +   +SGHTLKH+  A  A  +  +
Sbjct  192  RFPSRYTRGSYVYQVIALYAIAKLAEVLDGQIFVWTDGWISGHTLKHLIAAYAAYRIVQI  251

Query  182  LAQRDI  165
            L +R +
Sbjct  252  LRKRTL  257



>ref|WP_026635895.1| hypothetical protein [Dyella japonica]
Length=244

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 127/229 (55%), Gaps = 6/229 (3%)
 Frame = -3

Query  893  LSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGL  714
            L++ G+ +L  V L +   P + QP++YH FAD+R + GIP   DV SN  FLA+GL GL
Sbjct  2    LALAGI-VLAIVALAL---PPMAQPQSYHGFADQRGWLGIPNFGDVMSNLAFLAVGLMGL  57

Query  713  ALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGI  534
            A       V+   +  +  + + + G+A  AFGS+YYH  P+D RLVWDRLPM +    +
Sbjct  58   AAMRL-PAVQAMGRTSMHAYGMTFAGLALTAFGSAYYHWAPSDARLVWDRLPMTLVFMPL  116

Query  533  LSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIP  354
            L+  + ER+   R    ++   L+GVG+V+YW+   +L PY   E   I+ ++L    +P
Sbjct  117  LAATLAERL-RWRSDQPLLALSLLGVGTVVYWKLTGNLLPYFAAEGGSILLLLLAVALLP  175

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAI  207
              ++            L+A   E  DK +++ +   VSGHT+KH+  A+
Sbjct  176  TPWSGRAQLFAVLATYLVAFACEQGDKLVFQATGGNVSGHTIKHLVAAL  224



>ref|WP_034061702.1| hypothetical protein [Lacinutrix sp. PAMC 27137]
Length=251

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 149/264 (56%), Gaps = 17/264 (6%)
 Frame = -3

Query  944  QRDINTNTRQARPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYT  765
             +   T+ ++     S L+  G+A+L   + + +++P I Q ++YHDF+D + FF +   
Sbjct  1    MKSFFTSLKKENIAYSILTSLGLALL---IGIFIVSP-IIQSQSYHDFSDAKTFFKMNNF  56

Query  764  LDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEV-LGWTVFYTGIATVAFGSSYYHLNPN  588
             +V SN PF  +G  G+          I L  E  L + +F++ I  V+ GS+YYHLNPN
Sbjct  57   WNVISNLPFFIVGFLGIY--------NIKLITEKKLQYVMFFSSILFVSIGSTYYHLNPN  108

Query  587  DDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYA  408
            +  L++DRLPM +    + SI + E +++K G   ++P LL+G+ SV+YW  F+DL  Y 
Sbjct  109  NYTLIFDRLPMTLLFMALSSIIISEFINDKIGKKFLLPMLLLGLFSVLYWVFFEDLSLYV  168

Query  407  MVETVPIIAIVLMALWIPPRYTHST-YWLWAAGCLLLARIGELADKPIYKLSLHRVSGHT  231
             ++  P++ I ++ +     YTH+  YWL  A   ++A+  E  D  ++   L  +SGH+
Sbjct  169  FIQFYPMLVIPIVLVCFKSSYTHAYGYWLLLA-FYIIAKGCEYYDVELFT-KLKVISGHS  226

Query  230  LKHVFGAI-LAVILTLMLAQRDIQ  162
            +KH+  A+ L V+  + + +R I+
Sbjct  227  IKHIMSAMGLYVLYRVYIKRRKIE  250



>ref|WP_039050743.1| MULTISPECIES: hypothetical protein [Proteobacteria]
Length=266

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 123/220 (56%), Gaps = 4/220 (2%)
 Frame = -3

Query  881  GVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCY  702
            G+A+L  + LLM   P + QP+ YH FAD+R + G+P+  DV SN  F+  GLAG     
Sbjct  31   GMALLFTLALLM---PGMAQPEHYHAFADQRGWLGLPHAADVLSNLGFVLAGLAGGLALR  87

Query  701  YGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIF  522
              +Y K++     L   +F+ G+     GS++YH  P D  LVWDRL M++A AG+L + 
Sbjct  88   RADYQKLNGTARALC-ALFFAGLLCSGAGSAWYHWAPQDSSLVWDRLGMSLAFAGLLGLA  146

Query  521  VIERVDEKRGILSIIPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYT  342
            V  R+D+    ++    L+    SV  W +  ++ P+ +V+   ++ ++ +A   P R+ 
Sbjct  147  VQTRIDDISARITAGVLLVAAPVSVAVWAQTSNVLPWVLVQGGGMLVLLWLAFITPRRHA  206

Query  341  HSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKH  222
                  W  G  L+A++ EL+D  ++ ++ H +SGH+LKH
Sbjct  207  LPVELGWVIGLYLVAKLLELSDGDVFDVTAHTISGHSLKH  246



>ref|XP_002294763.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88123.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=272

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/260 (32%), Positives = 122/260 (47%), Gaps = 39/260 (15%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKF-----------------------FGIPYTLDVTSNFPFLAIGLA  720
            IPQ KAYH+FADKR+                        F +P   DV SN   L  G+ 
Sbjct  13   IPQQKAYHNFADKRRCQCECGIPKFLPANVSTRNVRGVGFNVPNFGDVASNVVILIGGIC  72

Query  719  GLA---LCYYGNYVKISLQGEVLGWT------VFYTGIATVAFGSSYYHLNPNDDRLVWD  567
            GL    L  Y N    +   +   W       +F+     ++ GS+YYH  PN+  LVWD
Sbjct  73   GLVSLILLEYPNDTTTNHPSDHDDWQTKACLPIFFGSTVAISMGSTYYHWKPNNATLVWD  132

Query  566  RLPMAIALAGILSIFVIERVDEKR-------GILSIIPSLLVGVGSVIYWRRFDDLRPYA  408
            RLPM +A A I    + E +   +       G + + P + VGV SV+YW   DDLR Y 
Sbjct  133  RLPMTVAFAAIFCFMLDEYLPSHQSQNVDGIGRVLLTPLIAVGVMSVLYWSWVDDLRLYV  192

Query  407  MVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTL  228
             V  +P+  ++L+ ++  P++T     L        A+I E  D  I+  + +R+SGH+L
Sbjct  193  AVSILPMFIMLLLVIFYEPKHTGKMQQLLGLALYAGAKICEDRDYEIFYFTGNRLSGHSL  252

Query  227  KHVFGAILAVILTLMLAQRD  168
            KH+   +  V++  M+  RD
Sbjct  253  KHILAGLAPVVIAQMVYVRD  272



>ref|WP_005373706.1| Alkaline phytoceramidase (aPHC) [Methylomicrobium album]
 gb|EIC30829.1| Alkaline phytoceramidase (aPHC) [Methylomicrobium album BG8]
Length=256

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 118/227 (52%), Gaps = 9/227 (4%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWT  651
            IPQ  AYH FAD+R   G+P   +V SNFPFL +GL G+     G  +   L      + 
Sbjct  27   IPQDSAYHRFADQRTMAGLPNFWNVISNFPFLIVGLIGMRRVL-GEPLTGGLAELRWMYF  85

Query  650  VFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPS  471
             F+ G+     GSSYYHL+P++  LVWDRLP+ I    +    V E V  +      +P 
Sbjct  86   AFFAGVFLTGIGSSYYHLHPDNRTLVWDRLPITIGFMALFGAIVGEYVSIRAARTLFVPL  145

Query  470  LLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAI-VLMALWIPPRYTHSTYWLWAAGC  309
            L VG+ SV+YW   +     DLRPYA+V+ +P+I I V++ L+       + YW      
Sbjct  146  LCVGLASVLYWHVTELNGQGDLRPYALVQFLPVILIPVILGLFKSELQGDAFYW-GMIAA  204

Query  308  LLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
              LA+  E  D  +Y+L L  VSGHTLKH+  A    I    L  R+
Sbjct  205  YALAKAAEFFDAGLYEL-LGGVSGHTLKHLIAAAAPFIFYRALRHRE  250



>emb|CEE12979.1| hypothetical protein BN1094_01523 [Legionella massiliensis]
 emb|CDZ77241.1| hypothetical protein BN59_01523 [Legionella massiliensis]
Length=258

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 121/231 (52%), Gaps = 10/231 (4%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG  657
            P IPQ ++YH+FAD+R + GI    +V SN  F  IG+ GL L +  + ++     E   
Sbjct  30   PPIPQSQSYHNFADQRSWLGINNAFNVLSNLSFALIGIWGLFLLFSHSKIQFIDSSERWF  89

Query  656  WTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSII  477
            W     G+  VA GS YYHL P++ RLVWDRLPM I     +S  + +R++ +       
Sbjct  90   WVSLSLGLILVALGSGYYHLVPDNSRLVWDRLPMTIVFISFVSALISDRINSRLAFWLWP  149

Query  476  PSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAG  312
              L++G+ SV+ W   +     DLR YA V+    +  ++M L +   YT S  W  A  
Sbjct  150  FLLMIGIFSVLQWHVSELHGAGDLRLYAAVQAYTCLLALIMLL-LQSHYTRS--WDIAII  206

Query  311  CLL--LARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDI  165
             L   LA+  EL D  IY+     +SGHTLKH+  A+ A  +  M+ +R I
Sbjct  207  TLFYGLAKAFELYDAQIYQFCRGIISGHTLKHLTAALSAFWMIRMIWKRQI  257



>ref|WP_011628715.1| hypothetical protein [Alkalilimnicola ehrlichii]
 ref|YP_741810.1| hypothetical protein Mlg_0967 [Alkalilimnicola ehrlichii MLHE-1]
 gb|ABI56320.1| conserved hypothetical protein [Alkalilimnicola ehrlichii MLHE-1]
Length=258

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 127/242 (52%), Gaps = 11/242 (5%)
 Frame = -3

Query  911  RPQGSPLSVCGVAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLA  732
            R  G  L++ G A++  V    L  P IPQP+AYHDFAD+R+  GIP+  DV SN  FL 
Sbjct  2    RSGGLWLTLLGAALVAAV---WLWVPPIPQPEAYHDFADQRRVLGIPHFGDVISNGVFLL  58

Query  731  IGLAGLALCYYGNYVKISLQGEVLGWTVF--YTGIATVAFGSSYYHLNPNDDRLVWDRLP  558
            +GL GL L       + + +     W  +  +     VAFGS YYHL+P+  RL WDRLP
Sbjct  59   VGLYGL-LQTRRLQARQTFRPATDAWPYYALFAATVGVAFGSIYYHLDPDHWRLYWDRLP  117

Query  557  MAIALAGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETV  393
            +++A   I +  + ER+  +     +   LL+G     +W   +     DLR Y +V+ V
Sbjct  118  ISLAFMAIFTAVLGERLPARVTPWLLPLLLLIGAAGATHWLVTELSGQGDLRLYLLVQAV  177

Query  392  PIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG  213
            PI+  V+       RYT     + AAG  LLA + E  D  +++ +   VSGHTLKH+  
Sbjct  178  PILVAVVWIGMRGGRYTRGGDVIAAAGWYLLALVLENLDALVFEATGGWVSGHTLKHLLA  237

Query  212  AI  207
             +
Sbjct  238  GV  239



>ref|WP_040879759.1| hypothetical protein, partial [Marinobacterium rhizophilum]
Length=244

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 119/217 (55%), Gaps = 8/217 (4%)
 Frame = -3

Query  824  QPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLG-WTV  648
            Q   YHDFAD R   GI   +DV +N PF+ +GL GL L      +  +    + G + V
Sbjct  17   QSLDYHDFADHRTLLGIANAVDVLTNLPFVLVGLVGLRLL---QKIAPAADSPLAGMYRV  73

Query  647  FYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSL  468
            F  G+  V  GS +YHL+P++D L WDRLPMA   A   S+ V ERV E  G+      +
Sbjct  74   FMAGLILVGVGSGWYHLHPDNDSLFWDRLPMAACFASFCSLVVCERVGETAGLRLCAWLM  133

Query  467  LVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLW-AAGCLLLARI  291
             + + SV YWR  DDLRPY +++  P++ +  + L+   R    T WLW    C  LA++
Sbjct  134  PLALASVQYWRWLDDLRPYLLIQFGPLLVMPFVLLF---RRGPGTLWLWLMLLCYGLAKV  190

Query  290  GELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLML  180
             E+ D+ +++L+   +SGH  KH+  A  A +L + L
Sbjct  191  LEMNDRALFELTAGWMSGHGFKHLMAAAAASMLVIKL  227



>ref|WP_009205004.1| hypothetical protein [Sulfuricella denitrificans]
 ref|YP_008546841.1| hypothetical protein SCD_n01998 [Sulfuricella denitrificans skB26]
 dbj|BAN35809.1| hypothetical protein SCD_n01998 [Sulfuricella denitrificans skB26]
Length=264

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 121/228 (53%), Gaps = 7/228 (3%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLA-LCYYGNYVKISLQGEVL  660
            P  PQP AYHDFAD+R F G+P  L+V SN  F+ +  AGL  L   G       + E  
Sbjct  28   PSFPQPAAYHDFADQRAFLGLPNFLNVASNGLFVLVSAAGLRWLTAAGGDTAFRDRRERW  87

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
             + +F+ G+A     S++YHLNP++ RL+WDRL M +AL   L+  + ER+    G+  +
Sbjct  88   IYLIFFLGLALTGIASAWYHLNPDNGRLLWDRLAMTVALMSWLAAIIAERISVAAGLALL  147

Query  479  IPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAA  315
               L  G  SV+YW   +     DLRPY MV   P + I L+ L  PPRYT     L   
Sbjct  148  PVLLAAGAASVLYWGATEALGAGDLRPYGMVHFYPALLIPLLILLFPPRYTRGGDVLIVL  207

Query  314  GCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQR  171
            G    A   EL D+ I+ L    V GHT+KHVF A+ A  +  ML  R
Sbjct  208  GWYAAALGAELLDRQIFALG-GIVGGHTVKHVFAALAACWVLRMLRLR  254



>ref|WP_031429698.1| alkaline phytoceramidase [Methylomicrobium agile]
Length=256

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/227 (37%), Positives = 115/227 (51%), Gaps = 9/227 (4%)
 Frame = -3

Query  830  IPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWT  651
            IPQ  AYH FAD+R   G+P   +V SNFPFL +GL G+     G      L      + 
Sbjct  27   IPQDSAYHRFADQRTMAGLPNFRNVISNFPFLVVGLTGMRRVL-GEPPTGGLAELRWMYF  85

Query  650  VFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPS  471
             F+ G+     GSSYYHL+P++  LVWDRLP+ I    +    V E V  +      +P 
Sbjct  86   AFFAGVFLTGIGSSYYHLHPDNRTLVWDRLPITIGFMALFGSIVGEYVSIRAARTLFVPL  145

Query  470  LLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAA-GC  309
            L VG+ SV+YW   +     DLRPY +V+ +P++ I ++ LW+         + W     
Sbjct  146  LFVGLASVLYWHVTELNGQGDLRPYVLVQLLPMMLIPVI-LWLFKSELQGDAFYWGMIAA  204

Query  308  LLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRD  168
              LA+  E  D  +Y+L L  VSGHTLKH+  A    I    L  R+
Sbjct  205  YALAKAAEFFDAGLYEL-LGGVSGHTLKHLIAAAAPFIFYRALRHRE  250



>ref|WP_010645564.1| protein phosphatase 2C-like protein [endosymbiont of Bathymodiolus 
sp.]
Length=251

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 139/252 (55%), Gaps = 16/252 (6%)
 Frame = -3

Query  899  SPLSVCGVAILCFVV-LLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGL  723
              L++  + ++ FV+ L+M L   IPQ   YH F D R  FG+    +V SNFPFL +G+
Sbjct  5    QKLTIKLILLISFVITLIMFLQDPIPQSVKYHSFVDDRGMFGVVNFYNVISNFPFLLVGI  64

Query  722  AGLALCYYGNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIAL  543
              + L    N + IS   + + +T+F+ G+  + FGSSY+HL+   + L  DRLPM I  
Sbjct  65   YAIILLK-NNKLDISDNIKYMYYTMFF-GVVMIFFGSSYFHLDVRHETLFLDRLPMVIVF  122

Query  542  AGILSIFVIERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVP--II  384
              + SI + E +  K G    IP + +G+ +++YW   +     DLR Y +V+ +P  I+
Sbjct  123  MALFSIVISEFISLKIGKKLFIPLMALGLFTIVYWIIGEHYGSGDLRGYLLVQFLPMLIM  182

Query  383  AIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAIL  204
             I+L++     R +   YW +     + A++ E  D  I++L    +SGH++KH+  A L
Sbjct  183  PIILLSF---KRKSAKAYW-YLLLFYVFAKLFEYFDGQIFEL-FGFISGHSIKHMVAA-L  236

Query  203  AVILTLMLAQRD  168
             +++ L++ ++D
Sbjct  237  GLLIFLLIEKKD  248



>ref|WP_033961000.1| hypothetical protein [Psychroserpens sp. PAMC 27130]
Length=251

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 114/211 (54%), Gaps = 11/211 (5%)
 Frame = -3

Query  836  PRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKIS-LQGEVL  660
            P I Q   YH+F D +  F IP   +V SN PFL +G+ GL         K++    +  
Sbjct  28   PPIEQRLDYHNFIDIKTIFNIPNFWNVLSNLPFLIVGILGLT--------KLNVFNKKRF  79

Query  659  GWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSI  480
             + +F+  I  VA GSSYYHLNPN + LVWDRLPM +A   +LSI + E +++K G   +
Sbjct  80   QYLIFFMSILLVALGSSYYHLNPNHETLVWDRLPMTVAFMSLLSILISESINDKIGKNLL  139

Query  479  IPSLLVGVGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLL  300
             P L++G+ S++YW    DLR Y  V+  PI+ I ++ L    +      + +     ++
Sbjct  140  FPLLVLGIASIVYWLITKDLRLYVFVQFYPILIIPILLLCFRLKINAVNGYWFLLLAYVI  199

Query  299  ARIGELADKPIYKLSLHRVSGHTLKHVFGAI  207
            A+  E  D  ++     + SGH+LKH+  A+
Sbjct  200  AKTLEYFDALVFDYL--KFSGHSLKHIISAV  228



>ref|WP_012800967.1| hypothetical protein [Kangiella koreensis]
 ref|YP_003146221.1| hypothetical protein Kkor_1034 [Kangiella koreensis DSM 16069]
 gb|ACV26453.1| conserved hypothetical protein [Kangiella koreensis DSM 16069]
Length=259

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 120/235 (51%), Gaps = 13/235 (6%)
 Frame = -3

Query  878  VAILCFVVLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYY  699
            VAI    +  M     I Q   YH FAD  +  GI    +V SNF F+ +GL GL     
Sbjct  12   VAISILAIAGMFFVGPIAQDNQYHLFADSHQIVGISNFWNVFSNFSFVLVGLFGL-----  66

Query  698  GNYVKISLQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFV  519
              Y ++++     G+     G+  V FGS+YYH  P++  L+WDRLPM +A   + ++ +
Sbjct  67   WRYPRLAVADSKAGYLFLCVGVLLVGFGSAYYHAAPSNASLLWDRLPMTVAFMALFALLL  126

Query  518  IERVDEKRGILSIIPSLLVGVGSVIYWRRFD-----DLRPYAMVETVPIIAIVLMALWIP  354
             ERV      L +   ++ GV + +YW   +     DLRPY +V+ +PII + L+     
Sbjct  127  SERVISSCRNLVLWVLVIFGVLAALYWSWTESLGQGDLRPYMLVQFLPIILMPLILWLFK  186

Query  353  PRYTHSTYWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFG--AILAVI  195
             RY  ++   +A     LA+  E  D  IY+++   VSGHTLKH+    A+L +I
Sbjct  187  ERYLSTSLLFYAFILYFLAKACEYFDHEIYEMT-QLVSGHTLKHLVASLAVLCII  240



>ref|WP_028982523.1| hypothetical protein [Sporocytophaga myxococcoides]
Length=243

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 118/242 (49%), Gaps = 16/242 (7%)
 Frame = -3

Query  857  VLLMLLTPRIPQPKAYHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKIS  678
            ++ ++L   IPQ  +YH FAD   F+GI    +V SNFPF  IG  G+      +++  S
Sbjct  13   LIFLILHGPIPQSASYHSFADHSTFYGIRNFYNVVSNFPFFIIGAVGIIFILKNDFLYKS  72

Query  677  LQGEVLGWTVFYTGIATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEK  498
             +        F+ GI     GS+YYH +P+   LVWDRLPM I      S  +      +
Sbjct  73   AR------LCFFIGIFLTGLGSAYYHYDPSTSTLVWDRLPMTITFMSFFSFILFRNFSFR  126

Query  497  RGILSIIPSLLVGVGSVIYW-----RRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHST  333
                 +I  LL G+ SVI+W     R   DLR YA+V+  P++AI+++ LW         
Sbjct  127  NHDNILILLLLTGIASVIFWYTGELRGSGDLRLYALVQFYPVVAIIIILLWNGKDRQMFG  186

Query  332  YWLWAAGCLLLARIGELADKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQTER  153
               W     + A++ E  D+    L+   +SGHT+KH+  A  AV L ++        ++
Sbjct  187  VIFW----YIAAKVFEATDQEFLSLT-EVISGHTIKHLMAACAAVHLLVLFYIEYKSLKK  241

Query  152  IS  147
            IS
Sbjct  242  IS  243



>ref|WP_034606499.1| hypothetical protein, partial [Chitinimonas koreensis]
Length=204

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 108/206 (52%), Gaps = 7/206 (3%)
 Frame = -3

Query  812  YHDFADKRKFFGIPYTLDVTSNFPFLAIGLAGLALCYYGNYVKISLQGEVLGWTVFYTGI  633
            YH FAD+R   G+P   DV SN  FL +G AGLA           L+    GW +F+ G+
Sbjct  1    YHHFADRRSGLGLPNAADVLSNLAFLLVGAAGLAFVRRWRR-HPGLRAGRAGWLLFFGGL  59

Query  632  ATVAFGSSYYHLNPNDDRLVWDRLPMAIALAGILSIFVIERVDEKRGILSIIPSLLVGVG  453
               AFGSSYYHL P+D RLVWDRLP+A+  AG+L+    E +   R  ++ +  L     
Sbjct  60   VLTAFGSSYYHLAPDDARLVWDRLPIALTCAGLLAAVGCETLGCGRRTVAALALLAAASV  119

Query  452  SVIYWRR---FDDLRPYAMVETVPIIAI-VLMALWIPPRYTHSTYWLWAAGCLLLARIGE  285
               YW       DLRPY +++   ++ +  L      PRY     WL A G  +LA++ E
Sbjct  120  GWWYWSAPLGGGDLRPYLLLQIATLVWVPALQQAAAAPRYERRAVWL-AVGAYVLAKLCE  178

Query  284  LADKPIYKLSLHRVSGHTLKHVFGAI  207
            L D  ++ L L   SGHTLKH+   +
Sbjct  179  LTDHALFDL-LGLCSGHTLKHLLAGM  203



>ref|XP_010463240.1| PREDICTED: uncharacterized protein LOC104743907 [Camelina sativa]
Length=173

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  458  VGSVIYWRRFDDLRPYAMVETVPIIAIVLMALWIPPRYTHSTYWLWAAGCLLLARIGELA  279
            V  ++YWR FDDL+PYA+V+ V  I I LM +  PP YTHSTYWLWAAG  LLA++ E A
Sbjct  30   VFFILYWRFFDDLKPYALVQFVHCIVIPLMVILSPPMYTHSTYWLWAAGFYLLAKVEEAA  89

Query  278  DKPIYKLSLHRVSGHTLKHVFGAILAVILTLMLAQRDIQ  162
            DKPIY  + H +SGH+LKH++ A+  V LTL+LA++  +
Sbjct  90   DKPIYSWTHHIISGHSLKHLYAAMFHVFLTLVLAKKPFK  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2469297046400