BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26057_g1_i1 len=1209 path=[1:0-1208]

Length=1209
                                                                      Score     E

ref|XP_009775353.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    482   2e-166   
ref|XP_009629123.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    481   3e-166   
ref|XP_011079631.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    472   1e-162   
ref|XP_006355815.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    466   2e-160   
ref|XP_004240550.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    464   1e-159   
ref|XP_009620847.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    462   1e-158   
ref|XP_009771842.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    462   1e-158   
ref|XP_010038230.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    459   9e-158   
gb|KDP28184.1|  hypothetical protein JCGZ_13955                         457   4e-157   
gb|EYU46742.1|  hypothetical protein MIMGU_mgv1a010264mg                457   4e-157   
ref|XP_003632381.1|  PREDICTED: bifunctional epoxide hydrolase 2        456   3e-156   
ref|XP_007163124.1|  hypothetical protein PHAVU_001G208300g             455   4e-156   
ref|XP_003554527.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    453   4e-155   
gb|EYU46741.1|  hypothetical protein MIMGU_mgv1a009984mg                452   8e-155   
ref|XP_010038235.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    452   9e-155   
emb|CDP17110.1|  unnamed protein product                                452   9e-155   
emb|CDP17111.1|  unnamed protein product                                452   1e-154   
ref|XP_007050977.1|  Alpha/beta-Hydrolases superfamily protein          451   2e-154   
ref|XP_006444387.1|  hypothetical protein CICLE_v10021228mg             449   1e-153   
ref|XP_010088294.1|  Epoxide hydrolase 2                                448   3e-153   
ref|XP_002302724.1|  epoxide hydrolase family protein                   447   9e-153   Populus trichocarpa [western balsam poplar]
ref|XP_006359858.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    447   1e-152   
ref|XP_004247402.1|  PREDICTED: bifunctional epoxide hydrolase 2        446   1e-152   
gb|KHG07158.1|  Epoxide hydrolase 2                                     446   2e-152   
ref|XP_002523108.1|  epoxide hydrolase, putative                        445   3e-152   Ricinus communis
ref|XP_010039296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    444   1e-151   
ref|XP_011041992.1|  PREDICTED: bifunctional epoxide hydrolase 2        443   2e-151   
ref|XP_011015179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    443   2e-151   
ref|XP_007200440.1|  hypothetical protein PRUPE_ppa008875mg             441   1e-150   
ref|XP_008355493.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    441   1e-150   
ref|XP_004494384.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    441   1e-150   
ref|XP_006444386.1|  hypothetical protein CICLE_v10023691mg             441   2e-150   
ref|XP_011079630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    440   3e-150   
gb|KCW50060.1|  hypothetical protein EUGRSUZ_K03501                     440   7e-150   
ref|XP_010911257.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    439   1e-149   
ref|XP_010038231.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    438   2e-149   
ref|XP_006396441.1|  hypothetical protein EUTSA_v10028814mg             438   3e-149   
ref|XP_009335707.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    437   3e-149   
ref|XP_010038234.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    437   4e-149   
ref|NP_567228.1|  putative epoxide hydrolase                            437   5e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235117.1|  PREDICTED: bifunctional epoxide hydrolase 2        437   5e-149   
ref|XP_006480000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    437   6e-149   
ref|XP_002320333.2|  epoxide hydrolase family protein                   436   9e-149   Populus trichocarpa [western balsam poplar]
ref|XP_010556730.1|  PREDICTED: bifunctional epoxide hydrolase 2        436   1e-148   
ref|XP_006288215.1|  hypothetical protein CARUB_v10001452mg             436   3e-148   
ref|XP_002523107.1|  epoxide hydrolase, putative                        434   5e-148   Ricinus communis
ref|XP_010429523.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    435   5e-148   
ref|XP_004290809.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    434   5e-148   
ref|XP_009111296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    434   1e-147   
emb|CDY65636.1|  BnaAnng20810D                                          433   2e-147   
ref|XP_002874922.1|  hypothetical protein ARALYDRAFT_490337             433   3e-147   
ref|XP_010422608.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    432   5e-147   
ref|XP_010456047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    432   6e-147   
ref|XP_008454327.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    431   2e-146   
emb|CDY50394.1|  BnaCnng19260D                                          431   2e-146   
gb|KFK30821.1|  hypothetical protein AALP_AA6G030400                    429   8e-146   
ref|XP_010088295.1|  Epoxide hydrolase 2                                428   2e-145   
gb|KDO87161.1|  hypothetical protein CISIN_1g048209mg                   429   2e-145   
ref|XP_009391487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    427   3e-145   
ref|XP_008386679.1|  PREDICTED: bifunctional epoxide hydrolase 2        427   5e-145   
ref|XP_009411662.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    427   6e-145   
gb|KEH24395.1|  epoxide hydrolase                                       427   6e-145   
gb|EYU42746.1|  hypothetical protein MIMGU_mgv1a010198mg                426   2e-144   
ref|XP_008454330.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    426   2e-144   
ref|XP_010921626.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    425   2e-144   
ref|XP_004152245.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    425   3e-144   
gb|AAO27849.1|AF482450_1  soluble epoxide hydrolase                     425   4e-144   Euphorbia lagascae
gb|AFZ93648.1|  epoxide hydrolase                                       424   5e-144   
ref|XP_010039280.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    424   8e-144   
gb|KDP28185.1|  hypothetical protein JCGZ_13956                         423   2e-143   
gb|KDP28186.1|  hypothetical protein JCGZ_13957                         423   2e-143   
ref|XP_010269590.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    422   3e-143   
ref|XP_008223222.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    422   5e-143   
ref|XP_009111297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    422   6e-143   
emb|CDY65635.1|  BnaAnng20800D                                          421   8e-143   
ref|XP_007222764.1|  hypothetical protein PRUPE_ppa008756mg             421   9e-143   
ref|XP_007222693.1|  hypothetical protein PRUPE_ppa008676mg             421   1e-142   
ref|XP_008454322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    420   2e-142   
ref|XP_008775993.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    420   2e-142   
ref|XP_010684348.1|  PREDICTED: bifunctional epoxide hydrolase 2        420   2e-142   
ref|XP_010649574.1|  PREDICTED: bifunctional epoxide hydrolase 2        420   2e-142   
emb|CAZ86692.1|  epoxide hydrolase 1                                    420   5e-142   
ref|XP_008784769.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    419   8e-142   
ref|XP_004152244.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    418   2e-141   
ref|XP_004156834.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    417   3e-141   
ref|XP_009393200.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    417   5e-141   
ref|XP_009352305.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    417   7e-141   
gb|EPS67066.1|  pectinesterase                                          436   3e-140   
gb|AAM28292.1|  epoxide hydrolase                                       415   3e-140   Ananas comosus
ref|XP_010038233.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    415   3e-140   
gb|KGN66047.1|  hypothetical protein Csa_1G569240                       414   5e-140   
ref|XP_010914488.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    414   6e-140   
gb|EPS62395.1|  hypothetical protein M569_12392                         413   1e-139   
ref|XP_008454325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    414   1e-139   
ref|XP_008789846.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    413   1e-139   
ref|XP_004152242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    412   3e-139   
ref|XP_007035641.1|  Alpha/beta-Hydrolases superfamily protein          415   3e-139   
ref|XP_004296863.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    412   4e-139   
ref|XP_006489040.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    414   5e-139   
gb|KDO71745.1|  hypothetical protein CISIN_1g017221mg                   414   6e-139   
ref|XP_004290776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    411   7e-139   
ref|XP_010102979.1|  Epoxide hydrolase 2                                411   8e-139   
ref|XP_006419515.1|  hypothetical protein CICLE_v10005186mg             413   8e-139   
gb|KEH24510.1|  epoxide hydrolase                                       410   2e-138   
ref|XP_004152361.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    410   2e-138   
ref|XP_004134492.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    409   5e-138   
ref|XP_002271210.1|  PREDICTED: bifunctional epoxide hydrolase 2        408   1e-137   Vitis vinifera
ref|XP_003550367.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    407   3e-137   
ref|XP_007147001.1|  hypothetical protein PHAVU_006G088400g             407   5e-137   
ref|XP_008784772.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    406   9e-137   
ref|XP_008784771.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    407   1e-136   
ref|XP_008784770.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    407   2e-136   
gb|KDP27824.1|  hypothetical protein JCGZ_18904                         405   3e-136   
gb|KDP27825.1|  hypothetical protein JCGZ_18905                         405   3e-136   
ref|XP_009393199.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    404   5e-136   
emb|CDY09722.1|  BnaC07g33390D                                          404   7e-136   
gb|ACU19478.1|  unknown                                                 404   8e-136   Glycine max [soybeans]
ref|XP_009136735.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    405   1e-135   
ref|XP_003554633.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    404   1e-135   
ref|XP_010094462.1|  Epoxide hydrolase 2                                403   1e-135   
gb|ADP68585.1|  epoxide hydrolase A                                     403   2e-135   
gb|ACE82565.1|  epoxide hydrolase                                       403   2e-135   Nicotiana benthamiana
emb|CDX90550.1|  BnaA03g42310D                                          403   2e-135   
ref|XP_010104146.1|  Epoxide hydrolase 2                                402   2e-135   
gb|KHG21329.1|  Epoxide hydrolase 2                                     405   3e-135   
ref|XP_009788536.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    402   3e-135   
ref|XP_006433457.1|  hypothetical protein CICLE_v10001881mg             402   3e-135   
ref|XP_007221833.1|  hypothetical protein PRUPE_ppa020197mg             402   4e-135   
ref|XP_010914487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    402   5e-135   
ref|XP_007031041.1|  Alpha/beta-Hydrolases superfamily protein          401   7e-135   
gb|AES82458.2|  epoxide hydrolase                                       401   9e-135   
ref|XP_009350800.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    401   9e-135   
ref|XP_002512456.1|  epoxide hydrolase, putative                        400   1e-134   Ricinus communis
ref|XP_010105136.1|  Epoxide hydrolase 2                                402   1e-134   
ref|XP_004230258.1|  PREDICTED: bifunctional epoxide hydrolase 2        400   1e-134   
gb|KDP23458.1|  hypothetical protein JCGZ_23291                         400   2e-134   
ref|XP_008438903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    402   3e-134   
ref|XP_011091000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    400   4e-134   
ref|XP_010024724.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    399   4e-134   
ref|XP_009386486.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    399   4e-134   
ref|XP_008450607.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    399   5e-134   
ref|XP_006604802.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    399   8e-134   
ref|XP_002318980.2|  epoxide hydrolase family protein                   398   9e-134   Populus trichocarpa [western balsam poplar]
ref|XP_007015353.1|  Alpha/beta-Hydrolases superfamily protein          398   1e-133   
ref|XP_011010961.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    398   1e-133   
ref|XP_011023717.1|  PREDICTED: bifunctional epoxide hydrolase 2        398   1e-133   
gb|ACE82566.1|  epoxide hydrolase                                       398   1e-133   Nicotiana benthamiana
ref|XP_011010960.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    398   1e-133   
gb|KFK41013.1|  hypothetical protein AALP_AA2G073900                    398   2e-133   
ref|XP_008807392.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    398   2e-133   
ref|XP_009629075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    397   3e-133   
gb|KHG24497.1|  Epoxide hydrolase 2                                     397   3e-133   
ref|XP_010914485.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    397   3e-133   
ref|XP_007147002.1|  hypothetical protein PHAVU_006G088500g             397   3e-133   
ref|XP_006344695.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    397   3e-133   
ref|XP_011092097.1|  PREDICTED: bifunctional epoxide hydrolase 2        396   5e-133   
gb|KDP27828.1|  hypothetical protein JCGZ_18908                         396   6e-133   
ref|XP_002455386.1|  hypothetical protein SORBIDRAFT_03g009830          396   7e-133   Sorghum bicolor [broomcorn]
ref|XP_003626243.1|  Epoxide hydrolase                                  396   7e-133   
gb|AFK39700.1|  unknown                                                 396   1e-132   
emb|CDP17206.1|  unnamed protein product                                395   1e-132   
ref|XP_009622179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    396   1e-132   
ref|XP_009414133.1|  PREDICTED: bifunctional epoxide hydrolase 2        397   1e-132   
ref|XP_008341331.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    395   1e-132   
ref|XP_002283462.1|  PREDICTED: bifunctional epoxide hydrolase 2        394   3e-132   Vitis vinifera
ref|NP_001238563.1|  epoxide hydrolase                                  395   3e-132   
ref|XP_006342824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    394   4e-132   
ref|XP_010105137.1|  Epoxide hydrolase 2                                394   4e-132   
ref|XP_004152243.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    394   5e-132   
ref|XP_004494576.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    394   6e-132   
ref|XP_007147004.1|  hypothetical protein PHAVU_006G088600g             394   6e-132   
ref|XP_006414412.1|  hypothetical protein EUTSA_v10025488mg             395   7e-132   
gb|ACJ85188.1|  unknown                                                 393   9e-132   Medicago truncatula
ref|XP_008340789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    393   1e-131   
ref|XP_007154300.1|  hypothetical protein PHAVU_003G106900g             393   1e-131   
ref|XP_002314368.1|  hypothetical protein POPTR_0010s01430g             394   1e-131   Populus trichocarpa [western balsam poplar]
emb|CAA55294.1|  epoxide hydrolase                                      394   1e-131   Glycine max [soybeans]
ref|XP_003626241.1|  Epoxide hydrolase                                  393   1e-131   
ref|XP_006472971.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    402   2e-131   
ref|XP_011006450.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    392   4e-131   
ref|XP_008371325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    392   4e-131   
ref|XP_002270853.1|  PREDICTED: bifunctional epoxide hydrolase 2        392   4e-131   Vitis vinifera
ref|XP_004967831.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    391   6e-131   
ref|XP_008454324.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    392   8e-131   
gb|KHN43314.1|  Epoxide hydrolase 2                                     390   9e-131   
ref|XP_004508197.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    392   1e-130   
ref|NP_001051780.1|  Os03g0829100                                       391   1e-130   Oryza sativa Japonica Group [Japonica rice]
gb|EYU43974.1|  hypothetical protein MIMGU_mgv1a009814mg                390   2e-130   
ref|XP_009757467.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    391   2e-130   
gb|EYU21013.1|  hypothetical protein MIMGU_mgv1a010239mg                390   2e-130   
gb|EYU43973.1|  hypothetical protein MIMGU_mgv1a010247mg                390   2e-130   
ref|XP_004298141.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    390   2e-130   
ref|XP_008361962.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    390   3e-130   
ref|XP_010024723.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    390   3e-130   
gb|KEH32298.1|  epoxide hydrolase                                       391   3e-130   
ref|XP_006644009.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    389   3e-130   
ref|XP_010043042.1|  PREDICTED: bifunctional epoxide hydrolase 2        389   4e-130   
ref|XP_002314371.1|  hypothetical protein POPTR_0010s01440g             389   4e-130   Populus trichocarpa [western balsam poplar]
ref|NP_001240943.1|  uncharacterized protein LOC100803974               389   5e-130   
gb|KHN20253.1|  Epoxide hydrolase 2                                     389   6e-130   
dbj|BAJ99775.1|  predicted protein                                      389   6e-130   
gb|ACU19450.1|  unknown                                                 389   7e-130   Glycine max [soybeans]
ref|NP_001042621.1|  Os01g0255000                                       389   7e-130   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001275381.1|  epoxide hydrolase                                  389   7e-130   
ref|NP_001148885.1|  epoxide hydrolase 2                                389   8e-130   Zea mays [maize]
ref|XP_003566463.1|  PREDICTED: bifunctional epoxide hydrolase 2        389   8e-130   
ref|XP_006600362.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    389   9e-130   
ref|XP_006414587.1|  hypothetical protein EUTSA_v10025505mg             390   1e-129   
ref|XP_002516953.1|  epoxide hydrolase, putative                        388   1e-129   Ricinus communis
ref|XP_006419522.1|  hypothetical protein CICLE_v10005425mg             388   1e-129   
emb|CDM82646.1|  unnamed protein product                                388   1e-129   
ref|XP_003556522.1|  PREDICTED: bifunctional epoxide hydrolase 2 ...    387   2e-129   
ref|XP_003626240.1|  Epoxide hydrolase                                  402   3e-129   
ref|XP_006489041.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    387   3e-129   
ref|XP_007147005.1|  hypothetical protein PHAVU_006G088700g             387   4e-129   
ref|XP_004981166.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    387   4e-129   
tpg|DAA53983.1|  TPA: epoxide hydrolase 2                               387   4e-129   
ref|XP_004239808.1|  PREDICTED: bifunctional epoxide hydrolase 2        387   5e-129   
ref|XP_010434902.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    388   8e-129   
ref|XP_011090999.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   8e-129   
ref|XP_007015342.1|  Alpha/beta-Hydrolases superfamily protein          386   9e-129   
ref|XP_004229258.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   1e-128   
gb|AFK39155.1|  unknown                                                 385   1e-128   
emb|CDO98837.1|  unnamed protein product                                385   1e-128   
ref|NP_001275417.1|  epoxide hydrolase                                  384   3e-128   
ref|XP_003554635.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    384   3e-128   
gb|AFK41660.1|  unknown                                                 384   4e-128   
ref|NP_001274907.1|  epoxide hydrolase                                  384   4e-128   
pdb|3CXU|A  Chain A, Structure Of A Y149f Mutant Of Epoxide Hydro...    384   5e-128   
ref|XP_002463580.1|  hypothetical protein SORBIDRAFT_01g002410          384   5e-128   Sorghum bicolor [broomcorn]
ref|NP_001055069.1|  Os05g0273800                                       384   5e-128   Oryza sativa Japonica Group [Japonica rice]
gb|AFK34299.1|  unknown                                                 384   5e-128   
emb|CAJ19276.1|  putative epoxide hydrolase                             383   9e-128   Solanum commersonii
ref|XP_004239806.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    383   9e-128   
gb|ACF83934.1|  unknown                                                 383   1e-127   Zea mays [maize]
ref|XP_006342825.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    383   1e-127   
gb|ACU23321.1|  unknown                                                 382   1e-127   Glycine max [soybeans]
pdb|2CJP|A  Chain A, Structure Of Potato (Solanum Tuberosum) Epox...    383   2e-127   
gb|AFK46740.1|  unknown                                                 382   2e-127   
ref|XP_007144960.1|  hypothetical protein PHAVU_007G198000g             382   2e-127   
ref|NP_001150215.1|  epoxide hydrolase 2                                382   2e-127   Zea mays [maize]
ref|XP_009598630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   2e-127   
ref|XP_008775992.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   3e-127   
ref|XP_006419517.1|  hypothetical protein CICLE_v10005451mg             381   6e-127   
ref|XP_004494577.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   6e-127   
ref|NP_001274962.1|  epoxide hydrolase                                  381   8e-127   
ref|XP_010449872.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    383   9e-127   
gb|AES82420.2|  epoxide hydrolase                                       380   1e-126   
ref|XP_003626244.1|  Epoxide hydrolase                                  380   1e-126   
gb|AFK45529.1|  unknown                                                 380   1e-126   
dbj|BAK07144.1|  predicted protein                                      381   2e-126   
ref|XP_004239805.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    380   2e-126   
emb|CDO98838.1|  unnamed protein product                                380   2e-126   
ref|XP_003626245.1|  Epoxide hydrolase                                  379   3e-126   
ref|XP_010693594.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    380   4e-126   
ref|XP_006349824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    379   7e-126   
emb|CDY05187.1|  BnaC05g46160D                                          379   7e-126   
ref|XP_009775927.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    378   8e-126   
ref|XP_010229424.1|  PREDICTED: uncharacterized protein LOC100841009    392   1e-125   
ref|XP_009622181.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    378   1e-125   
ref|XP_010039619.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    377   1e-125   
gb|ACJ84958.1|  unknown                                                 377   2e-125   Medicago truncatula
gb|KHN03961.1|  Epoxide hydrolase 2                                     377   2e-125   
ref|NP_193331.6|  alpha/beta-Hydrolases superfamily protein             379   3e-125   Arabidopsis thaliana [mouse-ear cress]
gb|KEH24503.1|  epoxide hydrolase                                       377   3e-125   
ref|XP_011021885.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    378   3e-125   
ref|XP_009622776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    377   3e-125   
ref|XP_004229259.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    377   5e-125   
ref|XP_004252913.1|  PREDICTED: bifunctional epoxide hydrolase 2        376   6e-125   
ref|XP_009757465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    376   6e-125   
ref|XP_006650836.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    376   8e-125   
ref|XP_011006451.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    375   1e-124   
ref|XP_011039566.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    376   1e-124   
ref|XP_010649601.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    375   2e-124   
gb|ACJ84799.1|  unknown                                                 374   2e-124   Medicago truncatula
ref|XP_002306333.2|  hypothetical protein POPTR_0005s08280g             375   3e-124   Populus trichocarpa [western balsam poplar]
ref|NP_001276233.1|  bifunctional epoxide hydrolase 2-like              374   3e-124   
dbj|BAK06387.1|  predicted protein                                      374   5e-124   
gb|EPS69728.1|  epoxide hydrolase                                       373   6e-124   
ref|NP_001042622.1|  Os01g0255100                                       373   1e-123   
emb|CDP10752.1|  unnamed protein product                                373   1e-123   
ref|XP_009147218.1|  PREDICTED: bifunctional epoxide hydrolase 2        373   1e-123   
ref|XP_004494951.1|  PREDICTED: uncharacterized protein LOC101500941    383   2e-123   
ref|XP_006414415.1|  hypothetical protein EUTSA_v10025689mg             372   2e-123   
ref|XP_006299381.1|  hypothetical protein CARUB_v10015540mg             372   3e-123   
ref|XP_010449873.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    371   6e-123   
emb|CDY27752.1|  BnaA05g31610D                                          371   9e-123   
gb|ABK21215.1|  unknown                                                 370   9e-123   
ref|XP_006283220.1|  hypothetical protein CARUB_v10004250mg             384   1e-122   
ref|XP_010693593.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    372   2e-122   
gb|KFK41012.1|  hypothetical protein AALP_AA2G073800                    369   3e-122   
ref|XP_006397371.1|  hypothetical protein EUTSA_v10022504mg             369   4e-122   
gb|ABR16314.1|  unknown                                                 368   6e-122   
ref|XP_004965308.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    369   9e-122   
ref|XP_003626202.1|  Epoxide hydrolase                                  380   1e-121   
ref|XP_010674075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    367   1e-121   
gb|KFK37968.1|  hypothetical protein AALP_AA3G053200                    367   3e-121   
gb|EMT04118.1|  hypothetical protein F775_13984                         367   3e-121   
ref|XP_010039627.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   3e-121   
ref|XP_009140747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   3e-121   
ref|XP_002884518.1|  hypothetical protein ARALYDRAFT_317420             367   4e-121   
emb|CDY48181.1|  BnaA04g15450D                                          366   4e-121   
ref|XP_009788447.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   6e-121   
ref|XP_010486015.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   6e-121   
emb|CDX90553.1|  BnaA03g42280D                                          365   1e-120   
ref|XP_003604118.1|  Epoxide hydrolase                                  365   2e-120   
ref|XP_003563920.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   2e-120   
ref|XP_009136732.1|  PREDICTED: bifunctional epoxide hydrolase 2        365   2e-120   
ref|XP_010464087.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    365   2e-120   
emb|CAD30841.1|  soluble epoxide hydrolase                              364   2e-120   
ref|NP_187211.1|  alpha/beta-Hydrolases superfamily protein             365   2e-120   
ref|XP_002868171.1|  hypothetical protein ARALYDRAFT_329917             371   4e-120   
ref|XP_010434903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    364   4e-120   
emb|CDY09727.1|  BnaC07g33340D                                          363   8e-120   
ref|XP_010440228.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    363   1e-119   
gb|KHG22415.1|  Epoxide hydrolase 2                                     362   3e-119   
gb|KHG16220.1|  Epoxide hydrolase 2                                     361   3e-119   
emb|CDJ26688.1|  unnamed protein product                                361   4e-119   
gb|EMT09897.1|  hypothetical protein F775_52362                         360   2e-118   
ref|XP_006444395.1|  hypothetical protein CICLE_v10024303mg             358   2e-118   
ref|XP_008680999.1|  PREDICTED: uncharacterized protein LOC100191...    359   3e-118   
ref|NP_001151201.1|  epoxide hydrolase 2                                359   4e-118   
ref|XP_006414584.1|  hypothetical protein EUTSA_v10025778mg             358   5e-118   
ref|XP_010546737.1|  PREDICTED: bifunctional epoxide hydrolase 2        357   2e-117   
ref|XP_004981168.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    357   2e-117   
gb|EPS69185.1|  hypothetical protein M569_05583                         356   2e-117   
dbj|BAJ91671.1|  predicted protein                                      357   3e-117   
gb|ACG46051.1|  epoxide hydrolase 2                                     357   3e-117   
ref|XP_010548981.1|  PREDICTED: bifunctional epoxide hydrolase 2        356   4e-117   
gb|EYU42194.1|  hypothetical protein MIMGU_mgv1a010473mg                355   5e-117   
ref|XP_002443185.1|  hypothetical protein SORBIDRAFT_08g014640          357   7e-117   
dbj|BAJ89155.1|  predicted protein                                      356   9e-117   
emb|CBI39538.3|  unnamed protein product                                353   1e-116   
gb|AAA81893.1|  epoxide hydrolase                                       354   1e-116   
gb|EAY92419.1|  hypothetical protein OsI_14153                          355   2e-116   
ref|XP_004981167.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    352   1e-115   
emb|CAB46034.1|  putative epoxide hydrolase                             360   1e-115   
ref|NP_001132040.1|  uncharacterized protein LOC100193450               352   4e-115   
emb|CDY57860.1|  BnaC08g47760D                                          350   6e-115   
ref|XP_010429482.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    350   1e-114   
ref|XP_010440227.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    351   1e-114   
gb|AFW56302.1|  hypothetical protein ZEAMMB73_530848                    352   2e-114   
ref|XP_002459617.1|  hypothetical protein SORBIDRAFT_02g007580          348   4e-114   
ref|NP_001154238.1|  alpha/beta-Hydrolases superfamily protein          348   4e-114   
ref|XP_010524544.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    350   8e-114   
ref|XP_006299523.1|  hypothetical protein CARUB_v10015695mg             348   1e-113   
ref|XP_006838631.1|  hypothetical protein AMTR_s00002p00235860          347   2e-113   
gb|EAY92418.1|  hypothetical protein OsI_14152                          346   4e-113   
dbj|BAJ90007.1|  predicted protein                                      346   5e-113   
ref|NP_180242.1|  soluble epoxide hydrolase                             343   4e-112   
gb|KFK32480.1|  hypothetical protein AALP_AA6G247900                    342   8e-112   
ref|XP_006650837.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    342   1e-111   
ref|XP_006838629.1|  hypothetical protein AMTR_s00002p00235200          342   2e-111   
ref|XP_010042740.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    338   3e-111   
gb|AES82460.2|  epoxide hydrolase                                       350   4e-111   
ref|XP_003626242.1|  Epoxide hydrolase                                  349   5e-111   
ref|XP_002960490.1|  hypothetical protein SELMODRAFT_266570             340   6e-111   
ref|NP_001051781.1|  Os03g0829200                                       340   7e-111   
ref|XP_006378063.1|  hypothetical protein POPTR_0010s01420g             339   8e-111   
ref|XP_002967234.1|  hypothetical protein SELMODRAFT_87385              339   1e-110   
ref|XP_006296031.1|  hypothetical protein CARUB_v10025176mg             339   2e-110   
ref|XP_006479996.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    336   3e-110   
gb|KCW50054.1|  hypothetical protein EUGRSUZ_K03494                     335   3e-110   
ref|XP_008246047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    337   4e-110   
ref|XP_010417820.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    338   6e-110   
ref|XP_002880830.1|  predicted protein                                  337   6e-110   
ref|XP_006838632.1|  hypothetical protein AMTR_s00002p00236030          337   8e-110   
emb|CDJ26419.1|  unnamed protein product                                337   9e-110   
gb|EMT01002.1|  hypothetical protein F775_32452                         336   3e-109   
ref|XP_008644360.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    335   1e-108   
ref|NP_180243.1|  alpha/beta-hydrolases superfamily protein             333   3e-108   
gb|ACN28644.1|  unknown                                                 331   4e-108   
ref|XP_003577254.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    333   6e-108   
ref|XP_010473058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    332   9e-108   
ref|XP_010544298.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    332   1e-107   
gb|EAY73347.1|  hypothetical protein OsI_01224                          332   2e-107   
gb|KDO87174.1|  hypothetical protein CISIN_1g021158mg                   327   8e-107   
gb|KCW50160.1|  hypothetical protein EUGRSUZ_K03595                     326   1e-106   
ref|XP_011015180.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    326   2e-106   
ref|XP_002310826.2|  epoxide hydrolase family protein                   328   4e-106   
ref|XP_008338037.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    327   7e-106   
ref|XP_010100621.1|  Epoxide hydrolase 2                                325   8e-106   
ref|XP_003577188.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    327   1e-105   
ref|XP_002275186.1|  PREDICTED: bifunctional epoxide hydrolase 2        325   4e-105   
ref|XP_010544295.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    325   5e-105   
gb|KHG02720.1|  Epoxide hydrolase 2                                     337   2e-104   
emb|CAN77654.1|  hypothetical protein VITISV_032325                     323   3e-104   
ref|XP_009346065.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    322   7e-104   
ref|XP_002979677.1|  hypothetical protein SELMODRAFT_111571             322   9e-104   
ref|XP_008354646.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    322   1e-103   
ref|XP_009346066.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    322   1e-103   
ref|XP_011025873.1|  PREDICTED: bifunctional epoxide hydrolase 2        322   1e-103   
ref|XP_010107837.1|  Epoxide hydrolase 2                                321   2e-103   
gb|KDP37443.1|  hypothetical protein JCGZ_08284                         320   3e-103   
ref|XP_002451255.1|  hypothetical protein SORBIDRAFT_05g026560          320   4e-103   
gb|KHG02721.1|  Epoxide hydrolase 2                                     316   3e-102   
ref|XP_008223225.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    316   3e-102   
ref|XP_011100955.1|  PREDICTED: bifunctional epoxide hydrolase 2        317   5e-102   
ref|XP_010275536.1|  PREDICTED: bifunctional epoxide hydrolase 2        317   7e-102   
emb|CAD31713.1|  epoxide hydrolase                                      315   7e-102   
ref|XP_002985384.1|  hypothetical protein SELMODRAFT_181715             316   1e-101   
dbj|BAK08144.1|  predicted protein                                      315   3e-101   
gb|KEH24396.1|  epoxide hydrolase                                       312   3e-101   
gb|AGV54241.1|  epoxide hydrolase 2-like protein                        315   4e-101   
ref|XP_007156093.1|  hypothetical protein PHAVU_003G257900g             315   5e-101   
ref|XP_008354647.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    315   6e-101   
ref|XP_010275537.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    314   1e-100   
dbj|BAJ98388.1|  predicted protein                                      314   1e-100   
ref|XP_008337725.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    313   2e-100   
ref|XP_010254690.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    312   5e-100   
ref|XP_004287856.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    312   6e-100   
ref|XP_010649095.1|  PREDICTED: bifunctional epoxide hydrolase 2        310   2e-99    
ref|XP_008454323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    308   5e-99    
ref|XP_002521508.1|  epoxide hydrolase, putative                        309   6e-99    
gb|AFK36273.1|  unknown                                                 309   6e-99    
gb|KEH20402.1|  epoxide hydrolase                                       309   9e-99    
gb|AFK46496.1|  unknown                                                 308   1e-98    
ref|XP_007202253.1|  hypothetical protein PRUPE_ppa008854mg             308   2e-98    
ref|XP_011006454.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    307   2e-98    
ref|XP_010028623.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    308   2e-98    
ref|XP_004963322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    307   5e-98    
ref|XP_007046807.1|  Alpha/beta-Hydrolases superfamily protein is...    307   6e-98    
gb|AFK43935.1|  unknown                                                 307   6e-98    
ref|XP_003557340.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    306   9e-98    
emb|CDP01962.1|  unnamed protein product                                306   1e-97    
ref|XP_008677783.1|  PREDICTED: epoxide hydrolase 2 isoform X1          305   1e-97    
ref|XP_008241748.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    305   2e-97    
ref|XP_008775994.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    303   2e-97    
ref|XP_001753609.1|  predicted protein                                  306   2e-97    
gb|KHN02949.1|  Epoxide hydrolase 2                                     302   4e-97    
ref|XP_010557474.1|  PREDICTED: bifunctional epoxide hydrolase 2        304   4e-97    
gb|AFK43554.1|  unknown                                                 303   1e-96    
ref|NP_001147768.1|  LOC100281378                                       303   3e-96    
ref|XP_003520282.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    303   3e-96    
ref|XP_006433456.1|  hypothetical protein CICLE_v10001881mg             298   7e-96    
ref|XP_004509321.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    299   5e-95    
gb|KHG08034.1|  Epoxide hydrolase 2                                     299   8e-95    
ref|NP_001067364.1|  Os12g0636400                                       298   1e-94    
ref|NP_001240134.1|  uncharacterized protein LOC100809053               299   1e-94    
ref|XP_002443655.1|  hypothetical protein SORBIDRAFT_08g022970          298   1e-94    
ref|XP_006423389.1|  hypothetical protein CICLE_v10028838mg             298   2e-94    
ref|XP_009346058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    298   2e-94    
ref|XP_006487348.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    298   3e-94    
ref|XP_008366789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    297   4e-94    
ref|NP_190669.1|  alpha/beta-Hydrolases superfamily protein             297   4e-94    
gb|KDO49467.1|  hypothetical protein CISIN_1g020621mg                   296   8e-94    
ref|WP_033434609.1|  epoxide hydrolase                                  296   9e-94    
ref|XP_004287855.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    296   1e-93    
ref|XP_010426641.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    296   1e-93    
ref|XP_007147003.1|  hypothetical protein PHAVU_006G088600g             293   1e-93    
emb|CDX34843.1|  Epoxide hydrolase                                      295   2e-93    
ref|XP_008241747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    294   3e-93    
ref|XP_010254688.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    295   3e-93    
gb|KHN27037.1|  Epoxide hydrolase 2                                     295   3e-93    
ref|XP_003579088.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    294   5e-93    
ref|XP_010503777.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    294   8e-93    
ref|XP_006408053.1|  hypothetical protein EUTSA_v100212090mg            292   9e-93    
emb|CDX23555.1|  Epoxide hydrolase                                      293   1e-92    
gb|EAZ29152.1|  hypothetical protein OsJ_13213                          292   1e-92    
ref|XP_010515481.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    293   2e-92    
ref|WP_035692775.1|  epoxide hydrolase                                  293   2e-92    
emb|CDX48757.1|  Epoxide hydrolase                                      293   2e-92    
ref|NP_001152729.1|  LOC100286370                                       292   2e-92    
ref|XP_006654297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    290   3e-92    
dbj|BAK01028.1|  predicted protein                                      292   3e-92    
ref|WP_027528024.1|  epoxide hydrolase                                  291   6e-92    
ref|XP_010679802.1|  PREDICTED: bifunctional epoxide hydrolase 2        291   6e-92    
ref|XP_002880829.1|  predicted protein                                  290   8e-92    
ref|XP_006664242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    291   9e-92    
ref|XP_010039297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    289   9e-92    
ref|XP_006291410.1|  hypothetical protein CARUB_v10017549mg             291   1e-91    
emb|CDY26530.1|  BnaC01g23690D                                          291   1e-91    
ref|XP_008662613.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    290   2e-91    
gb|ETX06952.1|  epoxide hydrolase                                       290   2e-91    
ref|WP_012852003.1|  epoxide hydrolase                                  290   3e-91    
ref|XP_006403966.1|  hypothetical protein EUTSA_v10010546mg             290   3e-91    
emb|CDY33304.1|  BnaA01g19710D                                          290   3e-91    
ref|XP_002877783.1|  hypothetical protein ARALYDRAFT_485452             290   4e-91    
ref|XP_006419521.1|  hypothetical protein CICLE_v10005425mg             285   2e-90    
ref|WP_033665135.1|  epoxide hydrolase                                  287   3e-90    
emb|CDX34847.1|  Epoxide hydrolase                                      288   3e-90    
ref|WP_033667766.1|  epoxide hydrolase                                  287   3e-90    
ref|XP_010033445.1|  PREDICTED: bifunctional epoxide hydrolase 2        286   5e-90    
ref|WP_030020148.1|  epoxide hydrolase                                  286   6e-90    
ref|WP_031006090.1|  epoxide hydrolase                                  286   9e-90    
ref|WP_030021863.1|  epoxide hydrolase                                  285   2e-89    
ref|XP_006433454.1|  hypothetical protein CICLE_v10003596mg             283   3e-89    
ref|WP_031006507.1|  epoxide hydrolase                                  284   4e-89    
gb|KHN00509.1|  Epoxide hydrolase 2                                     283   5e-89    
gb|KEH24512.1|  epoxide hydrolase                                       280   8e-89    
ref|XP_009136579.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    283   8e-89    
ref|XP_010547454.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    282   2e-88    
ref|WP_018656912.1|  hypothetical protein                               282   2e-88    
ref|WP_008968056.1|  epoxide hydrolase                                  282   3e-88    
gb|EMS55500.1|  Epoxide hydrolase 2                                     279   5e-88    
ref|XP_004963323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    281   6e-88    
ref|WP_020669616.1|  hypothetical protein                               281   7e-88    
ref|WP_030747352.1|  epoxide hydrolase                                  281   9e-88    
ref|WP_020866990.1|  hypothetical protein                               280   1e-87    
ref|WP_036042737.1|  epoxide hydrolase                                  281   1e-87    



>ref|XP_009775353.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2-like [Nicotiana sylvestris]
Length=318

 Score =   482 bits (1240),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 220/325 (68%), Positives = 267/325 (82%), Gaps = 12/325 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH  VSVNGINMHVAEIG+GPAV+F+HGFPELWY+WRHQML+L+ KGYRA+APDLR
Sbjct  1     MEKIQHKYVSVNGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSKKGYRAMAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD+PP A  Y+ FHIVGDLVALLD L L +VFLVGHDWGA+IAW F +FRPDRIKA
Sbjct  61    GYGDTDSPPDATHYTAFHIVGDLVALLDVLGLDQVFLVGHDWGALIAWYFSLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SVV  PRHP+RKP++++RE FGDD+Y+CRFQ+PGE EE F S+D  T+ K FL++R
Sbjct  121   LVNLSVVFRPRHPSRKPVDSLRELFGDDYYVCRFQKPGEVEEEFASVDTATVVKGFLSSR  180

Query  618   DPRPPRIP-----HQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             DPRPP IP     HQ++A+          +LP W+T++D+ Y+A K  ++GFTGGLNYYR
Sbjct  181   DPRPPCIPKEIGFHQALAK-------SPATLPSWITEEDVHYFAEKLKETGFTGGLNYYR  233

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
             N D+NWELTA +SG +IQVP KF+VGD D TYH PG KE IH GG KK VPNLQ+VVVME
Sbjct  234   NLDKNWELTAPFSGCKIQVPTKFVVGDLDXTYHVPGTKEYIHNGGFKKEVPNLQEVVVME  293

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             GV H+INQEKP+E+N+HI +FIQ F
Sbjct  294   GVGHFINQEKPDEINSHIYDFIQRF  318



>ref|XP_009629123.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   481 bits (1238),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 268/325 (82%), Gaps = 12/325 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH  VS+NGINMHVAEIG+GPAV+F+HGFPELWY+WRHQML+L++KGYRAIAPDLR
Sbjct  1     MEKIQHKNVSINGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSNKGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD+PP A +Y+VFHIVGDLVALLD L L +V+LVGHDWGA+IAW F +FRPDRIKA
Sbjct  61    GYGDTDSPPDATNYTVFHIVGDLVALLDVLGLDQVYLVGHDWGALIAWYFSLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SVV  PRHP+RKP++++RE FGDD+Y+CRFQ+PGE EE F S+D  T+ K FL++R
Sbjct  121   LVNLSVVFRPRHPSRKPVDSLRELFGDDYYMCRFQKPGEVEEEFASVDTATVIKGFLSSR  180

Query  618   DPRPPRIP-----HQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             DPRPP IP     HQ++A+          +LP W+T++D+ Y+A K  ++GFTGGLNYYR
Sbjct  181   DPRPPCIPKEIGFHQALAK-------SPATLPSWITEEDVHYFAEKLKKTGFTGGLNYYR  233

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
             N D+NWELTA +SG +IQVP KF+VGD D TYH PG KE IH GG KK VPNLQ+VVVME
Sbjct  234   NLDKNWELTAPFSGCKIQVPTKFVVGDLDATYHVPGTKEYIHNGGFKKEVPNLQEVVVME  293

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             G  H+INQEKP E+N+HI +FIQ F
Sbjct  294   GAGHFINQEKPAEINSHIYDFIQRF  318



>ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   472 bits (1215),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 262/321 (82%), Gaps = 5/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             MERIQH  +  NGIN+HVAEIG+GPA+LFLHGFPELWYTWRHQML L+S+GYRAIAPDLR
Sbjct  1     MERIQHRHIQTNGINIHVAEIGEGPAILFLHGFPELWYTWRHQMLSLSSRGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPSA SY+ FHI+GDLV LLDAL L +VFLVGHDWGA++AW FC+FRPDRIKA
Sbjct  61    GYGDSDAPPSASSYTAFHIIGDLVGLLDALGLDQVFLVGHDWGAVMAWYFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P RKP+E+MR   GDD+YICRFQ+PGEAEE F  +D   L K FL +R
Sbjct  121   LVNMSVVFQPRNPRRKPVESMRAILGDDYYICRFQKPGEAEEEFARVDTAQLIKKFLISR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             +P P R+P     +V +  R +  + LP WL++ D++YYATKF + GFTGGLNYYR  D 
Sbjct  181   NPTPLRVP----KEVGFGGRTDKPIILPSWLSEDDVQYYATKFNKKGFTGGLNYYRAMDL  236

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
              WELTAAW+G QI+VPVKFIVGD DLTY+ PGVKE IH GG +K VP LQ++V+MEGVAH
Sbjct  237   TWELTAAWTGVQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRKQVPFLQELVIMEGVAH  296

Query  261   YINQEKPEEVNNHILEFIQNF  199
             ++NQEKPEE++ HI +F+Q F
Sbjct  297   FLNQEKPEEISQHIYDFVQRF  317



>ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   466 bits (1199),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 262/321 (82%), Gaps = 4/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPA-VLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME IQH  +SVNGINMHVAEIG+GP+ +LFLHGFPELWYTWRHQ++ L+SKGYRAIAPDL
Sbjct  1     MENIQHKNLSVNGINMHVAEIGEGPSTILFLHGFPELWYTWRHQLISLSSKGYRAIAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTD+PPS  SY+VFHIVGDL+ALLDAL L +VFLVGHDWGA+IAW+ C+ RPDRIK
Sbjct  61    RGYGDTDSPPSPSSYTVFHIVGDLIALLDALGLDQVFLVGHDWGAVIAWHVCLLRPDRIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVNMSVV  PR+P RKP+E+MR   GDD+YICRFQ+ GEAEE F  +D   L   FLT+
Sbjct  121   ALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQEYGEAEEEFARVDTARLIAKFLTS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P R+P +   +         ++LP WL+++D+ YYA KF QSGFTGGLNYYR  D 
Sbjct  181   RNPAPLRVPKE---KGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDL  237

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVKFI+GD DLTY+ PGVKE IH+GG +K+VP LQ+VV+MEGVAH
Sbjct  238   NWELTAPWTGVQIKVPVKFIIGDVDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVAH  297

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQE+PEE+N+HI +F Q F
Sbjct  298   FINQERPEEINDHIYDFFQKF  318



>ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=318

 Score =   464 bits (1195),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 262/321 (82%), Gaps = 4/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPA-VLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME IQH  ++VNGINMH+AEIG+GP+ +LFLHGFPELWY+WRHQ++ L+SKGYRAIAPDL
Sbjct  1     MENIQHKNLTVNGINMHIAEIGEGPSTILFLHGFPELWYSWRHQLISLSSKGYRAIAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTD+PPS  SY+VFHIVGDL+ALLDAL L +VFLVGHDWGA+IAW+ C+ RPDRIK
Sbjct  61    RGYGDTDSPPSPSSYTVFHIVGDLIALLDALGLDQVFLVGHDWGAVIAWHVCLLRPDRIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVNMSVV  PR+P RKP+E+MR   GDD+YICRFQ+ GEAEE F  +D   L   FLT+
Sbjct  121   ALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQEYGEAEEEFARVDTARLIAKFLTS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P R+P +   +         ++LP WL+++D+ YYA KF QSGFTGGLNYYR  D 
Sbjct  181   RNPAPLRVPKE---KGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDL  237

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVKFIVGD DLTY+ PGVKE IH+GG +K+VP LQ+VV+MEGVAH
Sbjct  238   NWELTAPWTGVQIKVPVKFIVGDVDLTYNTPGVKEYIHKGGFQKVVPFLQEVVIMEGVAH  297

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQE+PEE+N+HI +F Q F
Sbjct  298   FINQERPEEINDHIYDFFQKF  318



>ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   462 bits (1188),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 255/321 (79%), Gaps = 4/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDG-PAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+IQH  ++VNGINMH+AEIG+G  A+LFLHGFPELWYTWRHQ+L L+SKGYRAIAPDL
Sbjct  1     MEKIQHKNLTVNGINMHIAEIGEGQSAILFLHGFPELWYTWRHQLLALSSKGYRAIAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAPPS  SY+VFHIVGDL+ALLD L+L +VFLVGHDWGAIIAW+ C+ RPDRIK
Sbjct  61    RGYGDTDAPPSPSSYTVFHIVGDLIALLDTLRLDQVFLVGHDWGAIIAWHLCLLRPDRIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVNMSVV  PRHP RKP+E+MR   GDD+YICRFQ+ G+ EE F  +D   L   FL +
Sbjct  121   ALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQEYGQVEEEFARVDTARLIAKFLIS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P R+   S  +         + LP WL+++DI YYA KF Q GFTGGLNYYR  D 
Sbjct  181   RNPAPLRV---SKEKGFGGSSHTPIKLPSWLSEEDINYYANKFSQKGFTGGLNYYRAMDL  237

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVKFIVGD DLTY+ PGVKE IH+GG +K+VP LQ+VV+MEGV H
Sbjct  238   NWELTAPWTGQQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGH  297

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +IN+EKPEE+N HI +F Q F
Sbjct  298   FINEEKPEEINGHIYDFFQKF  318



>ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=318

 Score =   462 bits (1188),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 256/321 (80%), Gaps = 4/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-AVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+IQH  +SVNGINMH+AEIG+GP A+LFLHGFPELWYTWRHQ++ L+S+GYRAIAPDL
Sbjct  1     MEKIQHKNLSVNGINMHIAEIGEGPTAILFLHGFPELWYTWRHQLISLSSRGYRAIAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAPPS  SY+VFHIVGDL+ALLD L L +VFLVGHDWGAIIAW  C+ RPDRIK
Sbjct  61    RGYGDTDAPPSPSSYTVFHIVGDLIALLDTLGLDQVFLVGHDWGAIIAWYLCLLRPDRIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVNMSVV  PRHP RKP+E+MR   GDD+YICRFQ+ G+ EE F  +D   L   FL +
Sbjct  121   ALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQEYGQVEEEFARVDTARLIAKFLIS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P R+   S  +         + LP WL+++DI YYA KF Q GFTGGLNYYR  D 
Sbjct  181   RNPAPLRV---SKEKGFGGSSHTPIKLPSWLSEEDIDYYANKFSQKGFTGGLNYYRAMDL  237

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVKFIVGD DLTY+ PGVKE IH+GG +K+VP LQ+VV+MEGV H
Sbjct  238   NWELTAPWTGMQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGH  297

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +IN+E+PEE+N+HI +FIQ F
Sbjct  298   FINEERPEEINDHIYDFIQKF  318



>ref|XP_010038230.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50053.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus grandis]
Length=319

 Score =   459 bits (1182),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 254/322 (79%), Gaps = 5/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGD--GPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             ME I+H TV  NGINMHVA +G   G  VLFLHGFP+LWYTWR QML LA+ GYRA+APD
Sbjct  1     METIEHATVPTNGINMHVASVGGAGGDTVLFLHGFPDLWYTWRRQMLSLAALGYRAVAPD  60

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGDTDAPPSA SY+ FHIVGDLV LLDAL +  VFLVGHDWGA++AW FC+ RPDR+
Sbjct  61    LRGYGDTDAPPSAASYTAFHIVGDLVGLLDALGVERVFLVGHDWGAVMAWYFCLLRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN SVV  PR+P RKP++++R  FGDD+YICRFQ+PGEAEE F   D T L K FLT
Sbjct  121   KALVNTSVVFQPRNPKRKPIDSLRALFGDDYYICRFQEPGEAEEDFARADITKLMKLFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +R+P+PP IP +     L   R +   LPPWL+++D+ YYA+KF Q GFTGGLNYYR  +
Sbjct  181   SRNPKPPCIPKEIGYSGLANSRDK---LPPWLSEEDVNYYASKFSQKGFTGGLNYYRALN  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
               WEL A W+G QI+VPVKFIVGD D+TYH PGVKE IH GGLKK+VP LQ+VVVMEGVA
Sbjct  238   LTWELAAPWTGVQIKVPVKFIVGDLDITYHVPGVKEYIHNGGLKKLVPFLQEVVVMEGVA  297

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H++ QEKPEEV NHI +FI+ F
Sbjct  298   HFLQQEKPEEVTNHIYDFIKKF  319



>gb|KDP28184.1| hypothetical protein JCGZ_13955 [Jatropha curcas]
Length=315

 Score =   457 bits (1177),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 252/320 (79%), Gaps = 5/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+  NGINMHVA IG GP +LFLHGFPELWY+WRHQ+L L++ GYR IAPDLR
Sbjct  1     MEKIEHTTIPTNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS   Y++ H+VGDLV LLD+L + +VFLVGHDWGAI+AW+ C+FRPDRIKA
Sbjct  61    GYGDTDAPPSPTQYTILHLVGDLVGLLDSLGIEQVFLVGHDWGAIVAWHMCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P  KPLE  RE  GDDFYICRFQ+PGE EE F       + + FL +R
Sbjct  121   LVNTSVVFTPRNPNHKPLEKYRELLGDDFYICRFQEPGEIEEDFAQAGAAKVLRRFLASR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P+PP IP     ++ +    +  SLPPWL+++DI YY +KF Q GFTGGLNYYR  D N
Sbjct  181   NPKPPCIP-----KIGFRGLPDNPSLPPWLSEEDINYYVSKFNQKGFTGGLNYYRCLDLN  235

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TYHFPGVKE IH GGLKK VP LQ+VV+MEGV HY
Sbjct  236   WELTAPWTGLQIKVPVKFIVGDLDVTYHFPGVKEYIHNGGLKKYVPFLQEVVIMEGVCHY  295

Query  258   INQEKPEEVNNHILEFIQNF  199
             +NQEKPEE++ HI +FI+ F
Sbjct  296   LNQEKPEEISAHIYDFIKKF  315



>gb|EYU46742.1| hypothetical protein MIMGU_mgv1a010264mg [Erythranthe guttata]
Length=317

 Score =   457 bits (1177),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 259/320 (81%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H+ +SVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQML+L+++GYRAIAPDLR
Sbjct  1     MEKIKHSNMSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLYLSARGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS   Y+ FH+VGDLVALLDAL L +VFLV HDWGAI+AW FC+FRP+RIK 
Sbjct  61    GYGDTDAPPSPADYTAFHLVGDLVALLDALGLEQVFLVAHDWGAIVAWWFCLFRPERIKG  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PRHP  KP+E  +   GDDFY+CRFQ+ GEAE+ F S++ + + K+  + R
Sbjct  121   LVNMSVQFHPRHPEIKPIEMYKNLLGDDFYMCRFQKAGEAEKAFESVEASQVIKSLFSFR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
               +P  +P +   + L++   E+   PPWLT++D+ Y+A KF ++G+TGGLNYYR  D  
Sbjct  181   GGKPIIVPREIGLEALFQAPAES---PPWLTEEDLDYFAGKFKKTGYTGGLNYYRAMDLT  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W G+Q++VPVKFI+G+QD+TY+ PG+KE IH+GG KK VPNL+QVVVMEGVAH+
Sbjct  238   WELAAPWVGAQVKVPVKFIIGEQDITYYVPGIKEYIHDGGFKKDVPNLEQVVVMEGVAHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKPEEV+ HI EFI NF
Sbjct  298   INQEKPEEVSQHIYEFITNF  317



>ref|XP_003632381.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 212/321 (66%), Positives = 259/321 (81%), Gaps = 5/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH  + VNGINMHVAEIG+GP +LFLHGFPELWY+WRHQ+L L+S GYRAIAPDLR
Sbjct  1     MEKIQHRNLRVNGINMHVAEIGEGPPILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS  SY+  HIVGDL+ALLD+L+L +VFLVGHDWGA IAW FC+ RPDR+KA
Sbjct  61    GYGDSDAPPSPASYTALHIVGDLIALLDSLRLGQVFLVGHDWGAAIAWYFCLLRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+PTRKP+E+MR  FGDD+Y+CRFQ+PG AE  F  +   T+ K FL +R
Sbjct  121   LVNMSVVFRPRNPTRKPIESMRVLFGDDYYMCRFQEPGLAENEFARLGTETVMKIFLGSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             +PRPPR+P +S     Y    +T  +LPPWL+Q+DI Y+A+KF Q+GFTGGLNYYR  D 
Sbjct  181   NPRPPRMPKES----WYSGALKTPTALPPWLSQEDIDYFASKFNQNGFTGGLNYYRALDL  236

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             +WE  A W+G  I+VPVKFIVGD D TY+ PGVKE IH GG K+ VP LQ++V+MEGVAH
Sbjct  237   SWEALAPWTGVPIKVPVKFIVGDLDTTYNTPGVKEYIHNGGFKREVPFLQELVIMEGVAH  296

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQE+PEE+N HI +FI+ F
Sbjct  297   FINQERPEEINAHIYDFIRRF  317



>ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
 gb|ESW35118.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
Length=317

 Score =   455 bits (1171),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 211/321 (66%), Positives = 255/321 (79%), Gaps = 5/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TVS NGINMHVA IG GP VLFLHGFPELWYTWRHQ+L L+S GYRAIAPDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSSVGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPSA SYSV HIV DLV LLDAL + +VFLVGHDWGA IAW FC+ RP+R+KA
Sbjct  61    GYGDTDAPPSASSYSVLHIVADLVGLLDALGIDQVFLVGHDWGASIAWYFCLLRPERLKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P RKP++++R   GDD+YICRFQ+PGE EE F       + K FL +R
Sbjct  121   LVNMSVVFRPRNPKRKPIQSLRAMMGDDYYICRFQKPGEVEEDFARAGAARIIKKFLASR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             DPRPPR    +  ++ +    +  V+LP WL+++D+ YYA+KF Q GFTGGLNYYR  D 
Sbjct  181   DPRPPR----ASKEIGFGGSPDLHVALPSWLSEEDVNYYASKFEQKGFTGGLNYYRAMDL  236

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
              WELTAAW+G QI+VPVKFIVGD D+TY+ PGVKE IH GG K+ VP LQ+++VMEGVAH
Sbjct  237   TWELTAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELIVMEGVAH  296

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +IN+E+PEE++ HI +FI+ F
Sbjct  297   FINEERPEEISAHIYDFIKKF  317



>ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=317

 Score =   453 bits (1165),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 250/320 (78%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGINMHVA IG GP VLFLHGFPELWYTWRHQ+L L++ GYRAIAPDLR
Sbjct  1     MEKIEHKTVRTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSAVGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPP A SYS  HIV DLV LLDAL +  VFLVGHDWGA IAW+FC+ RPDR+KA
Sbjct  61    GYGDTDAPPDASSYSALHIVADLVGLLDALGIERVFLVGHDWGASIAWHFCLLRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P RKP++++R   GDD+YICRFQ+PGE EE F       + K F+ +R
Sbjct  121   LVNMSVVFRPRNPNRKPIQSLRAIMGDDYYICRFQKPGEVEEEFARAGAARIIKTFIASR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DPRPP +P +       + R   + LP WLT++D+ YYA+KF Q GFTGGLNYYR  D  
Sbjct  181   DPRPPCVPKEIGFGGSPDLR---IDLPSWLTEEDVNYYASKFEQKGFTGGLNYYRAMDLT  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTAAW+G QI+VPVKFIVGD D+TY+ PGVKE IH GG K+ VP LQ++VVMEGVAH+
Sbjct  238   WELTAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELVVMEGVAHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+P+E++ HI +FI+ F
Sbjct  298   INQERPQEISAHIYDFIKKF  317



>gb|EYU46741.1| hypothetical protein MIMGU_mgv1a009984mg [Erythranthe guttata]
Length=325

 Score =   452 bits (1163),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 253/320 (79%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++IQH  +  NGIN+HVAEIG GPAVLFLHGFPELWY+WRHQMLFL+S+GYRAIAPDLR
Sbjct  1     MDKIQHKNIRSNGINIHVAEIGRGPAVLFLHGFPELWYSWRHQMLFLSSRGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPSA SY+ FHI+GDLV LLDAL L  V+LVGHDWGA++AW  C+ RPDRIKA
Sbjct  61    GYGDSDAPPSASSYTAFHIIGDLVGLLDALGLDRVYLVGHDWGAVMAWYLCLLRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SVV  PR+P RKP+E+MR   G+D+YICRFQ+PGEAE  F  +D   L K FLT+R
Sbjct  121   LVNLSVVFHPRNPKRKPVESMRAILGNDYYICRFQEPGEAESEFARVDTARLIKKFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P P  +P +        K    +++P WL+++D++YYA+KF   GFTGGLNYYR  D N
Sbjct  181   NPAPLIVPKEVGFGGSPHK---PITMPSWLSEEDVQYYASKFSLKGFTGGLNYYRAMDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA WS  QI+VPVKFIVGD DLTY+ PGVKE IH GG K+ VP LQ++V+MEGVAH+
Sbjct  238   WELTAPWSSVQIKVPVKFIVGDLDLTYNTPGVKEYIHGGGFKRQVPFLQELVIMEGVAHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKPEE + HI +FI  F
Sbjct  298   INQEKPEETSQHIYDFIHKF  317



>ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   452 bits (1163),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 209/322 (65%), Positives = 253/322 (79%), Gaps = 2/322 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-AVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+I+H TV  NGINMHVA +GDGP  VLF+HGFPELWY+WRHQML LA+ GYRAIAPDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMLSLAALGYRAIAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYG TDAPP  +SY+ FH+VGDLV +LDAL +  VF+VGHDWGAI+AW+ C+ RPDR+K
Sbjct  61    RGYGGTDAPPRVESYTAFHVVGDLVGMLDALGIGRVFVVGHDWGAIMAWHLCLVRPDRVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN SV   PR+P RKP+E+MR TFGDD+Y+CRFQ+PG AEE F   D   L + FLT 
Sbjct  121   ALVNTSVAWFPRNPERKPVESMRATFGDDYYVCRFQEPGVAEEDFAKADIAKLIQLFLTG  180

Query  621   RDPRPPRIPHQ-SVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             RDP PP +P    ++ ++     + V LP WLT  DI YYAT+F ++GFTGG NYYR  D
Sbjct  181   RDPSPPIVPKDVGISGLIKLLDQQQVELPSWLTDDDISYYATQFSRTGFTGGFNYYRCLD  240

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWEL+A W+G++I+VPVKFIVGD DLTYHFPGVKE IH+GG KK VPNL+ VVVMEGVA
Sbjct  241   LNWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKEYIHDGGFKKAVPNLEDVVVMEGVA  300

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H++ QEKP+EV  HI +FI+ F
Sbjct  301   HFLQQEKPQEVTAHIHDFIKKF  322



>emb|CDP17110.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   452 bits (1162),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 255/323 (79%), Gaps = 6/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H +V VNGINMHVAE+G+GPAVL LHGFPELWY+WRHQML+LASKGYRA+APDLR
Sbjct  1     MENIKHQSVVVNGINMHVAEVGEGPAVLLLHGFPELWYSWRHQMLYLASKGYRALAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS  SY+ FH+VGDLVALL++L L +VFLVGHDWG++IAW+ C+FRPDRIKA
Sbjct  61    GYGDSDAPPSPSSYTAFHVVGDLVALLNSLGLDKVFLVGHDWGSLIAWHLCLFRPDRIKA  120

Query  798   LVNMSVV---ISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
             LVNMS V     P++P++KPLE MRETFGDD+Y+CRFQ  GE EE F  +D   L KAFL
Sbjct  121   LVNMSCVYHYFDPKNPSKKPLEEMRETFGDDYYVCRFQATGEVEEEFAGVDTAELVKAFL  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             +NRD RPP IP        ++       LP WLTQ+D+ YYATKF ++GF+GG N+YR  
Sbjct  181   SNRDTRPPCIPRGGFQYFAHQNPN---PLPEWLTQEDLNYYATKFKKTGFSGGFNFYRCI  237

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             D NWEL+A W  +QIQVPVKF+VGD DLTYH PG+++ IH GG KK VP+LQ+V+V+ G 
Sbjct  238   DLNWELSAPWREAQIQVPVKFVVGDLDLTYHIPGIQDYIHNGGFKKDVPDLQEVIVIPGA  297

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH+INQEK +E + HI +FI  F
Sbjct  298   AHFINQEKADECSIHIYDFISKF  320



>emb|CDP17111.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   452 bits (1162),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 210/320 (66%), Positives = 253/320 (79%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++IQH  V VNGIN+HVAEIGDGPA+LFLHGFPELWY+WRHQ+L L++KGYRA+APDLR
Sbjct  1     MDKIQHRQVPVNGINLHVAEIGDGPAILFLHGFPELWYSWRHQLLSLSAKGYRALAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS  +Y+  HIVGDLV LLD+L L  VFLVGHDWGA++AW FC+ RPDRIKA
Sbjct  61    GYGDSDAPPSPSNYTALHIVGDLVGLLDSLGLDRVFLVGHDWGAVMAWYFCLLRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV +PR+P RKPLE MR  FGDD+YICRFQ+PGEAEE F  +D   + K FLT+R
Sbjct  121   LVNMSVVFTPRNPKRKPLEAMRARFGDDYYICRFQEPGEAEEEFARVDTARIIKKFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P P  +P +             + LP WL++ D+ Y+A+KF Q GFTGGLNYYR  D N
Sbjct  181   RPGPLCVPKEV---GFGGSPHNPIQLPSWLSEDDVNYFASKFSQKGFTGGLNYYRAMDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+T+  PGVKE I +GG K+ VP LQ++VVMEGVAH+
Sbjct  238   WELTAPWTGLQIKVPVKFIVGDLDVTFTTPGVKEYIQKGGFKRDVPFLQELVVMEGVAHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             +NQEKPEEV+ HI +FIQ F
Sbjct  298   VNQEKPEEVSAHIYDFIQKF  317



>ref|XP_007050977.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95134.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=316

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+ NGINMHVA +G GP +LFLHGFPELWY+WRHQ+L L+S GYR +APDLR
Sbjct  1     MEKIEHTMVTTNGINMHVASVGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRCVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPSA SY+VFHIVGDLV LLDAL +  VFLVGHDWGA+IAW FC FRPDR+KA
Sbjct  61    GFGDTDAPPSAASYTVFHIVGDLVGLLDALGVDSVFLVGHDWGAVIAWYFCHFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PRH + KP+E  R  FGDD+YICRFQ+PGE EE F  +D   + K FLT+R
Sbjct  121   LVNMSVAYRPRHRSMKPVEGFRALFGDDYYICRFQEPGEIEEDFAQMDTAKIMKIFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP     ++ +    +   LP WL+++DI Y+A+KF + GFTGGLNYYR  D +
Sbjct  181   NPRPPCIP----KEIGFRGYPDPPPLPSWLSEEDINYFASKFNEKGFTGGLNYYRALDLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+G QI+VPVKFIVGD D+TYH PG KE IH GG KK VP LQ+VVVMEGVAH+
Sbjct  237   WELMAPWTGLQIKVPVKFIVGDLDITYHIPGAKEYIHNGGFKKDVPFLQEVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EE++ HI +FI+ F
Sbjct  297   INQEKSEEISKHIYDFIKKF  316



>ref|XP_006444387.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 ref|XP_006479995.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR57627.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 gb|KDO87172.1| hypothetical protein CISIN_1g021184mg [Citrus sinensis]
Length=316

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 251/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV+ NGINMHVA IG GPAVLFLHGFPELWY+WR Q+L+L+S+GYRAIAPDLR
Sbjct  1     MEKIKHTTVATNGINMHVASIGTGPAVLFLHGFPELWYSWRKQLLYLSSRGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS  SY+  H+VGDLV LLD   + +VFLVGHDWGA+IAW FC+ RPDR+KA
Sbjct  61    GYGDTDAPPSITSYTALHVVGDLVGLLDEFGIEQVFLVGHDWGALIAWYFCLLRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SVV   R+P  KP++  R  FGDDFYICRFQ+PG AEE F  ID   L K FL  R
Sbjct  121   LVNLSVVFRSRNPATKPVDQYRALFGDDFYICRFQEPGVAEEDFAQIDTARLIKKFLGGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P+PP +P +   + L + R    +LP WL+++D+ YYA+KF Q GFTGGLNYYR  D N
Sbjct  181   SPKPPCVPKEIGFRGLPDLR----TLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+G+QI++PVKF+VGD D+TYH PG++E I  GG KK VP LQ+V+VMEGVAH+
Sbjct  237   WELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK +EV++HI +FI+ F
Sbjct  297   INQEKADEVSSHIYDFIKQF  316



>ref|XP_010088294.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33519.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 206/322 (64%), Positives = 248/322 (77%), Gaps = 6/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGD--GPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             ME+I+H TV  NGINMHVA IG    PA++FLHGFPELWY+WRHQM+ L+S GYR IAPD
Sbjct  1     MEKIEHTTVPTNGINMHVASIGSTTAPAIIFLHGFPELWYSWRHQMISLSSLGYRCIAPD  60

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYG+TDAPPS +SY+VFHIVGDLV LLD L L ++F+VGHDWGA+IAW  C+FRPDR+
Sbjct  61    LRGYGETDAPPSPESYTVFHIVGDLVGLLDHLGLDQIFVVGHDWGAVIAWYLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVNMSV  SPRHPTRKP+E  R   G+D+YICRFQ+PGEAE+ F   D T L K F  
Sbjct  121   KALVNMSVAFSPRHPTRKPIEGFRALLGNDYYICRFQEPGEAEKDFARDDTTNLLKKFYL  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P PP IP     ++ +       ++P WL ++D+K+YA KF + GFTGGLNYYR  D
Sbjct  181   GRNPSPPCIP----KEIGFSDLKAPQTMPSWLLEEDVKFYARKFDEKGFTGGLNYYRALD  236

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
               WELTAAWSG+Q++VPVKFI+GD D+TYH PG KE IH GG K+ VP LQ+VVVMEGVA
Sbjct  237   LTWELTAAWSGTQVKVPVKFIIGDLDVTYHVPGAKEYIHNGGFKRDVPYLQEVVVMEGVA  296

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             HYINQEK EE   HI +F++ F
Sbjct  297   HYINQEKAEETAAHIYDFVKKF  318



>ref|XP_002302724.1| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE81997.1| epoxide hydrolase family protein [Populus trichocarpa]
Length=316

 Score =   447 bits (1149),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 251/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H TV+ NGINMH+A IG GP +LFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MDKIEHQTVATNGINMHIASIGTGPVILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP +   Y++FHIVGDLV L+D+L + +VFLVGHDWG+ +AW FC+ RPDRIKA
Sbjct  61    GYGDTDAPKNVREYTIFHIVGDLVGLIDSLGIDKVFLVGHDWGSTVAWYFCLLRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P +  ++  RE FGDDFYICR Q+PGE EE F  +D  ++   FLT+R
Sbjct  121   LVNMSVVFQPRNPHKSSVQISRELFGDDFYICRIQEPGEVEEDFAQMDTASIITRFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP+PP IP     +V +       +LP WL+++DI YYA KF Q+GFTGGLNYYR  D N
Sbjct  181   DPKPPCIP----KEVGFRGIPYNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYYRCLDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL AAW+G QI+VPVKFIVGD DLTYH PGVKE I +GGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELMAAWTGLQIKVPVKFIVGDVDLTYHIPGVKEYISKGGLKKYVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             +NQEKPEEV+ HI +FI+ F
Sbjct  297   LNQEKPEEVSEHIYDFIKKF  316



>ref|XP_006359858.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   447 bits (1149),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/325 (66%), Positives = 258/325 (79%), Gaps = 12/325 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH  V+VNGI MHVAEIG+GPAVLFLHGFPELWY+WRHQ+L+ ++KGYRAIAPDLR
Sbjct  1     MEKIQHKNVTVNGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+ P    SY+ FHIVGDL+ALLD L L +VFLVGHDWGA+IAW FC+FRPDRIKA
Sbjct  61    GYGDTEIPSEISSYTAFHIVGDLIALLDILDLEKVFLVGHDWGALIAWFFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+S  + PR+P RKP++ +RE  GDD+Y+CRFQ+PGE EE F SID   L   FLT+R
Sbjct  121   LVNLSCELRPRNPLRKPIDCLRELLGDDYYMCRFQKPGEVEEEFASIDTAKLMIGFLTSR  180

Query  618   DPRPPRIP-----HQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             D RPP IP     HQ+ AQ+         +LP WLTQ+D+ YY  K  ++GFTGGLNYYR
Sbjct  181   DTRPPCIPKEIGFHQAFAQL-------PATLPSWLTQEDVNYYVEKLNKTGFTGGLNYYR  233

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
             N D+NWELTA +SG +IQVP KF+VG+ DLTYH PG+KE IH GG KK VP+L++VVVME
Sbjct  234   NMDKNWELTAPFSGCKIQVPTKFVVGELDLTYHIPGIKEYIHNGGFKKEVPSLEEVVVME  293

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             G AH+INQEKP+E+N HI +FIQ F
Sbjct  294   GAAHFINQEKPDEINAHIYDFIQKF  318



>ref|XP_004247402.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=318

 Score =   446 bits (1148),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/325 (65%), Positives = 259/325 (80%), Gaps = 12/325 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH TVS NGI MHVAEIG+GPAVLFLHGFPELWY+WRHQ+L+ ++KGYRAIAPDLR
Sbjct  1     MEKIQHKTVSANGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+ P    SY+ FHIVGDL++LLD L L +VFL+GHDWGA+IAW FC+FRPDRIKA
Sbjct  61    GYGDTEIPSEISSYTAFHIVGDLISLLDILDLEKVFLIGHDWGALIAWFFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+S  + PR+P RKP++ +RE  GDD+Y+CRFQ+PGE EE F SID   L   FL++R
Sbjct  121   LVNLSCELRPRNPLRKPIDCLRELLGDDYYMCRFQKPGEVEEEFASIDTAKLIIGFLSSR  180

Query  618   DPRPPRIP-----HQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             D RPP IP     HQ+ AQ+         +LP WLTQ+D+ YYA K  ++GFTGGLNYYR
Sbjct  181   DTRPPCIPKEIGFHQAFAQL-------PAALPSWLTQEDVNYYAEKLNKTGFTGGLNYYR  233

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
             N D+NWELTA +SG +IQVP KF+VG+ DLTY+ PG+KE IH GG KK VP+L++VVVME
Sbjct  234   NMDKNWELTALFSGCKIQVPTKFVVGELDLTYNIPGIKEYIHNGGFKKEVPSLEEVVVME  293

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             G AH+INQEKP+E+N HI +FIQ F
Sbjct  294   GAAHFINQEKPDEINAHIYDFIQKF  318



>gb|KHG07158.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=316

 Score =   446 bits (1146),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV+ NGI MHVA IG GP +LFLHGFPELWYTWR Q+L L+S GYR +APDLR
Sbjct  1     MEKIEHTTVTTNGIKMHVASIGSGPIILFLHGFPELWYTWRRQLLSLSSLGYRCVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY+VFH+VGDLV LLDAL + +VFLVGHDWGA+IAWNFC+FRPDRIKA
Sbjct  61    GYGDSDAPPSPESYTVFHVVGDLVGLLDALGVDKVFLVGHDWGAMIAWNFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV   PR+P  K ++  R  FGDDFYICRFQ PGEAE  F  +D   + K FLT R
Sbjct  121   LVNLSVPYHPRNPKVKTVDGYRALFGDDFYICRFQVPGEAEAHFAQMDTAKVLKKFLTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP PP IP ++  + L     +  +LP WL++ +I Y+ATKF Q GFTGGLNYYR  + N
Sbjct  181   DPNPPCIPKETGLKAL----PDPPALPSWLSEDEINYFATKFNQKGFTGGLNYYRAMNLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+G QIQVPVKFIVGD D+TYH PGVKE +  GG KK VP LQ++VVMEGVAH+
Sbjct  237   WELMAPWTGLQIQVPVKFIVGDLDITYHIPGVKEYLQNGGFKKNVPFLQELVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP+E++ HI +F++ F
Sbjct  297   INQEKPQEISMHIYDFVKKF  316



>ref|XP_002523108.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39293.1| epoxide hydrolase, putative [Ricinus communis]
Length=316

 Score =   445 bits (1145),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 249/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV+ NGINMHVA IG GP +LFLHGFPELWY+WRHQ+L L+S+GYR IAPDLR
Sbjct  1     MEKIEHTTVATNGINMHVAAIGTGPEILFLHGFPELWYSWRHQLLSLSSRGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP S   Y+  HIVGDL+ LLD++ + +VFLVGHDWGA++AW  CMFRPDRIKA
Sbjct  61    GYGDTDAPESLTGYTALHIVGDLIGLLDSMGIEQVFLVGHDWGAMMAWYLCMFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SV    R+P  K LE  R  +GDD+Y+CRFQ+PG AEE F  +D   L ++  T+R
Sbjct  121   LVNTSVAYMSRNPQLKSLELFRTVYGDDYYVCRFQEPGGAEEDFAQVDTAKLIRSVFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP PP +P     ++ +    +  SLP WL+++D+ YYA KF + GFTGGLNYYRN D+N
Sbjct  181   DPNPPIVP----KEIGFRSLPDPPSLPSWLSEEDVNYYADKFNKKGFTGGLNYYRNIDQN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W G QI+VPVKF++GD DLTYHFPG+K+ IH GG K++VP LQ+VVVMEGVAH+
Sbjct  237   WELTAPWDGLQIKVPVKFVIGDLDLTYHFPGIKDYIHNGGFKQVVPLLQEVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKPEE++ HI +FI+ F
Sbjct  297   INQEKPEEISEHIYDFIKKF  316



>ref|XP_010039296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   444 bits (1143),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 207/324 (64%), Positives = 250/324 (77%), Gaps = 6/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-AVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+I+H TV  NGINMHVA +GDGP  VLF+HGFPELWY+WRHQM+ LA+ GYR +APDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYG+TDAPPS DSY+ FH+VGDLV +LDAL +  VF+VGHDWGA+IAW  C+ RPDR+K
Sbjct  61    RGYGNTDAPPSVDSYTAFHVVGDLVGMLDALGIGRVFVVGHDWGAMIAWYLCLLRPDRVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN SV   PR P RKP+E MR  FGDD+Y+CRFQ+PGEAEE F   DP  LFK FL  
Sbjct  121   ALVNTSVAWFPRDPERKPVEKMRAMFGDDYYVCRFQEPGEAEEDFAKADPAKLFKLFLAG  180

Query  621   RDPRPPRIPHQ---SVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             RDP PP +      S    L+E     V LP WL++ DI +YA +F ++GFTGGLNYYR 
Sbjct  181   RDPSPPIVTKDVGFSGMTKLFEDH--QVDLPSWLSEDDINFYAAQFSRTGFTGGLNYYRC  238

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             +D NWEL+A+W+G  I+VP+KFIVGD DLTYH PGVKE IH GG K+ VPNL++VVVMEG
Sbjct  239   WDLNWELSASWTGVPIEVPMKFIVGDLDLTYHIPGVKEYIHGGGFKQAVPNLEEVVVMEG  298

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH++ QEKP+EV +HI  FI+ F
Sbjct  299   VAHFLMQEKPQEVTSHIHNFIKKF  322



>ref|XP_011041992.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 256/321 (80%), Gaps = 4/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV+ NGINMH+A IG GP +LFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP     Y+VFHI+GDLV L+D+L + +VFLVGHDWGA++AW FC+ RPDRIKA
Sbjct  61    GYGDTDAPKDHREYTVFHILGDLVGLIDSLGIDKVFLVGHDWGAVVAWYFCLLRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P +  ++  R+ FGDD+YICRFQ+PGE EE F  +D   + + FLT+R
Sbjct  121   LVNMSVVFQPRNPDKSFVQISRDLFGDDYYICRFQEPGEVEEDFAQMDTARIIRKFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P+PPRIP     +V +    +  +LP WL+++DI +YA KF ++GFTGGLNYYR  D N
Sbjct  181   NPKPPRIP----KEVGFRGLPDNPNLPSWLSEKDINHYAGKFNKTGFTGGLNYYRCLDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTAAW+G QI+VPVKFIVGD D+TY+ PG ++ I EGGLKK VP LQ+V +MEGVAH+
Sbjct  237   WELTAAWTGLQIKVPVKFIVGDLDITYNMPGAQDYISEGGLKKYVPFLQEVAIMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNFH  196
             +NQEKPEEV++HI +FI+ F+
Sbjct  297   LNQEKPEEVSSHIYDFIKKFN  317



>ref|XP_011015179.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Populus 
euphratica]
Length=316

 Score =   443 bits (1139),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 251/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H T++ NGINMH+A IG GP VLFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MDKIEHQTIATNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP +A  Y++FHIVGDLV L+D+L + +VFLVGHDWGA +AW FC+ RPDRIKA
Sbjct  61    GYGDTDAPKNAREYTIFHIVGDLVGLIDSLGIDKVFLVGHDWGATVAWYFCLLRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P +  ++  RE FGDDFYICRFQ+PGE EE F  +D  ++   FLT+R
Sbjct  121   LVNMSVVFQPRNPHKSSVQISRELFGDDFYICRFQEPGEVEEDFAQMDTASIITRFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP+PP IP     +V +    +  +LP WL+++DI YYA KF Q+GFTGGLNY R  D N
Sbjct  181   DPKPPCIP----KEVGFRGIPDNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYNRCLDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL AAW+G +I+V  KFIVGD D TYH PGVKE I +GGLKK VP LQ+VVVMEGVAH+
Sbjct  237   WELMAAWTGLKIKVSAKFIVGDVDPTYHIPGVKEYISKGGLKKYVPFLQEVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             +NQEKPEEV+ HI +FI+ F
Sbjct  297   LNQEKPEEVSEHIYDFIKKF  316



>ref|XP_007200440.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
 emb|CAZ86693.1| epoxide hydrolase 2 [Prunus persica]
 gb|EMJ01639.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
Length=316

 Score =   441 bits (1135),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TVS NGINMH+A IG GP VLFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MEKIEHTTVSTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS  SYS  HIVGDL+ LLD L + +VFLVGHDWGA+IAW FC+FRPDR+KA
Sbjct  61    GFGDTDAPPSPASYSALHIVGDLIGLLDHLGIDQVFLVGHDWGAVIAWWFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  SPR+P RKP++  R  FGDD+YICRFQ+PGE E+ F   D T++ K FLT R
Sbjct  121   LVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQEPGEIEKEFAGYDTTSIMKKFLTGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P+PP +P +   +    K  ET  LPPWL+++D+ Y+A+KF ++GF GGLNYYR  +  
Sbjct  181   SPKPPCLPKELGLRAW--KTPET--LPPWLSEEDLNYFASKFSKTGFVGGLNYYRALNLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+G Q++VPVKFIVGD D+TYH PGVK  IH GG K+ VP LQ+VVV+E  AH+
Sbjct  237   WELTGPWTGLQVKVPVKFIVGDLDITYHIPGVKNYIHNGGFKRDVPFLQEVVVIEDGAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+P+E++ H+ +FIQ F
Sbjct  297   INQERPDEISRHVYDFIQKF  316



>ref|XP_008355493.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=316

 Score =   441 bits (1134),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV  NGINMHVA IG GP VLFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MENIEHTTVPTNGINMHVASIGTGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS  SY+  HIVGDL+ LLD L + +VFLV HDWGA++AW FC+FRPDR+KA
Sbjct  61    GFGDTDAPPSPTSYTAMHIVGDLIGLLDHLGIDQVFLVAHDWGAVMAWWFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  SPR+P RKP++  R  FGDD+YICRFQ+PGE E+ F SID   + K FLT R
Sbjct  121   LVNMSVAFSPRNPKRKPIDTFRALFGDDYYICRFQEPGEIEQDFDSIDTAAVMKCFLTGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P+PP IP     +         V+LP WLT++D+ Y+A+KF ++GFTGGLNYYR  +  
Sbjct  181   SPKPPCIPKDQGLK----SWAAPVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+G QI+VPVKFIVGD D+TYH PG++  IH+GG K+ VP LQ+VVVME  AH+
Sbjct  237   WELTGPWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVPFLQEVVVMEDAAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP+EV+ H+ +FI+ F
Sbjct  297   INQEKPDEVSQHVYDFIKKF  316



>ref|XP_004494384.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=317

 Score =   441 bits (1134),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 247/321 (77%), Gaps = 5/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV+ NGI MH+A IG GP +LFLHGFPELWY+WRHQ+L L+S GYRAIAPDLR
Sbjct  1     MEKIEHTTVNTNGIKMHIASIGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPP   SYS  HIVGDLV LLD L +  VFLVGHDWGA +AW FC+ +PDR+KA
Sbjct  61    GYGDTDAPPCPSSYSALHIVGDLVGLLDGLGVDRVFLVGHDWGAAMAWYFCLLKPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P RKP++ MR   GDD+YICRFQ+PGEAEE F       + K+FLT R
Sbjct  121   LVNMSVVFRPRNPIRKPVQTMRALMGDDYYICRFQKPGEAEEEFARAGANRIIKSFLTLR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             DPR   +P     ++ +     T ++LP WL+++D+ YYATK+ Q GFTGGLNYYR  D 
Sbjct  181   DPRALCVPK----EIGFGGSPNTPITLPSWLSEEDVNYYATKYEQKGFTGGLNYYRALDL  236

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
              WEL A W+G QI+VPVKFIVGD DLTY+ PGVKE IH GG ++ VP LQ++VVMEGVAH
Sbjct  237   TWELMAPWTGEQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRREVPYLQEMVVMEGVAH  296

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQE+PEE+N HI +FI+ F
Sbjct  297   FINQERPEEINAHIYDFIKKF  317



>ref|XP_006444386.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 ref|XP_006479994.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
 dbj|BAD13534.1| soluble epoxide hydrolase [Citrus jambhiri]
 gb|ESR57626.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 gb|KDO87173.1| hypothetical protein CISIN_1g021158mg [Citrus sinensis]
Length=316

 Score =   441 bits (1133),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV+ NGINMHVA IG GPAVLF+HGFPELWY+WR+Q+L+L+S+GYRAIAPDLR
Sbjct  1     MEKIEHTTVATNGINMHVASIGTGPAVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS  SY+  H+VGDL+ LLD L + +VFLVGHDWGA+IAW FC+FRPDR+KA
Sbjct  61    GYGDTDAPPSVTSYTALHLVGDLIGLLDKLGIHQVFLVGHDWGALIAWYFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PR+P  +PL N R  +GDD+YICRFQ+PGE EE F  ID   L K FL  R
Sbjct  121   LVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCLR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P+P  IP  +    L     +  +LP WL+++D+ YYA+KF Q GFTG +NYYR +D N
Sbjct  181   IPKPLCIPKDTGLSTL----PDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCWDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+G QI+VPVK+IVGDQDL Y+  G KE IH GG KK VP LQ VVVMEGVAH+
Sbjct  237   WELMAPWTGVQIKVPVKYIVGDQDLVYNNKGTKEYIHNGGFKKYVPYLQDVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EEV  HI EFI+ F
Sbjct  297   INQEKAEEVGAHIYEFIKKF  316



>ref|XP_011079630.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=316

 Score =   440 bits (1132),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 257/320 (80%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             MERI H  ++VNGINMHVAEIGDGPAVLFLHGFPELWY+WRHQML+L+++GYRAIAPDLR
Sbjct  1     MERIVHKNLNVNGINMHVAEIGDGPAVLFLHGFPELWYSWRHQMLYLSARGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS  SY+ FHIVGDLVALLDAL L +VFLV HDWGA+IAW FC+FRPDRIKA
Sbjct  61    GYGDTDAPPSPSSYTTFHIVGDLVALLDALGLDQVFLVAHDWGALIAWCFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PRHP  K L+  R+  GDDFY+CRFQ+PGEAEE F   + T + K+  + R
Sbjct  121   LVNMSVQFHPRHPEIKTLQRYRDLLGDDFYMCRFQKPGEAEEAFACEEITQVIKSLFSFR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
               RP  +P +   +VL++   E   LPPWLT++DI Y+ATKF ++GFTGGLNYYR  D +
Sbjct  181   GGRPIVVPKELGLEVLFQAPAE---LPPWLTEEDINYFATKFKKTGFTGGLNYYRAMDLS  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL   W+G +++VPVKFI+GD D+TYH PGV+E IH+GG KK VP+L +VVVMEGVAH+
Sbjct  238   WELMGPWTGVEVKVPVKFIIGDADITYHVPGVEEYIHKGGFKKDVPDL-EVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EEV++HI +FI  F
Sbjct  297   INQEKAEEVSHHIYQFITRF  316



>gb|KCW50060.1| hypothetical protein EUGRSUZ_K03501 [Eucalyptus grandis]
Length=332

 Score =   440 bits (1131),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 245/310 (79%), Gaps = 2/310 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-AVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+I+H TV  NGINMHVA +GDGP  VLF+HGFPELWY+WRHQML LA+ GYRAIAPDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMLSLAALGYRAIAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYG TDAPP  +SY+ FH+VGDLV +LDAL +  VF+VGHDWGAI+AW+ C+ RPDR+K
Sbjct  61    RGYGGTDAPPRVESYTAFHVVGDLVGMLDALGIGRVFVVGHDWGAIMAWHLCLVRPDRVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN SV   PR+P RKP+E+MR TFGDD+Y+CRFQ+PG AEE F   D   L + FLT 
Sbjct  121   ALVNTSVAWFPRNPERKPVESMRATFGDDYYVCRFQEPGVAEEDFAKADIAKLIQLFLTG  180

Query  621   RDPRPPRIPHQ-SVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             RDP PP +P    ++ ++     + V LP WLT  DI YYAT+F ++GFTGG NYYR  D
Sbjct  181   RDPSPPIVPKDVGISGLIKLLDQQQVELPSWLTDDDISYYATQFSRTGFTGGFNYYRCLD  240

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWEL+A W+G++I+VPVKFIVGD DLTYHFPGVKE IH+GG KK VPNL+ VVVMEGVA
Sbjct  241   LNWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKEYIHDGGFKKAVPNLEDVVVMEGVA  300

Query  264   HYINQEKPEE  235
             H++ QEKP+E
Sbjct  301   HFLQQEKPQE  310



>ref|XP_010911257.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   439 bits (1129),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 249/320 (78%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV+VNGINMH+AE G+GP VLF+HGFPELWY+WRHQM+ LA++GYRA+APDLR
Sbjct  1     MEGITHRTVAVNGINMHIAEKGEGPMVLFIHGFPELWYSWRHQMVALAARGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS   Y++FH+VGDLVALLDAL   +VF VGHDWGA++AW  CM RPDR++A
Sbjct  61    GYGDTDAPPSTTDYTIFHLVGDLVALLDALAQDQVFAVGHDWGAVVAWWLCMLRPDRVRA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  SPRHP R+P+++++  FGDD YICRFQ+PG AE  F  I+   L K FLT R
Sbjct  121   LVNMSVAFSPRHPARRPVDSLKALFGDDHYICRFQEPGAAEAEFARINTALLLKKFLTYR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P P  I   S  +         ++LP WLT++D+ YY +KF +SGFTGGLNYYR  + N
Sbjct  181   KPAPLLI---SKEKGFGGSPNTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYYRCLNLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD DLTYH PG+++ IH+GG K+ VP LQ V+VM+GV H+
Sbjct  238   WELTAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDHIHKGGFKREVPFLQDVIVMQGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+P E+++HI EFI+ F
Sbjct  298   INQERPHEISDHIYEFIRKF  317



>ref|XP_010038231.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50055.1| hypothetical protein EUGRSUZ_K03496 [Eucalyptus grandis]
Length=322

 Score =   438 bits (1127),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 209/325 (64%), Positives = 246/325 (76%), Gaps = 8/325 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-----AVLFLHGFPELWYTWRHQMLFLASKGYRAI  994
             ME I+H TV  NGINMHVA +G         VLFLHGFP+LWYTWR QML LA+ GYRA+
Sbjct  1     METIEHATVPTNGINMHVASVGGDGGAGGDTVLFLHGFPDLWYTWRRQMLSLAALGYRAV  60

Query  993   APDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRP  814
             APDLRGYGDTDAPPSA SY+ FHIVGDLV LLDAL +  VFLVGHDWGA++AW FC+ RP
Sbjct  61    APDLRGYGDTDAPPSAASYTAFHIVGDLVGLLDALGVERVFLVGHDWGAVMAWYFCLLRP  120

Query  813   DRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKA  634
             DR+KALVN SV   P    RKP++++R  FGDD+YICRFQ+PGEAEE F   D T L K 
Sbjct  121   DRVKALVNTSVAFLPGSRKRKPVDSLRALFGDDYYICRFQEPGEAEEDFARADITKLMKL  180

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             FLT R P+PP IP +     L   R +   LPPWL+++DI +YA+KF Q GFTGGLNYYR
Sbjct  181   FLTCRSPKPPCIPKEIGCSGLASSRDK---LPPWLSEEDINFYASKFSQKGFTGGLNYYR  237

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
               +  W+L A W+G QI+VPVKFIVGD D+TYH PG K+ IH GGLKK+VP LQ+VVVME
Sbjct  238   AMNLTWKLAAPWTGVQIKVPVKFIVGDLDITYHVPGAKQHIHNGGLKKLVPFLQEVVVME  297

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             GVAH++ QEKPEEV NHI +FI+ F
Sbjct  298   GVAHFLQQEKPEEVTNHIYDFIKKF  322



>ref|XP_006396441.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
 gb|ESQ37894.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
Length=316

 Score =   438 bits (1126),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+S NGINMHVA IG GP +LFLHGFP+LWY+WRHQ+L  A  GYRAIAPDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS DSY++ HIVGDLV LL++L +  VFLVGHDWGAI+AW  CM RPDR+ A
Sbjct  61    GYGDSDAPPSPDSYTILHIVGDLVGLLNSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVNA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  R  FGDD+Y+CRFQ+PGE EE F   D   L   F T+R
Sbjct  121   LVNTSVVFNPRNPSVKPVDAFRALFGDDYYVCRFQEPGEIEEDFAQADTKKLINRFFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      + +    +   LP WLT+QD+++YA KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KTLGFRGLPDPPPLPAWLTEQDVRFYADKFSQKGFTGGLNYYRALNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD DLTYH PG KE IHEGGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDLTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             ++QEKP+EV +HI  F + F
Sbjct  297   LHQEKPDEVTDHIYGFFKKF  316



>ref|XP_009335707.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
 ref|XP_009335715.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=316

 Score =   437 bits (1125),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 245/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV  NGINMHVA IG GP VLFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MENIEHTTVPTNGINMHVASIGTGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS  SY+  HIVGDL+ LLD L + +VFLV HDWGA++AW FC+FRPDR+KA
Sbjct  61    GFGDTDAPPSPTSYTAMHIVGDLIGLLDHLGIDQVFLVAHDWGAVMAWWFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  SPR+P RKP++  R  FGDD+YICRFQ+PGE E+ F SID   + K FLT R
Sbjct  121   LVNMSVAFSPRNPKRKPIDTFRALFGDDYYICRFQEPGEIEQDFDSIDTAAVMKRFLTGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P+PP IP     +         V+LP WLT++D+ Y+A+KF ++GFTGGLNYYR  +  
Sbjct  181   SPKPPCIPKDQGLK----SWAAPVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+G QI+VPVKFIVGD D+TYH PG++  IH+GG K+ V  LQ+VVVME  AH+
Sbjct  237   WELTGPWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVAFLQEVVVMEDAAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP+EV+ H+ +FI+ F
Sbjct  297   INQEKPDEVSQHVYDFIKKF  316



>ref|XP_010038234.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50059.1| hypothetical protein EUGRSUZ_K03500 [Eucalyptus grandis]
Length=325

 Score =   437 bits (1125),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 250/324 (77%), Gaps = 6/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-AVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+I+H TV  NGINMHVA +G+GP  VLF+HGFPELWY+WRHQM+ LA+ GYR + PDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGNGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVGPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RG+GDTDAPPS +SY+ FH+VGDLV +LD L +  VF+VGHDWGAIIAW  C+ RPDR+K
Sbjct  61    RGFGDTDAPPSVESYTAFHVVGDLVGMLDVLGIGRVFVVGHDWGAIIAWYLCLLRPDRVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN SV   PR+P RKP+E +R TFGDD+Y+CRFQ+PGEAE  F   DP  LFK FL +
Sbjct  121   ALVNTSVAWFPRNPERKPVEKLRATFGDDYYVCRFQEPGEAEADFAKADPAKLFKLFLVS  180

Query  621   RDPRPPRIPHQ---SVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             RDP PP +P     S    ++E     V LP WL++ DI +YA +F ++GFTGGLNYYR 
Sbjct  181   RDPSPPILPKDVGFSGMTKIFED--HQVDLPSWLSEDDINFYAAQFSRTGFTGGLNYYRC  238

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWEL+A+W+G  I+VPVKFIVGD DLTYH PGVKE I+ GG K+ VPNL++VVVMEG
Sbjct  239   SDLNWELSASWTGVPIEVPVKFIVGDLDLTYHIPGVKEYINGGGFKRAVPNLEEVVVMEG  298

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH++ QEKP +V +HI +FI+ F
Sbjct  299   VAHFLQQEKPRDVTSHIHDFIKKF  322



>ref|NP_567228.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAC19281.1| T14P8.15 [Arabidopsis thaliana]
 emb|CAB80727.1| AT4g02340 [Arabidopsis thaliana]
 gb|AAM26670.1| AT4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AAN18121.1| At4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AEE82157.1| putative epoxide hydrolase [Arabidopsis thaliana]
Length=324

 Score =   437 bits (1125),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 248/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+S NGINMHVA IG GP +LF+HGFP+LWY+WRHQ++  A+ GYRAIAPDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFVHGFPDLWYSWRHQLVSFAALGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY++ HIVGDLV LLD+L +  VFLVGHDWGAI+AW  CM RPDR+ A
Sbjct  61    GYGDSDAPPSRESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVNA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  R  FGDD+YICRFQ+PGE EE F  +D   L   F T+R
Sbjct  121   LVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQEPGEIEEDFAQVDTKKLITRFFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      V +    +  SLP WLT+QD+++Y  KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSVGFRGLPDPPSLPAWLTEQDVRFYGDKFSQKGFTGGLNYYRALNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE IHEGGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWTGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             ++QEKP+EV +HI  F + F
Sbjct  297   LHQEKPDEVTDHIYGFFKKF  316



>ref|XP_008235117.1| PREDICTED: bifunctional epoxide hydrolase 2 [Prunus mume]
Length=316

 Score =   437 bits (1124),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGINMH+A IG GP VLFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MEKIEHTTVRTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS  SYS  HIVGDL+ LLD L + +VFLVGHDWGA+IAW FC+FRPDR+KA
Sbjct  61    GFGDTDAPPSPASYSALHIVGDLIGLLDHLGIDQVFLVGHDWGAVIAWWFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  SPR+P RKP++  R  FGDD+YICRFQ+PGE E+ F   D  ++ K FLT R
Sbjct  121   LVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQEPGEIEKEFAGFDAASIMKKFLTGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P+PP +P +   +    K  ET  LPPWL ++D+ Y+A+KF ++GF GGLNYYR  +  
Sbjct  181   SPKPPCLPKELGLRAW--KTPET--LPPWLLEEDVNYFASKFSKTGFVGGLNYYRALNLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+G QI+VPVKFIVGD D+TYH PG+KE IH GG K+ VP LQ+VVV+E  AH+
Sbjct  237   WELTGPWTGLQIKVPVKFIVGDLDITYHIPGMKEYIHNGGFKRDVPFLQEVVVIEDGAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP E++ H+ +FI  F
Sbjct  297   INQEKPHEISQHVYDFIHKF  316



>ref|XP_006480000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=316

 Score =   437 bits (1123),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 245/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGINMHVA IG GP VLF+HGFPELWY+WR+Q+L+L+S+GYRAIAPDLR
Sbjct  1     MEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS  SY+  H+VGDL+ LLD L + +VFLVGHDWGA+IAW FC+FRPDR+KA
Sbjct  61    GYGDTDAPPSVTSYTALHLVGDLIGLLDKLGIHQVFLVGHDWGALIAWYFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PR+P  +PL N R  +GDD+YICRFQ+PGE EE F  ID   L K FL  R
Sbjct  121   LVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCLR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
               +P  IP  +    +     +  +LP WL+++D+ YYA+KF Q GFTG +NYYR  D N
Sbjct  181   IAKPLCIPKDTGLSTV----PDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCSDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+G QI+VPVKFIVGDQDL Y+  G+KE IH+GG KK VP LQ+VVVMEGVAH+
Sbjct  237   WELMAPWTGVQIEVPVKFIVGDQDLVYNNKGMKEYIHDGGFKKYVPYLQEVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EEV  HI EFI+ F
Sbjct  297   INQEKAEEVGAHIYEFIKKF  316



>ref|XP_002320333.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|ABK93786.1| unknown [Populus trichocarpa]
 gb|EEE98648.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   436 bits (1122),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 254/321 (79%), Gaps = 4/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV+ NGINMH+A IG GP +LFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP +   Y+VFHI+GDLV L+D+L + +VFLVGHDWGA++AW FC+ RPDR+KA
Sbjct  61    GYGDTDAPKNYREYTVFHILGDLVGLIDSLGIDKVFLVGHDWGAMVAWYFCLLRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV  PR+P +  ++  R+ FGDD+YICRFQ+PGE EE F  +D   + + FLT+R
Sbjct  121   LVNMSVVFQPRNPHKSFVQISRDLFGDDYYICRFQEPGEVEEDFAQMDTARIIRKFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P+PP IP     +V +    +  +LP WL+++DI YYA KF Q+GFTGGLNYYR  D N
Sbjct  181   NPKPPCIP----KEVGFRGLPDNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYYRCLDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL AAW+G QI+VPVKFIVGD D+TY+ P  ++ I +GGLKK VP LQ+V +MEGVAH+
Sbjct  237   WELMAAWTGLQIKVPVKFIVGDLDITYNMPEAQDYISKGGLKKYVPFLQEVAIMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNFH  196
             +NQEKPEEV++HI +FI+ F+
Sbjct  297   LNQEKPEEVSSHIYDFIKKFN  317



>ref|XP_010556730.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=316

 Score =   436 bits (1121),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 245/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I H TVS NGINMHVA IG GP +LFLHGFP+LWY+WRHQ+L L++ GYRAIAPDLR
Sbjct  1     MEKIVHTTVSTNGINMHVASIGSGPPILFLHGFPDLWYSWRHQLLSLSALGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY+V H+VGDLV LLD+L L  VFLVGHDWGAI+AW  C+ RPDR+ A
Sbjct  61    GYGDSDAPPSLESYTVLHLVGDLVGLLDSLGLDRVFLVGHDWGAIVAWWLCLIRPDRVNA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SV  SPR+P  KP++  R  FGDD+YICRFQ+ GE EE F       L   FLT+R
Sbjct  121   LVNTSVAFSPRNPAVKPVDGFRALFGDDYYICRFQERGEIEEDFAQAGAKKLITKFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      + +    +  SLP WLT+QDI YYA KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KALGFRGLPDPPSLPDWLTEQDIDYYAEKFSQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G+QI+VPVKF+VGD D+TYH PGVKE IHEGG+KK VP LQ+VVV+EGV H+
Sbjct  237   WELTAPWTGAQIKVPVKFMVGDLDVTYHIPGVKEYIHEGGIKKQVPFLQEVVVLEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKPEE+  HI +F + F
Sbjct  297   LQQEKPEEITAHIHDFFKKF  316



>ref|XP_006288215.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
 gb|EOA21113.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
Length=324

 Score =   436 bits (1120),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 243/320 (76%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TVS NGINMHVA IG GP +LFLHGFP+LWY+WRHQ+L  A+ GYRAIAPDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFATLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SYS+ HIVGDLV LLD+L +  VFLVGHDWGAIIAW  CM RPDR+ A
Sbjct  61    GYGDSDAPPSPESYSILHIVGDLVGLLDSLGVDRVFLVGHDWGAIIAWWLCMIRPDRVSA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+PT KP++  R  FGDD+YICRFQ+ GE EE F  +D   L   F  +R
Sbjct  121   LVNTSVVFNPRNPTLKPVDAFRALFGDDYYICRFQEAGEIEEDFAQVDTKKLITKFFVSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      V +    +  SLP WLT+QD+ +Y  KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSVGFRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+ Y+ PG KE IH+GGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDIVYNIPGTKEYIHDGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+EV +HI  F + F
Sbjct  297   LQQEKPDEVTDHIYGFFEKF  316



>ref|XP_002523107.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39292.1| epoxide hydrolase, putative [Ricinus communis]
Length=315

 Score =   434 bits (1117),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 248/320 (78%), Gaps = 5/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGINMH+A IG GP +LFLHGFP+LWYTWRHQ+L L+S GYR IAPDLR
Sbjct  1     MEKIEHTTVYTNGINMHIASIGKGPVILFLHGFPDLWYTWRHQLLALSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS + Y+V HIVGDLV LLD+L + +VFLVGHDWGA +AW+ C+FRPDRIKA
Sbjct  61    GFGDTDAPPSPNEYTVLHIVGDLVGLLDSLGVEQVFLVGHDWGATVAWHLCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SV  SPR+P +KP+E  RE  GDDFYICRFQ+ GE EE F       + + FL +R
Sbjct  121   LVNTSVAFSPRNPHKKPVERYRELLGDDFYICRFQEHGEIEEDFAKAGAARIIRRFLASR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                PP +P  +  + L   +    +LP WL+++DI YY +K+GQ GFTGGLNYYR  D N
Sbjct  181   STAPPCVPKATGFRSLPVPQ----NLPSWLSEEDINYYVSKYGQKGFTGGLNYYRCLDLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+GSQI+VPVKFIVGD D+TYHFPGVKE IH  G+KK VP LQ+VVV+EGVAH+
Sbjct  237   WELTAPWTGSQIKVPVKFIVGDMDITYHFPGVKEYIHH-GMKKHVPFLQEVVVLEGVAHF  295

Query  258   INQEKPEEVNNHILEFIQNF  199
             ++QEKP+EV  HI +FI+ F
Sbjct  296   LSQEKPDEVTAHIHDFIKKF  315



>ref|XP_010429523.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   435 bits (1118),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 245/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TVS NGINMHVA IG GP +LFLHGFP+LWY+WRHQ+L  A+ GYRAIAPDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY++ HIVGDLV LLD+L +  VFLVGHDWGAI+AW  CM RPDR+KA
Sbjct  61    GYGDSDAPPSPESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  R+ FGDD+Y+CRFQ+ GE EE F  +D   L   F  +R
Sbjct  121   LVNTSVVFNPRNPSVKPVDKFRDLFGDDYYVCRFQETGEIEEDFAQVDTKKLITRFFVSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      V +    +  SLP WLT+QD+ +Y  KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSVGFRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE IH GGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+EV +HI  F + F
Sbjct  297   LQQEKPDEVTDHIYGFFEKF  316



>ref|XP_004290809.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   434 bits (1117),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGINMHVA IG GP +LFLHGFPELWY+WRHQ+L L++ GYR IAPDLR
Sbjct  1     MEKIEHTTVPTNGINMHVASIGSGPPILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPP A SY+  HIVGDL+ LLD L + +VFLV HDWGA+IAW FC+FRPDR+K 
Sbjct  61    GFGDTDAPPDASSYTAMHIVGDLIGLLDHLGIEQVFLVAHDWGAVIAWWFCLFRPDRVKC  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  +PR+P RKP++  +  FGDD+YICRFQ+PGEAE  FG +D  ++ K FLT R
Sbjct  121   LVNMSVAFNPRNPKRKPVDGFKALFGDDYYICRFQEPGEAEAYFGGLDTASVMKMFLTGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P PP+I      ++ +        +P WL+++D+ Y+ATKF ++GFTGGLNYYR  +  
Sbjct  181   NPAPPKISK----ELGFASWKPVEPMPAWLSEEDVNYFATKFSKTGFTGGLNYYRAINLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG+KE IH GG K  VP LQ+V+++EG AH+
Sbjct  237   WELTAPWTGVQIKVPVKFIVGDLDITYNIPGIKEYIHNGGFKSQVPFLQEVIIVEGAAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EE + HI +FI+ F
Sbjct  297   INQEKAEECSAHIYDFIKKF  316



>ref|XP_009111296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=316

 Score =   434 bits (1115),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 247/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+S NGIN+HVA IG GPA+LFLHGFP+LWY+WR Q+L LA  GYRAIAPDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSLADLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+D+PPS +SY+V H+VGDLV LLD+L +  VFLVGHDWGAI+AW  CM RPDR+KA
Sbjct  61    GYGDSDSPPSHESYTVLHVVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWMCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  +  FG+D+YICRFQ+PGE EE F  +D   L   F T+R
Sbjct  121   LVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      + +    +  +LP WLT++D+ +YA KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSLGFRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE IHEGGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+EV +HI  F   F
Sbjct  297   LQQEKPDEVTDHIYSFFSKF  316



>emb|CDY65636.1| BnaAnng20810D [Brassica napus]
Length=316

 Score =   433 bits (1113),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+S NGIN+HVA IG GPA+LFLHGFP+LWY+WR Q+L  A  GYRAIAPDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFADLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY+V H+VGDLV LLD+L +  VFLVGHDWGAI+AW  CM RPDR+KA
Sbjct  61    GYGDSDAPPSHESYTVLHVVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWMCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  +  FG+D+YICRFQ+PGE EE F  +D   L   F T+R
Sbjct  121   LVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      + +    +  +LP WLT++D+ +YA KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSLGFRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE IHEGGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+EV +HI  F   F
Sbjct  297   LQQEKPDEVTDHIYSFFSKF  316



>ref|XP_002874922.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51181.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   433 bits (1113),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TVS NGINMHVA IG GP +LFLHGFP+LWY+WRHQ+L  A+ GYRAIAPDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY++ HIVGDLV LL++L +  VFLVGHDWGAI+AW  CM RPDR+ A
Sbjct  61    GYGDSDAPPSRESYTILHIVGDLVGLLNSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVNA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  R  FGDD+YICRFQ+PGE EE F  +D   L   F  +R
Sbjct  121   LVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQEPGEIEEDFAQVDTKKLITRFFISR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      V +    +  SLP WLT++D+ +Y  KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSVGFRGLPDPPSLPAWLTEEDVSFYGDKFSQKGFTGGLNYYRALNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE IHEGGLKK VP LQ+VVV+EGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVLEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             ++QEKP+E+ +HI  F + F
Sbjct  297   LHQEKPDEITDHIYGFFKKF  316



>ref|XP_010422608.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   432 bits (1112),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 243/320 (76%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             MERI+H T+S NGINMHV  IG GP +LFLHGFP+LWY+WRHQ+L  A+ GYRAIAPDLR
Sbjct  1     MERIEHTTISTNGINMHVTSIGTGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY++ HIVGDLV LLD+L +  VFLVGHDWGAI+AW  CM RPDR+KA
Sbjct  61    GYGDSDAPPSPESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  R  FGDD+Y+CRFQ+ GE EE F  +D   L   F  +R
Sbjct  121   LVNTSVVFNPRNPSVKPVDKFRALFGDDYYVCRFQEAGEIEEDFAQVDTKKLITRFFVSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      V +    +  SLP WLT+QD+ +Y  KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSVGFRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE +H GGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYLHGGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+EV +HI  F + F
Sbjct  297   LQQEKPDEVTDHIYGFFEKF  316



>ref|XP_010456047.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   432 bits (1111),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 243/320 (76%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+S NGINMHVA IG G  +LFLHGFP+LWY+WRHQ+L  A+ GYRAIAPDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGSVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAP S +SY++ HIVGDLV LLD+L +  VFLVGHDWGAI+AW  CM RPDR+KA
Sbjct  61    GYGDSDAPQSPESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+PT KP++  R  FGDD+YICRFQ+ GE EE F  +D   L   F  +R
Sbjct  121   LVNTSVVFNPRNPTVKPVDKFRALFGDDYYICRFQEAGEIEEDFAQVDTKKLITRFFVSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      V +    +  SLP WLT+QD+ +Y  KFGQ GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSVGFRGLPDPPSLPAWLTEQDVSFYGDKFGQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE IH GGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+EV +HI  F + F
Sbjct  297   LQQEKPDEVTDHIYGFFEKF  316



>ref|XP_008454327.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=315

 Score =   431 bits (1107),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 248/321 (77%), Gaps = 7/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++IQH+T+S NGIN+H A IG GP VLFLHGFPELWY+WRHQ+LFLASKG+RAIAPDLR
Sbjct  1     MDKIQHSTISTNGINIHFASIGSGPVVLFLHGFPELWYSWRHQLLFLASKGFRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GD+DAPPS  SY+  HIVGDL+ LLD L + +VFLVGHDWGA++AW FC+FRPDR+KA
Sbjct  61    GFGDSDAPPSPSSYTPHHIVGDLIGLLDHLGIDQVFLVGHDWGAMMAWYFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV  +PR+P   PL   R   GDDFYIC+FQ+PG AE  FGS+D  T+ K FLT R
Sbjct  121   LVNLSVHYTPRNPAGSPLAVTRRYLGDDFYICKFQEPGVAEADFGSVDTATMMKKFLTMR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVS-LPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             DPRP  IP+       ++   ET   LP WLT++DI+Y+A+KF ++GFTGG NYYR  D 
Sbjct  181   DPRPAIIPNG------FKTLLETPEILPSWLTEEDIEYFASKFSKTGFTGGFNYYRALDI  234

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
              WELT  WS +QI+VP KFIVGD DL Y+FPG KE IH GG KK VP L+ VVV+EG AH
Sbjct  235   TWELTGPWSRAQIKVPTKFIVGDLDLVYNFPGAKEYIHGGGFKKDVPLLEDVVVIEGAAH  294

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQEKP+E+++ I +FI  F
Sbjct  295   FINQEKPDEISSLIYDFITKF  315



>emb|CDY50394.1| BnaCnng19260D [Brassica napus]
Length=316

 Score =   431 bits (1107),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+S NGIN+HVA IG GPA+LFLHGFP+LWY+WR Q+L  A  GYRAIAPDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFAGLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+D+PPS +SY+V H+VGDLV LLD+L +  VFLVGHDWGAI+AW  CM RPDR+KA
Sbjct  61    GYGDSDSPPSHESYTVLHVVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWMCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P+ KP++  +  FG+D+YICRFQ+PGE EE F  +D   L   F T+R
Sbjct  121   LVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      + +    +  +LP WLT++D+ +YA KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KSLGFRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TY+ PG KE IHEGGLKK VP LQ+VVVMEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+EV +HI  F   F
Sbjct  297   LQQEKPDEVTDHIYGFFSKF  316



>gb|KFK30821.1| hypothetical protein AALP_AA6G030400 [Arabis alpina]
Length=316

 Score =   429 bits (1103),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 241/320 (75%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+S NGINMHVA IG GP +LFLHGFP+LWY+WRHQ+L  A  GY+AIAPDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYKAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS +SY+V HIVGDL+ LL++L + +V LVGHDWGAI+AW  CM RPDR+KA
Sbjct  61    GYGDSDAPPSHESYTVLHIVGDLIGLLNSLGVDKVLLVGHDWGAIVAWWLCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV +PR+P  KPL+  R  FGDD+YICRFQ+PGE EE F   D   L   F T+R
Sbjct  121   LVNTSVVFNPRNPNVKPLDTFRSLFGDDYYICRFQEPGEIEEDFAQTDTKKLITRFFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +PRPP IP      V +        LP W T++D+ +Y  KF Q GFTGGLNYYR  + +
Sbjct  181   NPRPPCIP----KTVGFRGLPAPPPLPAWFTEEDVSFYVDKFNQKGFTGGLNYYRAMNLS  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGD D+TYH PG KE IH+GGLKK VP LQ+VV+MEGV H+
Sbjct  237   WELTAPWAGLQIKVPVKFIVGDLDITYHIPGTKEYIHDGGLKKHVPFLQEVVIMEGVGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKPEEV +HI  F + F
Sbjct  297   LQQEKPEEVTDHIYSFFKKF  316



>ref|XP_010088295.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33520.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   428 bits (1100),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H+TV  NGINMHVA +G GPA+LFLHGFPELWY+WRHQM+ L+S GYR IAPDLR
Sbjct  1     MEKIEHSTVHTNGINMHVASVGTGPAILFLHGFPELWYSWRHQMISLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS  SY+  HIVGDLV L+D L + ++FLVGHDWGA+IAW FC+FRPDRIKA
Sbjct  61    GYGDTDAPPSPTSYTSLHIVGDLVGLIDHLVIEKLFLVGHDWGAMIAWYFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV   PR+P    ++  R   GDDFYICRFQ+PGE+E  F S D   +F+  L NR
Sbjct  121   LVNLSVPFFPRNPKINFVDGFRAELGDDFYICRFQEPGESEADFSS-DTVAVFRRILANR  179

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP+PP IP +   + +YE   + V+LP WLT+ DI ++A KF ++GFTGGLNYYR  +  
Sbjct  180   DPKPPLIPKEIGFRGVYE---DPVALPSWLTEDDINHFANKFNETGFTGGLNYYRALNLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTAAW+G+++QVP KFI+GD DL Y+FPG+KE I  GG K+ VP LQ++V++EG AH+
Sbjct  237   WELTAAWTGARVQVPTKFIMGDLDLVYYFPGMKEYILNGGFKRDVPLLQELVIIEGAAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP+E+++HI  FIQ F
Sbjct  297   INQEKPDEISSHIHHFIQKF  316



>gb|KDO87161.1| hypothetical protein CISIN_1g048209mg, partial [Citrus sinensis]
Length=349

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 245/334 (73%), Gaps = 18/334 (5%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGINMHVA IG GP VLF+HGFPELWY+WR+Q+L+L+S+GYRAIAPDLR
Sbjct  20    MEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  79

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS  SY+  H+VGDL+ LLD L + +VFLVGHDWGA+IAW FC+FRPDR+KA
Sbjct  80    GYGDTDAPPSVTSYTALHLVGDLIGLLDKLGIHQVFLVGHDWGALIAWYFCLFRPDRVKA  139

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PR+P  +PL N R  +GDD+YICRFQ+PGE EE F  ID   L K FL  R
Sbjct  140   LVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCLR  199

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD--  445
               +P  IP  +    +     +  +LP WL+++D+ YYA+KF Q GFTG +NYYR  D  
Sbjct  200   IAKPLCIPKDTGLSTV----PDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCSDLY  255

Query  444   ------------RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVP  301
                          NWEL A W+G QI+VPVKFIVGDQDL Y+  G+KE IH+GG KK VP
Sbjct  256   VPKTYTMAIIIKENWELMAPWTGVQIEVPVKFIVGDQDLVYNNKGMKEYIHDGGFKKYVP  315

Query  300   NLQQVVVMEGVAHYINQEKPEEVNNHILEFIQNF  199
              LQ+VVVMEGVAH+INQEK EEV  HI EFI+ F
Sbjct  316   YLQEVVVMEGVAHFINQEKAEEVGAHIYEFIKKF  349



>ref|XP_009391487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   427 bits (1099),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 249/320 (78%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV+VNGINMHVAE G+GP VL +HGFPELWY+WRHQ++ LA+ GY A+APDLR
Sbjct  1     MEEITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYSWRHQIVALAAHGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPP+  SY++FH+VGD+V L++AL   +VF+VGHDWGA++AW  CMFRPD++KA
Sbjct  61    GFGDTDAPPAVTSYTMFHVVGDIVGLIEALGRDQVFVVGHDWGALVAWCLCMFRPDKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SVV  PR+PT KP+E +R  +GDD+Y+CRFQ+PG  E  FG +  + + K FLT  
Sbjct  121   LVNLSVVFRPRNPTGKPVETLRTAYGDDYYVCRFQEPGRTEAEFGRVGTSLIIKKFLTYH  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP P  +P +       +K     +LP WL++ D+ Y+A KF +SGFTGGLNYYR  D N
Sbjct  181   DPGPVIVPKEKGFGDAPDKEN---ALPSWLSEDDLNYFAGKFEKSGFTGGLNYYRALDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVGDQDL YHFPGV++ I +GG K+ VP L+ +VVMEGV H+
Sbjct  238   WELTAPWTGVQIKVPVKFIVGDQDLAYHFPGVQDYISKGGFKRDVPLLEDMVVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+P+E++N ILEFI+ F
Sbjct  298   INQERPQEISNIILEFIKKF  317



>ref|XP_008386679.1| PREDICTED: bifunctional epoxide hydrolase 2 [Malus domestica]
Length=316

 Score =   427 bits (1098),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/320 (62%), Positives = 242/320 (76%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGINMHVA IG GP VLFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MEKIEHTTVPTNGINMHVASIGAGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS  SY+  HIVGDL+ LLD L + +VFLV HDWGA+ AW FC+FRPDR+KA
Sbjct  61    GFGDTDAPPSPTSYTAMHIVGDLIGLLDHLGIDQVFLVAHDWGAVXAWWFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMS+  SPR+P RKP++  R  FGDD+YICRFQ+P E E  F SI    + K FLT+R
Sbjct  121   LVNMSIAFSPRNPKRKPVDGFRALFGDDYYICRFQEPEEIERDFDSIGTAAVMKRFLTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P+PP IP     +         V+LP WLT++D+ Y  +KF +SGFTGGLNYYR  +  
Sbjct  181   SPKPPCIPKDQGLK----SWAAPVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+G QI+VPVKFIVG+ D+TY+ PGV+  IH+GG K+ VP LQ+VVVMEG AH+
Sbjct  237   WELTGPWTGLQIKVPVKFIVGELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             I QEKP+EV+ H+ +FI+ F
Sbjct  297   IAQEKPDEVSQHVYDFIKKF  316



>ref|XP_009411662.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   427 bits (1098),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 251/322 (78%), Gaps = 5/322 (2%)
 Frame = -1

Query  1161  GMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             GME I H  + VNGINMHVAE GDGP VLF+HGFPELWY+WRHQ+  LA++GYRA+APDL
Sbjct  2     GMEGISHRKLHVNGINMHVAEKGDGPVVLFVHGFPELWYSWRHQIASLAARGYRAVAPDL  61

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGD+DAPPSA +Y++ H+VGDLVAL+ AL   +VF+VGHDWGA +AW  CM RPD++K
Sbjct  62    RGYGDSDAPPSASAYTILHLVGDLVALIHALGQDQVFVVGHDWGAAVAWWLCMLRPDKVK  121

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN+SV  SPR+P R+ L+++R  FGDD Y+CRFQ+ G  E  F  I+ + L K FLT 
Sbjct  122   ALVNLSVPFSPRNPHRRTLDSLRAIFGDDHYMCRFQEHGATEAEFAQIETSLLIKKFLTY  181

Query  621   RDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             R P P  +P +      ++   ET ++LP WL+++DI Y+A+KF +SGFTGGLNYYR  D
Sbjct  182   RKPEPIIVPKEKG----FDGTLETPIALPTWLSEEDINYFASKFEKSGFTGGLNYYRCLD  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTA W+G+QI+VPVKFIVGD DLTYH PGV++ IH+GG KK+VP LQ VVVMEGV 
Sbjct  238   LNWELTAPWTGAQIKVPVKFIVGDLDLTYHSPGVQDYIHKGGFKKLVPFLQDVVVMEGVG  297

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQE+  ++++HI EFI+ F
Sbjct  298   HFINQERAHDISDHIYEFIKKF  319



>gb|KEH24395.1| epoxide hydrolase [Medicago truncatula]
Length=317

 Score =   427 bits (1097),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 246/321 (77%), Gaps = 5/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV  NGI MHVA IG GP ++FLHGFPELWY+WRHQ+L L++ GYRA+APDLR
Sbjct  1     MEKIEHTTVQTNGIKMHVASIGSGPVIIFLHGFPELWYSWRHQLLSLSALGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD+P S  SY+  HIVGDLV LLDAL +  VFLVGHDWGA +AW FC+ +PDR+KA
Sbjct  61    GYGDTDSPSSPSSYTAHHIVGDLVGLLDALNVDRVFLVGHDWGAAMAWYFCLLKPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSVV   R+P RKP++ MR   GDD+Y+CRFQ+PGEAEE F     T + K+FLT R
Sbjct  121   LVNMSVVFRSRNPVRKPVQTMRALMGDDYYMCRFQKPGEAEEEFARAGATRIIKSFLTLR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             DPR   +P     ++ +     T ++LP WL+++D+ YYATKF Q GFTGGLNYYR  D 
Sbjct  181   DPRALCVP----KEIGFGGSPNTHITLPKWLSEEDVNYYATKFEQKGFTGGLNYYRALDL  236

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
              WEL A W+G QI+VP KFIVGD DLTY+ PGVKE IH GG K+ VP LQ++VVMEGVAH
Sbjct  237   TWELMAPWTGEQIKVPAKFIVGDLDLTYNTPGVKEYIHNGGFKREVPYLQEMVVMEGVAH  296

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQE+PEE++ HI +FI+ F
Sbjct  297   FINQERPEEISAHIYDFIKKF  317



>gb|EYU42746.1| hypothetical protein MIMGU_mgv1a010198mg [Erythranthe guttata]
Length=319

 Score =   426 bits (1094),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 247/321 (77%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPA-VLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+I H  + VNGINMHVAE+G GPA VLFLHGFPELWY+WRHQM+ L+ KGYR IAPDL
Sbjct  1     MEQIVHKNLKVNGINMHVAELGQGPAAVLFLHGFPELWYSWRHQMVHLSGKGYRTIAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAPPS  SY+V HIVGDLVALLDAL L +VFLVGHDWGAI+AW FC+ RPDRIK
Sbjct  61    RGYGDTDAPPSPTSYTVLHIVGDLVALLDALGLDQVFLVGHDWGAIVAWWFCLLRPDRIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN SV   PR+P  K ++  R+  GD FY+CRFQ+ G+AEE F S D  ++ + FL+ 
Sbjct  121   ALVNTSVAFQPRNPFVKTIQGYRDVLGDGFYMCRFQEAGKAEEAFASTDTASVIRRFLSG  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             RDP+PP IP +    +L+  +     LP WL  +D+ YYATKF +SGFTGGLNYYR  D 
Sbjct  181   RDPKPPCIPTELSLDILF--KAPPPPLPSWLLPEDVDYYATKFDKSGFTGGLNYYRAMDL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             +WELT  W+ S I+VPVKF++GD D+TYHFPGVKE I  GGLKK VP L++VVV+EGV H
Sbjct  239   SWELTGPWTKSVIKVPVKFLIGDMDVTYHFPGVKEYIQSGGLKKYVPLLEEVVVIEGVGH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             ++NQE P+ V+ HIL+FI  F
Sbjct  299   FLNQEIPDLVSQHILDFISKF  319



>ref|XP_008454330.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=316

 Score =   426 bits (1094),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 243/320 (76%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T++ NGINMH+A IG GP VL LHGFPELWY+WRHQ+L+L+S GYRAIAPDLR
Sbjct  1     MEAIEHTTINTNGINMHIASIGTGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAP S   Y+ FHIVGDLV  LD L + +VF+VGHDWGAIIAW  C+FRPDR+KA
Sbjct  61    GFGDTDAPESHTVYTPFHIVGDLVGALDELGIEKVFVVGHDWGAIIAWYLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV    R+PT   ++  R  FGDDFYICRFQ PGEAE+ FGSID   LFK FL  R
Sbjct  121   LVNLSVHFLRRNPTISFVQGFRIAFGDDFYICRFQVPGEAEKDFGSIDTAELFKKFLCGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P +   + +   +    +LP WL+Q+DI Y+ATKF ++GFTGG NYYR  D  
Sbjct  181   SPDPPILPKEFGIRSIPSPQ----NLPSWLSQEDINYFATKFNRTGFTGGFNYYRALDLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA+W+ +Q+QVPVKFIVGD DLTYHFPG KE IH GG K  VP L++VVVME  AH+
Sbjct  237   WELTASWNKAQVQVPVKFIVGDLDLTYHFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+P E++ HI +FI+ F
Sbjct  297   INQERPHEISAHIHDFIKKF  316



>ref|XP_010921626.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   425 bits (1093),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 243/318 (76%), Gaps = 3/318 (1%)
 Frame = -1

Query  1152  RIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGY  973
              I H  V+VNGINMH+AE G+GP VL LHGFPELWY+WRHQ+L L++ GYRAIAPDLRG+
Sbjct  4     EIHHRFVAVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALSAAGYRAIAPDLRGF  63

Query  972   GDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKALV  793
             GDTDAPP A SY++FH+VGDLVAL+  L   +VF+VGHDWGA++AW+ CMFRPD+++ALV
Sbjct  64    GDTDAPPEASSYTMFHVVGDLVALIHTLGQEKVFVVGHDWGAMVAWSLCMFRPDKVRALV  123

Query  792   NMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRDP  613
             N+SV   PR P RKP+E +R  +GDD+YIC FQ+PG  E  F  I    + K FLT  DP
Sbjct  124   NLSVAFRPRSPDRKPVETLRAVYGDDYYICTFQEPGRTEAEFACIPTALVIKKFLTYHDP  183

Query  612   RPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWE  433
              P  +P ++      +K    ++LP WL+++DI Y+A+KF +SGFTGGLNYYR  D NWE
Sbjct  184   SPVIVPKENGFAASPDKE---ITLPSWLSEEDINYFASKFDKSGFTGGLNYYRALDLNWE  240

Query  432   LTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYIN  253
             LTA W+G QI+VPVKFIVG+QDL Y+ PGVK+ IH+GG KK VP L+ VVV+EG  H+IN
Sbjct  241   LTAPWTGMQIKVPVKFIVGNQDLMYNIPGVKDYIHKGGFKKDVPFLEDVVVIEGAGHFIN  300

Query  252   QEKPEEVNNHILEFIQNF  199
             QEKP+E  +HI EFIQ F
Sbjct  301   QEKPQETTDHIYEFIQKF  318



>ref|XP_004152245.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156836.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52816.1| hypothetical protein Csa_4G001830 [Cucumis sativus]
Length=316

 Score =   425 bits (1093),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 240/320 (75%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T++ NGI MH+A IG GP VL LHGFPELWY+WRHQ+L+L+S GYRAIAPDLR
Sbjct  1     METIEHTTINTNGIKMHIASIGTGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAP S  +Y+ FHIVGDLV  LD L + +VF+VGHDWGAIIAW FC+FRPDR+KA
Sbjct  61    GFGDTDAPESHTAYTAFHIVGDLVGALDELGIEKVFVVGHDWGAIIAWYFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV   PR+P    ++  R  FGDDFYICRFQ PGEAE+ FGSID T LFK  L  R
Sbjct  121   LVNLSVHFLPRNPAISFVQGFRFAFGDDFYICRFQVPGEAEKDFGSIDTTELFKKILCGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P     + +         LP WL+Q+DI Y+ATKF  +GFTGG NYYR  D  
Sbjct  181   TPDPPILPKGLGIRSIPSPH----DLPSWLSQEDINYFATKFNHTGFTGGFNYYRALDLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA+W+ +Q+QVPVKFIVGD DLTY+FPG KE IH GG K  VP L++VVVME  AH+
Sbjct  237   WELTASWNKAQVQVPVKFIVGDLDLTYYFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+P E++ HI EFI+ F
Sbjct  297   INQERPHEISVHIHEFIKKF  316



>gb|AAO27849.1|AF482450_1 soluble epoxide hydrolase [Euphorbia lagascae]
Length=321

 Score =   425 bits (1092),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 196/321 (61%), Positives = 243/321 (76%), Gaps = 5/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+I+H+ VS NGINMH+A IG  GP +LFLHGFP+LWY+WRHQ+L+L+S GYR IAPDL
Sbjct  5     MEKIEHSMVSTNGINMHIASIGTQGPVILFLHGFPDLWYSWRHQLLYLSSVGYRCIAPDL  64

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAPP+ + Y+VFHI+GDLV LLD+L + +VFLVGHDWGAII+W FC+  P RIK
Sbjct  65    RGYGDTDAPPAINQYTVFHILGDLVGLLDSLGIDQVFLVGHDWGAIISWYFCLLMPFRIK  124

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN SVV +PR P  K +E  R+  G+DFYICRFQ+ GE E+ F       +   FLT+
Sbjct  125   ALVNASVVFTPRDPRCKTVEKYRKELGEDFYICRFQEVGEIEDDFAQAGTAKIITKFLTS  184

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R  RPP IP ++     Y    E   +P WL+Q DI YY +K+ + GF+GGLNYYR  D 
Sbjct  185   RHIRPPCIPKETG----YRSLREPSHIPSWLSQDDINYYVSKYNKKGFSGGLNYYRCLDL  240

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVKFIVGDQD TYH PGVKE IH GGLKK VP LQ++V++EG AH
Sbjct  241   NWELTAPWTGVQIKVPVKFIVGDQDATYHLPGVKEFIHNGGLKKHVPFLQEIVILEGAAH  300

Query  261   YINQEKPEEVNNHILEFIQNF  199
             ++ QEKPEE++ HIL+F + F
Sbjct  301   FLQQEKPEEISAHILDFFEKF  321



>gb|AFZ93648.1| epoxide hydrolase [Euphorbia lathyris]
 gb|AFZ93653.1| epoxide hydrolase [Euphorbia lathyris]
Length=315

 Score =   424 bits (1091),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 247/320 (77%), Gaps = 5/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+ NGINMHVA IG+G  +LFLHG+PELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MEKIEHTKVATNGINMHVASIGEGRPILFLHGYPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP S + Y+V HIVGDLV LLDALQ+ +VFLVGHDWGAIIAW  C+FRPDRIKA
Sbjct  61    GYGDTDAPHSVEKYTVLHIVGDLVGLLDALQIDQVFLVGHDWGAIIAWYVCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SV   PR PT   +E  R  +G+D+YI R+Q+PG AE  +  I+   LF+  LTNR
Sbjct  121   LVNTSVPFLPRDPTTPFVEFYRNLYGEDYYIVRYQKPGVAEAEYAKINSAKLFRIILTNR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP P     + +      K+ +  +LP WLT++D+ YYA KF ++GFTGG+NYYRNFDR 
Sbjct  181   DPNPEATLPKDIG-----KQPDPSTLPCWLTEKDVDYYARKFHKTGFTGGINYYRNFDRT  235

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTAAW+G+Q++VPVKFIVGD DL Y+ PG+KE IH GG K+ VP L++VV+MEGVAH+
Sbjct  236   WELTAAWTGAQVKVPVKFIVGDLDLVYNIPGMKEYIHNGGFKRDVPFLEEVVIMEGVAHF  295

Query  258   INQEKPEEVNNHILEFIQNF  199
             +NQEK +E++ HI +FI+ F
Sbjct  296   LNQEKADEISKHIYDFIKKF  315



>ref|XP_010039280.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50058.1| hypothetical protein EUGRSUZ_K03499 [Eucalyptus grandis]
Length=331

 Score =   424 bits (1091),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 250/331 (76%), Gaps = 14/331 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-AVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+I+H TV  NGINMHVA +GDGP  VLFLHGFPELWY+WR QM+ LA+ GYR +APDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFLHGFPELWYSWRPQMVSLAALGYRTVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RG+G TDAP   +SY+ FH+VGDLV +LDAL + + F+VGHDWGAI+AW  C+ RPDR++
Sbjct  61    RGFGGTDAPLRVESYTAFHVVGDLVGMLDALGIGQAFVVGHDWGAIMAWYLCLLRPDRVR  120

Query  801   ALVNMSV------VISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLF  640
             ALVN SV         P  P +KP+E++R  +GDD+Y+CRFQ+PGE EE F   DP  L 
Sbjct  121   ALVNTSVPWCPGGTCFPSDPEKKPVESLRAMYGDDYYVCRFQEPGEIEEDFAKADPAKLI  180

Query  639   KAFLTNRDPRPPRIP----HQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTG  472
             + FLT R+P PPR+P    +    ++L + +   V LP WLT++DI YYAT+F ++GFTG
Sbjct  181   QLFLTTRNPGPPRVPKDLGYSGRTKLLEDSQ---VDLPSWLTEEDINYYATQFSRTGFTG  237

Query  471   GLNYYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQ  292
             GLNYYR  D NWEL+A W+G++I+VPVKFIVGD DL YH PGVKE IH+GG K+ VPNL+
Sbjct  238   GLNYYRCLDLNWELSAPWAGARIEVPVKFIVGDLDLIYHIPGVKEYIHDGGFKQTVPNLK  297

Query  291   QVVVMEGVAHYINQEKPEEVNNHILEFIQNF  199
             +VVVMEGVAHY+  EKP EV +HI +FI+ F
Sbjct  298   EVVVMEGVAHYLLLEKPHEVTSHICDFIKKF  328



>gb|KDP28185.1| hypothetical protein JCGZ_13956 [Jatropha curcas]
Length=315

 Score =   423 bits (1087),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 238/320 (74%), Gaps = 6/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH  V+ NGINMHVA IG GPA+LFLHGFPELWY+WRHQ+L L++ GYR IAPDLR
Sbjct  1     MENIQHIRVAANGINMHVATIGTGPAILFLHGFPELWYSWRHQLLHLSALGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAP S   Y+ FHIVGDL+ LLD L + +VFLVGHDWGA+IAW FC+FRPDRIKA
Sbjct  61    GFGDTDAPESVTEYTGFHIVGDLIGLLDELGIEKVFLVGHDWGAVIAWYFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN S+  +PR P   P++ ++  FGDD+Y+CRFQ+P EAEE F  +D  +L K   T R
Sbjct  121   LVNSSIAFTPRTPV-NPVDGLKACFGDDYYVCRFQEPIEAEEKFSLLDIASLLKTIFTAR  179

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P PPRIP +     +         LP WL+++DI YYA KF Q+G TGGLNYYR     
Sbjct  180   NPNPPRIPKE-----IEFPDCLCSCLPSWLSEEDINYYAAKFHQTGITGGLNYYRAIKLT  234

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+G QI+VPVKFIVGD D  YH PG+KE I  GG KK VPNLQ+VV+MEGV H+
Sbjct  235   WELMAPWAGQQIKVPVKFIVGDLDTAYHLPGMKEYIKNGGFKKDVPNLQEVVIMEGVGHF  294

Query  258   INQEKPEEVNNHILEFIQNF  199
             I QEK EEV+NHI +FI+NF
Sbjct  295   IIQEKAEEVSNHIYDFIKNF  314



>gb|KDP28186.1| hypothetical protein JCGZ_13957 [Jatropha curcas]
Length=319

 Score =   423 bits (1087),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 195/321 (61%), Positives = 240/321 (75%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH  V  NGINMHVA IG GPA+LFLHGFPELWY+WRHQ+L L++ GYR IAPDLR
Sbjct  1     MEKIQHIRVPTNGINMHVATIGTGPAILFLHGFPELWYSWRHQLLHLSALGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD P S   Y+ FHIVGDL+ LLDAL + +VFLVGHDWG+IIAW FC+FRPDRIKA
Sbjct  61    GYGDTDVPASVSEYTGFHIVGDLIGLLDALGIEQVFLVGHDWGSIIAWYFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHP-TRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             LVN SV  +PR P    P+EN+R   GDD+Y+CRFQ P E E  F  ++  +L ++  T 
Sbjct  121   LVNTSVAFTPRFPQLLNPVENLRAIIGDDYYVCRFQGPIEHEAQFAGVNTASLLRSIYTA  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             RDP+PPRIP     + L+       SLP WL+++DI Y+ATKF Q+GFTGGLNYYRN   
Sbjct  181   RDPKPPRIPKNIAYESLFPD--SLCSLPSWLSEEDIDYFATKFKQTGFTGGLNYYRNLKS  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
              WEL A W+G Q++VPVKFIVGD D  Y+ PGVKE ++ GG K  VP L++VV+MEGVAH
Sbjct  239   TWELMAPWTGQQVKVPVKFIVGDLDTAYNLPGVKEYVNNGGFKNDVPLLEEVVIMEGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +I QEK +E++ HI +FI+ F
Sbjct  299   FIIQEKAQEISQHIYDFIKKF  319



>ref|XP_010269590.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nelumbo nucifera]
Length=318

 Score =   422 bits (1086),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 242/320 (76%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  VSVNGINMH+AE G+GP VLF+HGFPELWY+WRHQ++ LA++GYRA+APDLR
Sbjct  1     MEGIEHRMVSVNGINMHIAEKGEGPVVLFIHGFPELWYSWRHQIVALAARGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPS  SYSVFHIVGDL+ALL+ L   +VF+VGHDWGAIIAW  C+FRPDR+KA
Sbjct  61    GYGDTDAPPSITSYSVFHIVGDLIALLNILGQDQVFVVGHDWGAIIAWYLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV   PR+P  K ++ +R  FGD++YICRFQ+PGE E  F     T + K FLT +
Sbjct  121   LVNLSVSFMPRNPAGKTVQRLRAAFGDNYYICRFQEPGEIEAEFAQAGATKIMKYFLTYK  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                P  +P  S+  +      +   LPPWLT++D+ YYATKF Q GFTGGLNYYR  D  
Sbjct  181   KTGPLILPKGSIRGL--HDAPQVDELPPWLTEEDVNYYATKFEQKGFTGGLNYYRALDLT  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WE+TA W+  Q++VP KFIVGDQD+TY  PG KE IH GG K+ VP LQ+VVVMEGV H+
Sbjct  239   WEITAPWTNVQVKVPAKFIVGDQDVTYTTPGAKEYIHGGGFKRDVPFLQEVVVMEGVGHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
             I QE+ +E++ HI +FIQ F
Sbjct  299   ITQERADEISAHIHDFIQKF  318



>ref|XP_008223222.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Prunus mume]
Length=323

 Score =   422 bits (1085),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 195/324 (60%), Positives = 250/324 (77%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME ++H TV VNGINMH+AE G GP +LFLHGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  4     MEGVEHRTVQVNGINMHIAEKGQGPLILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  63

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP S  SY+  H++GDLVALLDA+     +VF+VGHDWGA+IAW  C+FRPDR+
Sbjct  64    GFGDTDAPDSPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGALIAWYLCLFRPDRV  123

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVNMSVV  PR+P RK LE+++  +GDD+YICRFQ+PG  E  F  I    + K FLT
Sbjct  124   KALVNMSVVFPPRNPRRKTLESLKAVYGDDYYICRFQEPGVIEAEFAKIGTARVMKEFLT  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
              R+P P  +P      +++    +  + LP WL++ ++ YYA+KF ++GFTGG+NYYRN 
Sbjct  184   YRNPGPLFLP----KDIMFGHPPDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNL  239

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             + NWEL AAW+G+Q++VPVKFIVGDQDLTY+  G K+ IH+GG KK VP L++VVVMEGV
Sbjct  240   NLNWELIAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKCVPLLEEVVVMEGV  299

Query  267   AHYINQEKPEEVNNHILEFIQNFH  196
             AH+INQE+P+E+N HI +FI  FH
Sbjct  300   AHFINQERPDEINKHIHDFIAKFH  323



>ref|XP_009111297.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=315

 Score =   422 bits (1084),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 243/320 (76%), Gaps = 5/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TVS NGINMHVA IG GP VLFLHGFP+LWY+WRHQ+L  A  GYRAIAPDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+D+PPS +SY++ HIVGDLV LLD+L + +VFLVGHDWGAIIAW  CM RPDR+KA
Sbjct  61    GYGDSDSPPSHESYTLLHIVGDLVGLLDSLGVDQVFLVGHDWGAIIAWWMCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PR+P+ K ++  +  FG+D+YICRFQ+PG+ EE F  +D   L   F T+ 
Sbjct  121   LVNMSVEFHPRNPSVKTVDAFKALFGEDYYICRFQEPGDIEEDFAQVDTKKLVNGFFTSH  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             + RPP IP +SV + L     +  +LP W T+QD+ +YA KF Q GFTGGLNYYR  + +
Sbjct  181   NTRPPCIP-KSVFRYL----PDPPALPGWFTEQDVCFYADKFSQKGFTGGLNYYRAMNLS  235

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W G QI+VPVK+I GD D TYH PG KE IHEGGLKK VP LQ+VVVMEGV H+
Sbjct  236   WELTAPWDGLQIKVPVKYITGDLDPTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHF  295

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+E+ +HI  F + F
Sbjct  296   LQQEKPKEITDHIYGFFKKF  315



>emb|CDY65635.1| BnaAnng20800D [Brassica napus]
Length=315

 Score =   421 bits (1083),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 243/320 (76%), Gaps = 5/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TVS NGINMHVA IG GP VLFLHGFP+LWY+WRHQ+L  A  GYRAIAPDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+D+PPS +SY++ HIVGDLV LLD+L + +VFLVGHDWGAIIAW  CM RPDR+KA
Sbjct  61    GYGDSDSPPSHESYTLLHIVGDLVGLLDSLGVDQVFLVGHDWGAIIAWWMCMIRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PR+P+ K ++  +  FG+D+YICRFQ+PG+ EE F  +D   L   F T+ 
Sbjct  121   LVNMSVEFHPRNPSVKTVDAYKALFGEDYYICRFQEPGDIEEDFAQVDTKKLVNGFFTSH  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             + RPP IP +SV + L     +  +LP W T+QD+ +YA KF Q GFTGGLNYYR  + +
Sbjct  181   NTRPPCIP-KSVFRYL----PDPPALPGWFTEQDVCFYADKFSQKGFTGGLNYYRAMNLS  235

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W G QI+VPVK+I GD D TYH PG KE IHEGGLKK VP LQ+VVVMEGV H+
Sbjct  236   WELTAPWDGLQIKVPVKYITGDLDPTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHF  295

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKP+E+ +HI  F + F
Sbjct  296   LQQEKPKEITDHIYGFFKKF  315



>ref|XP_007222764.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
 gb|EMJ23963.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
Length=320

 Score =   421 bits (1083),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 246/323 (76%), Gaps = 5/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ I+H TV VNGINMH+AE G GP +LF+HGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP S  SY+  H+VGDL+ALLD +     +VF+VGHDWGA IAW  C+FRPDR+
Sbjct  61    GFGDTDAPDSPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGAFIAWYLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVNMSV   PR+P RK LE+++  +GDD+Y+CRFQ+PG  E  F  I    + K FLT
Sbjct  121   KALVNMSVAFRPRNPQRKNLESLKAVYGDDYYMCRFQEPGVIEAEFAKIGTARVMKEFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  +P     ++        + LP WL++ ++ YYA+KF ++GFTGG+NYYRN D
Sbjct  181   YRNPGPLFLPKD---KMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLD  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTAAW+G+Q++VPVKFIVGDQDLTY+  G K+ IH+GG KK VP L++VVVMEGVA
Sbjct  238   LNWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVA  297

Query  264   HYINQEKPEEVNNHILEFIQNFH  196
             H+INQE+P+E+N HI +FI  FH
Sbjct  298   HFINQERPDEINKHIHDFIAKFH  320



>ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
 gb|EMJ23892.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
Length=323

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/323 (60%), Positives = 246/323 (76%), Gaps = 5/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ I+H TV VNGINMH+AE G GP +LF+HGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  4     MDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  63

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP S  SY+  H++GDLVALLDA+     +VF+VGHDWGA IAW  C+FRPDR+
Sbjct  64    GFGDTDAPDSPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGAFIAWYLCLFRPDRV  123

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVNMSV   PR+P RK LE+++  +GDD+YICRFQ+PG  E  F  I    + K FLT
Sbjct  124   KALVNMSVAFLPRNPQRKSLESLKAVYGDDYYICRFQEPGVIEAEFAKIGTARVMKEFLT  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+  P  +P     ++        + LP WL++ ++ YYA+KF ++GFTGG+NYYRN D
Sbjct  184   YRNSGPLFLPKD---KMFGHPLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLD  240

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTAAW+G+Q++VPVKFIVGDQDLTY+  G K+ IH+GG KK VP L++VVVMEGVA
Sbjct  241   LNWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVA  300

Query  264   HYINQEKPEEVNNHILEFIQNFH  196
             H+INQE+P+E+N HI +FI  FH
Sbjct  301   HFINQERPDEINKHIHDFIAKFH  323



>ref|XP_008454322.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Cucumis 
melo]
Length=316

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 238/320 (74%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ IQH T+  NGI MH+A +G+GP VL LHGFPELWY+WRHQ+L+L+S GYRAIAPDLR
Sbjct  1     MDAIQHTTIKTNGIKMHIASVGNGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD+P S  SY+  HIVGDLV  LD L + +VFLVGHDWGAIIAW FC+FRP+RIKA
Sbjct  61    GYGDTDSPESHTSYTALHIVGDLVGALDELGIEKVFLVGHDWGAIIAWYFCLFRPERIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV   PR+P    ++  R  +GDDFY+CRFQ PGEAE  F  ID   LFK  L+NR
Sbjct  121   LVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQVPGEAEADFACIDTAQLFKTTLSNR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
               + P +P +   + +        +LP WLT++DI YYA KF ++GFTG LNYYR FD  
Sbjct  181   STKAPCLPKEYGFRAIPPPE----NLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QIQVPVKFIVGD DLTYHF G KE IHEGG K+ VP L++VV++E   H+
Sbjct  237   WELTAPWTGVQIQVPVKFIVGDSDLTYHFKGAKEYIHEGGFKRDVPLLEEVVIVENAGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             +++EKP E+N HI +FI+ F
Sbjct  297   VHEEKPHEINTHIHDFIKKF  316



>ref|XP_008775993.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=318

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 243/322 (75%), Gaps = 5/322 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             +G   I H TV VNGI MHVAE G+GPAVL LHGFPEL Y+WRHQ+  LA++GYRAIAPD
Sbjct  2     EGASGISHRTVEVNGIRMHVAEKGEGPAVLLLHGFPELGYSWRHQIAGLAARGYRAIAPD  61

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGDTDAPP   SY++ H+VGDLVALLDAL L +VF+VGHDWGA +AW+ C+FRPDR+
Sbjct  62    LRGYGDTDAPPDVASYTICHLVGDLVALLDALSLSQVFVVGHDWGAFVAWHLCLFRPDRV  121

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV   PR P  KPL++ R  +GDD YI RFQ+PG AE  F  +   T+ + F T
Sbjct  122   KALVNLSVAFMPRKPAAKPLDDFRALYGDDSYISRFQEPGAAEAEFARLGTATVLRKFFT  181

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  IP        +    E ++LP WL+++DI Y+ +KF +SGFTG +NYYR FD
Sbjct  182   YRNPGPIFIPKDG-----WGSPNEHITLPSWLSEEDINYFKSKFEKSGFTGPINYYRCFD  236

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWEL A W+G+QI+VP KFI+GD DLTYHFP +++ IH+GG KK VP LQ+VVVMEGVA
Sbjct  237   LNWELAAPWTGAQIKVPAKFIIGDLDLTYHFPRMQDYIHKGGFKKDVPFLQEVVVMEGVA  296

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQEK +E+ +HI +FIQ F
Sbjct  297   HFINQEKAQEITDHIYDFIQKF  318



>ref|XP_010684348.1| PREDICTED: bifunctional epoxide hydrolase 2 [Beta vulgaris subsp. 
vulgaris]
Length=319

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 246/323 (76%), Gaps = 7/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVN-GINMHVAEIGDGP--AVLFLHGFPELWYTWRHQMLFLASKGYRAIAP  988
             M++I+H  + +N GINMH+AEIG+     +L LHGFPELWYTWRHQ+L L++ GYRA+AP
Sbjct  1     MDKIEHRNILLNNGINMHIAEIGEAKKGTILLLHGFPELWYTWRHQLLSLSAAGYRALAP  60

Query  987   DLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDR  808
             DLRGYGDTDAPP A+SY+ FH+VGDL++L+D   + ++FLVGHDWGAIIAW+F +FRPDR
Sbjct  61    DLRGYGDTDAPPCAESYTSFHVVGDLISLIDHFHIDQIFLVGHDWGAIIAWHFSLFRPDR  120

Query  807   IKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
             IKALVN+SV  +PR+PT KP+E +R + GDDFYICRFQ+PGE E+   SID   L K FL
Sbjct  121   IKALVNLSVPFTPRNPTLKPVERLRNSLGDDFYICRFQEPGEMEKELDSIDTAKLMKKFL  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
              +RDP PP  P   +A        + V+LP WL+++DI Y+A KF Q+GFTGGLNYYR+ 
Sbjct  181   VSRDPEPPCFPKGKLAAA----AEKPVTLPSWLSEEDINYFADKFKQTGFTGGLNYYRSM  236

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             D  WEL A W+G Q++VP KFI+G+ D+TY FP  K  IH GG+K+ VP L  VV+MEG 
Sbjct  237   DLTWELMAPWTGMQVKVPTKFILGELDITYRFPLTKNYIHNGGMKRDVPLLDDVVIMEGA  296

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH+INQE+PEE++ HIL++   F
Sbjct  297   AHFINQERPEEISKHILDYFDQF  319



>ref|XP_010649574.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
 emb|CBI22972.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 238/320 (74%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME ++H TV  NGIN+HVAE G+GP +LF+HGFPE WY+WRHQ+  LA  GYRA+APDLR
Sbjct  1     MEGVEHRTVKANGINIHVAEKGEGPIILFIHGFPESWYSWRHQIHALALLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAP    SY+  H+VGDL+ +LDA+   +VF+VGHDWGAIIAW  C+FRPDR+KA
Sbjct  61    GYGDSDAPSDVGSYTCLHVVGDLIGVLDAMGADKVFVVGHDWGAIIAWYLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV   PR+P  KPLE  R  +GDDFY+CRFQ+PG+ E     +   T  K+   NR
Sbjct  121   LVNMSVAYFPRNPMHKPLEIYRHLYGDDFYVCRFQEPGQIEIEIAEVGTATALKSIFANR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP PP +P     Q   +  G  + LPPWL ++++ +Y TKF ++GFTGG+NYYRNFDRN
Sbjct  181   DPSPPCLPKGKAFQ---DVSGAPIVLPPWLPEEEVNFYVTKFEETGFTGGINYYRNFDRN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+GSQI+VP KF+VGD DLTYHF G KE IH G  KK VP L++VVVMEGV H+
Sbjct  238   WELTAPWTGSQIKVPTKFMVGDMDLTYHFAGAKEYIHSGEFKKNVPLLEEVVVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             +++EK +E+N HI +F Q F
Sbjct  298   LHEEKADEINKHIHDFFQKF  317



>emb|CAZ86692.1| epoxide hydrolase 1 [Prunus persica]
Length=323

 Score =   420 bits (1079),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 245/323 (76%), Gaps = 5/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGINMH+AE G G  +LF+HGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  4     MEGIEHRTVQVNGINMHIAEKGQGLLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  63

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP S  SY+  H+VGDL+ALLD +     +VF+VGHDWGA IAW  C+FRPDR+
Sbjct  64    GFGDTDAPDSPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGAFIAWYLCLFRPDRV  123

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVNMSV   PR+P RK LE+++  +GDD+Y+CRFQ+PG  E  F  I    + K FLT
Sbjct  124   KALVNMSVAFRPRNPQRKNLESLKAVYGDDYYMCRFQEPGVIEAEFAKIGTARVMKEFLT  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  +P     ++        + LP WL++ ++ YYA+KF ++GFTGG+NYYRN D
Sbjct  184   YRNPGPLFLPKD---KMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLD  240

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTAAW+G+Q++VPVKFIVGDQDLTY+  G K+ IH+GG KK VP L++VVVMEGVA
Sbjct  241   LNWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVA  300

Query  264   HYINQEKPEEVNNHILEFIQNFH  196
             H+INQE+P+E+N HI +FI  FH
Sbjct  301   HFINQERPDEINKHIHDFIAKFH  323



>ref|XP_008784769.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=322

 Score =   419 bits (1077),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 242/320 (76%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M  I H  V VNGINMH+AE G+GP VL LHGFPELWY+WRHQ+L LA++GYRAIAPDLR
Sbjct  6     MAEISHRLVEVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALAARGYRAIAPDLR  65

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPP   SY++FH+VGDLVAL+  L   +VF+VGHDWGA++AW+ C+FRPD+++A
Sbjct  66    GFGDTDAPPDVSSYTMFHVVGDLVALIHTLGQEKVFVVGHDWGALVAWSLCLFRPDKVRA  125

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV   PR P RKP+E  R  +GDD+YIC FQ+PG  E  F  I    + K FLT  
Sbjct  126   LVNLSVAFRPRSPDRKPVETFRALYGDDYYICTFQEPGRTEAEFARIPTALVIKKFLTYH  185

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP P  +  ++      +K    ++LP WL+++D+ Y+A+KF +SGFTGGLNYYR  D N
Sbjct  186   DPGPVIVSKENGFAASPDKE---ITLPSWLSEEDVDYFASKFDKSGFTGGLNYYRALDLN  242

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFIVG+QDL Y+ PGVK+ IH+GG ++ VP L+ VVV+EG  H+
Sbjct  243   WELTAPWTGMQIKVPVKFIVGNQDLIYNIPGVKDYIHKGGFERDVPFLEDVVVIEGAGHF  302

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP+E+ +HI EFIQ F
Sbjct  303   INQEKPQEITDHIYEFIQKF  322



>ref|XP_004152244.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52822.1| Epoxide hydrolase 2 [Cucumis sativus]
Length=315

 Score =   418 bits (1074),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 241/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH+T+  NGIN+H+A IG GPA+LFLHGFPE+WYTWRHQ+LF AS+G+RAIAPDLR
Sbjct  1     MEKIQHSTIPTNGINIHLASIGSGPALLFLHGFPEIWYTWRHQLLFFASRGFRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+D PPS  SY+  HIVGDL+ LLD L++ +VFLVGHD GA IAW F +FRPDR+KA
Sbjct  61    GYGDSDVPPSPSSYTAHHIVGDLIGLLDHLEIDQVFLVGHDLGATIAWYFSIFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV  +PR P   PL  +R   GDDFYIC+FQ+PG AE   GS+D  T+ K FLT R
Sbjct  121   LVNLSVYHTPRIPEMPPLAIIRLFLGDDFYICKFQEPGVAEADLGSVDTATMMKKFLTLR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP  P  P    + +L        +LP WLT+ D+ YYA+KF ++GFTGGLNYYR  D  
Sbjct  181   DPSAPIAP-NGFSTLLATPE----TLPSWLTEDDVDYYASKFAKTGFTGGLNYYRALDLT  235

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+G++I+VP KFIVGDQDL YHFPG KE IH    K+ VP+L++VVV+EG AH+
Sbjct  236   WELTGPWTGAKIKVPTKFIVGDQDLVYHFPGAKEYIHGDSFKEDVPHLEEVVVIEGAAHF  295

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK +E+N+ I +FI  F
Sbjct  296   INQEKADEINSLIYDFITKF  315



>ref|XP_004156834.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2-like [Cucumis sativus]
Length=315

 Score =   417 bits (1072),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 241/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+IQH+T+  NGIN+H+A IG GPA+LFLHGFPE+WYTWRHQ+LF AS+G+RAIAPDLR
Sbjct  1     MEKIQHSTIPTNGINIHLASIGSGPALLFLHGFPEIWYTWRHQLLFFASRGFRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+D PPS  SY+  HIVGDL+ LLD L++ +VFLVGHD GA IAW F +FRPDR+KA
Sbjct  61    GYGDSDVPPSPSSYTAHHIVGDLIGLLDHLEIDQVFLVGHDLGATIAWYFSIFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV  +PR P   PL  +R   GDDFYIC+FQ+PG AE   GS+D  T+ K FLT R
Sbjct  121   LVNLSVYHTPRIPEMPPLAIIRLFLGDDFYICKFQEPGVAEADLGSVDTATMMKKFLTLR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP  P  P    + +L        +LP WLT+ D+ YYA+KF ++GFTGGLNYYR  D  
Sbjct  181   DPSAPIAP-NGFSTLLATPE----TLPSWLTEDDVDYYASKFAKTGFTGGLNYYRALDLT  235

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+G++I+VP KFIVGDQDL YHFPG KE IH    K+ VP+L++VVV+EG AH+
Sbjct  236   WELTGPWTGAKIKVPTKFIVGDQDLVYHFPGXKEYIHGDSFKEDVPHLEEVVVIEGAAHF  295

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK +E+N+ I +FI  F
Sbjct  296   INQEKADEINSLIYDFITKF  315



>ref|XP_009393200.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   417 bits (1071),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 194/319 (61%), Positives = 242/319 (76%), Gaps = 8/319 (3%)
 Frame = -1

Query  1155  ERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             E + H  V  NGI+MHVAE G+GPAVL LHGFPELWY+WRHQ+  LA++GYRAIAPDLRG
Sbjct  4     EGVAHRMVEANGISMHVAEKGEGPAVLLLHGFPELWYSWRHQIAGLAARGYRAIAPDLRG  63

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKAL  796
             YGDT AP +A SY+VFHIVGDL+ALLDAL +P+V+LVGHDWGA IAWN C+FRPDR+KAL
Sbjct  64    YGDTSAPSAAASYTVFHIVGDLIALLDALAIPQVYLVGHDWGAQIAWNLCLFRPDRVKAL  123

Query  795   VNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRD  616
             VN+SV   PR+P  KP ++ R  +GDDFY+CRFQ+PG  E  F  I    L +  L NR+
Sbjct  124   VNLSVPFMPRNPAGKPTQHFRSFYGDDFYVCRFQEPGAIEAEFARIGTGKLLRIVLCNRN  183

Query  615   PRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNW  436
               P       +++V +E     V+LP WL+++DI Y+A+K  +SGFTG +NYYR  D NW
Sbjct  184   AGP-----LLLSEVDFEAE---VALPSWLSEEDIDYFASKLDKSGFTGPVNYYRCLDLNW  235

Query  435   ELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYI  256
             EL A WSG QIQVPVKFI+GDQD+TYHFPG+KE I  GG ++ VP L++ VVMEGVAH+I
Sbjct  236   ELGAPWSGVQIQVPVKFIIGDQDMTYHFPGIKEYIQGGGFRRDVPMLEEAVVMEGVAHFI  295

Query  255   NQEKPEEVNNHILEFIQNF  199
             NQEK  E+ +HI +FI+ F
Sbjct  296   NQEKAPEITDHICDFIRRF  314



>ref|XP_009352305.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   417 bits (1071),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 190/322 (59%), Positives = 245/322 (76%), Gaps = 5/322 (2%)
 Frame = -1

Query  1155  ERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             E I+H TV VNGINMHVAE G GP +LF+HGFP+LWY+WRHQ+L L++ GYR +APDLRG
Sbjct  4     EGIEHRTVQVNGINMHVAEKGHGPLILFIHGFPDLWYSWRHQILALSALGYRTVAPDLRG  63

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGDTDAP S  SY+  H+VGDLVALLD +     +VF+V HDWG+IIAW  C+FRPDR+K
Sbjct  64    YGDTDAPASPSSYTCLHVVGDLVALLDTIAPDQEQVFVVAHDWGSIIAWYLCLFRPDRLK  123

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALV++SV  SPR+P RK +++++  +GDD+YICRFQ+PG  E  F  +  T + K FLT 
Sbjct  124   ALVSLSVAFSPRNPQRKIIKSLQAVYGDDYYICRFQEPGVIEAEFAQMGTTRILKEFLTY  183

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P  +P     +         + LP WL++ ++ YYATKF ++GFTGG+NYYRN D 
Sbjct  184   RNPGPLFLPK---GKGFGRPTDAPIVLPSWLSEDEVNYYATKFEKTGFTGGINYYRNLDL  240

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELT AW+G+Q++VPVKFIVGDQDL Y+ PG K+ IH+GG KK  P L+QVVVMEGVAH
Sbjct  241   NWELTTAWTGAQVKVPVKFIVGDQDLVYNSPGAKDFIHKGGFKKYAPLLEQVVVMEGVAH  300

Query  261   YINQEKPEEVNNHILEFIQNFH  196
             ++ QEKP+E+N HI +FI+NFH
Sbjct  301   FLQQEKPDEINTHIHDFIKNFH  322



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   436 bits (1121),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/318 (64%), Positives = 247/318 (78%), Gaps = 3/318 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  +  NGIN+HVAE+G+GPAVLFLHGFPELWY+WRHQMLFL+S+GYRAIAPDLR
Sbjct  1     MESIRHAMIPTNGINLHVAEVGEGPAVLFLHGFPELWYSWRHQMLFLSSRGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPSA  Y+ FHIVGDL+ LLDAL L  V LV HDWGA+IAW  C+ RPDRIKA
Sbjct  61    GYGDSDAPPSAAEYTAFHIVGDLIGLLDALGLDRVLLVAHDWGAVIAWYLCLMRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SVV SPR+PT KP+E+MR++ GDD+YIC+FQ+PG AE  F ++   TL K   T R
Sbjct  121   LVNTSVVYSPRNPTIKPIESMRKSLGDDYYICQFQEPGVAEREFAAMGAATLLKKLYTLR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
               +PPR P         EK    + LPPWL+++DIKYYA KF Q GFTGGLNYYR  D  
Sbjct  181   QAKPPRHPKGVGFGPPPEK---PIVLPPWLSEEDIKYYADKFDQKGFTGGLNYYRAVDLT  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA ++G QI+VP KFIVGD D TY+ PGVKE IH GG KK VP L++VV++EGV H+
Sbjct  238   WELTAPFTGLQIKVPAKFIVGDLDATYNTPGVKEYIHGGGFKKQVPFLEEVVILEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQ  205
             + +EKP+E+++HI +FI+
Sbjct  298   LIEEKPDELSHHIYDFIR  315



>gb|AAM28292.1| epoxide hydrolase [Ananas comosus]
Length=318

 Score =   415 bits (1066),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 244/323 (76%), Gaps = 8/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGD---GPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAP  988
             ME I H TV +NGI +HVAE G      AVL LHGFPELWY+WRHQ++ LA++GYRAIAP
Sbjct  1     MEGIVHRTVEINGIAVHVAEKGGDDAAAAVLLLHGFPELWYSWRHQIVGLAARGYRAIAP  60

Query  987   DLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDR  808
             DLRGYGDT APPS +SY++FH+VGD+VALLDAL+LP+VF+VGHDWGA IAW  CM RPDR
Sbjct  61    DLRGYGDTSAPPSVNSYTLFHLVGDVVALLDALELPQVFVVGHDWGAAIAWTLCMIRPDR  120

Query  807   IKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
             +KALVN SV   PR+P+  P+  ++  +GD+ Y+CRFQ+PG AE  F  +    + +  L
Sbjct  121   VKALVNTSVAHMPRNPSVSPVHQIKHLYGDNIYVCRFQEPGVAEAEFAEVGTKNVLRKIL  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T RDPRP  + H+      +   GE ++LP WL+++D+ YYA+KF ++GFTGG+NYYR  
Sbjct  181   TMRDPRPSSLTHKD-----WGSTGEEIALPSWLSEEDLDYYASKFEKTGFTGGMNYYRCM  235

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             + NWELTA W+G++IQVP KFIVGD DLTYH+P +++ IH+GG K  VP L++VVV+EGV
Sbjct  236   NLNWELTAPWAGAKIQVPTKFIVGDLDLTYHYPNIQDYIHKGGFKNEVPLLEEVVVLEGV  295

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
              H+I QE+ EEV +HI  FI+ F
Sbjct  296   GHFIQQERAEEVTDHIYNFIKKF  318



>ref|XP_010038233.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50057.1| hypothetical protein EUGRSUZ_K03498 [Eucalyptus grandis]
Length=331

 Score =   415 bits (1067),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/330 (61%), Positives = 240/330 (73%), Gaps = 12/330 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGP-AVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME+IQH TV  NGINMHVA +G+GP  +LFLHGFPELWY+WRHQM+ LA+ GYRA+APDL
Sbjct  1     MEKIQHATVRTNGINMHVASVGEGPDTILFLHGFPELWYSWRHQMVSLAALGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYG TDAPPS +SY+ FH+VGD+V LLDAL +  VF+VGHDWGAIIAW  C+ RPDR+K
Sbjct  61    RGYGGTDAPPSVESYAAFHVVGDVVGLLDALGIGRVFVVGHDWGAIIAWCLCLLRPDRVK  120

Query  801   ALVNMSV------VISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLF  640
             ALVN SV      +  P  P RKP+E  R  +GDD+YIC FQ+PGE EE F   D   L 
Sbjct  121   ALVNTSVTWFRRLMWFPSDPERKPVETARAMYGDDYYICSFQKPGEIEEDFAKADTAVLM  180

Query  639   KAFLTNRDPRPPRIPHQ---SVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGG  469
             K  LTNR+P P R+P     S    L+E+    V LP WLT+ DIKY+A +F ++GFTG 
Sbjct  181   KVILTNRNPSPLRVPKDLGFSGLIKLFEQH--QVELPSWLTEDDIKYFAAEFSRTGFTGA  238

Query  468   LNYYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQ  289
             +NYYR  D + EL A W G  I+VP KFIVGD DLTYH PGVKE IH  G K+ VPNL+Q
Sbjct  239   VNYYRCLDLSSELLAPWDGVPIKVPTKFIVGDLDLTYHIPGVKEYIHGDGFKRAVPNLEQ  298

Query  288   VVVMEGVAHYINQEKPEEVNNHILEFIQNF  199
             VVVMEGVAH++ QEKPEEV  HI +F + F
Sbjct  299   VVVMEGVAHFLQQEKPEEVTAHIHDFFKKF  328



>gb|KGN66047.1| hypothetical protein Csa_1G569240 [Cucumis sativus]
Length=317

 Score =   414 bits (1065),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 237/320 (74%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ I H TVSVNGINMH+AE G+GP VLF+HGFPELWYTWRHQ+L L+S GY A+APDLR
Sbjct  1     MDTISHRTVSVNGINMHIAEKGEGPIVLFIHGFPELWYTWRHQILALSSLGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAP S  SYS+ HIVGDLVAL+++  + EVF+V HDWGA+IAW+ C+FR + +KA
Sbjct  61    GYGDSDAPDSISSYSIMHIVGDLVALVESFGVKEVFVVAHDWGALIAWSLCLFRAEMVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PRHP RKP+E MR  FGDD+YICRFQ PGE EE    +    + +  LT R
Sbjct  121   FVCLSVPFRPRHPNRKPVETMRMVFGDDYYICRFQNPGEIEEEMAQVGAKDVLRGILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                PP  P +   Q    + G    LP WL+++D+ Y+A+K+ Q GFTG LNYYR+ D N
Sbjct  181   RQGPPIYPKK---QAFRARAGPPSPLPSWLSEEDLSYFASKYEQKGFTGPLNYYRSMDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G Q++VPVKFIVGD D+ Y  PGVKE ++ GG KK VP LQ VVVM+GV H+
Sbjct  238   WELTAPWTGVQVKVPVKFIVGDVDMVYTTPGVKEYVNGGGFKKDVPFLQDVVVMDGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             +NQEKPEE+N HI +FI+ F
Sbjct  298   LNQEKPEEINTHIYDFIKKF  317



>ref|XP_010914488.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   414 bits (1064),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 200/322 (62%), Positives = 250/322 (78%), Gaps = 6/322 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             +G   I H TV VNGI MHVAE G+GP+VL LHGFPELWY+WRHQ+  LA++GYRAIAPD
Sbjct  2     EGASGISHRTVEVNGIRMHVAEKGEGPSVLLLHGFPELWYSWRHQIAGLAARGYRAIAPD  61

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGDTDAPP   SYS+FHIVGDLVALLDAL L  VF+VGHDWGA+IAWN CMFRPDR+
Sbjct  62    LRGYGDTDAPPDVASYSIFHIVGDLVALLDALALQHVFVVGHDWGALIAWNLCMFRPDRV  121

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV   PR+P +KP++  R  +GDD+Y+CRFQ+PG  E  F  I+  ++F+ FL 
Sbjct  122   KALVNLSVAFMPRNPAKKPVDYFRHLYGDDYYVCRFQEPGAIEAKFAQIETASIFRMFLP  181

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +RDP P  +P +           E + LP WL+++DI ++A+KF +SGFTG +NYYR  +
Sbjct  182   SRDPGPLLMPKEG------WNVPEKIPLPSWLSEEDINFFASKFDKSGFTGPVNYYRCLN  235

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTA W+G+QI+VPVKFIVGD DLTYH+PG+++ IH+GG K+ VP LQ+VVVMEGV 
Sbjct  236   LNWELTAPWTGAQIKVPVKFIVGDLDLTYHYPGIQDYIHKGGFKQNVPLLQEVVVMEGVG  295

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQEK  E+ +HI EFIQ F
Sbjct  296   HFINQEKAHEITDHIYEFIQKF  317



>gb|EPS62395.1| hypothetical protein M569_12392 [Genlisea aurea]
Length=318

 Score =   413 bits (1062),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 239/320 (75%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H+T+  NGIN+HVAEIGDGPAVLFLHGFP LWYTWRHQMLFL+SKGYRAIAPDLR
Sbjct  1     MESIRHSTIPTNGINLHVAEIGDGPAVLFLHGFPGLWYTWRHQMLFLSSKGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYG +D PPS  SY++FH+VGDLV LLD L + +VFLVGHDWG+I+AW F +FRPDR+KA
Sbjct  61    GYGGSDVPPSPSSYTIFHVVGDLVGLLDGLGVDKVFLVGHDWGSIVAWYFSLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LV+ S+   PRHP  + ++ +R+  GDDFYI +FQ+PG AE  F + D + L     T+R
Sbjct  121   LVSTSIEFKPRHPAVRTVDFLRQKLGDDFYIVKFQEPGLAEAEFAAADTSKLLTKIFTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP PPR    S       +  + + LPPWL++ D+KYYA  F ++GFTGGLN++R  D N
Sbjct  181   DPNPPRRSKGSAGFGTLPE--DPIPLPPWLSEDDVKYYADAFDKTGFTGGLNHFRALDLN  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+ +++ VP K IVGD D++Y+ PGVKE +H GG K+ VP L +VVV++GVAH+
Sbjct  239   WELTGPWTAAEVGVPAKLIVGDLDISYNTPGVKEYVHGGGFKRDVPLLHEVVVLDGVAHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
             +N+E P EVN HI  FI  F
Sbjct  299   LNEESPHEVNRHIYNFIAKF  318



>ref|XP_008454325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=324

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 240/320 (75%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+  NGINMHVA IG GPAVLFLHGFP+LWY+WRHQ+LFLASKG+RA+APDLR
Sbjct  1     MEKIEHTTIPTNGINMHVASIGSGPAVLFLHGFPQLWYSWRHQLLFLASKGFRALAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS  SY+  HI+GDL+ LLD L L +VFLVGHDWGA+IAW FC+FRPDR+KA
Sbjct  61    GFGDTDAPPSPSSYTFLHIIGDLIGLLDHLGLEKVFLVGHDWGAMIAWYFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV    RHP+   ++  R   GD+FYIC+FQ+ G AE  FG +D  T+ K F+  R
Sbjct  121   LVNLSVYYIKRHPSISFVDGFRAVAGDNFYICQFQEAGVAEADFGRVDTATMMKKFMGMR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP  P I  +      +        LP WLT++DI ++ATKF ++GFTGG NYYR  + +
Sbjct  181   DPEAPLIFTKEKG---FSSMETPDPLPCWLTEEDIDFFATKFSKTGFTGGFNYYRALNLS  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTAAW+GS+I+VPVKFIVGD DL YHFPG K+ IH G  KK VP L++VVV++  AH+
Sbjct  238   WELTAAWNGSKIEVPVKFIVGDLDLVYHFPGAKQYIHGGEFKKDVPFLEEVVVIKDAAHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             I+QEKP ++N+ I  FI  F
Sbjct  298   IHQEKPHQINSLIYHFINKF  317



>ref|XP_008789846.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   413 bits (1062),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/326 (61%), Positives = 250/326 (77%), Gaps = 15/326 (5%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV+VNGINMH+AE G+GP VLF+HGFPELWY+WRHQM+ LA +GYRA+APDLR
Sbjct  1     MEGITHRTVAVNGINMHIAEKGEGPMVLFVHGFPELWYSWRHQMVALAGRGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAPPSA  Y++FH+VGDLVALLDAL L +VF+VGHDWGA++AW  CM RPDR++A
Sbjct  61    GYGDTDAPPSATDYTIFHLVGDLVALLDALALDQVFVVGHDWGAVVAWWLCMLRPDRVRA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  SPR+P R+P++++R  FGDD YICRFQ+PG  E  F  I    L K FL  R
Sbjct  121   LVNMSVAFSPRNPARRPVDSLRALFGDDHYICRFQEPGAVEAEFARISTALLLKKFLAYR  180

Query  618   DPRPPRIPHQSVAQVLYEKRG------ETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYY  457
              P          A ++ +++G        ++LP WLT++D+ YY +KF +SGFTGGLNYY
Sbjct  181   KPE---------ALLVSKEKGFGGSPDTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYY  231

Query  456   RNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVM  277
             R  + NWELTA W+G QI+VPVKFIVGD DLTYH PG+++ +H+GG K+ VP L  VVVM
Sbjct  232   RCLNLNWELTAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDYLHKGGFKRDVPFLHDVVVM  291

Query  276   EGVAHYINQEKPEEVNNHILEFIQNF  199
             +GV H++NQEKP E+++HI EFIQ F
Sbjct  292   QGVGHFLNQEKPHEISDHIYEFIQKF  317



>ref|XP_004152242.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156832.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52825.1| hypothetical protein Csa_4G001920 [Cucumis sativus]
Length=316

 Score =   412 bits (1059),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 237/320 (74%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ IQH T++ NGI MH+A IG+GP VL LHGFPELWY+WRHQ+L+L+S GYRAIAPDLR
Sbjct  1     MDAIQHTTINTNGIKMHIASIGNGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD+P S  SY+  HIVGDL+  LD L + +VFLVGHDWGAIIAW FC+FRP+RIKA
Sbjct  61    GYGDTDSPGSHTSYTALHIVGDLIGALDELGIEKVFLVGHDWGAIIAWYFCLFRPERIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV   PR+P    ++  R  +GDDFY+CRFQ PGEAE  F  ID   LFK  L+ R
Sbjct  121   LVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQVPGEAEADFACIDTAQLFKTTLSTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                 P +P +   + +        +LP WLT++DI YYA KF ++GFTG LNYYR FD  
Sbjct  181   STEAPCLPKEYGFRAIPPPE----NLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QIQVPVKFIVGD D+TYHF G KE IH+GG K+ VP L++VV+++   H+
Sbjct  237   WELTAPWTGVQIQVPVKFIVGDLDITYHFKGAKEYIHDGGFKRDVPLLEEVVIVKNAGHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             +++EKP E+N HI +FI+ F
Sbjct  297   VHEEKPHEINTHIHDFIKKF  316



>ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY06567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=396

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 247/316 (78%), Gaps = 7/316 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  V+VNGINMHVAE G GP +LFLHGFPELWY+WRHQ+   AS GY+A+APDL 
Sbjct  74    MEEIEHRIVNVNGINMHVAEKGKGPVILFLHGFPELWYSWRHQITAFASLGYQAVAPDLC  133

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLD--ALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             GYGDTDAP +A SY+V ++VGDLVALLD  A +  +VF+VGHDWGA+IAW  C+ RPDR+
Sbjct  134   GYGDTDAPDAASSYTVLNVVGDLVALLDVVAPEQDKVFVVGHDWGALIAWWLCLVRPDRV  193

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVNMSVV SPR+P RKPLE++R  +GDD+YICRFQ PGE E  F  +    + K FLT
Sbjct  194   KALVNMSVVFSPRNPKRKPLESLRAFYGDDYYICRFQAPGEIEAEFAELGFERVLKGFLT  253

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPP-WLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
              R+P P  +P        + +    +SLPP WL+++D+KYY +++ + GFTGGLNYYRN 
Sbjct  254   YRNPGPLLLPKGK----YFGQPDTPISLPPNWLSEEDVKYYISQYEKKGFTGGLNYYRNI  309

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             D NWELTA W+GSQ++VPVKFIVGDQDLTY+ PG K+ I +GGLK+ VP L+QVVVMEGV
Sbjct  310   DLNWELTAPWTGSQVKVPVKFIVGDQDLTYNAPGTKDYIQKGGLKRDVPFLEQVVVMEGV  369

Query  267   AHYINQEKPEEVNNHI  220
             AH++++EKP+E+N H+
Sbjct  370   AHFLHEEKPDEINKHM  385



>ref|XP_004296863.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   412 bits (1059),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 192/322 (60%), Positives = 239/322 (74%), Gaps = 5/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGINMHVAE G GP +LF+HGFPELWY WRHQ+  LA+ GYRA+APDLR
Sbjct  1     MEGIEHRTVKVNGINMHVAEKGQGPVILFIHGFPELWYCWRHQIQALAAVGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRI  805
             GYGDTDAP    SY+  H+VGDLVALLDA+   +  VF+VGHDWGA+IAW  C+FRPDR+
Sbjct  61    GYGDTDAPADQSSYTCLHVVGDLVALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV  SPR+P RK  E +R  +GDD+Y+CRFQ+PGE E  F  I    + K FLT
Sbjct  121   KALVNLSVAFSPRNPQRKTTEMLRAVYGDDYYMCRFQEPGEIEAEFAQIGTARVMKEFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R P P  +P     +         + LP WL++ D+ YY + F + GFTGG+NYYRNFD
Sbjct  181   YRHPGPLFLPK---GKGFRHPPDAPIPLPSWLSEDDVNYYVSFFEKKGFTGGINYYRNFD  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             RNWELTA W+G++I+VPVKFIVGDQDL Y+  G K+ IH+GG KK VP L++VVVMEGV 
Sbjct  238   RNWELTAPWTGARIKVPVKFIVGDQDLVYNSLGAKDFIHKGGFKKYVPLLEEVVVMEGVG  297

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+IN+E+P E++ HI +FI+ F
Sbjct  298   HFINEERPNEISEHIHDFIKKF  319



>ref|XP_006489040.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=375

 Score =   414 bits (1064),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 243/321 (76%), Gaps = 5/321 (2%)
 Frame = -1

Query  1155  ERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             E IQH  V+VNGINMHVAE G GP +LF+HGFP LWY+WRHQ+  LAS GYRA+APDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSWRHQIAALASLGYRAVAPDLRG  117

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGDTDAP    SY+  H+VGD++ALLDA+   +  VF+VGHDWGA+IAW  C+FRPDR+K
Sbjct  118   YGDTDAPAEVSSYTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDRVK  177

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN+SVV +PR+P  KPL+  +  +GDD+YICRFQ+PGE E  F  +   T+ K FLT 
Sbjct  178   ALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLTY  237

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P  +P     +         + LP WL+++D+KYYA+K+ ++GFTGG+NYYRN + 
Sbjct  238   RNPGPLFLPK---GKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIEL  294

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWEL A W+G+QI+VPVKFIVGD DLTY+ PG K+ I++GG KK VP L++V+VMEGV H
Sbjct  295   NWELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGH  354

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +IN+EKP+EVN HI  F Q F
Sbjct  355   FINEEKPDEVNKHIYNFFQKF  375



>gb|KDO71745.1| hypothetical protein CISIN_1g017221mg [Citrus sinensis]
Length=375

 Score =   414 bits (1063),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 244/321 (76%), Gaps = 5/321 (2%)
 Frame = -1

Query  1155  ERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             E IQH  V+VNGINMHVAE G GP +LF+HGFP LWY+WRHQ+  LAS GYRA+APDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSWRHQITALASLGYRAVAPDLRG  117

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGDTDAP    SY+  H+VGD++ALLDA+   +  VF+VGHDWGA+IAW  C+FRPDR+K
Sbjct  118   YGDTDAPAEVPSYTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDRVK  177

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN+SVV +PR+P  KPL+  +  +GDD+YICRFQ+PGE E  F  +   T+ K FLT 
Sbjct  178   ALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLTY  237

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P  +P     +         ++LP WL+++D+KYYA+K+ ++GFTGG+NYYRN + 
Sbjct  238   RNPGPLFLPK---GKGFGHPPDAQIALPSWLSEEDVKYYASKYEKAGFTGGINYYRNIEL  294

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWEL A W+G+QI+VPVKFIVGD DLTY+ PG K+ I++GG KK VP L++V+VMEGV H
Sbjct  295   NWELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGH  354

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +IN+EKP+EVN HI  F Q F
Sbjct  355   FINEEKPDEVNKHIYNFFQKF  375



>ref|XP_004290776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   411 bits (1057),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 190/322 (59%), Positives = 241/322 (75%), Gaps = 4/322 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T+ VNGINMHVAE G GP +LFLHGFPELWY WRHQM  LAS GYRA+APDLR
Sbjct  1     MEGIEHKTIKVNGINMHVAEKGQGPVILFLHGFPELWYCWRHQMHALASLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP  A SY+  H+VGDL+ALLDA+   +  VF+VGHDWGA+IAW+ C+FRPDR+
Sbjct  61    GFGDTDAPAEASSYTCLHVVGDLIALLDAVAADQEKVFVVGHDWGAVIAWHLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV  +PR+P  KP+  ++  +G D+Y+CRFQ+ G+ E+   S+    + K FL+
Sbjct  121   KALVNLSVAFTPRNPQFKPVPALKAVYGGDYYMCRFQEEGDIEDELASLGCDRVMKEFLS  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             NR+P P  +P               V+LP WL++ DI YYA+ F + GFTG LNY+RN D
Sbjct  181   NRNPGPLMLPKGK--GFGNASPDAPVTLPSWLSEDDIHYYASNFEKKGFTGALNYFRNLD  238

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             RNWELTA W+GS+I VPVKFIVGDQDL Y+  G K+ IH+GG KK VP L++VVVMEGVA
Sbjct  239   RNWELTAPWTGSKILVPVKFIVGDQDLVYNSMGAKDYIHKGGFKKYVPLLEEVVVMEGVA  298

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+IN+E+PEE+N HI +F + F
Sbjct  299   HFINEERPEEINQHIYDFFKKF  320



>ref|XP_010102979.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB94546.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   411 bits (1057),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 242/320 (76%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H+T++ NGIN+HVA IG GPA+LFLHGFPELW++WRHQML L++ GYR IAPDLR
Sbjct  1     MDKIEHSTITTNGINIHVASIGTGPAILFLHGFPELWHSWRHQMLSLSALGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPPS  SYSV HIVGDLV LLD L L +VFLVGHDWGA +AW FC+FRPDRIKA
Sbjct  61    GYGDSDAPPSPASYSVHHIVGDLVGLLDHLSLDKVFLVGHDWGAYMAWFFCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             +VN+SV   PR+P    ++  R  FGDDFY CRFQ+PGE E+ F S D  T+ K   T+ 
Sbjct  121   VVNLSVAFMPRNPRINLVDGFRAFFGDDFYFCRFQEPGEIEKDFASDDTATVLKKLYTSF  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                   IP     ++ ++      +LP WL+++DI Y A+KF Q GFTGGLNYYR  +  
Sbjct  181   GATHLFIP----KELGFKGLKAPDTLPSWLSEEDINYSASKFEQKGFTGGLNYYRAANLT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+G+Q++VP KFIVGD+D TYHFPGVK+ I  GG KK VP+L++VV++EGVAH+
Sbjct  237   WELLAPWTGAQVKVPAKFIVGDEDTTYHFPGVKQYIESGGFKKDVPSLEEVVIVEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQ KPEE++ HI +FI+ F
Sbjct  297   INQAKPEEISTHIYDFIKKF  316



>ref|XP_006419515.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
 gb|ESR32755.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
Length=375

 Score =   413 bits (1062),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 242/321 (75%), Gaps = 5/321 (2%)
 Frame = -1

Query  1155  ERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             E IQH  V+VNGINMHVAE G GP +LF HGFP LWY+WRHQ+  LAS GYRA+APDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFFHGFPLLWYSWRHQIAALASLGYRAVAPDLRG  117

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGDTDAP    SY+  H+VGD++ALLDA+   +  VF+VGHDWGA+IAW  C+FRPDR+K
Sbjct  118   YGDTDAPAEVSSYTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDRVK  177

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN+SVV +PR+P  KPL+  +  +GDD+YICRFQ+PGE E  F  +   T+ K FLT 
Sbjct  178   ALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLTY  237

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P P  +P     +         + LP WL+++D+KYYA+K+ ++GFTGG+NYYRN + 
Sbjct  238   RNPGPLFLPK---GKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIEL  294

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWEL A W+G+QI+VPVKFIVGD DLTY+ PG K+ I++GG KK VP L++V+VMEGV H
Sbjct  295   NWELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGH  354

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +IN+EKP+EVN HI  F Q F
Sbjct  355   FINEEKPDEVNKHIYNFFQKF  375



>gb|KEH24510.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   410 bits (1055),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 239/321 (74%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEEIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQISALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S  SY++FH+VGD+VAL+D+L +  VFLV HDWGAII W  C+FRP+RIK
Sbjct  61    RGYGDTDAPASISSYTIFHLVGDIVALIDSLGVDRVFLVAHDWGAIIGWYLCLFRPERIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  KP++ MR  +GDD+YICRFQ+PG+ E          L KA LT+
Sbjct  121   AYVCLSVPYLPRNPKLKPVDGMRAVYGDDYYICRFQEPGKMEAEIAKGSSELLIKAMLTS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+P PP +P + +    +     T+ LP WLT +D+ YYA+KF Q+GF+GGLNYYRNF+ 
Sbjct  181   RNPGPPILPKEGILS--HPSVSSTMPLPSWLTLEDVAYYASKFEQTGFSGGLNYYRNFNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+GS I+VPVKFI+GD DL Y   G K+ I  GG K  VPNL++VV+ +GVAH
Sbjct  239   NWELTAAWTGSHIKVPVKFIIGDLDLVYTSFGTKQYIESGGFKNDVPNLEEVVIQKGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++NHI +FI+ F
Sbjct  299   FNNQEAAEEISNHIYDFIKKF  319



>ref|XP_004152361.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156886.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52823.1| hypothetical protein Csa_4G001900 [Cucumis sativus]
Length=322

 Score =   410 bits (1054),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 242/320 (76%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H T+  NGINMHVA IG GPAVLFLHGFP+LWY+WRHQ+LFLASKG+RA+APDLR
Sbjct  1     MEKIEHTTIPTNGINMHVASIGSGPAVLFLHGFPQLWYSWRHQLLFLASKGFRALAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAPPS  SY+  HI+GDL+ LLD   L +VFLVGHDWGA+IAW FC+FRPDR+KA
Sbjct  61    GFGDTDAPPSPSSYTFHHIIGDLIGLLDHFGLDKVFLVGHDWGAVIAWYFCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV    RHP+   ++  R + G++FYIC+FQ+ G AE  FGS+D  T+ K F+  R
Sbjct  121   LVNLSVHYLKRHPSINFVDGFRASAGENFYICQFQEAGVAEADFGSVDTATMMKKFMGMR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             DP  P  P  +  +  +        LP WLT++D+ ++A+KF ++GFTGG NYYR  + +
Sbjct  181   DPVAP--PIYNTKEKGFSSLETPNPLPCWLTEEDVDFFASKFSKTGFTGGFNYYRALNLS  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTAAW+GS+I+VPVKFIVGD DL YHFPG KE I+ G  KK VP L++VVV++  AH+
Sbjct  239   WELTAAWNGSKIEVPVKFIVGDLDLVYHFPGAKEYINGGEFKKDVPFLEEVVVIKDAAHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP ++N+ I  FI  F
Sbjct  299   INQEKPHQINSLIYHFINKF  318



>ref|XP_004134492.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004162212.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN57130.1| hypothetical protein Csa_3G164490 [Cucumis sativus]
Length=324

 Score =   409 bits (1052),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 248/323 (77%), Gaps = 4/323 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGD-GPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             +  I+H T+++NGIN+H+AE G+ GP +LF+HGFPELWY+WRHQ+L L+S+GYRA+APDL
Sbjct  3     LSSIRHTTLNLNGINLHIAEKGESGPLILFIHGFPELWYSWRHQILDLSSRGYRAVAPDL  62

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDR  808
             RGYGD+D+PPS + Y+ FHIVGDL+AL+DAL   E  VF+VGHDWGA+IAWN CM+RPDR
Sbjct  63    RGYGDSDSPPSVNDYTCFHIVGDLIALIDALVGVEEKVFVVGHDWGAVIAWNLCMYRPDR  122

Query  807   IKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
             +KALVN SV  + R P RKP+E+++  +GDD+YICRFQ+PGE E  F  I    +    L
Sbjct  123   VKALVNTSVTFNRRSPKRKPIESLKALYGDDYYICRFQEPGEIEAEFAEIGTERIMTEIL  182

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             + R P+P  +P +   +         +SLPPWL +QD+ YY +KF ++GFTG +NYYRN 
Sbjct  183   SYRTPKPLMMP-KGRGKGKDHPLDTPISLPPWLAKQDMDYYVSKFDKNGFTGPINYYRNL  241

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             DRNWEL A+++G+Q++VP KFIVGDQDLTYH  G K+ I  G +KK VP L++VVVMEGV
Sbjct  242   DRNWELNASFTGAQVKVPTKFIVGDQDLTYHSFGAKQYIQSGEMKKDVPFLEEVVVMEGV  301

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
              H++ +EKP E++NHI EFI+N+
Sbjct  302   GHFLQEEKPHEISNHIYEFIKNY  324



>ref|XP_002271210.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   408 bits (1049),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 185/320 (58%), Positives = 237/320 (74%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH TV  NGIN+H+AE G GP +LFLHGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MEEIQHRTVEANGINIHIAEKGQGPIILFLHGFPELWYSWRHQIHALASLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GDTDAP    SY+  H+VGD++ +LDA+    VF+VGHDWGA++AW  C++RPDR+KA
Sbjct  61    GFGDTDAPADGTSYTSLHVVGDIIGVLDAIGADRVFVVGHDWGAVMAWYLCLYRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVNMSV  SPR+P RKPLE++R   GDD+YICRFQ+PG  E  F  I    + K FLT R
Sbjct  121   LVNMSVPFSPRNPMRKPLESLRAQLGDDYYICRFQEPGVIETEFAEIGVDRVLKHFLTYR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P P  +P         +     + LP WL+++++ YY TK+ ++GFTGGLNYYR+ +RN
Sbjct  181   NPAPLFLPK---GNAFGDDPATPIVLPSWLSEEEVHYYTTKYQKTGFTGGLNYYRSLNRN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA ++G Q +VP KFIVGD D+TYH PG K+ IH GGLKK VP L+ V+VMEGV H+
Sbjct  238   WELTAPFTGYQSKVPTKFIVGDHDMTYHAPGSKDFIHGGGLKKYVPLLEDVIVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             I++EK +E+N HI +F Q F
Sbjct  298   IHEEKSDEINKHIYDFFQQF  317



>ref|XP_003550367.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Glycine 
max]
Length=319

 Score =   407 bits (1047),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 246/322 (76%), Gaps = 5/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T++VNGINMH+AE G+GP +LF+HGFP+LWY+WRHQ+  LAS GYR +APDLR
Sbjct  1     MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRI  805
             GYGDTD P +  +Y+  H+VGDLV LLDA+   E  VF+VGHDWGA+ AW+  ++RP+RI
Sbjct  61    GYGDTDVPANPTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGAMTAWSLSLYRPERI  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             +ALVN+SVV +PR+P RKPL+ +R  +G+D+YICRFQ+PGE E  F  I    + K FLT
Sbjct  121   RALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQEPGEIEAEFAQIGTARVLKEFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  +P     +         ++LP WL++++  YYA+K+ ++GFTGGLNYYRN D
Sbjct  181   YRNPGPLYLPK---GKAFAHPTDSPIALPSWLSEEECDYYASKYDKTGFTGGLNYYRNLD  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTA+W+G+Q++VPVKFIVGD DLTY+ PG KE IH+GG K+ VP L+ VVV+EG  
Sbjct  238   LNWELTASWTGAQVKVPVKFIVGDLDLTYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAG  297

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+++QE+P+E++NHI +F + F
Sbjct  298   HFLHQERPDEISNHIYDFFKKF  319



>ref|XP_007147001.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
 gb|ESW18995.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
Length=316

 Score =   407 bits (1045),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/320 (60%), Positives = 235/320 (73%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV VNGI MHVAE G+GPAVLFLHGFPELWYTWRHQ+L L+S+GY A+APDLR
Sbjct  1     MEYIVHRTVEVNGIKMHVAEKGEGPAVLFLHGFPELWYTWRHQILDLSSRGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SYS F IVGDLVAL+D L + +VFLV HDWGAII W  CMFRPDR+KA
Sbjct  61    GYGDTEAPASMSSYSCFDIVGDLVALIDLLGVDQVFLVAHDWGAIIGWYLCMFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP++ MR  +GDD+YICRFQ+ G+AE          + K  LTNR
Sbjct  121   YVCLSVPFWPRNPKVKPVDAMRALYGDDYYICRFQEAGKAEGELAKNSTEEVLKKLLTNR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +  + +   L      ++ LP WL+ QD+KYYA+KF ++GFTGGLNYYRN + N
Sbjct  181   TPGPPILQKEGMGSNL----NTSMPLPSWLSLQDLKYYASKFEKTGFTGGLNYYRNINLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G+Q++VPVKFI GD D  Y   G+K  I  G  KK VPNL++V+V EGVAH+
Sbjct  237   WELTAPWTGAQVKVPVKFITGDLDSVYTSLGMKNYIESGAFKKDVPNLEEVIVQEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  E+V+NHI +FI+NF
Sbjct  297   NNQEAAEDVSNHIYDFIKNF  316



>ref|XP_008784772.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Phoenix 
dactylifera]
Length=322

 Score =   406 bits (1044),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 183/317 (58%), Positives = 239/317 (75%), Gaps = 5/317 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I H TV+VNGINMHVAE G+GP VL +HGFPELWYTWRHQ+  LA++G+RA+APDLRG+G
Sbjct  11    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  70

Query  969   DTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKALVN  790
             DTDAPP   SYS+FH+VGDLVAL+D+L   +VF+VGHDWGA++AW+ CMFRP++++A+VN
Sbjct  71    DTDAPPGVSSYSMFHLVGDLVALIDSLGQDQVFVVGHDWGAMVAWSLCMFRPEKVRAVVN  130

Query  789   MSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRDPR  610
             +SV  +PR+P RK +E +R  +GDD Y+CRFQ+PG AE  F  +    + + F T   P 
Sbjct  131   LSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSPD  190

Query  609   PPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWEL  430
             P  IP +      +      + LP WL++ DIKYYA+KF ++GFTGGLNYYR  D NWEL
Sbjct  191   PLFIPKEG-----WGSPDTEIPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWEL  245

Query  429   TAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYINQ  250
             TA W+G+ I+VP KFIVGD DLTYH PG+++ IH+ G K  VP L++VVVM+GV H+IN+
Sbjct  246   TAPWTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINE  305

Query  249   EKPEEVNNHILEFIQNF  199
             EKP E+  HI  FI+ F
Sbjct  306   EKPHEITVHIYNFIKKF  322



>ref|XP_008784771.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 183/317 (58%), Positives = 239/317 (75%), Gaps = 5/317 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I H TV+VNGINMHVAE G+GP VL +HGFPELWYTWRHQ+  LA++G+RA+APDLRG+G
Sbjct  27    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  86

Query  969   DTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKALVN  790
             DTDAPP   SYS+FH+VGDLVAL+D+L   +VF+VGHDWGA++AW+ CMFRP++++A+VN
Sbjct  87    DTDAPPGVSSYSMFHLVGDLVALIDSLGQDQVFVVGHDWGAMVAWSLCMFRPEKVRAVVN  146

Query  789   MSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRDPR  610
             +SV  +PR+P RK +E +R  +GDD Y+CRFQ+PG AE  F  +    + + F T   P 
Sbjct  147   LSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSPD  206

Query  609   PPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWEL  430
             P  IP +      +      + LP WL++ DIKYYA+KF ++GFTGGLNYYR  D NWEL
Sbjct  207   PLFIPKEG-----WGSPDTEIPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWEL  261

Query  429   TAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYINQ  250
             TA W+G+ I+VP KFIVGD DLTYH PG+++ IH+ G K  VP L++VVVM+GV H+IN+
Sbjct  262   TAPWTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINE  321

Query  249   EKPEEVNNHILEFIQNF  199
             EKP E+  HI  FI+ F
Sbjct  322   EKPHEITVHIYNFIKKF  338



>ref|XP_008784770.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=359

 Score =   407 bits (1046),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 183/317 (58%), Positives = 239/317 (75%), Gaps = 5/317 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I H TV+VNGINMHVAE G+GP VL +HGFPELWYTWRHQ+  LA++G+RA+APDLRG+G
Sbjct  48    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  107

Query  969   DTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKALVN  790
             DTDAPP   SYS+FH+VGDLVAL+D+L   +VF+VGHDWGA++AW+ CMFRP++++A+VN
Sbjct  108   DTDAPPGVSSYSMFHLVGDLVALIDSLGQDQVFVVGHDWGAMVAWSLCMFRPEKVRAVVN  167

Query  789   MSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRDPR  610
             +SV  +PR+P RK +E +R  +GDD Y+CRFQ+PG AE  F  +    + + F T   P 
Sbjct  168   LSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSPD  227

Query  609   PPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWEL  430
             P  IP +      +      + LP WL++ DIKYYA+KF ++GFTGGLNYYR  D NWEL
Sbjct  228   PLFIPKEG-----WGSPDTEIPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWEL  282

Query  429   TAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYINQ  250
             TA W+G+ I+VP KFIVGD DLTYH PG+++ IH+ G K  VP L++VVVM+GV H+IN+
Sbjct  283   TAPWTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINE  342

Query  249   EKPEEVNNHILEFIQNF  199
             EKP E+  HI  FI+ F
Sbjct  343   EKPHEITVHIYNFIKKF  359



>gb|KDP27824.1| hypothetical protein JCGZ_18904 [Jatropha curcas]
Length=321

 Score =   405 bits (1040),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/324 (59%), Positives = 241/324 (74%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             M+ I+H  V VNGIN+HVAE G  +GP +LF+HGFPELWY+WRHQ++ LAS GYRA+APD
Sbjct  1     MDAIEHRFVQVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPD  811
             +RGYGDTDAP    SY+ FHIVGDL+ LLDA+  Q  +VF+VGHDWGA IAW+ C+FRPD
Sbjct  61    MRGYGDTDAPDDLQSYTCFHIVGDLIGLLDAVAPQQEKVFVVGHDWGAYIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R+KALVN+SVV + R+P  K +E MR  +GDD+Y+CRFQ+PGE E  F  +    + K F
Sbjct  121   RVKALVNLSVVFALRNPNGKRIEVMRAVYGDDYYMCRFQEPGEIEAEFAELGTERILKEF  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
              T R P P  +P       L E     + LP W +++D++YY  KF + GFTGGLNYYR 
Sbjct  181   FTYRHPGPIFLPKGKAFSRLPET---PLVLPSWFSEEDVQYYTNKFEKKGFTGGLNYYRI  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              DRNWELTA W+G+Q++VP KFIVGDQDLTY+  G K+ I +GG KK VP L++VV+MEG
Sbjct  238   LDRNWELTAPWNGAQVKVPAKFIVGDQDLTYNSFGAKDYIEKGGFKKAVPFLEEVVIMEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH++NQEKPEE+N HI +F Q F
Sbjct  298   VAHFLNQEKPEEINKHIYDFFQKF  321



>gb|KDP27825.1| hypothetical protein JCGZ_18905 [Jatropha curcas]
Length=321

 Score =   405 bits (1040),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 243/325 (75%), Gaps = 9/325 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             M+ ++H  V VNGIN+HVAE G  +GP +LF+HGFPELWY+WR+Q++ LAS GYRAIAPD
Sbjct  1     MDAVEHRFVHVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRYQIVALASLGYRAIAPD  60

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPD  811
             +RGYGDTDAP    SY+  HIVGDL+ LLDA+  Q  +VF+VGHDWGA IAW  C+FRPD
Sbjct  61    MRGYGDTDAPADPQSYTCLHIVGDLIGLLDAVAPQQEKVFVVGHDWGAYIAWYLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R+KALVN+SV  +PR+P RKP E MR  +GDD+Y+CR Q+PG+ E  F  +    + K F
Sbjct  121   RVKALVNLSVAFAPRNPKRKPTEGMRAVYGDDYYVCRIQEPGDIEAEFAELGTEKIMKEF  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             LT R+P P  +P        + +  ET + LP W +++D++YY  KF + GFTGGLNYYR
Sbjct  181   LTYRNPGPLLLPKGKA----FSRPSETPLVLPSWFSEEDVQYYINKFEKKGFTGGLNYYR  236

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
               DRNWELTA W+G++++VPVKFIVGDQDLTY+  G K+ I +GG KK VP L++VV+ME
Sbjct  237   IVDRNWELTAPWTGAEVKVPVKFIVGDQDLTYNTFGTKDFIEKGGFKKAVPFLEEVVIME  296

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             GV H++N+EKPEE+N HI +F Q F
Sbjct  297   GVGHFLNEEKPEEINKHIYDFFQKF  321



>ref|XP_009393199.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   404 bits (1038),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 241/320 (75%), Gaps = 8/320 (3%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I H TV VNGI++HVAE G+GP VL +HGFPELWY+WRHQ+L LA++GYRA+APDLRGYG
Sbjct  6     ITHRTVEVNGISIHVAEKGEGPVVLLVHGFPELWYSWRHQILGLAARGYRALAPDLRGYG  65

Query  969   DTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKALVN  790
             D+ APPS  SYSVFHIVGDLVALLDAL +P+VFLVGHDWGA++AW  C+FRPDR+KALVN
Sbjct  66    DSSAPPSVASYSVFHIVGDLVALLDALAIPQVFLVGHDWGALVAWYMCLFRPDRVKALVN  125

Query  789   MSVVIS---PRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             +SV +    PR+P  K +E  R  +GDD+Y+CRFQ+PG  E  F  +   +L +    +R
Sbjct  126   LSVALVPFIPRNPAGKLVEYFRSLYGDDYYVCRFQEPGAVEADFDRLGTESLLRMVFASR  185

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P P  +P ++   +        + LP WL+++DI Y+ +KF +SGFTG +NYYR  D N
Sbjct  186   NPGPLLLPKEAFVPL-----DRQIPLPDWLSEEDISYFTSKFDESGFTGPVNYYRCLDLN  240

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
              EL A W G +IQVPVKFIVGDQDLTYH+PG+++ +H GG K+ VP L++VVVMEGVAH+
Sbjct  241   RELGAPWCGVKIQVPVKFIVGDQDLTYHYPGIQDYLHGGGFKEDVPMLEEVVVMEGVAHF  300

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK  E+ +HI  FI+ F
Sbjct  301   INQEKAHEITDHIYHFIRKF  320



>emb|CDY09722.1| BnaC07g33390D [Brassica napus]
Length=329

 Score =   404 bits (1038),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 188/328 (57%), Positives = 241/328 (73%), Gaps = 9/328 (3%)
 Frame = -1

Query  1161  GMERIQHNTVSVNGINMHVAEI-----GDGPAVLFLHGFPELWYTWRHQMLFLASKGYRA  997
             G++ ++H T+ VNGINMHVAE+     G  P +LF+HGFPELWYTWRHQM  L+S GYR 
Sbjct  3     GLDGVEHKTLKVNGINMHVAELPGSGSGGDPIILFIHGFPELWYTWRHQMTALSSLGYRT  62

Query  996   IAPDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCM  823
             IAPDLRGYGDTDAP   + Y+ F+IVGDLVAL+DA+   +  VF+VGHDWGA+IAW  CM
Sbjct  63    IAPDLRGYGDTDAPEKVEDYTYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAWQLCM  122

Query  822   FRPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTL  643
             +RP+++KALVNMSV+ SPR+P R P+  +R  FGDD+YICRFQ+PGE E  F  +    +
Sbjct  123   YRPEKVKALVNMSVLFSPRNPDRVPIPTLRRFFGDDYYICRFQKPGEIEAEFKKLGTEKV  182

Query  642   FKAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLN  463
              K FLT + P P  +P   + +    + G + +LPPWLTQ+D+ YY T +   GFTG +N
Sbjct  183   LKEFLTYKTPGPLYLPKGKLFKS--SENGASSALPPWLTQEDLDYYVTNYNNKGFTGPIN  240

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYRN DRNWELTA W+G++I VPVKFIVGDQDLTY+ PG KE I+ GG KK VP L + V
Sbjct  241   YYRNIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETV  300

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             V++GV H++++E PEE+N HI  F Q F
Sbjct  301   VLKGVGHFLHEESPEEINQHIHSFFQKF  328



>gb|ACU19478.1| unknown [Glycine max]
 gb|KHN43316.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   404 bits (1037),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 236/320 (74%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ FHIVGDLVAL+D+L + +VFLV HDWGAII W  CMFRPD++KA
Sbjct  61    GYGDTEAPPSISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP++ MR  +GDD+YICRFQ+PG+AE          + K    +R
Sbjct  121   YVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPGKAEGELAKNSTEQVIKNVFISR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +  + +          ++ LP WL+Q+D+ YYA+KF ++GFTGGLNYYRNF+ N
Sbjct  181   KPGPPILEKEGMGF----NPNTSMPLPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G+Q++VPVKFI GD DL Y   G K  I  G  KK VPNL++VVV EGVAH+
Sbjct  237   WELTAPWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  E+V+NHI +FI+ F
Sbjct  297   NNQEAAEDVSNHIYDFIKKF  316



>ref|XP_009136735.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=362

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/328 (58%), Positives = 242/328 (74%), Gaps = 8/328 (2%)
 Frame = -1

Query  1161  GMERIQHNTVSVNGINMHVAEI-----GDGPAVLFLHGFPELWYTWRHQMLFLASKGYRA  997
             G++ ++H T+ VNGINMHVAE+     G  P +LF+HGFPELWYTWRHQM  L+S GYR 
Sbjct  35    GLDGVEHKTLKVNGINMHVAELPGSGSGGEPIILFIHGFPELWYTWRHQMTALSSLGYRT  94

Query  996   IAPDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCM  823
             IAPDLRGYGDTDAP   + Y+ F+IVGDLVAL+DA+   +  VF+VGHDWGA+IAW  CM
Sbjct  95    IAPDLRGYGDTDAPEKMEDYTYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAWQLCM  154

Query  822   FRPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTL  643
             +RP+++KALVNMSV+ SPR P R P+  +R  FGDD+YICRFQ+PGE E  F  +    +
Sbjct  155   YRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKPGEIELEFKKLGTEKV  214

Query  642   FKAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLN  463
              K FLT + P P  +P   + +   E  G + +LPPWLTQ+D+ YY TK+   GFTG +N
Sbjct  215   LKEFLTYKTPGPLYLPKGKLFKS-SENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPIN  273

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYRN DRNWELTA W+G++I+VPVKFIVGDQDLTY+ PG KE I+ GG KK VP L + V
Sbjct  274   YYRNIDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETV  333

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             V++GV H++++E PEE+N HI  F Q F
Sbjct  334   VLKGVGHFLHEESPEEINQHIHSFFQKF  361



>ref|XP_003554633.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=341

 Score =   404 bits (1038),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 236/320 (74%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  26    MEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  85

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ FHIVGDLVAL+D+L + +VFLV HDWGAII W  CMFRPD++KA
Sbjct  86    GYGDTEAPPSISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKA  145

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP++ MR  +GDD+YICRFQ+PG+AE          + K    +R
Sbjct  146   YVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPGKAEGELAKNSTEQVIKNVFISR  205

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +  + +          ++ LP WL+Q+D+ YYA+KF ++GFTGGLNYYRNF+ N
Sbjct  206   KPGPPILEKEGMGF----NPNTSMPLPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLN  261

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G+Q++VPVKFI GD DL Y   G K  I  G  KK VPNL++VVV EGVAH+
Sbjct  262   WELTAPWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHF  321

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  E+V+NHI +FI+ F
Sbjct  322   NNQEAAEDVSNHIYDFIKKF  341



>ref|XP_010094462.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB56095.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   403 bits (1035),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 180/318 (57%), Positives = 231/318 (73%), Gaps = 3/318 (1%)
 Frame = -1

Query  1152  RIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGY  973
             +I H TVSVNGI MH+AE G+GP VLFLHGFPELWY+WRHQ+  L+S GYRA+APDLRGY
Sbjct  4     KITHRTVSVNGIEMHIAEKGNGPVVLFLHGFPELWYSWRHQISALSSLGYRAVAPDLRGY  63

Query  972   GDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKALV  793
             GDTDAP    SY+  H+VGDLV L+DAL + +V+LV  DWG ++AW  C+FRP+++KA V
Sbjct  64    GDTDAPADVASYTCLHVVGDLVGLVDALGVEQVYLVAQDWGCLMAWYLCLFRPEKVKAFV  123

Query  792   NMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRDP  613
              + V   PR+P  KP+E+MR  FGDD+Y+CRFQ+PGE E     +  + + K  LT R P
Sbjct  124   CLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQEPGEIEAEMAQVGASAVLKKILTTRKP  183

Query  612   RPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWE  433
              PP +P     +        +V+LP WL+++D+ YYATKF   GFTGGLNYYRN D NWE
Sbjct  184   GPPFLPK---GKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINWE  240

Query  432   LTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYIN  253
             L AAW G++++VPVKFIVGD D+ Y  PG KE +H GG KK VP LQ+VVV+E   H+I+
Sbjct  241   LMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFIS  300

Query  252   QEKPEEVNNHILEFIQNF  199
             QE+ EE++ HI +FIQ F
Sbjct  301   QERAEEISTHIYDFIQKF  318



>gb|ADP68585.1| epoxide hydrolase A [Vigna radiata]
Length=319

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 245/321 (76%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S+GYRA+APDLR
Sbjct  1     MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SY++ H+VGD+VAL+D+L + +VFLV HDWGAI+ W  C+FRP++IKA
Sbjct  61    GYGDTEAPESISSYTIMHLVGDIVALIDSLGVGQVFLVAHDWGAIVGWYLCLFRPEKIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPT-TLFKAFLTN  622
              V +SV   PR+P  +P++ MR  +GDD+YICRFQ+PG+AE ++GS +    + K+ LTN
Sbjct  121   YVCLSVPFMPRNPKVRPVDAMRALYGDDYYICRFQEPGKAEALYGSNNNIGEVIKSILTN  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R P PP +P + VA  L      +  LP WL+++D+ YYA+KF ++G TGGLNYYRN + 
Sbjct  181   RRPGPPILPKEGVA--LPSGSLPSRPLPSWLSEEDVTYYASKFSKTGLTGGLNYYRNLNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+G++++VPVKFI GD D+ Y   G+K+ I  G  K+ V  L++VVV EGVAH
Sbjct  239   NWELTAAWTGAKVKVPVKFITGDLDVVYTSLGIKDYIDSGAFKRDVHYLEEVVVQEGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E+++NHI EFI+ F
Sbjct  299   FNNQEAAEDISNHIYEFIKKF  319



>gb|ACE82565.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 238/323 (74%), Gaps = 11/323 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV+VNGINMHVAE G GP +LFLHGFPELWYTWRHQ++  A  G+RA+APDLR
Sbjct  1     MESIEHRTVNVNGINMHVAEKGKGPVILFLHGFPELWYTWRHQLVAFADLGHRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP  A SY+ FH+VGDLVAL+++L +  VFLV HDWGA+I W  C+FRPD +KA
Sbjct  61    GYGDTDAPAEAASYTCFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEV--FGSIDPTTLFKAFLT  625
              V +SV   PRHP  KP+  MR  FGDD+Y+CRFQ PG  EE+  +GS     + K  LT
Sbjct  121   YVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPGMEEEIAKYGS---EVVLKKILT  177

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +R P PP +P  S   +  + +     LP WL+Q D+ YY+TKF + GFTGGLNYYR  D
Sbjct  178   DRKPGPPCLPKGSPFGISPDSK-----LPSWLSQDDLNYYSTKFDRKGFTGGLNYYRALD  232

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNL-QQVVVMEGV  268
              NWELTAAW+G++++VPVKF+VG+ DL Y  PG+KE +H GG KK VP L + VVVMEG 
Sbjct  233   LNWELTAAWTGAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGA  292

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH+INQE+ +E+N+HI +FI  F
Sbjct  293   AHFINQERAQEINSHIYDFINKF  315



>emb|CDX90550.1| BnaA03g42310D [Brassica napus]
Length=330

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/328 (58%), Positives = 242/328 (74%), Gaps = 8/328 (2%)
 Frame = -1

Query  1161  GMERIQHNTVSVNGINMHVAEI-----GDGPAVLFLHGFPELWYTWRHQMLFLASKGYRA  997
             G++ ++H T+ VNGINMHVAE+     G  P +LF+HGFPELWYTWRHQM  L+S GYR 
Sbjct  3     GLDGVEHKTLKVNGINMHVAELPGSGSGGEPIILFIHGFPELWYTWRHQMTALSSLGYRT  62

Query  996   IAPDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCM  823
             IAPDLRGYGDT+AP   + Y+ F+IVGDLVAL+DA+   +  VF+VGHDWGA+IAW  CM
Sbjct  63    IAPDLRGYGDTNAPEKMEDYAYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAWQLCM  122

Query  822   FRPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTL  643
             +RP+++KALVNMSV+ SPR P R P+  +R  FGDD+YICRFQ+PGE E  F  +    +
Sbjct  123   YRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKPGEIELEFKKLGTEKV  182

Query  642   FKAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLN  463
              K FLT + P P  +P   + +   E  G + +LPPWLTQ+D+ YY TK+   GFTG +N
Sbjct  183   LKEFLTYKTPGPLYLPKGKLFKS-SENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPIN  241

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYRN DRNWELTA W+G++I+VPVKFIVGDQDLTY+ PG KE I+ GG KK VP L + V
Sbjct  242   YYRNIDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETV  301

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             V++GV H++++E PEE+N HI  F Q F
Sbjct  302   VLKGVGHFLHEESPEEINQHIHSFFQKF  329



>ref|XP_010104146.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB98711.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   402 bits (1034),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 180/318 (57%), Positives = 230/318 (72%), Gaps = 3/318 (1%)
 Frame = -1

Query  1152  RIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGY  973
             +I H TVSVNGI MH+AE G+GP VLFLHGFPELWY+WRHQ+  L+S GYRA+APDLRGY
Sbjct  4     KITHRTVSVNGIEMHIAEKGNGPVVLFLHGFPELWYSWRHQISALSSLGYRAVAPDLRGY  63

Query  972   GDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKALV  793
             GDTDAP    SY+  H+VGDLV L+DAL + +V+LV  DWG ++AW  C+FRP+++KA V
Sbjct  64    GDTDAPADVASYTCLHVVGDLVGLVDALGVEQVYLVAQDWGCLMAWYLCLFRPEKVKAFV  123

Query  792   NMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRDP  613
              + V   PR+P  KP+E+MR  FGDD+Y+CRFQ+PGE E     +  + + K  LT R P
Sbjct  124   CLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQEPGEIEAEMAQVGASAVLKKILTTRKP  183

Query  612   RPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWE  433
              PP +P     +        +V+LP WL+++D+ YYATKF   GFTGGLNYYRN D NWE
Sbjct  184   GPPFLPK---GKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINWE  240

Query  432   LTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYIN  253
             L AAW G++++VPVKFIVGD D+ Y  PG KE +H GG KK VP LQ+VVV+E   H+I 
Sbjct  241   LMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFIG  300

Query  252   QEKPEEVNNHILEFIQNF  199
             QE+ EE++ HI +FIQ F
Sbjct  301   QERAEEISTHIYDFIQKF  318



>gb|KHG21329.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=386

 Score =   405 bits (1040),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 238/322 (74%), Gaps = 6/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  +  NGINMHVAE G GP +LFLHGFPELWYTWRHQ+   AS GYRA+APDLR
Sbjct  69    MEGIEHRVIKANGINMHVAEKGKGPVILFLHGFPELWYTWRHQITAFASLGYRALAPDLR  128

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLD--ALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+G+T+AP  A +Y+   +VGDL+ALLD  A    +VF+VGHDWGA+IAW  CMFRPDR+
Sbjct  129   GFGETEAPDDASTYTSLDVVGDLIALLDVVAADQDQVFVVGHDWGALIAWWLCMFRPDRV  188

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVNMSV  +PR+P  KPLE +R  +GDD+YICRFQ+PG  E  F  +    + K F T
Sbjct  189   KALVNMSVAFNPRNPNMKPLEGLRALYGDDYYICRFQEPGVIEAEFREMGYERVLKGFFT  248

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              RDP P  IP        + +    +SLP W +++D KYY +++ + GFTG LNYYRN +
Sbjct  249   YRDPCPLLIPKGK----YFGQPDTPISLPSWFSEEDCKYYLSQYEKKGFTGALNYYRNIN  304

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NW+LTA W+GS+++VPVKFIVGDQDLTY+ PG+K+ +H+GGLKK VP L+QVVVMEGVA
Sbjct  305   LNWQLTAPWTGSKVKVPVKFIVGDQDLTYNGPGIKDYLHKGGLKKNVPLLEQVVVMEGVA  364

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H++ +E P+EVN HI +F   F
Sbjct  365   HFLQEENPDEVNKHIHDFFNKF  386



>ref|XP_009788536.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=315

 Score =   402 bits (1033),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 238/323 (74%), Gaps = 11/323 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV+VNGINMHVAE G GP VLFLHGFPELWYTWRHQ++  A  GYRA+APDLR
Sbjct  1     MEGIEHRTVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP  A SY+ FH+VGDLVAL+++L +  VFLV HDWGA+I W  C+FRPD +KA
Sbjct  61    GYGDTDAPAEAASYTCFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEV--FGSIDPTTLFKAFLT  625
              V +SV   PRHP  KP+  MR  FGDD+Y+CRFQ PG  +E+  +GS     + K  LT
Sbjct  121   YVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPGMEDEIAKYGS---EAVLKKILT  177

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +R P PP +P ++   +  + +     LP WL+Q D+KYY+TKF Q GFTGGLNYYR  D
Sbjct  178   DRKPGPPCLPKENPFGISPDSK-----LPSWLSQDDLKYYSTKFDQKGFTGGLNYYRALD  232

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNL-QQVVVMEGV  268
              NWELTAAW+G++++VPVKF+VG+ DL Y  PG+KE +H GG KK VP L + VVVMEG 
Sbjct  233   LNWELTAAWTGAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGA  292

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH+INQE+ ++ N+HI  FI  F
Sbjct  293   AHFINQERAQDTNSHIHGFINKF  315



>ref|XP_006433457.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46697.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=317

 Score =   402 bits (1033),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 235/320 (73%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  V VNGI MH+AE G+GP VLFLHGFPELWYTWR Q+L L+S GYRAIAPDLR
Sbjct  1     MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SYS  HIVGDLVAL+++L + +VF+V HDWGAIIAW  C+F P+R+KA
Sbjct  61    GYGDTEAPSSISSYSCHHIVGDLVALINSLGVEQVFVVAHDWGAIIAWYLCLFCPERVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP+E+MR  FGDD+YICRFQ+PG+ E     +    + K  L NR
Sbjct  121   FVCLSVPFLPRNPNIKPVESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILANR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P P   P ++   +  E R   V+LP W ++QD+ +YATKF Q+GFTG LNYYR  + N
Sbjct  181   KPGPSCFPEENAFGIDPENR---VTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WE+TAAW+  Q++VPVKFIVG+ D+ Y  PG+KE +H GG KK VP L+++VV+E   H+
Sbjct  238   WEMTAAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+ EE+N HI +FI+ F
Sbjct  298   INQERAEEINAHIYDFIKKF  317



>ref|XP_007221833.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
 gb|EMJ23032.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
Length=320

 Score =   402 bits (1032),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 240/322 (75%), Gaps = 5/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGINMH+AE G GP +LF+HGFPELWY+W HQ+  LAS GYRA+APDLR
Sbjct  1     MEGIEHRTVQVNGINMHIAEKGQGPLILFVHGFPELWYSWSHQITALASFGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP S  SY+  H+VGDL+ALLDA+     +VF+VGHDWGA +AW  C+FRPDR+
Sbjct  61    GFGDTDAPDSPTSYTCLHVVGDLIALLDAIAPDQDKVFVVGHDWGAYLAWFLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV   PR+P RK +E+++  +GDD+Y+CRFQ+PG  E  F  +    + K FLT
Sbjct  121   KALVNLSVAFMPRNPQRKFIESVKAVYGDDYYMCRFQEPGVMEAEFAKLGTARVMKEFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  +P     ++        + LP WL++ ++ YYA+KF ++GFTG LNYYRN D
Sbjct  181   YRNPGPLFLPKD---KMFGHAPDAPIVLPSWLSEDEVNYYASKFEKTGFTGALNYYRNLD  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTAAW+  Q++VPVKFIVGDQDL Y+    K+ IH+GG KK VP L++VVVMEGVA
Sbjct  238   LNWELTAAWTEVQVKVPVKFIVGDQDLVYNSLHAKDFIHKGGFKKYVPLLEEVVVMEGVA  297

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQE+P+E+N HI +FI  F
Sbjct  298   HFINQERPDEINKHIHDFIAKF  319



>ref|XP_010914487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   402 bits (1032),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 194/322 (60%), Positives = 242/322 (75%), Gaps = 5/322 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             +G+  I H TV  NGI MHVAE G+GPAVL LHGFPELWY+WRHQ+  LA++GYRAIAPD
Sbjct  2     EGVSGISHQTVEANGIRMHVAEKGEGPAVLLLHGFPELWYSWRHQIASLAARGYRAIAPD  61

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRG+GDTDAPP   SY++FH+VGDLVALLDAL L + F+VGHDWGA +AW+ CMFRPDR+
Sbjct  62    LRGFGDTDAPPDVSSYNIFHLVGDLVALLDALALSQAFVVGHDWGAHVAWHLCMFRPDRV  121

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KA+VN+SV   PR+P  KP++  R  +GD++YICRFQ+P  AE  F  +   T+ K F T
Sbjct  122   KAVVNLSVAFLPRNPAMKPVDYFRSIYGDEYYICRFQEPDAAEAEFARLGAATVLKKFFT  181

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              RDP P  IP        +    E ++LP WL++ DI YY +KF +SGFTG +NYYR FD
Sbjct  182   YRDPGPIYIPKDG-----WGSPNEQITLPSWLSEADINYYTSKFEKSGFTGPINYYRCFD  236

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELT  W+G+Q  VP KFIVGD DLTYH+P +++ IH+GG KK VP LQ+VVVMEGVA
Sbjct  237   LNWELTEPWNGAQANVPAKFIVGDLDLTYHYPNMQDYIHKGGFKKDVPLLQEVVVMEGVA  296

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQEK +E+ +HI +FIQ F
Sbjct  297   HFINQEKAQEIADHIYDFIQKF  318



>ref|XP_007031041.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY11543.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=317

 Score =   401 bits (1031),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 230/320 (72%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ IQH  V+VNGI MHVAE G GP +LFLHGFPELWYTWRHQ+L L+S GY  +APDLR
Sbjct  1     MDGIQHRMVNVNGITMHVAEKGQGPVILFLHGFPELWYTWRHQILALSSLGYHTVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+A     SY+  HIVGDL+AL+D+L + +VFLV HDWGAII W  CMFRPDR+KA
Sbjct  61    GYGDTEASTCVTSYTCLHIVGDLIALIDSLGVEQVFLVAHDWGAIIGWYLCMFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR P  KP+E+MR  FG+D+YICRFQ+PG+ E     +  + + K  L+ R
Sbjct  121   FVCLSVPFMPRKPKMKPVESMRLLFGEDYYICRFQEPGKIEAEIAHVGTSEVLKKVLSTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
             +P PPR+P      +   K    V+LP W +++D+ YYA KF Q GFTGGLNYYR  D N
Sbjct  181   EPGPPRLPKDDAFGI---KPDTPVTLPSWFSEEDLSYYANKFNQKGFTGGLNYYRALDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+  Q+++PVKFIVGD D  Y  PG+KE +  GG K+ VP L +VVVMEGV H+
Sbjct  238   WELTAPWTNVQVKLPVKFIVGDLDTVYTTPGIKEYVQSGGFKRDVPLLDEVVVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+ EE+N+ I +FI+ F
Sbjct  298   INQERAEEINSLIYDFIKKF  317



>gb|AES82458.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   401 bits (1030),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 238/321 (74%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S  SY++FH+VGD+VAL+D+L + +VFLV HDWGA+I W  C+FRP++IK
Sbjct  61    RGYGDTDAPASISSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAMIGWYLCLFRPEKIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  KP++ MR  FGDD+YICRFQ+PG+ E  F    P  L K  LT+
Sbjct  121   AYVCLSVPYLPRNPKMKPVDGMRALFGDDYYICRFQEPGKMESEFAKGGPELLIKNMLTS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+  PP +P + V  +       T +LP WL+Q+DI YYA+KF ++GF+G LNYYRN + 
Sbjct  181   RNSGPPILPKEGV--IPNPHASGTKALPSWLSQEDITYYASKFEKTGFSGALNYYRNLNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+ ++I+VPVKFI GD D  Y   G K+ I  GG KK VPNL++VV+ EGVAH
Sbjct  239   NWELTAAWTAAKIKVPVKFITGDLDAVYTSFGTKQYIESGGFKKDVPNLEEVVIQEGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E+++NHI +FI+ F
Sbjct  299   FNNQEAAEDISNHIYDFIKKF  319



>ref|XP_009350800.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   401 bits (1030),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 239/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I+H TV VNGINMHVAE G+GP +LFLHGFPELWY+WRHQ+L L++ GYRA+APDLRGYG
Sbjct  6     IEHRTVQVNGINMHVAEKGNGPLILFLHGFPELWYSWRHQILALSALGYRAVAPDLRGYG  65

Query  969   DTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIKAL  796
             DTDAP S  SY+  H+VGDLVALLDA+     +VF+V HDWGA+IAW  C+FRPDR+KAL
Sbjct  66    DTDAPASPSSYTCLHMVGDLVALLDAIAPDQEKVFVVAHDWGALIAWYLCLFRPDRVKAL  125

Query  795   VNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRD  616
             V++SV   PR+P RK +E+    +GDD+Y+CRFQ+PG  E  F  +  T + K FLT R+
Sbjct  126   VSLSVQFMPRNPRRKVIESFHAAYGDDYYMCRFQEPGVIEAEFAQMGTTRVIKEFLTYRN  185

Query  615   PRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNW  436
             P P  +P     +         + LP WL++ D+ YY  KF ++GFTG +NYYRN D NW
Sbjct  186   PGPLFLPK---GKAFGHPTDTPIVLPSWLSEDDVNYYTAKFDKTGFTGPVNYYRNLDVNW  242

Query  435   ELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYI  256
             ELTA W+G+Q++VPVKF+VGDQDL Y+  G  + IH+GG KK VP L++VVV+EGVAH++
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSQGAPDFIHKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  255   NQEKPEEVNNHILEFIQNFH  196
              QEKP+E++ HI +FI+ FH
Sbjct  303   QQEKPDEISKHIHDFIKKFH  322



>ref|XP_002512456.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF49908.1| epoxide hydrolase, putative [Ricinus communis]
Length=317

 Score =   400 bits (1029),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 231/320 (72%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV+VNGI MH+AE G+GP +LFLHGFPELWYTWRHQ+L L S GYRA+APDLR
Sbjct  1     MEGIMHKTVNVNGIKMHIAEKGEGPVILFLHGFPELWYTWRHQILGLTSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAP    SY+  HIVGDL+AL+D L + +VFLV HDWGAI+ W  C+FRPDR+KA
Sbjct  61    GYGDSDAPTLCSSYTCHHIVGDLIALIDHLGVEQVFLVAHDWGAIMGWYLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP+E+MR  FGDD+Y+CRFQ+PGE E       P  + K  LT+R
Sbjct  121   FVCLSVPFRPRNPKMKPVESMRLLFGDDYYVCRFQEPGEIEAEIARCGPAEVIKKILTDR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P P  +  ++   +        ++LP WLT++D+ YYA  F Q GFTG LNYYR  D +
Sbjct  181   KPGPSCLFKENAFGIC---PNNPITLPSWLTEEDVAYYAANFNQKGFTGALNYYRAMDLS  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G  ++VPVKF+VGD D+ Y  PG+KE +H GG +  VP L+++VVME V H+
Sbjct  238   WELTAPWTGDSVKVPVKFVVGDLDMVYTTPGIKEYVHGGGFRYYVPLLEEIVVMEEVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+PEE+N  I EFI+N+
Sbjct  298   INQERPEEINKLIYEFIRNY  317



>ref|XP_010105136.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03944.1| Epoxide hydrolase 2 [Morus notabilis]
Length=347

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 233/306 (76%), Gaps = 5/306 (2%)
 Frame = -1

Query  1113  MHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYGDTDAPPSADSYS  934
             MHVAE G+GP +L +HGFPELWYTWRHQ++ LAS GYRAIAPDLRGYGDTDAP SA  Y+
Sbjct  1     MHVAEKGNGPVILLVHGFPELWYTWRHQIMALASLGYRAIAPDLRGYGDTDAPDSAAKYT  60

Query  933   VFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRIKALVNMSVVISPRHP  760
              F +VGDL+ALLDA+   E  VF+VGHDWGA+I+W  C+FRPDR+KALVN+SV  +PR+P
Sbjct  61    CFDVVGDLIALLDAVAGEEEKVFVVGHDWGALISWYLCLFRPDRVKALVNLSVAFNPRNP  120

Query  759   TRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRDPRPPRIPHQSVA  580
              RKP E +R  +GDD+Y+CRFQ+PGE E  F  I   T+ K F T R P+P  +P     
Sbjct  121   NRKPYETLRALYGDDYYVCRFQEPGEIEAEFAEIGAATVIKEFYTYRSPKPLFMPK---G  177

Query  579   QVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWELTAAWSGSQIQ  400
             +     +   ++LP W++++D+ YYA+KF ++GFTGG+NYYRN DRNWELTA W+G+++Q
Sbjct  178   KCFGHPKDTPIALPSWVSEEDMDYYASKFEKTGFTGGINYYRNIDRNWELTAPWTGAKMQ  237

Query  399   VPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYINQEKPEEVNNHI  220
             VPVKFIVGDQDL Y+  G K+ IH+GG K+ VP LQ+VVVMEGV H++N+EK +EV  HI
Sbjct  238   VPVKFIVGDQDLVYNLYGTKDYIHKGGFKRDVPFLQEVVVMEGVGHFVNEEKADEVTQHI  297

Query  219   LEFIQN  202
              +F   
Sbjct  298   YDFFSK  303



>ref|XP_004230258.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=314

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 234/322 (73%), Gaps = 10/322 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T++VNGINMHVAE G GP VLFLHGFPELWYTWRHQ++ LA +GYRA+APDLR
Sbjct  1     MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP    SY+ FH+VGDLVAL+++L +  VFLV HDWGA+I W  CMFRPD +KA
Sbjct  61    GYGDTDAPKEVTSYTYFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCMFRPDLVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEV--FGSIDPTTLFKAFLT  625
              V +SV   PR+P  KP+  MR   GDD+Y+CRFQ PG  +E+  +GS     + K  L 
Sbjct  121   YVCLSVPFRPRNPKMKPIPTMRAFLGDDYYMCRFQDPGMEDEIAKYGS---EAILKKILI  177

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +R P PPR+P ++   +    +     LP WL+Q D+ YY+TKF Q GFTGGLNYYR  D
Sbjct  178   DRTPGPPRLPKENPFGISTNDK-----LPLWLSQDDLNYYSTKFDQKGFTGGLNYYRALD  232

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTA W+G ++ VPVKF+VGD D+ Y  PGVKE +H GG KK VP L+ VVV+EG A
Sbjct  233   LNWELTAPWTGVKVNVPVKFVVGDLDVVYTTPGVKEYVHGGGFKKDVPMLEGVVVLEGAA  292

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQE+ +E N+HI +FI  F
Sbjct  293   HFINQERAQETNSHIYDFINKF  314



>gb|KDP23458.1| hypothetical protein JCGZ_23291 [Jatropha curcas]
Length=317

 Score =   400 bits (1027),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 231/320 (72%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H  V+VNGINMH+AE G+GP +LFLHGFPELWYTWRHQ+L L+S G+ A+APDLR
Sbjct  1     MEEINHRVVNVNGINMHIAEKGEGPMILFLHGFPELWYTWRHQILSLSSLGFHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP  + SY+  HIVGDL+AL+D L   +VFLVGHDWGAII W  C+FRPD++KA
Sbjct  61    GYGDTEAPALSSSYTCHHIVGDLIALIDHLGAEKVFLVGHDWGAIIGWYLCLFRPDKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PRHP  K +E+MR  FGD++YICRFQ+PGE EE    +    + K   T+R
Sbjct  121   FVCLSVPFKPRHPNIKTVESMRLLFGDEYYICRFQKPGEIEEEIARVGTEEVLKKIFTDR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P ++      E     V+LP WLT++D+ YY TKF Q GFTGGLNYYR  D N
Sbjct  181   KPGPPCLPKENAFGSCKEN---PVTLPSWLTEEDLAYYVTKFNQKGFTGGLNYYRALDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G  I+VPVKF+VGD D+ Y  PG+KE +   G    VP L+ VVVMEGV H+
Sbjct  238   WELTAQWTGVAIKVPVKFVVGDADMVYTTPGMKEYVQGSGFSHYVPFLEDVVVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             I+QE+P+E++N I +FI  +
Sbjct  298   ISQERPKEISNLIYDFITQY  317



>ref|XP_008438903.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=369

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 252/340 (74%), Gaps = 4/340 (1%)
 Frame = -1

Query  1209  QR*NLLSHLP*LYTCKGMERIQHNTVSVNGINMHVAEIGD-GPAVLFLHGFPELWYTWRH  1033
             Q  N  +H P +     +  I+H T++VNGIN+H+AE G+ GP +LF+HGFPELWY+WR+
Sbjct  31    QSPNPQTHSPKMENQMELSSIRHRTLNVNGINLHIAEKGESGPLILFIHGFPELWYSWRY  90

Query  1032  QMLFLASKGYRAIAPDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGH  859
             Q+L L+S+GYRA+APDLRGYGD+D+PPS + Y+ FHIVGDL+AL+DA+   E  VF+VGH
Sbjct  91    QILDLSSRGYRAVAPDLRGYGDSDSPPSVNDYTCFHIVGDLIALIDAIVGVEEKVFVVGH  150

Query  858   DWGAIIAWNFCMFRPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEA  679
             DWGA+IAWN CM+RPDR+KALVN SV  + R P RKP+  ++  +GDD+YICRFQ+PGE 
Sbjct  151   DWGAMIAWNLCMYRPDRVKALVNTSVTFNRRSPKRKPIPALKALYGDDYYICRFQEPGEI  210

Query  678   EEVFGSIDPTTLFKAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYAT  499
             E  F  I    +    L+ R P+P  +P +   +         +SLPPWLT+QD+ YY +
Sbjct  211   EAEFAEIGTERIMTEILSYRIPKPLMMP-KGRGKGKDHPLDTPISLPPWLTKQDMDYYVS  269

Query  498   KFGQSGFTGGLNYYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGG  319
             KF ++GFTG +NYYRN DRNWEL A ++G+Q++VP KFIVGDQDLTY+  G K+ I  G 
Sbjct  270   KFDKNGFTGPINYYRNLDRNWELNAPFTGAQVKVPTKFIVGDQDLTYNSFGAKQYIESGE  329

Query  318   LKKIVPNLQQVVVMEGVAHYINQEKPEEVNNHILEFIQNF  199
             +KK VP L++VVVMEGV H++ +EKP E++NHI EFI+N+
Sbjct  330   MKKDVPFLEEVVVMEGVGHFLQEEKPHEISNHIYEFIKNY  369



>ref|XP_011091000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=327

 Score =   400 bits (1027),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 239/325 (74%), Gaps = 11/325 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M  ++H T+S+NGI+MHVAE+G GP +LFLHGFP+ WYTWRHQ+ F A+ GYRA+APDLR
Sbjct  1     MVGVEHKTLSLNGISMHVAEMGHGPIILFLHGFPQCWYTWRHQITFFATHGYRALAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLP---EVFLVGHDWGAIIAWNFCMFRP  814
             GY DT   P +D   ++  H+VGD+VAL+DAL  P   +V +VGHDWGA++AW  C++RP
Sbjct  61    GYADTTGVPPSDPAKFTTLHVVGDIVALIDALAPPNDQKVLVVGHDWGALVAWALCLYRP  120

Query  813   DRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKA  634
             D++KALVNMSVV + R+P+RKPLE +R  +GDD+YICRFQ+PG  E  F  I   T+ K 
Sbjct  121   DKVKALVNMSVVFTRRNPSRKPLEMLRAVYGDDYYICRFQEPGAIEHEFAQIGTKTVLKH  180

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             FLT R P P  IP               +SLPPWL+++D+ YY +K+  +GFT  LNYYR
Sbjct  181   FLTYRTPGPLNIPKGK------PFPDTPISLPPWLSEEDVDYYTSKYNLTGFTAALNYYR  234

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
               D NWELTAAW+G+QI VPVKFIVGD DLTY+ PG KE IH+GG K+ VP L++VVVME
Sbjct  235   ALDINWELTAAWTGAQITVPVKFIVGDVDLTYNAPGCKEYIHKGGFKRDVPLLKEVVVME  294

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             GV H+I++EKP++VN HI  F + F
Sbjct  295   GVGHFIHEEKPDDVNAHIHSFFKQF  319



>ref|XP_010024724.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61194.1| hypothetical protein EUGRSUZ_H03958 [Eucalyptus grandis]
Length=323

 Score =   399 bits (1026),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 238/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             ME I+H TV+VNGI MHVA  G   GP VL LHGFPELWY+WRHQM  LA+ GYRA+APD
Sbjct  3     MEGIEHRTVAVNGITMHVAIKGPSGGPTVLLLHGFPELWYSWRHQMAGLAALGYRAVAPD  62

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             LRG+GDTDAP SA  Y+   + GDL +LLDA+   E  VF+VGHDWGAI AW+ C+FRPD
Sbjct  63    LRGFGDTDAPASAAGYTGLSVAGDLASLLDAVAKGEEKVFVVGHDWGAIAAWHLCLFRPD  122

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R+KALVN+SV  +PRHP RKPLE++R  +G+D+YICRFQ+PGE E  F  I    + + F
Sbjct  123   RVKALVNLSVPFTPRHPARKPLESLRAAYGEDYYICRFQEPGEMEAEFAQIGTRRVLEEF  182

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT R+P P  +P     +         + LP WLT++D+ Y+ +K+  +GFTGG NYYR 
Sbjct  183   LTYRNPGPLFLPK---GKGFGHPTDTPIVLPSWLTEEDVDYFTSKYETTGFTGGFNYYRA  239

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWELTA W+G+QI+VP KF+VGD DLTY+ PG K+ IH+GGLKK VP L+ VVVMEG
Sbjct  240   LDLNWELTAPWTGAQIRVPAKFMVGDLDLTYNSPGTKDFIHKGGLKKYVPFLEDVVVMEG  299

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH+I++E+P+EV  HI +F Q F
Sbjct  300   VAHFIHEERPQEVTQHIHDFFQMF  323



>ref|XP_009386486.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   399 bits (1025),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 236/320 (74%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H T+ VNG+N+HVAE+G+GP VL LHGFPELW++WRHQ++ LA++GYRA+APDLR
Sbjct  1     MEGISHRTLLVNGVNIHVAEMGEGPVVLLLHGFPELWFSWRHQIVSLAARGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             G+GD+DAPPS+  Y+ FH+VGDLVAL+ AL   +VF+VGHDWGA +AW  C+ RPD +KA
Sbjct  61    GFGDSDAPPSSSVYTAFHVVGDLVALIQALGPDQVFVVGHDWGAYMAWWLCILRPDMVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV  +PR+P R+P++  R  FGDD YICRFQ+ G  E     I  T   K FLT R
Sbjct  121   LVNLSVAYAPRNPGRRPVDACRTIFGDDHYICRFQEHGAMEAEIAQIGTTLFMKKFLTYR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P    IP     +V  E     V+LP WL+++DI Y+A+KF +SGFTGGLNYYR  + N
Sbjct  181   KPAAINIPKDKGLEVSLET---PVTLPSWLSEEDINYFASKFEKSGFTGGLNYYRCLNLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL+A W+  Q+ VPVKFI+GD DLTYH PG+++ IH+GG K  VP L+ VVVMEGV H+
Sbjct  238   WELSAPWTEVQVDVPVKFIIGDLDLTYHTPGIQDYIHKGGFKSAVPFLEDVVVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+P EV++ I  FI  F
Sbjct  298   INQERPHEVSDLIYHFIHKF  317



>ref|XP_008450607.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=317

 Score =   399 bits (1025),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 238/320 (74%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ I H TVSVNGIN+H+AE G+GP VLF+HGFPELWYTWRHQ+L L+S GY A+APDLR
Sbjct  1     MDTINHRTVSVNGINVHIAEKGEGPIVLFIHGFPELWYTWRHQILALSSLGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAP S  SYS+ HIVGDLVAL+++L + EVF+V HDWGA+IAW  C+FR + +KA
Sbjct  61    GYGDSDAPDSISSYSIMHIVGDLVALVESLGVKEVFVVAHDWGALIAWGLCLFRAEIVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PRHP RKP+E MR+ FGDD+YICRFQ PGE EE    +    + +  LT R
Sbjct  121   FVCLSVPFRPRHPNRKPVETMRKVFGDDYYICRFQNPGEIEEEMAQVGAKEVLRGILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                PP  P +   Q    +   +  LP WL+++D+ Y+A+K+ Q GFTG LNYYR+ D N
Sbjct  181   RQGPPIYPKK---QAFRARPESSSPLPSWLSEEDLSYFASKYEQKGFTGPLNYYRSMDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G Q++VPVKFIVGD D+ Y  PGVKE ++ GG KK VP LQ VV+MEGV H+
Sbjct  238   WELTAPWTGVQVKVPVKFIVGDVDMVYTTPGVKEYVNGGGFKKDVPFLQDVVIMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             +NQEKPEE+N HI +FI+ F
Sbjct  298   LNQEKPEEINTHIYDFIRKF  317



>ref|XP_006604802.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43315.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   399 bits (1024),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 232/320 (73%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MEGIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ FHIVGDLVAL+D+L + +VFLV HDWGAII W  CMFRPD++KA
Sbjct  61    GYGDTEAPPSISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV    R P  + ++ MR  +GDD+Y+CRFQ+PGE E     +    + K  LT+R
Sbjct  121   YVCLSVPFLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTGYVLKNILTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                PP +PH            +  SLP WLT+ D+ YY +KF ++GFTGGLNYYRNF+ +
Sbjct  181   KTGPPFLPHGEFGTGFNPDMSD--SLPSWLTEDDLAYYVSKFEKTGFTGGLNYYRNFNLD  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G QI+VPVKFI G+ D  Y    +KE IH GG K+ VPNL+QV+V +GVAH+
Sbjct  239   WELTAPWTGVQIKVPVKFITGELDSVYTSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  EE+N HI +FI+ F
Sbjct  299   NNQEAAEEINTHIYDFIKKF  318



>ref|XP_002318980.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE94903.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   398 bits (1023),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 233/320 (73%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H  V VN I+MH+AE G GP VLFLHGFPELWY+WRHQ+L L+S GY A+APDLR
Sbjct  1     MEGISHRMVKVNDIDMHIAEKGQGPVVLFLHGFPELWYSWRHQILALSSLGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SYS  HIVGDL+AL+D L + +VFLV HDWGA+I W  C+FRPDR+KA
Sbjct  61    GYGDTEAPASISSYSCLHIVGDLIALIDYLGVEQVFLVAHDWGALIGWYLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP+E+M+  FG+D+Y+CRFQ+PG  E          + K  LT R
Sbjct  121   YVCLSVPYRPRNPKMKPVESMKLVFGEDYYMCRFQEPGVIEAEIACAGTEEVLKKILTGR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P ++   +  E   E+V++P WL + D+ +YATK+ Q GFTGGLNYYR  D N
Sbjct  181   KPGPPCLPKENPFGIYPE---ESVTMPSWLPEADLSFYATKYSQKGFTGGLNYYRALDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA+W+G+ + VPVKF+VGD D+ Y  PG+KE ++ GG K  VP L++VVVMEGV H+
Sbjct  238   WELTASWTGAPVIVPVKFVVGDLDMVYTTPGMKEFVNSGGFKHYVPLLEEVVVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EE++NHI ++I  +
Sbjct  298   INQEKAEEISNHIYDYISKY  317



>ref|XP_007015353.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32972.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   398 bits (1023),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 236/323 (73%), Gaps = 7/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME ++H T+ VNGINMH+AE G GP +LFLHGFPELWY+WRHQ+  L+S GYRA+APDLR
Sbjct  1     MEGVEHRTLKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQINALSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP    SY+ FH+VGDLV LLDA+  P+  VF+VGHDWGA +AW  C+FRPD++
Sbjct  61    GFGDTDAPDRVSSYTCFHVVGDLVQLLDAVAPPQEKVFVVGHDWGAFMAWYLCLFRPDKV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KAL+N+SV          P++  R  +G+D+YICRFQ+PGE E  F  I    + K FLT
Sbjct  121   KALLNLSVPYIQLGRQMNPIDGWRAFYGNDYYICRFQEPGEIEAEFAEIGTERVVKEFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
              R P P  +P       L+    +T ++LP WLTQ+++ YY T+F + GFTGG+NYYRNF
Sbjct  181   YRVPGPILLPEGK----LFGHSADTPITLPSWLTQEEVNYYVTQFDKKGFTGGINYYRNF  236

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             +RNWEL A W G +I+VP KFIVGDQDL YH PG+KE IH GG KK VP+LQQVVVMEGV
Sbjct  237   NRNWELLAPWGGCEIKVPAKFIVGDQDLVYHMPGIKEYIHNGGFKKDVPHLQQVVVMEGV  296

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
              H+IN EK +++N HI +F + F
Sbjct  297   GHFINMEKADDINKHIYDFFRQF  319



>ref|XP_011010961.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   398 bits (1022),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 230/320 (72%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H TV+ NGINMH+A  G GP +LFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MDKIEHRTVATNGINMHIASTGTGPVILFLHGFPELWYSWRHQLLSLSSVGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP S   Y+  H+VGDL+ LLD+L +  VFLVGHDWGA+IAW FC FRPDR+KA
Sbjct  61    GYGDTDAPRSVSEYTGLHLVGDLIGLLDSLGIDMVFLVGHDWGAMIAWYFCTFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SV   PR+P    L+  R  FGD++Y  RFQ+PGEAE+ F  +D   L   F TN 
Sbjct  121   LVNTSVPFLPRNPQGNLLQWFRALFGDNYYFLRFQEPGEAEDDFAQVDTKRLMIKFFTNF  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P     +       +  SLP WL+++DI YYA KF  +GFTGGLNYYR     
Sbjct  181   GPNPPLMPKGIGVKAF----PDPPSLPSWLSEEDINYYAEKFNLTGFTGGLNYYRATAIT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+GS I VP KFIVGD DL Y+ PG+K+ IH GG KK VP L++VVVMEGVAH+
Sbjct  237   WELMAPWTGSPITVPAKFIVGDLDLLYNIPGLKDFIHNGGFKKDVPLLEEVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKPEEV+ HI +F++ F
Sbjct  297   LQQEKPEEVSKHIYDFVKKF  316



>ref|XP_011023717.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   398 bits (1022),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 236/320 (74%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ I H  V VNGI+MH+AE G GP VLFLHGFPELWY+WRHQ+L L+S GY+A+APDLR
Sbjct  1     MDGISHRMVKVNGIDMHIAEKGQGPVVLFLHGFPELWYSWRHQILALSSLGYQAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SYS  HIVGDL+AL+D L + +VFLV HDWGA+I W  C+FRPDR+KA
Sbjct  61    GYGDTEAPASISSYSCLHIVGDLIALIDYLGVEKVFLVAHDWGALIGWYLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP+E+M+  FG+D+Y+CRFQ+PG  E+         + K  LT+R
Sbjct  121   YVCLSVPYRPRNPKMKPVESMKLVFGEDYYMCRFQEPGVVEDEIARAGTEEVLKKILTDR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P P  +P ++   +  E   E V++P WL++ D+ +YATK+ Q GFTGGLNYYR  D N
Sbjct  181   KPGPLCLPKENPFGIYPE---EPVTMPSWLSEADLSFYATKYSQKGFTGGLNYYRALDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA+W+G+ + VPVKF+VGD D+ Y  PG+KE ++ GG K  VP L+++VVMEGV H+
Sbjct  238   WELTASWTGAPVNVPVKFVVGDLDMVYTNPGMKEFVNSGGFKHYVPLLEEIVVMEGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EE++NHI ++I  +
Sbjct  298   INQEKAEEISNHIYDYISKY  317



>gb|ACE82566.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   398 bits (1022),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 233/321 (73%), Gaps = 7/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV+VNGINMHVAE G GP VLFLHGFPELWYTWRHQ++  A  GYRA+APDLR
Sbjct  1     MESIEHRTVNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP    SY+ FH+VGDLVAL+++L +  VFLV HDWGA+I W  C+FRPD +KA
Sbjct  61    GYGDTDAPADVASYTCFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PRHP  KP+  MR  FGDD+Y+CRFQ P   +E+  +     L K  LT+R
Sbjct  121   YVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPRMEDEIAKNGSEAVL-KKILTDR  179

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P ++   +  + +     LP WL+Q D+KYY+TKF Q GFTGGLNYYR  D N
Sbjct  180   KPGPPCLPKENPFGISPDSK-----LPSWLSQDDLKYYSTKFDQKGFTGGLNYYRALDLN  234

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNL-QQVVVMEGVAH  262
             WELTAAW+G++ +VPVKF+VG+ DL Y  PG+KE +H GG KK VP L + VVVMEG AH
Sbjct  235   WELTAAWTGAKAKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAH  294

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQE+ +E N+HI  FI  F
Sbjct  295   FINQERAQETNSHIHNFINKF  315



>ref|XP_011010960.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   398 bits (1022),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 229/320 (72%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H TV+ NGINMH+A  G GP +LFLHGFPELWY+WRHQ+L L+S GYR IAPDLR
Sbjct  1     MDKIEHRTVATNGINMHIASTGTGPVILFLHGFPELWYSWRHQLLSLSSVGYRCIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP S   Y+  H+VGDL+ LLD+L +  VFLVGHDWGA+IAW FC FRPDR+KA
Sbjct  61    GYGDTDAPRSVSEYTGLHLVGDLIGLLDSLGIDMVFLVGHDWGAMIAWYFCTFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN SV   PR+P    L+  R   GDD+Y  RFQ+PGEAE+ F  +D   L   F TN 
Sbjct  121   LVNTSVPFLPRNPQGNLLQWFRALLGDDYYFLRFQEPGEAEDDFAQVDTKRLMIKFFTNF  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P     +       +  SLP WL+++DI YYA KF  +GFTGGLNYYR     
Sbjct  181   GPNPPLMPKGIGVKAF----PDPPSLPSWLSEEDINYYAEKFNLTGFTGGLNYYRATAIT  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WEL A W+GS I VP KFIVGD DL Y+ PG+K+ IH GG KK VP L++VVVMEGVAH+
Sbjct  237   WELMAPWTGSPITVPAKFIVGDLDLLYNIPGLKDFIHNGGFKKDVPLLEEVVVMEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
             + QEKPEEV+ HI +F++ F
Sbjct  297   LQQEKPEEVSKHIYDFVKKF  316



>gb|KFK41013.1| hypothetical protein AALP_AA2G073900 [Arabis alpina]
Length=325

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/327 (57%), Positives = 238/327 (73%), Gaps = 10/327 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEI-GDG----PAVLFLHGFPELWYTWRHQMLFLASKGYRAI  994
             M+ I+H T+ VNGINMHVAE  G G    P +LF+HGFPELWYTWRHQM+ L+S GYR I
Sbjct  1     MDGIEHKTLKVNGINMHVAEKPGSGSEGDPIILFIHGFPELWYTWRHQMVALSSLGYRTI  60

Query  993   APDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQL--PEVFLVGHDWGAIIAWNFCMF  820
             APDLRGYGDTDAP   + Y+  ++VGDLVAL++ +     +VF+VGHDWGA+IAW  CM+
Sbjct  61    APDLRGYGDTDAPEKVEEYTYLNVVGDLVALINTVTSGDEKVFVVGHDWGAMIAWQLCMY  120

Query  819   RPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLF  640
             RP+++KALVNMSVV +PR+P R P+  +R  FGDD+YICRFQ+PGE E  F  +    + 
Sbjct  121   RPEKVKALVNMSVVFTPRNPDRVPVPTLRRVFGDDYYICRFQKPGEIEAEFKKLGTEKVL  180

Query  639   KAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNY  460
             K FLT + P+P  IP     ++         +LP WLTQ+D+ YY TK+ + GFTG +NY
Sbjct  181   KEFLTYKTPKPLFIPK---GELFKGSENAAAALPHWLTQEDLDYYTTKYEKRGFTGAINY  237

Query  459   YRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVV  280
             YRN DR+WELTA W+G++I VPVKFIVGDQDLTY+ PG KE IH GG KK VP L + VV
Sbjct  238   YRNLDRSWELTAPWTGAKIAVPVKFIVGDQDLTYNSPGAKEYIHGGGFKKDVPLLDETVV  297

Query  279   MEGVAHYINQEKPEEVNNHILEFIQNF  199
             +EG+ H++++E PEE+N HI  F Q F
Sbjct  298   LEGLGHFLHEENPEEINQHIHSFFQKF  324



>ref|XP_008807392.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 239/322 (74%), Gaps = 6/322 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             +G   I H TV VNGI MHV E G+GPAVL LHGFPELWY+WRHQ+  LA++GYRAIAPD
Sbjct  2     EGASGISHRTVEVNGIRMHVVEKGEGPAVLLLHGFPELWYSWRHQIAGLAARGYRAIAPD  61

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGDTDAPP   SYS  HIVGDLVALLDAL LP VF+VGHDWGA+IAW  CMFRPD++
Sbjct  62    LRGYGDTDAPPDVASYSALHIVGDLVALLDALALPHVFVVGHDWGALIAWYLCMFRPDKV  121

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV   PR+P  K ++  R+ +GDD+YICRFQ+PG  E  F  I   ++F+  L 
Sbjct  122   KALVNLSVAFMPRNPAMKTVDYFRKLYGDDYYICRFQEPGAIEARFAQIGTASIFRTILQ  181

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +RDP P  IP +           E   L  WL+++DI YYA+KF +SGFTG +NYYR  +
Sbjct  182   SRDPGPFLIPKEG------WDLPEKSPLCSWLSEEDINYYASKFDKSGFTGPVNYYRCMN  235

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTA W+G QI+VP KFIVGD DLTYH+PG+++ IH GG K+ VP LQ+VVVMEGV 
Sbjct  236   LNWELTAPWTGVQIKVPAKFIVGDLDLTYHYPGIQDYIHNGGFKQNVPLLQEVVVMEGVG  295

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQEK  E+ +HI +FIQ F
Sbjct  296   HFINQEKGHEITDHIYDFIQKF  317



>ref|XP_009629075.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=315

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 237/323 (73%), Gaps = 11/323 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H +V+VNGINMHVAE G GP VLFLHGFPELWYTWRHQ++  A  GYRA+APDLR
Sbjct  1     MEGIEHRSVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFAELGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP    SY+ FH+VGDLVAL+++L +  VFLV HDWGA+I W  C+FRPD +KA
Sbjct  61    GYGDTDAPGEVASYTYFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEV--FGSIDPTTLFKAFLT  625
              V +SV   PRHP  KP+  MR  FGDD+Y+CRFQ PG  +E+  +GS     + K  LT
Sbjct  121   YVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPGMEDEIAKYGS---EAVLKKILT  177

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +R P PP +P ++   +  + +     LP WL+Q D+ YY++KF Q GFTGGLNYYR  D
Sbjct  178   DRKPGPPCLPKENPFGISSDSK-----LPSWLSQDDLNYYSSKFDQKGFTGGLNYYRALD  232

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQ-VVVMEGV  268
              +WELTAAW+G+ ++VPVKF+VG+ DL Y  PG+KE +H GG KK VP L++ VVVMEG 
Sbjct  233   LSWELTAAWTGATVKVPVKFVVGELDLVYTTPGMKEYVHGGGFKKDVPMLEEDVVVMEGA  292

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH+INQE+ +E N+HI +FI  F
Sbjct  293   AHFINQERAQETNSHIHDFINKF  315



>gb|KHG24497.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 236/320 (74%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             MERI+H  V+VNGI+MHVAE G+GP +LFLHGFPELWYTWRHQ++ L+S GY A+APDLR
Sbjct  1     MERIRHKMVNVNGISMHVAEKGEGPVILFLHGFPELWYTWRHQIIALSSLGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP +  SYS   IVGDLVAL+D+L + +VFLV HDWGAII W  C+FRPDR+KA
Sbjct  61    GYGDTEAPTAISSYSCMQIVGDLVALIDSLGVEQVFLVAHDWGAIIGWYLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR P  KP+E+MR  FGDD+YICRFQ+PG+ E        + + K  +++R
Sbjct  121   FVCLSVPFMPRKPQMKPVESMRLFFGDDYYICRFQEPGKIEAEIARYGASNVLKKIISSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P  +   +   K    ++LP W +++D+ YYA KF + GFTG LNYYR FD N
Sbjct  181   KPGPPCMPKDNAFGI---KPDTPITLPSWFSEEDLSYYANKFNKKGFTGALNYYRAFDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WE TA W+ +Q++VPVKFIVGD D  Y  PG+KE ++ G  K+  P L++VV+M+GV H+
Sbjct  238   WEQTAPWTNTQVKVPVKFIVGDLDSVYTTPGMKEYVNGGDFKRDAPMLEEVVIMKGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+ +E+N+HI +FI+NF
Sbjct  298   INQERADEINSHIHDFIKNF  317



>ref|XP_010914485.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=319

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 239/323 (74%), Gaps = 6/323 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             +G   I H TV VNGI MHVAE G+GP VL LHGFPELWYTWRHQ+  LA++GYRAIAPD
Sbjct  2     EGASGISHRTVEVNGIRMHVAEKGEGPPVLLLHGFPELWYTWRHQIAGLAARGYRAIAPD  61

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGDTDAPP   SY+VFH+VGDLVALLD L L +VF+VGHDWGA +AW+ CM RPDR+
Sbjct  62    LRGYGDTDAPPDVASYTVFHLVGDLVALLDTLALSQVFVVGHDWGAFVAWHLCMLRPDRV  121

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV    R+P  KPL+ +R ++GD++YI RFQ+ G AE  F  +   T+ + F T
Sbjct  122   KALVNLSVPFMSRNPAAKPLDRVRASYGDEYYIIRFQEHGAAEAEFARLGTATVLRKFFT  181

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  +P +      +    E + LP WL+++DI Y  +KF +SGFTG +NYYR  D
Sbjct  182   YRNPGPLFMPKEG-----WCSPNEQIPLPFWLSEEDINYLTSKFEKSGFTGPINYYRCLD  236

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGV-KELIHEGGLKKIVPNLQQVVVMEGV  268
              NWEL A W+G+QI+VP KFI+GD DL YH P + ++ IH+GG +K VP L++VVVMEGV
Sbjct  237   LNWELAAPWTGAQIKVPTKFIIGDLDLNYHDPPLMQDYIHKGGFQKDVPLLREVVVMEGV  296

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH+INQEK +E+ +HI +FI+ F
Sbjct  297   AHFINQEKAQEITDHIYDFIRKF  319



>ref|XP_007147002.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
 gb|ESW18996.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
Length=320

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 238/321 (74%), Gaps = 2/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME ++H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L++ GYRA+APDLR
Sbjct  1     MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSALGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP S  SY++ H+V D+VAL+D+L + +VFLV HDWGA++ W  C+FRPDRIKA
Sbjct  61    GYGDTDAPASVSSYTILHLVADVVALIDSLGVDQVFLVAHDWGALVGWYTCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP++ MR  +GDD+YICRFQ+PG+ E ++ + +     K  LT+R
Sbjct  121   YVCLSVPFMPRNPKVKPVDAMRALYGDDYYICRFQEPGKMETLYDN-NIEEAIKNMLTSR  179

Query  618   DPRPPRIPHQSV-AQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
              P PP +P +   +  L      +  LP WL+Q+D+ YYA+KFG++G TGGLNYYRN + 
Sbjct  180   RPGPPILPKEGAGSNPLASGSLPSRPLPSWLSQEDLTYYASKFGKTGLTGGLNYYRNLNL  239

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+G Q++VPVKFI GD D+ Y   G K+ I  G  K+ VP L++VVV EGVAH
Sbjct  240   NWELTAAWTGVQVKVPVKFITGDLDIVYTSLGTKDYIESGAFKRDVPFLEEVVVQEGVAH  299

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E+V+NHI  FI+NF
Sbjct  300   FNNQEAAEDVSNHIYNFIKNF  320



>ref|XP_006344695.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=314

 Score =   397 bits (1019),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 233/322 (72%), Gaps = 10/322 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T++VNGINMHVAE G GP VLFLHGFPELWYTWRHQ++ LA +GYRA+APDLR
Sbjct  1     MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP    SY+ FH+VGDLVAL+++L +  VFLV HDWGA+I W  C+FRPD +KA
Sbjct  61    GYGDTDAPKEVTSYTYFHVVGDLVALIESLGVENVFLVAHDWGAMIGWYLCLFRPDLVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEV--FGSIDPTTLFKAFLT  625
              V +SV + PRHP  KP+  MR   GDD+Y+CRFQ PG  +E+  +GS     + K  L 
Sbjct  121   YVCLSVPLRPRHPKMKPIPTMRAFLGDDYYMCRFQDPGMEDEMAKYGS---EAVLKKILI  177

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             +R P PP +P  +   +  + +     LP WL+Q D+ YY+TKF Q GFTGGLNYYR  D
Sbjct  178   DRKPGPPCLPKDNPFGISTDDK-----LPLWLSQDDLNYYSTKFDQKGFTGGLNYYRALD  232

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWELTA W+G ++ VPVKF+VGD D+ Y  PG+KE +H GG KK VP L  VVV+EG A
Sbjct  233   LNWELTAPWTGVKVNVPVKFVVGDLDVVYTTPGMKEYVHGGGFKKDVPMLDDVVVLEGAA  292

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQE+ +E N+HI +FI  F
Sbjct  293   HFINQERAQETNSHIYDFINKF  314



>ref|XP_011092097.1| PREDICTED: bifunctional epoxide hydrolase 2 [Sesamum indicum]
Length=317

 Score =   396 bits (1018),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 234/321 (73%), Gaps = 5/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TVSVNGINMHVAE G GP VLFLHGFPELWYTWRHQ++  A+ GYRA+APDLR
Sbjct  1     MEGIEHRTVSVNGINMHVAEKGQGPIVLFLHGFPELWYTWRHQIVAFAALGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQL-PEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             GYGDTDAP    SYS  H+VGD+VAL+++L    +VFLV HDWGA+I W  C+FRPD +K
Sbjct  61    GYGDTDAPAEVSSYSCLHVVGDIVALIESLGGGDQVFLVAHDWGAMIGWYLCLFRPDLVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V+++V   PRHP  KP+E MR  FG+D+Y+CRFQ+PG+ E          + K  LT+
Sbjct  121   AYVSLTVPFRPRHPNVKPVEGMRAFFGEDYYMCRFQEPGKMESEIARYGAEAVIKKILTD  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R P PP +P ++     +    + + LPPW T+ D+KYYA  + + GFTGGLNYYR  D 
Sbjct  181   RTPGPPYLPKETP----FGSNIDDIKLPPWFTEDDLKYYAENYEKRGFTGGLNYYRALDL  236

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+G++++VPVKF+VGD D+ Y  PG+KE +H GG K  VP L++ VVM+ V H
Sbjct  237   NWELTAAWTGAKVRVPVKFVVGDVDMVYTTPGLKEYVHGGGFKNDVPLLEECVVMDNVGH  296

Query  261   YINQEKPEEVNNHILEFIQNF  199
             ++NQEK +EVN +I EFI+ F
Sbjct  297   FLNQEKADEVNAYIHEFIKKF  317



>gb|KDP27828.1| hypothetical protein JCGZ_18908 [Jatropha curcas]
Length=321

 Score =   396 bits (1018),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 242/324 (75%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             ME I+H TV+VNGINMHVAE+G   GP +LF+HGFPELWY WR ++L LAS+GYRA+APD
Sbjct  1     MEAIEHKTVNVNGINMHVAELGPVQGPVILFIHGFPELWYCWRREILALASQGYRAVAPD  60

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPD  811
             LRGYGDTDAP    SY  FHIVGDL+ LLDA+  Q  +VF VGHDWGA IAW+ C+FRPD
Sbjct  61    LRGYGDTDAPADPQSYPCFHIVGDLIGLLDAVAPQQEKVFGVGHDWGAPIAWDLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R+KALVN+SV    R+P  K ++  R  +GDDFY+CRFQ+ G+ E  F  +    + K F
Sbjct  121   RVKALVNLSVPFFRRNPEMKFVDAFRAAYGDDFYMCRFQEYGDIEAEFAELGTERVMKEF  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT R+P P   P     +V  +  G+ + LP WL+++++ YY TKF ++G TGG+NYYRN
Sbjct  181   LTYRNPGPFIFPK---GKVFSQPAGDPIILPSWLSEEEVHYYTTKFDKTGLTGGVNYYRN  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              DRNWELTA W+ +Q++VP KFIVGD+DL Y F G+K+ I +GG K+ VP L++VVVMEG
Sbjct  238   IDRNWELTAPWTEAQVKVPSKFIVGDEDLVYRFVGMKDYIEKGGFKRDVPLLEEVVVMEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH++NQE+P+E+NNHI +F + F
Sbjct  298   VAHFLNQERPDEINNHIYDFFKKF  321



>ref|XP_002455386.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
 gb|EES00506.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
Length=325

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 232/324 (72%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIA  991
             +E ++H TV  NG+ +HVAE G      P VL +HGFP+LWY WRHQM  LA++GYRA+A
Sbjct  5     VEGVRHRTVEANGVRLHVAEAGPEEAGAPVVLLVHGFPDLWYGWRHQMAALAARGYRAVA  64

Query  990   PDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPD  811
             PDLRGYGD+D+PP A SY+ FH+VGDLVAL+  L  P VF+VGHDWGAI+AW  C+ RPD
Sbjct  65    PDLRGYGDSDSPPDASSYTTFHVVGDLVALISDLGQPRVFVVGHDWGAIVAWQLCLLRPD  124

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
              ++ALVN+SVV  PR P   PL+ +R   G+D Y+CRFQ+PG AE  F   D   +FK  
Sbjct  125   LVRALVNLSVVYHPRRPEMSPLQTIRAACGEDHYMCRFQEPGVAEAEFALYDTKYVFKKT  184

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
                R P P  +P     +  ++      + PPWL+++DI YYA KF ++GFTGGLNYYR 
Sbjct  185   FGMRKPAPLVLPKD---KSFFDSLDSDGTCPPWLSEEDISYYAEKFAKTGFTGGLNYYRC  241

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              DR+WEL+A W+G+QI+VP KFIVGD D+TY+ PGV + IH+GG K  VPNL+ VV+MEG
Sbjct  242   MDRSWELSAPWTGAQIKVPSKFIVGDLDITYNAPGVPDYIHKGGFKASVPNLEDVVIMEG  301

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             V+H++NQEKP EV++HI EF   F
Sbjct  302   VSHFLNQEKPNEVSDHICEFFSKF  325



>ref|XP_003626243.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08020.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82461.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 234/321 (73%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S  SY++FH+VGD+VAL+D+L + +VFLV HDWGA+I W  CMFRP+RIK
Sbjct  61    RGYGDTDAPASISSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAMIGWYLCMFRPERIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV  + R+PT KP++  R  +GDD+YICRFQ+PG+ E     +    + K  LT 
Sbjct  121   AYVCLSVPFNHRNPTVKPIDGRRAAYGDDYYICRFQEPGKIEAEIAEVGTAYVLKNVLTT  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   PP +P             ET  LP WLT+ D+ Y+ +K+ ++GFTGGLNYYRNF+ 
Sbjct  181   RKTGPPILPKGEFGTGFNPDTPET--LPTWLTEDDLAYFVSKYEKTGFTGGLNYYRNFNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA WSG +I+VPVKFI GD D+ Y  P VKE IH GG K+ VPNL++V+V +GVAH
Sbjct  239   NWELTAPWSGVKIKVPVKFITGDLDMVYTSPHVKEYIHGGGFKEDVPNLEEVIVQKGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++NHI EFI+ F
Sbjct  299   FNNQEAAEEISNHIYEFIKKF  319



>gb|AFK39700.1| unknown [Lotus japonicus]
Length=322

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/324 (58%), Positives = 239/324 (74%), Gaps = 6/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S+GYRA+APDLR
Sbjct  1     MESIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSRGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SY+ FH+VGD++AL+D+L + +V+LVGHDWGA++ W  C+FRPDRIKA
Sbjct  61    GYGDTEAPSSVTSYTCFHLVGDIIALIDSLGVDKVYLVGHDWGAVLGWYVCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENM---RETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
              V +SV I        P++ +   R  +GDDFY+CRFQ+PG+ E  F  +D   LFK  L
Sbjct  121   YVCLSVPIRGFLRIDSPVKTVDGFRAVYGDDFYVCRFQEPGKMEAEFAEVDTAYLFKNIL  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T R   PP  P             ET  LP WL+++D++Y+A+KF ++GF+GGLNYYRN 
Sbjct  181   TMRKTGPPIFPKGEYGTGFNPDAPET--LPSWLSEEDLEYFASKFKKTGFSGGLNYYRNL  238

Query  447   DRNWELTAAWSGSQI-QVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             + NWELTA W+G  I  VPVKFIVGD D+TY+F G+K+ IH+GG KK VP L++VVV EG
Sbjct  239   NLNWELTAPWTGVGITNVPVKFIVGDVDITYNFTGMKDYIHKGGFKKDVPTLEEVVVQEG  298

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH+INQE  E+V+NHI +FI+ F
Sbjct  299   VAHFINQEAAEDVSNHIYDFIKKF  322



>emb|CDP17206.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 233/320 (73%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  V +NGINMHVAE G+GP VLFLHGFPELWYTWRHQ+   A+ GYRA+APDLR
Sbjct  1     MEGIEHKIVDLNGINMHVAEKGEGPVVLFLHGFPELWYTWRHQITAFATLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP S  SY+ FHIVGDLVAL+ +L +  VFLV HDWGA+IAW  C+FRPD +KA
Sbjct  61    GYGDTDAPSSISSYTCFHIVGDLVALIQSLGVDHVFLVAHDWGAMIAWYLCLFRPDMVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V++++   PR+P  KP+  +R  FG+++Y+CRFQ+PGE E          + K  LT+R
Sbjct  121   FVSLTLPFRPRNPKMKPIAGLRAFFGEEYYMCRFQEPGEIEAEIAKYGSKAVLKKILTDR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P  +   +        + LP WL+++D+KYYA K+ Q GFTGGLNYYR  D N
Sbjct  181   KPGPPCLPKGNPFGI---SPDTDIKLPAWLSEEDLKYYANKYAQKGFTGGLNYYRALDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTAAW+G+Q++VPVKFIVGD D+ Y  PG +E +H GG K+ VP L++ V+M+G  H+
Sbjct  238   WELTAAWTGAQVKVPVKFIVGDLDMVYTTPGTQEYVHGGGFKRDVPFLEEPVIMKGTGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             ++QE+ EE+N+HI  FI+ F
Sbjct  298   LHQERAEEINHHIHHFIKMF  317



>ref|XP_009622179.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=325

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 245/324 (76%), Gaps = 10/324 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ IQH  + VNGINMH+AE+G GP VLFLHGFPELWY+WR+QM F+A  GYRA+APDLR
Sbjct  4     MKEIQHKLLRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRYQMPFMAGHGYRAVAPDLR  63

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQ--LPEVFLVGHDWGAIIAWNFCMFRPD  811
             G+GDT    + D   ++  H+VGD+V LL+ +     +VF+VGHDWGA+IAW  C++RPD
Sbjct  64    GFGDTTGALNDDFTKFTTLHVVGDIVELLNIISPDQEKVFVVGHDWGAMIAWALCLYRPD  123

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVNMSV  +P++P  +P+  +R T+GD++YI RFQ+PGE EE F  I   T+ +  
Sbjct  124   KVKALVNMSVPFTPQNPIIRPIARLRATYGDEYYIIRFQEPGEIEEEFAQIGTKTVLEKL  183

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LTNR+P P ++P        ++K    V LPPWLT++++ YYATK+ Q+GFTGGLNYYR 
Sbjct  184   LTNRNPEPLKVPKGKP----FDK--SPVKLPPWLTEKEVDYYATKYEQTGFTGGLNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWELTA W+G++I+VPVKFIVGD D+TY+  GVK+ IH+GGLKK VP L+ VV+++G
Sbjct  238   LDLNWELTAPWTGAKIKVPVKFIVGDLDITYNAAGVKDYIHKGGLKKDVPLLEDVVILKG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH++ QEKP+EVN HI  F+Q F
Sbjct  298   VAHFLQQEKPDEVNKHIHAFLQGF  321



>ref|XP_009414133.1| PREDICTED: bifunctional epoxide hydrolase 2 [Musa acuminata subsp. 
malaccensis]
Length=349

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 238/319 (75%), Gaps = 4/319 (1%)
 Frame = -1

Query  1155  ERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             E I H  VSVNGINMHVAE G+GP VL LHGFPELWYTWRHQM  LA+ G+RA+APDLRG
Sbjct  35    EGISHRMVSVNGINMHVAEKGEGPTVLLLHGFPELWYTWRHQMHGLAACGFRAVAPDLRG  94

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKAL  796
             +GDTDAPP+A +YS+ HIVGDL+ALLD+L   +VF+VGHDWG+++AWN  MFRPD++ A+
Sbjct  95    FGDTDAPPAAAAYSILHIVGDLIALLDSLGQDKVFVVGHDWGSMVAWNLSMFRPDKVNAM  154

Query  795   VNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRD  616
             VN+S   +PR+PTRK LE +R  FGDD+Y+CRFQ+PG+ E  F  +    + K FLT R+
Sbjct  155   VNLSQAFTPRNPTRKSLEYLRTVFGDDYYMCRFQEPGKIEAEFARLGTAWVLKKFLTYRN  214

Query  615   PRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNW  436
             P P  I         +      + LP WL++ DI YY +K+ ++GFTGGLNYYR+ D NW
Sbjct  215   PGPLYITEDQG----WGSSDSKILLPSWLSEVDINYYTSKYEKAGFTGGLNYYRSLDLNW  270

Query  435   ELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYI  256
             ELTA W+G++I+VP KFIVGD DLTYH PG ++ IH+GGLK  VP L +VVVM+ V H+I
Sbjct  271   ELTAPWTGARIKVPAKFIVGDLDLTYHSPGAQDFIHKGGLKNYVPLLDEVVVMKEVGHFI  330

Query  255   NQEKPEEVNNHILEFIQNF  199
             N+EKP E+  +I +FI  F
Sbjct  331   NEEKPTEITENICDFITKF  349



>ref|XP_008341331.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 240/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I+H TV VNGINMHVAE G+GP +LF+HGFPELWY+WRHQ+L L+  GYR +APDLRGYG
Sbjct  6     IEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSDLGYRXVAPDLRGYG  65

Query  969   DTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIKAL  796
             DTDAP S  SY+  H+VGDLVALLDA+     +VF+V HDWGA+IAW   +FRPDR+KAL
Sbjct  66    DTDAPASPSSYTCLHMVGDLVALLDAIAPDQEQVFVVAHDWGAVIAWYLXLFRPDRVKAL  125

Query  795   VNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRD  616
             V++SV   PR+P RK +E+ +  +GDD+Y+CRFQ+PG  E  F  +  T + K FLT R+
Sbjct  126   VSLSVQFIPRNPQRKFIESFQAAYGDDYYMCRFQEPGVIEAEFAQMGTTRVIKEFLTYRN  185

Query  615   PRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNW  436
             P P  +P     +         + LP WL++ ++ YYA KF ++GFTGG+NYYRN D NW
Sbjct  186   PXPLFLPK---GKGFGHPXDTPIVLPSWLSEDEVNYYAAKFDKTGFTGGINYYRNLDINW  242

Query  435   ELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYI  256
             ELTA W+G+Q++VPVKF+VGDQDL Y+  G ++ IH+GG KK VP L++V+V+EGVAH++
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAQDFIHKGGFKKFVPLLEEVIVLEGVAHFL  302

Query  255   NQEKPEEVNNHILEFIQNFH  196
              QEKP+E++ HI +FI+ FH
Sbjct  303   QQEKPDEISKHIHBFIKKFH  322



>ref|XP_002283462.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   394 bits (1013),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 231/320 (72%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  VSVNGI MHVAE G GP VLFLHGFPELWYTWRHQ++ +AS GY A+APDLR
Sbjct  1     MEGIEHRMVSVNGIKMHVAEKGQGPVVLFLHGFPELWYTWRHQIIAMASHGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GY D++AP S  SY+  H+VGDL+AL+D L   +VFLVGHDWGA I W  C+FRPDR+KA
Sbjct  61    GYSDSEAPASFTSYTCLHVVGDLIALIDCLGADKVFLVGHDWGAQIGWYMCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V+++V   PR+P  +P+E MR  FGDD+Y+CRFQ+PGE E     +    + K  LT+R
Sbjct  121   YVSLTVPFRPRNPKIRPIEGMRAFFGDDYYMCRFQKPGEIEAEIARLGSKEVLKRILTDR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +P ++   +   K      LP W +++D+ YYA K+ + GFTGGLNYYR  D N
Sbjct  181   KPGPPCLPKENPFGI---KAIPPSPLPSWFSEEDLNYYARKYDEKGFTGGLNYYRALDLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G Q++VPVKF+VGD D+ Y  PGVKE +  G  KK VP L+ +V++EG  H+
Sbjct  238   WELTAPWTGEQVRVPVKFVVGDLDMVYTTPGVKEYVDSGAFKKDVPCLEDIVIIEGAGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEK EE+NN+I++FI+ F
Sbjct  298   INQEKAEEINNYIVDFIRKF  317



>ref|NP_001238563.1| epoxide hydrolase [Glycine max]
 dbj|BAA09852.1| Epoxide hydrolase [Glycine max]
 emb|CAA55293.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 238/321 (74%), Gaps = 6/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  26    MEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  85

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ FHIVGDLVAL+D+L + +VFLV HDWGAII W  CMFRPD++KA
Sbjct  86    GYGDTEAPPSISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKA  145

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV +  R P  + ++ MR  +GDD+Y+CRFQ+PGE E     +    + K  LT R
Sbjct  146   YVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLKNILTTR  205

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             +P PP +P        ++   E   +LP WLT++D+ YY +KF ++GFTG LNYYRNF+ 
Sbjct  206   NPGPPILPKGR-----FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNL  260

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVK+I G+ D+ Y+   +KE IH GG K+ VPNL+QV+V +GVAH
Sbjct  261   NWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAH  320

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++N+I +FI  F
Sbjct  321   FNNQEAAEEIDNYIYDFINKF  341



>ref|XP_006342824.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=325

 Score =   394 bits (1013),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 239/323 (74%), Gaps = 9/323 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+++H T+ VNGINMH+AE+G GP VLFLHGFPELWY+WRHQM F+A+ GYR +APDLR
Sbjct  1     MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFMAAHGYRVVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE-VFLVGHDWGAIIAWNFCMFRPDR  808
             G+GDT   P  D   ++  H+VGDLV LL+ +   + VFLVGHDWGA+IAW+ C++RPD+
Sbjct  61    GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPDQKVFLVGHDWGAMIAWDMCLYRPDK  120

Query  807   IKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
             IKALVNMSV   PR+P  +P+  +R  +GD++YI RFQ+PGE EE F  I   T+ +  L
Sbjct  121   IKALVNMSVPFFPRNPIIRPIVALRAIYGDEYYIIRFQEPGEIEEEFAQIGTKTVLEKML  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T RDP P ++P               V LPPWLT+ D+ YYATK+  +GFTGGLNYYR  
Sbjct  181   TIRDPEPLKLPKGKPFD------DSPVILPPWLTETDVDYYATKYEHTGFTGGLNYYRAL  234

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             D NWELTA W+G++I+VPVKFIVGD DLTY+  GVK  I++GGLKK VP L+ VV+++GV
Sbjct  235   DLNWELTAPWTGAKIEVPVKFIVGDLDLTYNSAGVKFYINKGGLKKNVPLLEDVVILKGV  294

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH++ QEKP+EVN HI  F Q+F
Sbjct  295   AHFLQQEKPDEVNEHIHVFFQSF  317



>ref|XP_010105137.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03945.1| Epoxide hydrolase 2 [Morus notabilis]
Length=319

 Score =   394 bits (1012),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 243/323 (75%), Gaps = 7/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ I+H TV VNGI+MHVAE GDGP +LF+HGFPELWY+WRHQ+  L+S G+RA+APDLR
Sbjct  1     MDGIEHRTVEVNGIHMHVAEKGDGPVILFIHGFPELWYSWRHQIAALSSLGFRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRI  805
             GYGD+ AP S   Y+   IVGDL+ALLDA+   +  VF+VGHDWGA+IAW  C+FRPDR+
Sbjct  61    GYGDSAAPESPAVYTCLDIVGDLIALLDAIAADQDKVFVVGHDWGALIAWYLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV  +PR+P R+P+ +MR   GD++YICRFQ+ GE E     I    + + FLT
Sbjct  121   KALVNLSVAFNPRNPRRRPIHSMRAVCGDNYYICRFQEFGEIEAELEKIGIDRVLREFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
              R P P  +P        +E+  +  +SLP WL+++D+KYY +KF ++GFTGG+NYYRN 
Sbjct  181   YRHPGPLFLPKGKG----FERPVDVPISLPDWLSEEDLKYYVSKFEKTGFTGGINYYRNI  236

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             DRNWEL A W+G+ I+VPVKFIVGD DLTY+  G K+ +H+GG K+ VP LQ+VV+MEGV
Sbjct  237   DRNWELVAPWTGTPIKVPVKFIVGDLDLTYNSFGAKDYVHKGGFKRDVPFLQEVVIMEGV  296

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
              H+INQE+P+E+N+HI +F   F
Sbjct  297   GHFINQERPQEINHHIYDFFNKF  319



>ref|XP_004152243.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156833.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52824.1| hypothetical protein Csa_4G001910 [Cucumis sativus]
Length=318

 Score =   394 bits (1012),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 236/325 (73%), Gaps = 13/325 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             ME I H TV  NGIN+HVA  G   GP VL LHGFPELWY+WRHQ++FL+S GYR IAPD
Sbjct  1     METINHITVQTNGINLHVATAGPVTGPPVLLLHGFPELWYSWRHQIIFLSSVGYRVIAPD  60

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGD+DAPPS+D+Y+  HIVGD+V LL+ L + +V LVGHDWGA+IAW FC+FRPDRI
Sbjct  61    LRGYGDSDAPPSSDTYTALHIVGDVVGLLNELGIDKVLLVGHDWGALIAWYFCLFRPDRI  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KA V +SV   PR+P    +E  +   GD FY+ RFQ+PG+AE+ F S+D    FK  ++
Sbjct  121   KASVILSVQFFPRNPKVSFVEGFKAVLGDQFYMVRFQEPGKAEKEFASVDIREFFKNVMS  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETV---SLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
             NRDP  P +P         E++ E V   SL PWLT QDI YYA KF  SGFTGGLNYYR
Sbjct  181   NRDPSAPYLPG--------EEKFEGVPPPSLAPWLTPQDIDYYAQKFSHSGFTGGLNYYR  232

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
              FDR WELTA W+ ++I+VPVKFIVGD DLTYHFPG ++ I+    +K VP L++V+VM+
Sbjct  233   AFDRTWELTAPWTAAEIKVPVKFIVGDLDLTYHFPGGQDYINGDAFRKDVPGLEEVIVMK  292

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
               +H+INQE+P+E+N HI +F   F
Sbjct  293   DTSHFINQERPDEINCHIHDFFNKF  317



>ref|XP_004494576.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=319

 Score =   394 bits (1012),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 235/321 (73%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV  NGI +H+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEGIEHRTVEANGIKIHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S +SY++FH+VGD+V ++DAL + +VFLV HDWGAI+ W  C+FRP+RIK
Sbjct  61    RGYGDTDAPGSVNSYTIFHLVGDIVGVIDALGVDQVFLVAHDWGAIVGWYLCLFRPERIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  K ++ MR  +GDD+YICRFQ+PG+AE  F  +    L K  LT+
Sbjct  121   AYVALSVPFMPRNPKFKTVDAMRALYGDDYYICRFQEPGKAEGEFAKVGAELLLKGMLTS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   PP +P + +   L         LP WL+Q+D+ YYA+KF +SGFTG LNYYRN + 
Sbjct  181   RRTGPPILPKEGMGSNL--DPSSPHPLPSWLSQEDLSYYASKFDKSGFTGPLNYYRNLNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+ ++++VPVKFI GD DL Y+  G K+ I  GG K+ VPNL++VV+ EGVAH
Sbjct  239   NWELTAAWTRAKVKVPVKFITGDLDLVYNSLGTKQYIESGGFKRDVPNLEEVVIQEGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E++ NHI EFI+ F
Sbjct  299   FNNQEAAEDITNHIYEFIKKF  319



>ref|XP_007147004.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
 gb|ESW18998.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
Length=318

 Score =   394 bits (1011),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 228/320 (71%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH  V VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S+GYRA+APDLR
Sbjct  1     MEGIQHKEVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SYS F IVGDLVAL+D L + +VFLV HDWGAII W  CMFRPDR+KA
Sbjct  61    GYGDTEAPASMSSYSCFDIVGDLVALIDLLGVEQVFLVAHDWGAIIGWYLCMFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV +  R+P  + ++ MR  +GDD+YICRFQ+PGE E     +    + K  LT R
Sbjct  121   YVCLSVPLLHRNPEIRTVDAMRAMYGDDYYICRFQKPGEMEAQMAEVGTEYVLKNILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP  P              T SLP WL+Q D+ YY +KF ++GFTG LNYYRN + N
Sbjct  181   KPGPPIFPKGEYGTGF--NPDMTNSLPSWLSQHDLAYYVSKFQKTGFTGPLNYYRNMNPN  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA WSG++I+VPVKFI GD D+ Y    +KE IH GG K+ VPNL++V+V +GVAH+
Sbjct  239   WELTAPWSGAKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  EE+N HI +FI  F
Sbjct  299   NNQEAAEEINTHIYDFINKF  318



>ref|XP_006414412.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
 gb|ESQ55865.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
Length=374

 Score =   395 bits (1016),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 236/328 (72%), Gaps = 13/328 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEI---GDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAP  988
             ++ ++H T++VNGINMH AEI   G  P +LF+HGFPELWYTWRHQM  L+S GYR IAP
Sbjct  49    LDGVEHKTLNVNGINMHYAEISGSGRDPIILFIHGFPELWYTWRHQMAALSSLGYRTIAP  108

Query  987   DLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLP---EVFLVGHDWGAIIAWNFCMFR  817
             DLRGYGDTDAP   + Y+  ++VGDLVAL+DA+       VF+VGHDWGA+IAW  C +R
Sbjct  109   DLRGYGDTDAPEKVEDYTYLNVVGDLVALIDAVTTSGDEAVFVVGHDWGAMIAWQLCQYR  168

Query  816   PDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFK  637
             P+++KALVNMSVV SPR+P R P+  +R  FGDD+YICRFQ+PGE E  F  +    + K
Sbjct  169   PEKVKALVNMSVVFSPRYPDRVPVPTLRHVFGDDYYICRFQKPGEIEAEFKKLGTENVLK  228

Query  636   AFLTNRDPRPPRIPHQSVAQVLYEKRGETVS--LPPWLTQQDIKYYATKFGQSGFTGGLN  463
              FLT + P P  +P   +      KR E  +  LPPWLTQ+D+ YY  K+ + GFTG +N
Sbjct  229   KFLTYKTPGPLYLPKPKLF-----KRSENAASALPPWLTQEDLDYYVNKYDKKGFTGPIN  283

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYRN DRNWELTA W+G++I VPVKFIVGDQDLTY+ PG KE IH GG K+ VP L + V
Sbjct  284   YYRNIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYIHGGGFKRDVPLLDETV  343

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             V+ G+ H++++E P+E+N HI  F Q F
Sbjct  344   VLNGLGHFLHEESPDEINQHIHNFFQKF  371



>gb|ACJ85188.1| unknown [Medicago truncatula]
Length=316

 Score =   393 bits (1010),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 234/321 (73%), Gaps = 6/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTD P S +SY++FH+VGD+VAL+D+L + +VFLV HDWGAI+ W  C+FRP+R+K
Sbjct  61    RGYGDTDVPSSVNSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAIVGWYLCLFRPERVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  KP++ MR  FGDD+YICRFQ+ G+ E          + K+ LT 
Sbjct  121   AYVCLSVPYLPRNPKVKPVDGMRALFGDDYYICRFQELGKMEAEIAKDSSEQVIKSMLTG  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   P  +P +      +     T  LP WL+Q+D+ YYA+KF ++GF+GGLN+YRN + 
Sbjct  181   RTTGPLILPKER-----FLSHPSTKPLPSWLSQEDVSYYASKFEKTGFSGGLNFYRNLNL  235

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+G+QI+VP+KFI GD DL Y   G K+ I  GG KK VPNL++VV+ EGVAH
Sbjct  236   NWELTAAWTGAQIKVPLKFITGDSDLVYTSSGTKQYIESGGFKKDVPNLEEVVIQEGVAH  295

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E+++NHI +FI+ F
Sbjct  296   FNNQEAAEDISNHIYDFIKKF  316



>ref|XP_008340789.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 238/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I+H TV VNGINMHVAE G+GP +LF+HGFPELWY+WRHQ+L L++ GYRA+APDLRGYG
Sbjct  6     IEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDLRGYG  65

Query  969   DTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIKAL  796
             DTDAP S  SY+  H+VGDLVALLDA+     +VF+V HDWGA IAW  C+ RPDR+KAL
Sbjct  66    DTDAPASPSSYNCLHVVGDLVALLDAIAPDQEQVFVVAHDWGAXIAWYLCLXRPDRVKAL  125

Query  795   VNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRD  616
             V++SV   PR+P RK +E+++  +GDD+YICRFQ+PG  E  F  +  T + K FLT R+
Sbjct  126   VSLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLTYRN  185

Query  615   PRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNW  436
             P P  +P     +         + LP WL++ ++ YY  KF ++GFTGG+NYYRN D NW
Sbjct  186   PGPLFLPK---GKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINW  242

Query  435   ELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYI  256
             ELTA W+G+Q++VPVKF+VGDQDL Y+  G  + I +GG KK VP L++VVV+EGVAH++
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSXGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  255   NQEKPEEVNNHILEFIQNFH  196
              QEKP+E++ HI +FI  FH
Sbjct  303   QQEKPDEISKHIHDFIXXFH  322



>ref|XP_007154300.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
 gb|ESW26294.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
Length=319

 Score =   393 bits (1009),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 244/328 (74%), Gaps = 17/328 (5%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME ++H TV+VNGINMH+AE+G+GP++LF+HGFP+LW++WRHQM  LAS GYR +APDLR
Sbjct  1     MEGVRHRTVNVNGINMHIAEMGEGPSILFIHGFPDLWFSWRHQMKALASLGYRCVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLD--ALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             GYGDTD P S  +Y+  H+VGD+V LLD  A    +VF+VGHDWGA+ AW   +FRPDRI
Sbjct  61    GYGDTDVPASPTAYTSLHVVGDIVGLLDEIAGDNEKVFVVGHDWGAMTAWVLSLFRPDRI  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             +ALVN+SV  +PR+P RKPL+ ++  +G+D+YICRFQ+PG  E  F  I    + K FLT
Sbjct  121   RALVNLSVAFTPRNPKRKPLDTLKAVYGNDYYICRFQEPGNIEAEFEQIGTERVLKEFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRG------ETVSLPPWLTQQDIKYYATKFGQSGFTGGLN  463
              R+P P           L+E +G        + LP WL++++  YYA+K+ ++GFTGGLN
Sbjct  181   YRNPAP---------IYLHEGKGFGHPIDSPLKLPSWLSEEECHYYASKYEKTGFTGGLN  231

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYRN D NWELTA W+G++++VPVKFIVGD DLTY+ PG K+ IH+GGLK+ VP L+ VV
Sbjct  232   YYRNLDLNWELTAPWTGAKVKVPVKFIVGDLDLTYNAPGAKDYIHKGGLKRDVPLLEDVV  291

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             V++G  H+++QE+P E+N HI +F++ F
Sbjct  292   VIQGAGHFLHQERPHEINQHIYDFVKKF  319



>ref|XP_002314368.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
 gb|EEF00539.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
Length=335

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/321 (58%), Positives = 240/321 (75%), Gaps = 8/321 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             I+H T++VNGIN+HVA  G  + P +LF+HGFP+LWY+WRHQ+  L+S GYRA+APDLRG
Sbjct  5     IEHRTINVNGINIHVAIKGPENAPVILFIHGFPQLWYSWRHQIEALSSLGYRAVAPDLRG  64

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGDTDAP    SY+V H+VGDL+ LLD +      VF+VGHDWGA+IAW+  +FRPDR+K
Sbjct  65    YGDTDAPAEVTSYTVLHVVGDLIGLLDVVAPNQESVFVVGHDWGALIAWHLSLFRPDRVK  124

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN+SV+ +PR+P+RK +  ++  +GDD+YI RFQ+PGE E  F  I    + K FLT 
Sbjct  125   ALVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEFLTY  184

Query  621   RDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             R P P  +P     Q    K  +T V LP WL+++D+KYY +KF Q GFTGGLNYYRN D
Sbjct  185   RTPAPIFLPK---GQGFNGKPLDTPVVLPSWLSEEDVKYYTSKFEQKGFTGGLNYYRNLD  241

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             RNWELTA W+G+QI+VPVKFIVGDQDLTY+  G K+ I +GG K+ VP LQ +VVMEGV 
Sbjct  242   RNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDYIAKGGFKRDVPFLQDLVVMEGVG  301

Query  264   HYINQEKPEEVNNHILEFIQN  202
             H+IN+EKPEE++ HI +F Q 
Sbjct  302   HFINEEKPEEISKHIYDFFQK  322



>emb|CAA55294.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 238/321 (74%), Gaps = 6/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  26    MEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  85

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ FHIVGDLVAL+D+L + +VFLV HDWGAII W  CMFRPD++KA
Sbjct  86    GYGDTEAPPSISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKA  145

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV +  R P  + ++ MR  +GDD+Y+CRFQ+PGE E     +    + +  LT R
Sbjct  146   YVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTTR  205

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             +P PP +P        ++   E   +LP WLT++D+ YY +KF ++GFTG LNYYRNF+ 
Sbjct  206   NPGPPILPKGR-----FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNL  260

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVK+I G+ D+ Y+   +KE IH GG K+ VPNL+QV+V +GVAH
Sbjct  261   NWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAH  320

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++N+I +FI  F
Sbjct  321   FNNQEAAEEIDNYIYDFINKF  341



>ref|XP_003626241.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82459.1| epoxide hydrolase [Medicago truncatula]
Length=316

 Score =   393 bits (1009),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 234/321 (73%), Gaps = 6/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTD P S +SY++FH+VGD+VAL+D+L + +VFLV HDWGAI+ W  C+FRP+R+K
Sbjct  61    RGYGDTDVPSSVNSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAIVGWYLCLFRPERVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  KP++ MR  FGDD+YICRFQ+ G+ E          + K+ LT 
Sbjct  121   AYVCLSVPYLPRNPKVKPVDGMRALFGDDYYICRFQELGKMEAEIAKDSSEQVIKSMLTG  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   P  +P +      +     T  LP WL+Q+D+ YYA+KF ++GF+GGLN+YRN + 
Sbjct  181   RTTGPLILPKER-----FLSHPSTKPLPSWLSQEDVAYYASKFEKTGFSGGLNFYRNLNL  235

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+G+QI+VP+KFI GD DL Y   G K+ I  GG KK VPNL++VV+ EGVAH
Sbjct  236   NWELTAAWTGAQIKVPLKFITGDSDLVYTSSGTKQYIESGGFKKDVPNLEEVVIQEGVAH  295

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E+++NHI +FI+ F
Sbjct  296   FNNQEAAEDISNHIYDFIKKF  316



>ref|XP_006472971.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=571

 Score =   402 bits (1032),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 235/320 (73%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  V VNGI MH+AE G+GP VLFLHGFPELWYTWR Q+L L+S GYRAIAPDLR
Sbjct  1     MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SYS  HIVGDLVAL+++L + +VF+V HDWGAIIAW  C+F P+R+KA
Sbjct  61    GYGDTEAPSSISSYSCHHIVGDLVALINSLGVEQVFVVAHDWGAIIAWYLCLFCPERVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP+E+MR  FGDD+YICRFQ+PG+ E     +    + K  L NR
Sbjct  121   FVCLSVPFLPRNPNIKPVESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILANR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P P   P ++   +  E R   V+LP W ++QD+ +YATKF Q+GFTG LNYYR  + N
Sbjct  181   KPGPSCFPEENAFGIDPENR---VTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLN  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WE+TAAW+  Q++VPVKFIVG+ D+ Y  PG+KE +H GG KK VP L+++VV+E   H+
Sbjct  238   WEMTAAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQE+ EE+N HI +FI+ F
Sbjct  298   INQERAEEINAHIYDFIKKF  317


 Score =   279 bits (713),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 173/243 (71%), Gaps = 5/243 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             + M+ I+H+TV+VNGI +H+AE G+ P VLFLHGFPE WY WRHQ+L L+  GYRA+APD
Sbjct  319   RKMDEIKHSTVNVNGIKIHIAEKGEVPVVLFLHGFPEFWYAWRHQILALSCLGYRAVAPD  378

Query  984   LRGYGDTDAPPSA-DSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDR  808
             LRGYGDT+ P S+  SY+ FH+ GD++AL+D L + +VF+V HD+GAIIAW+ C+FRP+R
Sbjct  379   LRGYGDTEVPSSSFTSYTCFHVAGDIIALIDFLGVEQVFVVAHDFGAIIAWHLCLFRPER  438

Query  807   IKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
             +K+ V++ +   P  P  KP+E +R  +GD+FYIC+FQ+PG  E     I    +  + L
Sbjct  439   VKSFVSLGMPYLPTDPNLKPVETLRAMYGDNFYICKFQEPGVLEAGIAHIGSKLMLASSL  498

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T R P PP I   ++A +      ET++LP WL++++  YY TKF Q+GFTGGLNYYR  
Sbjct  499   TTRRPGPPIISEDAIAHL----ARETINLPFWLSEEEFNYYVTKFDQTGFTGGLNYYRAI  554

Query  447   DRN  439
             D N
Sbjct  555   DLN  557



>ref|XP_011006450.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=323

 Score =   392 bits (1007),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 241/322 (75%), Gaps = 8/322 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             I+H T++VNGIN+HVA  G  + P +LF+HGFP+LWY+WRHQ+  L+S GYRA+APDLRG
Sbjct  5     IEHRTINVNGINIHVAIKGPENAPVILFIHGFPQLWYSWRHQIEALSSLGYRAVAPDLRG  64

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGDTDAP    SY+V H+VGDL+ LLD +   +  VF+VGHDWGA+IAW+  +FRPDR+K
Sbjct  65    YGDTDAPAEVTSYTVLHVVGDLIGLLDVVAPNQEGVFVVGHDWGALIAWHLSLFRPDRVK  124

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A+VN+SV+ +PR+P+RK +  ++  +GDD+YI RFQ+PGE E  F  I    + K FLT 
Sbjct  125   AMVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEFLTY  184

Query  621   RDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             R P P  +P     Q    K  +T V LP WL ++D+KYY +KF Q GFTGGLNYYRN D
Sbjct  185   RTPAPIFLPK---GQGFNGKPLDTPVVLPSWLAEEDVKYYTSKFEQKGFTGGLNYYRNLD  241

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             RNWELTA W+G+QI+VPVKFIVGDQDLTY+  G K+ + +GG K+ VP LQ +VVMEGV 
Sbjct  242   RNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDYLAKGGFKRDVPFLQDLVVMEGVG  301

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+IN+EKPEE++ HI +F + F
Sbjct  302   HFINEEKPEEISKHIYDFFRKF  323



>ref|XP_008371325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 237/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I+H TV VNGINMHVAE G+GP +LF+HGFPELWY+WRHQ+L L++ GYRA+APDLRGYG
Sbjct  6     IEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILTLSALGYRAVAPDLRGYG  65

Query  969   DTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIKAL  796
             DTDAP S  SY+  ++VGDLVALLDA+     +VF+V HDWGA IAW  C+ RPDR+KAL
Sbjct  66    DTDAPASPSSYNCLYMVGDLVALLDAIAPDQEQVFVVAHDWGATIAWYLCLLRPDRVKAL  125

Query  795   VNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRD  616
             V +SV   PR+P RK +E+++  +GDD+YICRFQ+PG  E  F  +  T + K FLT R+
Sbjct  126   VGLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLTYRN  185

Query  615   PRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNW  436
             P P  +P     +         + LP WL++ ++ YY  KF ++GFTGG+NYYRN D NW
Sbjct  186   PGPLFLPK---GKGFGHPTDTPIVLPSWLSEDEVNYYVAKFDKTGFTGGINYYRNXDINW  242

Query  435   ELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYI  256
             ELTA W+G+Q++VPVKF+VGDQDL Y+  G  + I +GG KK VP L++VVV+EGVAH++
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  255   NQEKPEEVNNHILEFIQNFH  196
              QEKP+E++ HI +FI  FH
Sbjct  303   QQEKPDEISKHIHDFIXXFH  322



>ref|XP_002270853.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 232/320 (73%), Gaps = 3/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV  NGIN+H+AE G GP +L LHGFPE WY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MEGIEHTTVRANGINIHLAEKGQGPIILLLHGFPEFWYSWRHQIHALASLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAP   DSY+ FH+VGDL+ +LDA+   +VF+VGHDWGA I WN C+FRPDR+KA
Sbjct  61    GYGDSDAPADVDSYTYFHLVGDLIGVLDAIGADKVFVVGHDWGAFIGWNLCLFRPDRVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
             LVN+SV  SPR+   KPL+  R  +GDD+YICRFQ+PG  E  F  I    + K FLT+ 
Sbjct  121   LVNLSVSFSPRNAMNKPLQTFRALYGDDYYICRFQEPGAIETEFAEIGIDKVLKYFLTSL  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                P  +P     + L ++ G  ++LP WL+++++ YY TK+  +GFTGGLNYYRN D +
Sbjct  181   PAGPLFLPK---GKALRDQLGIPITLPSWLSEEELNYYVTKYENTGFTGGLNYYRNLDLS  237

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+GSQ++VP KFIVGD DLTY+ PG  E +    LKK VP L++VVVM+GV H+
Sbjct  238   WELTAPWTGSQVEVPAKFIVGDLDLTYNTPGFNESMTFDELKKHVPLLEEVVVMKGVGHF  297

Query  258   INQEKPEEVNNHILEFIQNF  199
             + +EK +E+N HI  F Q F
Sbjct  298   LQEEKADEINQHIHAFFQRF  317



>ref|XP_004967831.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=325

 Score =   391 bits (1005),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 230/324 (71%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIA  991
             ++ ++H TV  NG+ +HVAE G      PAVL LHGFP+LWY WRHQM  LA++GYRA+A
Sbjct  5     VDGVRHRTVEANGVRLHVAEAGPEGGAAPAVLLLHGFPDLWYGWRHQMAALAARGYRAVA  64

Query  990   PDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPD  811
             PDLRGYGD+DAPP A +Y+ FH+VGDLVAL+  L  P+VF+VGHDWGAI+AW  C+ RPD
Sbjct  65    PDLRGYGDSDAPPDASAYTTFHVVGDLVALIADLGQPQVFVVGHDWGAIVAWQLCLLRPD  124

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
              ++ALVN+SVV  PR P   PL+ ++   G+D Y+CRFQ+PG AE  F   D   +F   
Sbjct  125   LVRALVNLSVVYHPRRPEGSPLQTIKAACGEDHYMCRFQEPGVAEAEFAQYDAKYIFNKT  184

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
                R P P  +P     +  ++      + PPWL+++DI YYA KF ++GFTGG NYYR 
Sbjct  185   FGMRKPAPLILPKD---KSFFDSLDSDGTCPPWLSEEDISYYAEKFSKTGFTGGFNYYRC  241

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWEL+A W+G+ I+VP KFIVGD D+TY+ PGV++ IH+GG K  VP L+ VVVMEG
Sbjct  242   MDLNWELSAPWTGAPIKVPTKFIVGDLDITYNTPGVQDYIHKGGFKASVPKLEDVVVMEG  301

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             V+H+INQEKP EV++HI EF   F
Sbjct  302   VSHFINQEKPSEVSDHICEFFSKF  325



>ref|XP_008454324.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=350

 Score =   392 bits (1007),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 234/324 (72%), Gaps = 7/324 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIA  991
             + ME IQH  V  NG+N+HVA  G   GP VL LHGFPELWY+WR Q+LFL+S GYR IA
Sbjct  31    RSMETIQHTNVQTNGVNLHVATAGPVTGPPVLLLHGFPELWYSWRSQILFLSSAGYRVIA  90

Query  990   PDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPD  811
             PDLRGYGD+DAPPS+DSY+  HIVGD+V LLD   + +V LVGHDWGA+IAW  C+FRPD
Sbjct  91    PDLRGYGDSDAPPSSDSYTALHIVGDVVGLLDEFGIDKVLLVGHDWGALIAWYCCLFRPD  150

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             RIKA V +SV   PR+P    +E  +   GD FY+ RFQ+PG+AE+ F S+D    FK  
Sbjct  151   RIKASVILSVQFFPRNPKMSFIEGFKAVLGDQFYMVRFQEPGKAEKEFASVDIREFFKNV  210

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             ++NRDP  P +P     +V +E      SL PWLT +DI YYA KF  SGFTGGLNYYR 
Sbjct  211   MSNRDPSAPYLP----GEVKFEGVPPP-SLAPWLTPKDIDYYAQKFSHSGFTGGLNYYRA  265

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             FDR WELTA W+ ++I+VPVKFIVGD DLTYHFPG ++ I+    +K VP L++V+V+  
Sbjct  266   FDRTWELTAPWTKAEIKVPVKFIVGDLDLTYHFPGAQDYINGDAFEKDVPGLEEVIVIGD  325

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              +H+INQE+P E+N+HI +F +NF
Sbjct  326   ASHFINQERPVEINSHIHDFFRNF  349



>gb|KHN43314.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   390 bits (1003),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 236/321 (74%), Gaps = 6/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ FHIVGDLVAL+D+L + +VFLV HDWGAII W  CMFRPD++KA
Sbjct  61    GYGDTEAPPSISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV +  R P  + ++ MR  +GDD+Y+CRFQ+PGE E     +    + +  LT R
Sbjct  121   YVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             +P PP +P        ++   E   +LP WLT++D+ YY +KF ++GFTG LNYYRNF+ 
Sbjct  181   NPGPPILPKGR-----FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNL  235

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVK+I G+ D+ Y+   +KE IH GG K+ VPNL+QV+V +GVAH
Sbjct  236   NWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAH  295

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++N+I +FI  F
Sbjct  296   FNNQEAAEEIDNYIYDFINKF  316



>ref|XP_004508197.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=357

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 240/324 (74%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
              E +QH TV VNGIN+H+AE G    P +LF+HGFP+LWY+WRHQ+  LAS GYR IAPD
Sbjct  37    FEELQHKTVIVNGINIHIAEKGTSQSPLILFIHGFPDLWYSWRHQITALASLGYRCIAPD  96

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             LRG+GDTD P S  SY+  H+VGDL+ +LDA+   E  VF+VGHDWGA+IAW+ C++RP+
Sbjct  97    LRGFGDTDVPASPTSYTSLHVVGDLIGVLDAVAGDEDKVFVVGHDWGAMIAWSLCLYRPE  156

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             RIKA+VN+SV  +PR+P RKPLE +R  +G+D+YI RFQ+PG+ E  F  I    + K F
Sbjct  157   RIKAVVNLSVSFTPRNPKRKPLETLRAVYGNDYYISRFQEPGDIEAEFAEIGTARVLKEF  216

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT R+P P  +P     +         + LP WL++++  YYA+K+ ++GFTGGLNYYRN
Sbjct  217   LTYRNPGPLYLPK---GKGFGHPIDSPIVLPSWLSEEECNYYASKYDKTGFTGGLNYYRN  273

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWELTA WSG++I+VPVKFIVGDQDLTY+ PG K+ I +GG+K+ VP L+ VVV+EG
Sbjct  274   LDLNWELTAPWSGAKIKVPVKFIVGDQDLTYNAPGAKDYILKGGMKRDVPLLEDVVVIEG  333

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
               H+I+QE+P+E+N HI +F + F
Sbjct  334   AGHFIHQERPDEINKHIYDFFKKF  357



>ref|NP_001051780.1| Os03g0829100 [Oryza sativa Japonica Group]
 gb|AAL79744.1|AC096687_8 putative hydrolase [Oryza sativa Japonica Group]
 gb|AAO39862.1| putative hydrolase [Oryza sativa Japonica Group]
 gb|ABF99683.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13694.1| Os03g0829100 [Oryza sativa Japonica Group]
 gb|EAZ29151.1| hypothetical protein OsJ_13212 [Oryza sativa Japonica Group]
Length=333

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 237/322 (74%), Gaps = 10/322 (3%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDG----PAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ++H TV  NGI+MHVAE G G    PAVLF+HGFPELWY+WRHQM  LA++GYR +APDL
Sbjct  7     VRHRTVEANGISMHVAEAGPGSGTAPAVLFVHGFPELWYSWRHQMGHLAARGYRCVAPDL  66

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYG T APP   SY++FH+VGDLVALLDAL+LP+VF+VGHDWGAI++WN C+ RPDR++
Sbjct  67    RGYGGTTAPPEHTSYTIFHLVGDLVALLDALELPQVFVVGHDWGAIVSWNLCLLRPDRVR  126

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN+SV   PR P  KPL+  R  +GDD+Y+CRFQ+PG  E+   S+D    FK  L  
Sbjct  127   ALVNLSVAFMPRRPAEKPLDYFRGAYGDDYYVCRFQEPG-VEKELASLDLKRFFKLALIV  185

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             +      +   S+ ++    R   V+LPPWL+++DI Y A+ + ++GF GG+NYYR FD 
Sbjct  186   QTTGSSAM---SIKKMRANNR--EVTLPPWLSEEDISYVASVYAKTGFAGGINYYRCFDL  240

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWEL A W+G+++ VP KFIVGD DL YH PGVK  IH+G LKK VP L++VVV++G  H
Sbjct  241   NWELMAPWTGAKVLVPTKFIVGDGDLAYHLPGVKSYIHKGRLKKDVPMLEEVVVIKGAGH  300

Query  261   YINQEKPEEVNNHILEFIQNFH  196
             +I QE+ +E+++HI  +I+ F+
Sbjct  301   FIQQERAQEISDHIYNYIKKFN  322



>gb|EYU43974.1| hypothetical protein MIMGU_mgv1a009814mg [Erythranthe guttata]
Length=331

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/328 (55%), Positives = 237/328 (72%), Gaps = 14/328 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H ++S+NG+ MHVAE G GP +LFLHGFPE WYTWRHQM+F AS+GYRA+APDLR
Sbjct  1     MEEIEHRSLSINGLTMHVAEAGRGPIILFLHGFPECWYTWRHQMVFFASRGYRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLP------EVFLVGHDWGAIIAWNFCM  823
             G+ DT   P++D   ++  H+ GDLVAL+DA+         +VF+VGHDWGA++AW  C+
Sbjct  61    GFADTTGAPASDPSKFTTLHVAGDLVALIDAVAAAPADDGGKVFVVGHDWGAVMAWALCL  120

Query  822   FRPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTL  643
             +RPD++KALVN+SV  S R+P RKP+E +R  +G+++YICRFQ+PG+ E+ F  I    +
Sbjct  121   YRPDKVKALVNLSVPFSRRNPNRKPIETLRSVYGNEYYICRFQEPGKIEQEFSQIGTKNV  180

Query  642   FKAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLN  463
              K FLT R+P P  +P                SLPPWL+ +D+ YYA+K+  +GFTG LN
Sbjct  181   LKNFLTYRNPGPLHLPKSKAFS------DTETSLPPWLSDEDVNYYASKYDATGFTGALN  234

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYR  D NWELT AWS  +I+V VKF+VGD DLTY+ PG KE IH GG KK VP L++VV
Sbjct  235   YYRALDINWELTGAWSRGEIKVAVKFMVGDLDLTYNSPGTKEYIHNGGFKKDVPLLKEVV  294

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             VM+ VAH+I+QEKP+EVN +IL F  N+
Sbjct  295   VMKDVAHFIHQEKPDEVNANILSFFNNY  322



>ref|XP_009757467.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=340

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 238/324 (73%), Gaps = 10/324 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             +E IQH T+ VNG+NMH+AE+G GP VLFLHGFPELWY+WRHQM F+A+ GYRA+A DLR
Sbjct  4     VEEIQHKTLRVNGLNMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFVAAHGYRAVALDLR  63

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLD--ALQLPEVFLVGHDWGAIIAWNFCMFRPD  811
             G+GDT   P  D   ++  H+VGD+V LL+  A    +VF+VGHDWGA+IAW  C +RPD
Sbjct  64    GFGDTTGAPEDDFTKFTTLHVVGDIVELLNIIAPDQEKVFVVGHDWGAMIAWALCFYRPD  123

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++ ALVNM+V  +PR+P  +P+  +R T+GD++YI RFQ+PGE EE F  I   T+ +  
Sbjct  124   KVNALVNMTVPFAPRNPIIRPIARLRATYGDEYYIIRFQEPGEIEEEFAKIGTKTVLEKL  183

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LTNR+P P  +P               V LPPWLT++D+ YYA+K+ Q+GFTGGLNYYR 
Sbjct  184   LTNRNPEPLMLPKGKPFD------ESPVKLPPWLTEKDVDYYASKYQQTGFTGGLNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWELTA W+G++++VPVKFIVGD D+TY   GVK+ IH+GG KK VP L+ VV+ +G
Sbjct  238   LDLNWELTAPWTGAKVKVPVKFIVGDLDITYSAAGVKDYIHKGGFKKDVPLLEDVVIFKG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH++ QEKP+EVN  IL+F+Q F
Sbjct  298   VAHFLPQEKPDEVNKQILDFLQGF  321



>gb|EYU21013.1| hypothetical protein MIMGU_mgv1a010239mg [Erythranthe guttata]
Length=318

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 237/327 (72%), Gaps = 16/327 (5%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH T+ VNGI+MHVAE+G+GP VLFLHGFPELWY+WRHQM+F+A++GYRA+APD+R
Sbjct  1     MEEIQHRTIPVNGISMHVAELGEGPLVLFLHGFPELWYSWRHQMVFVAARGYRAVAPDMR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQ---LPEVFLVGHDWGAIIAWNFCMFRP  814
             GYGDT   P  D   +++ H+VGDL++LLDA+      +VF+VGHDWGA +AW+ CM+RP
Sbjct  61    GYGDTTGAPLDDPSKFTLLHLVGDLISLLDAVSPNGADKVFVVGHDWGAFVAWHLCMYRP  120

Query  813   DRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKA  634
             DR+KALVN+SV   PR P   P++ MR  +G+D YICRFQ+PG+ E  F  I    + K 
Sbjct  121   DRVKALVNLSVAFIPRDPEMNPVQKMRSLYGEDHYICRFQEPGDIEAEFEKIGVKEVLKN  180

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSL--PPWLTQQDIKYYATKFGQSGFTGGLNY  460
              L  R+P P   P         + +G T S    PWLT++++ YY TKF ++GFTGG+NY
Sbjct  181   ILAFRNPAPLYFP---------KGKGFTYSADRAPWLTEEELDYYVTKFEKTGFTGGINY  231

Query  459   YRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVV  280
             YR F  +WEL A W+G+Q+ VP KFIVG+ DL YH PG K+ IH+GG KK VP LQ++VV
Sbjct  232   YRAFGLSWELNAPWAGAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFKKFVPLLQEIVV  291

Query  279   MEGVAHYINQEKPEEVNNHILEFIQNF  199
             +EG AH++NQE+ +E+N HI  F+Q F
Sbjct  292   LEGAAHFVNQERADEINQHIYAFLQQF  318



>gb|EYU43973.1| hypothetical protein MIMGU_mgv1a010247mg [Erythranthe guttata]
Length=318

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 237/327 (72%), Gaps = 16/327 (5%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH T+ VNGI+MHVAE+G+GP VLFLHGFPELWY+WRHQM+F+A++GYRA+APD+R
Sbjct  1     MEEIQHRTIPVNGISMHVAELGEGPLVLFLHGFPELWYSWRHQMVFVAARGYRAVAPDMR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQ---LPEVFLVGHDWGAIIAWNFCMFRP  814
             GYGDT   P  D   +++ H+VGDL++LLDA+      +VF+VGHDWGA +AW+ CM+RP
Sbjct  61    GYGDTTGAPLDDPSKFTLLHLVGDLISLLDAVSPDGADKVFVVGHDWGAFVAWHLCMYRP  120

Query  813   DRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKA  634
             DR+KALVN+SV   PR P   P++ MR  +G+D YICRFQ+PG+ E  F  I    + K 
Sbjct  121   DRVKALVNLSVAFIPRDPEMNPVQKMRSLYGEDHYICRFQEPGDIEAEFEKIGVKEVLKN  180

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSL--PPWLTQQDIKYYATKFGQSGFTGGLNY  460
              L  R+P P   P         + +G T S    PWLT++++ YY TKF ++GFTGG+NY
Sbjct  181   ILAFRNPAPLYFP---------KGKGFTYSADRAPWLTEEELDYYVTKFEKTGFTGGINY  231

Query  459   YRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVV  280
             YR F  +WEL A W+G+Q+ VP KFIVG+ DL YH PG K+ IH+GG KK VP LQ++VV
Sbjct  232   YRAFGLSWELNAPWAGAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFKKFVPLLQEIVV  291

Query  279   MEGVAHYINQEKPEEVNNHILEFIQNF  199
             +EG AH++NQE+ +E+N HI  F+Q F
Sbjct  292   LEGAAHFVNQERADEINEHIYAFLQQF  318



>ref|XP_004298141.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 236/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME ++H TV VNGINMHVAE G G  VL +HGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MEGVEHRTVRVNGINMHVAEKGQGQVVLLIHGFPELWYSWRHQIQSLASLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAP  A SY+ FH+VGDL+ALLD +     +VF+VGHDWGA+IAW  C+FRPDR+
Sbjct  61    GFGDTDAPADASSYTCFHVVGDLIALLDTVAGDQKKVFVVGHDWGALIAWYLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQ--PGEAEEVFGSIDPTTLFKAF  631
             KALVN+SV   PR+P RK LE+M+  +G+D++ C+F +  PGE E  F  I    + + F
Sbjct  121   KALVNLSVQYFPRNPQRKILESMKAAYGEDYHFCKFSEFLPGEIEAEFAQIGTARVIREF  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT R P P  +P     +         ++LP WL++ D+ YY  KF + GFTGG+NYYRN
Sbjct  181   LTYRHPGPLFLPK---GKGFGHPSDSPIALPSWLSEADVNYYVGKFEKKGFTGGINYYRN  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              DRNWEL A W+G+Q++VPVK+IVGDQDL Y+  G K+ IH G  KK VP L++VV+MEG
Sbjct  238   SDRNWELLAPWTGAQVKVPVKYIVGDQDLVYNSLGAKDYIHNGEFKKYVPFLEEVVIMEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH+INQEK +E++ HI +FI+ F
Sbjct  298   VAHFINQEKGDEISKHIHDFIKKF  321



>ref|XP_008361962.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 237/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGYG  970
             I+H TV VNGINMHVAE G+GP +LF+HGFPELWY+WRHQ+L L++ GYRA+APDLRGYG
Sbjct  6     IEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDLRGYG  65

Query  969   DTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIKAL  796
             DTDAP S  SY+    VGDLVALLDA+     +VF+V HDWGA IAW  C+ RPDR+KAL
Sbjct  66    DTDAPASPSSYNCLXXVGDLVALLDAIAPDQEQVFVVAHDWGAXIAWYLCLXRPDRVKAL  125

Query  795   VNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNRD  616
             V++SV   PR+P RK +E+++  +GDD+YICRFQ+PG  E  F  +  T + K FLT R+
Sbjct  126   VSLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLTYRN  185

Query  615   PRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNW  436
             P P  +P     +         + LP WL++ ++ YY  KF ++GFTGG+NYYRN D NW
Sbjct  186   PGPLFLPK---GKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINW  242

Query  435   ELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYI  256
             ELTA W+G+Q++VPVKF+VGDQDL Y+  G  + I +GG KK VP L++VVV+EGVAH++
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  255   NQEKPEEVNNHILEFIQNFH  196
              QEKP+E++ HI +FI+ FH
Sbjct  303   QQEKPDEISKHIHDFIRKFH  322



>ref|XP_010024723.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61193.1| hypothetical protein EUGRSUZ_H03957 [Eucalyptus grandis]
Length=323

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 239/324 (74%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDG--PAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             ++ I+H TV+VNGI MHVA  G    P VL LHGFPELWY+WRHQM  LA+ GYRA+APD
Sbjct  3     LQGIEHRTVTVNGIAMHVAIKGSSRSPTVLLLHGFPELWYSWRHQMAGLAALGYRAVAPD  62

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             LRG+GDTD P SA +Y+   +VGDLVALLDA+   E  VF+VGHDWGA++AW+  +FRPD
Sbjct  63    LRGFGDTDTPASASAYTSLSVVGDLVALLDAVAKGEEKVFVVGHDWGAVVAWHLSLFRPD  122

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R+KALVN+SV  +PR+P +KPLE++R  +G+D+YICRFQ+PGE E  F  I    + + F
Sbjct  123   RVKALVNLSVPFTPRNPAQKPLESLRAGYGEDYYICRFQEPGEMEAEFAQIGTRRVLEEF  182

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT R+P    +P     +       + + LP WLT++D+ YYA+K+ ++GFTGG NYYR 
Sbjct  183   LTIRNPDQLFLPK---GKAFGYPMDDLIILPSWLTEEDVDYYASKYEKTGFTGGFNYYRA  239

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWELTA W+G+QI+VP KFIVGD DLTY  PG K+ IH GGLKK VP L+ VVVM+G
Sbjct  240   LDLNWELTAPWTGAQIRVPAKFIVGDLDLTYTSPGAKDYIHRGGLKKYVPFLEDVVVMQG  299

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH+I++E+P+EV +HI +F   F
Sbjct  300   VAHFIHEERPQEVTHHIHDFFGKF  323



>gb|KEH32298.1| epoxide hydrolase [Medicago truncatula]
Length=355

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 238/322 (74%), Gaps = 5/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             +E I+H TV+VNGINMH+AE G GP +LF+HGFP+LWY+WRHQ+ +LA  GYR +APDLR
Sbjct  37    LEGIEHRTVTVNGINMHIAEKGQGPLILFIHGFPDLWYSWRHQITYLACHGYRCVAPDLR  96

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             GYGDTD P S  SY+  H+VGD++ LLDA+     +VF+VGHDWGA+ AW   ++RP+RI
Sbjct  97    GYGDTDIPSSPTSYTSLHVVGDIIGLLDAIAGDQEKVFVVGHDWGALTAWYLSLYRPERI  156

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV  +PR+P RKPL+ +R  +G+D+YI RFQ+PG+ E  F  I    + K FLT
Sbjct  157   KALVNLSVAFTPRNPKRKPLDTLRAVYGNDYYISRFQEPGDIEAEFAEIGTQRVLKEFLT  216

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  +P     +         + LPPWL++Q+  YYA+KF ++GFTG LNYYRN D
Sbjct  217   YRNPGPLYLPK---GKGFGHPIDSPILLPPWLSEQECNYYASKFDKTGFTGALNYYRNID  273

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWEL A W+G+Q++VPVKFIVGD DLTY+ PG K+ IH+GG+K+ VP L+ VVV+EG  
Sbjct  274   LNWELNAPWTGAQVKVPVKFIVGDLDLTYNAPGAKDYIHKGGMKRDVPLLEDVVVIEGAG  333

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+I+QE+ +++N +I +F + F
Sbjct  334   HFIHQERADKINTYIYDFFKKF  355



>ref|XP_006644009.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Oryza brachyantha]
Length=321

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 228/321 (71%), Gaps = 6/321 (2%)
 Frame = -1

Query  1152  RIQHNTVSV-NGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
              ++H TV V +G+ +HVAE G  DGPAV+ +HGFPELWY+WRHQM  LA++G+RA+APDL
Sbjct  4     EVRHRTVEVASGVRLHVAEAGPEDGPAVVLVHGFPELWYSWRHQMAALAARGFRAVAPDL  63

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGD+DAP    SY+V H+VGDLVAL+  L  P VF+  HDWGA +AW  C+ RPD + 
Sbjct  64    RGYGDSDAPADQASYTVLHLVGDLVALIADLGQPRVFVAAHDWGAAVAWQLCLLRPDLVT  123

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALV +SV   PR+P+R P++ +R   GD+ YIC FQ+PG AE  FG  D     K F   
Sbjct  124   ALVVLSVEYHPRNPSRSPVQTLRAICGDEHYICFFQKPGVAEAEFGRCDIKCALKKFYGM  183

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R P P  IP     + L++      + P WLT++DI YYA KF ++GFT GLNYYR  D 
Sbjct  184   RKPEPLIIPQ---GKTLFDSIDSDGTCPAWLTEEDIAYYAEKFEKTGFTAGLNYYRCIDL  240

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G  I+VP KFIVGDQDLTY+ PGVK+ IH+GGLK  VPNL+ VVVMEGVAH
Sbjct  241   NWELTAPWTGVPIKVPTKFIVGDQDLTYNIPGVKDYIHKGGLKASVPNLEDVVVMEGVAH  300

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQEKP EV+NHI EF   F
Sbjct  301   FINQEKPNEVSNHICEFFGKF  321



>ref|XP_010043042.1| PREDICTED: bifunctional epoxide hydrolase 2 [Eucalyptus grandis]
 gb|KCW85062.1| hypothetical protein EUGRSUZ_B01907 [Eucalyptus grandis]
Length=318

 Score =   389 bits (1000),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 235/321 (73%), Gaps = 4/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T+SVNGI MHVAE G GPAVL LHGFPELWYTWR Q+  LA++GYRA+APDLR
Sbjct  1     MEGIEHRTLSVNGITMHVAEKGRGPAVLLLHGFPELWYTWRRQIHALAAQGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEV-FLVGHDWGAIIAWNFCMFRPDRIK  802
             GYGDT+AP   + Y+  H VGD+VAL+D L L E   +VGHDWGA++ W  CMFRP+R++
Sbjct  61    GYGDTEAPAEVERYTCHHAVGDVVALMDELGLGEAAHVVGHDWGALVGWYLCMFRPERVR  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             + V ++V   PR+P  KP+E++R  FGDD+YICRFQ+PG+ E     +    + +  LT 
Sbjct  121   SYVCLTVPFRPRNPAAKPVESLRAHFGDDYYICRFQEPGDIESDIERLGVRNVLRKILTE  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R P PP  P     Q    + G+ ++LP WL+++D+ YY +KF + GFTGGLNYYR  D 
Sbjct  181   RKPGPPMWPK---GQDFSCRPGKPMALPSWLSEEDLDYYTSKFEKRGFTGGLNYYRALDL  237

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+ ++++VPVKF+VGD D+TY  PGVKE +H GG KK VP L+ VVV+EG +H
Sbjct  238   NWELTAPWTDARVRVPVKFVVGDLDITYTTPGVKEFVHGGGFKKHVPLLEDVVVIEGASH  297

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +INQE+PEEVN+HI  FI+ F
Sbjct  298   FINQERPEEVNSHIHNFIKKF  318



>ref|XP_002314371.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
 gb|ABK94011.1| unknown [Populus trichocarpa]
 gb|EEF00542.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
Length=323

 Score =   389 bits (1000),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 239/322 (74%), Gaps = 8/322 (2%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             I+H T++VNGIN+HVA  G  + P +LF+HGFP+LWY+WRHQ+  L+S GYRA+APDLRG
Sbjct  5     IEHRTINVNGINIHVAIKGPENAPVILFIHGFPQLWYSWRHQIEALSSLGYRAVAPDLRG  64

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGDTDAP    SY+V H+VGDL+ LLD +      VF+VGHDWGA++AW+  +FRPDR+K
Sbjct  65    YGDTDAPAEVTSYTVLHVVGDLIGLLDVVAPNQESVFVVGHDWGALMAWHLALFRPDRVK  124

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALVN+SV+ +PR+P+RK +  ++  +GDD+YI RFQ+PGE E  F  I    + K FLT 
Sbjct  125   ALVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEFLTY  184

Query  621   RDPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             R P P  +P     Q    K  +T V LP WL+++D+KYY +K+ Q GFTGGLNYYRN D
Sbjct  185   RTPAPLFLPK---GQGFNGKPLDTPVVLPSWLSEEDVKYYTSKYEQKGFTGGLNYYRNLD  241

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             RNWELTA W+G+QI+VPVKFIVGDQDLTY+  G K+ I +GG K+ VP L  +VVMEGV 
Sbjct  242   RNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDHIDKGGFKRDVPFLHDLVVMEGVG  301

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+IN+EKPEE++ HI +F Q  
Sbjct  302   HFINEEKPEEISKHIYDFFQKL  323



>ref|NP_001240943.1| uncharacterized protein LOC100803974 [Glycine max]
 gb|ACU18288.1| unknown [Glycine max]
 gb|KHN03960.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   389 bits (998),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 228/320 (71%), Gaps = 4/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L++ GYRA+APDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSNLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SY++ H+V D+VAL+ +L + +VFLV HDWGA+I W  C+FRPDRIKA
Sbjct  61    GYGDTEAPASISSYTILHLVSDIVALIHSLAVDQVFLVAHDWGAVIGWYLCLFRPDRIKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  KP++ MR  +GDD+YICRFQ+PG+AE  F +     + K  LT+R
Sbjct  121   YVCLSVPFMPRNPKVKPVDAMRALYGDDYYICRFQEPGKAEAEFANNSIEQVIKNILTSR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP +  +         R     LP WL+Q+D+ YYA+KF ++G TGGLNYYRN + N
Sbjct  181   RPGPPILRKEGAGSNSDPSR----PLPTWLSQEDVTYYASKFTKTGLTGGLNYYRNLNLN  236

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G Q++VPVKFI GD D  Y   G+K  I  G  KK VP L++VVV EGVAH+
Sbjct  237   WELTAPWTGVQVKVPVKFITGDLDAVYTSLGMKNYIESGAFKKDVPCLEEVVVQEGVAHF  296

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  E+V NHI +FI  F
Sbjct  297   NNQEAAEDVTNHIYDFINKF  316



>gb|KHN20253.1| Epoxide hydrolase 2 [Glycine soja]
Length=322

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 231/324 (71%), Gaps = 6/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGI MHVAE G+G  VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MESIEHRTVEVNGIKMHVAEKGEGAVVLFLHGFPELWYSWRHQILALSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP + +SY+ FH+VGD++AL+D+L + +VFLV HDWGAII W  C+FRPDRIKA
Sbjct  61    GYGDTEAPSTVNSYTCFHLVGDIIALIDSLGVDKVFLVAHDWGAIIGWYLCLFRPDRIKA  120

Query  798   LVNMSVVISP---RHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
              V +SV   P   R+P +K ++     +GDD+YICRFQ+PG+ E     +D   L K  L
Sbjct  121   YVCLSVPFRPFLGRNPKQKTVDFFHSLYGDDYYICRFQEPGKMEAEMAGVDTAYLMKNIL  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T R   PP  P            G   +LP W++Q+D+ YY TKF ++GF+GGLNYYRN 
Sbjct  181   TTRKTGPPTFPKGEYGTGF--NPGTPDTLPSWISQEDLDYYVTKFNKTGFSGGLNYYRNL  238

Query  447   DRNWELTAAWSGSQI-QVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             + NWELTA W+G+ I  VPVKFI G  DL Y  PG+KE IH GG KK VP L++VVV EG
Sbjct  239   NLNWELTAPWTGAGIVDVPVKFITGGVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEG  298

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH+ NQE  E+V+NHI +FI+ F
Sbjct  299   VAHFNNQEAAEDVSNHIYDFIKKF  322



>dbj|BAJ99775.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   389 bits (998),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 233/322 (72%), Gaps = 6/322 (2%)
 Frame = -1

Query  1155  ERIQHNTVSV-NGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             E ++H  V V  G+ +HVAE G  DGPAVL +HGFP+LWY WRHQM  LA++G+RA+APD
Sbjct  4     EGVRHRMVEVAKGLRLHVAEAGPEDGPAVLLVHGFPDLWYGWRHQMAALAARGFRAVAPD  63

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             +RGYGD+DAPPSA SY+ FH+VGDLVAL+  L  P+VF+VGHDWGA++AW+ C+ RPD +
Sbjct  64    MRGYGDSDAPPSAASYTTFHLVGDLVALIADLAQPQVFVVGHDWGALVAWHLCLLRPDLV  123

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             +ALVN+SV   PR     PL+ +R   G+D Y+CRFQ+PG AE  F   D +  FK    
Sbjct  124   RALVNLSVAYHPRSSEGSPLQAIRALCGEDHYMCRFQEPGVAEAEFALYDMSHKFKTVFG  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R P PP +P     +  ++      + PPWL+++DI YYA KF ++GFTGGLNYYR  D
Sbjct  184   MRKPAPPILPKD---KTFFDSLDSDGTCPPWLSEEDISYYADKFEKTGFTGGLNYYRCMD  240

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWEL+A W+G+ ++V  KFIVGD D+TY+ PGVK+ IH+GGLK  VPNL+ VVVMEGV+
Sbjct  241   LNWELSAPWTGAPVKVATKFIVGDLDVTYNVPGVKDYIHKGGLKANVPNLEDVVVMEGVS  300

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+ NQEKP EV++HI EF   F
Sbjct  301   HFCNQEKPNEVSDHICEFFSKF  322



>gb|ACU19450.1| unknown [Glycine max]
Length=315

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 236/319 (74%), Gaps = 6/319 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H TV VNGI MHVAE G+GP VLFLHGFPELWY+W HQ+L L+S GYRA+APDLR
Sbjct  1     MEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWHHQILSLSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ FHIVGDLVAL+D+L + +VFLV HDWGAII W  CMFRPD++KA
Sbjct  61    GYGDTEAPPSISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV +  R P  + ++ MR  +GDD+Y+CRFQ+PGE E     +    + +  LT R
Sbjct  121   YVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGET-VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             +P PP +P        ++   E   +LP WLT++D+ YY +KF ++GFTG LNYYRNF+ 
Sbjct  181   NPGPPILPKGR-----FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNL  235

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G QI+VPVK+I G+ D+ Y+   +KE IH GG K+ VPNL+QV+V +GVAH
Sbjct  236   NWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAH  295

Query  261   YINQEKPEEVNNHILEFIQ  205
             + NQE  EE++N+I +FI 
Sbjct  296   FNNQEAAEEIDNYIYDFIN  314



>ref|NP_001042621.1| Os01g0255000 [Oryza sativa Japonica Group]
 dbj|BAA84626.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAA85201.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAF04535.1| Os01g0255000 [Oryza sativa Japonica Group]
 dbj|BAG95508.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98766.1| unnamed protein product [Oryza sativa Japonica Group]
Length=322

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 229/320 (72%), Gaps = 6/320 (2%)
 Frame = -1

Query  1149  IQHNTVSV-NGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ++H TV V +G+ +HVAE G  DGPAVL +HGFPELWY+WRHQM  LA++G+RA+APDLR
Sbjct  6     VRHRTVEVASGVRLHVAEAGPEDGPAVLLVHGFPELWYSWRHQMRALAARGFRAVAPDLR  65

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGD+DAPP  DSY+V H+VGDLVAL+  +  P VF+  HDWGA +AW  C+ RPD + A
Sbjct  66    GYGDSDAPPGRDSYTVLHLVGDLVALIADVGQPRVFVAAHDWGAAVAWQLCLLRPDLVTA  125

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+PTR P++ +R   GD  YIC FQ+PG AE  FG  D   L K F   R
Sbjct  126   FVALSVEYHPRNPTRSPVQTLRAVCGDGHYICFFQKPGVAEAEFGRGDIKCLLKKFYGMR  185

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                P  IP     + L++      + P WL+++DI YYA KF ++GFTGGLNYYR  D N
Sbjct  186   KAAPLIIPP---GKTLFDSIDSDGTCPAWLSEEDISYYAEKFEKTGFTGGLNYYRCIDLN  242

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA W+G  I+VP KFIVGDQDLTY+ PGVK+ IH+GGLK  VPNL+ VV+MEGVAH+
Sbjct  243   WELTAPWTGVPIKVPTKFIVGDQDLTYNIPGVKDYIHKGGLKACVPNLEDVVIMEGVAHF  302

Query  258   INQEKPEEVNNHILEFIQNF  199
             INQEKP+EV++HI  F   F
Sbjct  303   INQEKPDEVSDHICGFFSKF  322



>ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81890.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 235/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+VNG+NMH+AE+G GP +LF+HGFPELWY+WRHQM++LA +GYRA+APDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+FH+VGD+VALL+A+   E  VF+V HDWGA+IAW+ C+FRPD
Sbjct  61    GYGDTTGAPINDPSKFSIFHLVGDVVALLEAIAPNEDKVFVVAHDWGALIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+SV   PR+    P+E ++  +G+D+YICRFQ PGE E  F  I   ++ K  
Sbjct  121   KVKALVNLSVHYHPRNSNMNPIEGLKALYGEDYYICRFQVPGEIEAEFAPIGAKSVLKKM  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RDP P   P     + + +     + L  WL+++++ YYA KF Q+GFTG LNYYR 
Sbjct  181   LTYRDPAPFYFPKGKGLEAIADA---PIVLSTWLSEEELDYYANKFEQTGFTGALNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                N ELTA W+G+Q+ VP KFIVG+ DL YH  G KE IH GG KK VP L++VVV+EG
Sbjct  238   LSINSELTAPWTGAQVNVPTKFIVGEFDLAYHMRGAKEYIHNGGFKKYVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH++NQE+P E++ HI +FIQ F
Sbjct  298   AAHFVNQERPHEISKHIYDFIQKF  321



>ref|NP_001148885.1| epoxide hydrolase 2 [Zea mays]
 gb|ACG33290.1| epoxide hydrolase 2 [Zea mays]
 gb|ACG37254.1| epoxide hydrolase 2 [Zea mays]
Length=325

 Score =   389 bits (998),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 231/325 (71%), Gaps = 7/325 (2%)
 Frame = -1

Query  1161  GMERIQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAI  994
              +E ++H T+  NG+ +HVAE G      P VL LHGFP+LWY WRHQM  LA++GYRA+
Sbjct  4     AVEGVRHRTLEANGVRLHVAEAGPEEGSAPVVLLLHGFPDLWYGWRHQMSALAARGYRAV  63

Query  993   APDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRP  814
             APDLRGYGD+D+PP A SY+ FH+VGDLVAL+  L   +VF+VGHDWGAI+AW  C+ RP
Sbjct  64    APDLRGYGDSDSPPDASSYTTFHVVGDLVALISDLGQRQVFVVGHDWGAIVAWQLCLLRP  123

Query  813   DRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKA  634
             D ++ALVN+SVV  PR P   PL+ +R   G+D Y+CRFQ+ G AE  F   D   +FK 
Sbjct  124   DLVRALVNLSVVYHPRRPEMSPLQAIRAACGEDHYMCRFQEFGVAEAEFALYDIKWVFKK  183

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
                 R P P  +P     +  ++      + PPWL+++DI YYA KF ++GFTGGLNYYR
Sbjct  184   TFGMRKPAPLILPKD---KSFFDSLDSDGTCPPWLSEEDISYYAEKFAKTGFTGGLNYYR  240

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
               DR+WEL+AAW+G+ I+VP KFIVGD D+TY+ PGV + IH+GG K  VPNL+ VVVME
Sbjct  241   CIDRSWELSAAWTGAPIKVPSKFIVGDLDITYNAPGVPDYIHKGGFKASVPNLEDVVVME  300

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             GV+H+INQEKP EV++HI EF   F
Sbjct  301   GVSHFINQEKPNEVSDHICEFFSKF  325



>ref|XP_003566463.1| PREDICTED: bifunctional epoxide hydrolase 2 [Brachypodium distachyon]
Length=322

 Score =   389 bits (998),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 231/322 (72%), Gaps = 6/322 (2%)
 Frame = -1

Query  1155  ERIQHNTVSV-NGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             E ++H TV V  G+ +HVAE G  DGPAVL LHGFP+LWY WRHQM  LA++G+RA+APD
Sbjct  4     EGVRHRTVEVARGVRLHVAESGPEDGPAVLLLHGFPDLWYGWRHQMAALAARGFRAVAPD  63

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGD+DAPP A SY+ FH+VGDLVAL+  L  P+VF+ GHDWGAI+AW  C+ RPD +
Sbjct  64    LRGYGDSDAPPDAGSYTTFHVVGDLVALIADLAQPQVFVAGHDWGAIVAWQLCLLRPDLV  123

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             +ALVN+SVV  PR     PLE +R   G+D Y+C FQ+PG AE  F   D   LFK  L 
Sbjct  124   RALVNLSVVYHPRRSEGSPLEAVRALCGEDHYMCHFQKPGVAEAEFALPDMRHLFKKVLG  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R   P  +P     +  ++      + P WL+++DI YYA KF ++GFTGG NYYR  D
Sbjct  184   MRKAAPLILPKD---KTFFDSLDSDGTCPAWLSEEDISYYADKFEKTGFTGGFNYYRCMD  240

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             +NWEL+A W+G+ I+VP KFIVGD DLTY+ PGVK+ IH+GGLK +VPNL+ +V+MEGV 
Sbjct  241   KNWELSAPWTGAPIKVPTKFIVGDLDLTYNTPGVKDYIHKGGLKAMVPNLEDLVIMEGVG  300

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQEKP EV++HI EF   F
Sbjct  301   HFINQEKPNEVSDHICEFFSKF  322



>ref|XP_006600362.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Glycine 
max]
 ref|XP_006600363.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Glycine 
max]
Length=354

 Score =   389 bits (1000),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 246/357 (69%), Gaps = 40/357 (11%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H T++VNGINMH+AE G+GP +LF+HGFP+LWY+WRHQ+  LAS GYR +APDLR
Sbjct  1     MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRI  805
             GYGDTD P +  +Y+  H+VGDLV LLDA+   E  VF+VGHDWGA+ AW+  ++RP+RI
Sbjct  61    GYGDTDVPANPTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGAMTAWSLSLYRPERI  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRF------------------------  697
             +ALVN+SVV +PR+P RKPL+ +R  +G+D+YICRF                        
Sbjct  121   RALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQVSKHGLSRSDEKKMLFSRGKPWF  180

Query  696   -----------QQPGEAEEVFGSIDPTTLFKAFLTNRDPRPPRIPHQSVAQVLYEKRGET  550
                        Q+PGE E  F  I    + K FLT R+P P  +P     +         
Sbjct  181   AKWLCCSSALLQEPGEIEAEFAQIGTARVLKEFLTYRNPGPLYLPK---GKAFAHPTDSP  237

Query  549   VSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRNWELTAAWSGSQIQVPVKFIVGDQ  370
             ++LP WL++++  YYA+K+ ++GFTGGLNYYRN D NWELTA+W+G+Q++VPVKFIVGD 
Sbjct  238   IALPSWLSEEECDYYASKYDKTGFTGGLNYYRNLDLNWELTASWTGAQVKVPVKFIVGDL  297

Query  369   DLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHYINQEKPEEVNNHILEFIQNF  199
             DLTY+ PG KE IH+GG K+ VP L+ VVV+EG  H+++QE+P+E++NHI +F + F
Sbjct  298   DLTYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAGHFLHQERPDEISNHIYDFFKKF  354



>ref|XP_006414587.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
 gb|ESQ56040.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
Length=371

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/328 (56%), Positives = 233/328 (71%), Gaps = 13/328 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEI---GDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAP  988
             ++ ++H T+ VNGINMH AEI   G  P +LF+HGFPELWYTWRHQM  L+S GYR IAP
Sbjct  46    LDGVEHKTLKVNGINMHYAEISGSGGDPIILFIHGFPELWYTWRHQMAALSSLGYRTIAP  105

Query  987   DLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLP---EVFLVGHDWGAIIAWNFCMFR  817
             DLRGYGDTDAP   + Y+  ++VGDLVA +DA+       VF+VGHDWGA+IAW  C +R
Sbjct  106   DLRGYGDTDAPEKVEEYAYLNVVGDLVAHIDAVTTSGDEAVFVVGHDWGAMIAWQLCQYR  165

Query  816   PDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFK  637
             P+++KALVNMSVV SPR+P R P+  +R  FGDD+YICRFQ+PGE E  F  +    + K
Sbjct  166   PEKVKALVNMSVVFSPRNPDRVPVPTLRHVFGDDYYICRFQKPGEIEAEFKKLGTENVLK  225

Query  636   AFLTNRDPRPPRIPHQSVAQVLYEKRGETVS--LPPWLTQQDIKYYATKFGQSGFTGGLN  463
              FLT + P P  +P   +      KR E  +  LPPWL Q+D+ YY  K+ + GFTG +N
Sbjct  226   KFLTYKTPGPLYLPKPKLF-----KRSENAASALPPWLAQEDLHYYVNKYDKKGFTGPIN  280

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYRN DRNWELTA W+G++I VPVKFIVGDQDLTY+ PG KE IH GG K+ VP L + V
Sbjct  281   YYRNIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYIHGGGFKRDVPLLDETV  340

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             V+ G+ H++++E P+E+N HI  F Q F
Sbjct  341   VLNGLGHFLHEESPDEINQHIHNFFQKF  368



>ref|XP_002516953.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF45567.1| epoxide hydrolase, putative [Ricinus communis]
Length=321

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 237/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             M+ I+H  + VNGINMHVAE+G  +GP +LF+HGFPELWY+WRHQ++ LAS GYRA+APD
Sbjct  1     MDAIEHRVIKVNGINMHVAEMGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQ--LPEVFLVGHDWGAIIAWNFCMFRPD  811
             LRG+GDTDAPP   SY+V H VGDL+ +LD +     +VF+VGHDWGA +AW  C+FRPD
Sbjct  61    LRGFGDTDAPPEQRSYTVMHSVGDLIGVLDVVAPLQEKVFVVGHDWGAYMAWFLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R+KALVN+SV  SPR+P +K +E +R  +GDD+Y+CRFQ+ G+ E  F  +    + K F
Sbjct  121   RVKALVNLSVSFSPRNPHKKIVEMLRAVYGDDYYMCRFQEVGDIEAEFAELGTERVIKEF  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT R P P  +P     +         + LP WL+++D +YY  KF + GFTGGLN YRN
Sbjct  181   LTYRYPGPLFLPK---GKAFNRSPENPLVLPSWLSEEDAQYYVGKFEEKGFTGGLNLYRN  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWELTA W+G++++VP+KFIVGDQDLTY+  G K  I +GG K+ VP L++VV+MEG
Sbjct  238   LDLNWELTAPWTGAKVKVPIKFIVGDQDLTYNSLGNKAYIEKGGFKRDVPFLEEVVIMEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH+INQEK EE+N HI +F Q F
Sbjct  298   VAHFINQEKAEEINKHIYDFFQKF  321



>ref|XP_006419522.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
 gb|ESR32762.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
Length=324

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 233/327 (71%), Gaps = 10/327 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH  V VNGINMH+AE G GP +LFLHGFPELWY+WRHQ+  LA  GYRA+APDLR
Sbjct  1     MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALACLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAPP   SY+ FH++GDLV L+D +     +VF+VGHDWGA +AW  C+FRPDR+
Sbjct  61    GFGDTDAPPDVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGAFMAWFLCLFRPDRV  120

Query  804   KALVNMSVVISP-----RHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLF  640
             KALVN+SVV +P           P+E +R  +GDD+Y+CRFQ+PGE E  F  I   T+ 
Sbjct  121   KALVNLSVVFNPFGSNTSESNNNPIEALRAYYGDDYYMCRFQEPGEIEAEFAQIGTETVI  180

Query  639   KAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNY  460
             K FLT R P P  +P     +         ++LP WL+++D+KY+  KF + GFTGG+NY
Sbjct  181   KEFLTFRTPGPIILPK---GKGFGHPPDAPMALPSWLSEEDVKYFTAKFDKKGFTGGINY  237

Query  459   YRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVV  280
             YRN + + EL A W+GS++Q+P KFI+GD DL YH PGVKE IH+GG K+ VP L++VV+
Sbjct  238   YRNINLSQELLAPWAGSRLQIPTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVI  297

Query  279   MEGVAHYINQEKPEEVNNHILEFIQNF  199
             MEGV H+INQEK +E++ HI +F   F
Sbjct  298   MEGVGHFINQEKGDEISKHIYDFFNKF  324



>emb|CDM82646.1| unnamed protein product [Triticum aestivum]
Length=322

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 233/322 (72%), Gaps = 6/322 (2%)
 Frame = -1

Query  1155  ERIQHNTVSV-NGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             E ++H  V V  G+ +HVAE G  DGPAVL +HGFP+LWY WRHQM  LA++G+RA+APD
Sbjct  4     EGVRHRMVEVAKGVRLHVAEAGPEDGPAVLLVHGFPDLWYGWRHQMAALAARGFRAVAPD  63

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             +RGYGD+DAPPSA SYS+FH+VGDLVAL+  L  P+VF+VGHDWGA++AW  C+ RPD +
Sbjct  64    MRGYGDSDAPPSAGSYSIFHLVGDLVALVADLGQPQVFVVGHDWGALVAWQLCLLRPDLV  123

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             +ALVN+SV   PR     PL+ +R   G+D Y+CRFQ+PG AE  F   D +  FK    
Sbjct  124   RALVNLSVAYHPRSSEGSPLQVIRALCGEDHYMCRFQEPGVAEAEFALYDNSHKFKTVFG  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R P PP +P     +  ++      + PPWL+++DI YYA KF ++GFTGGLNYYR  D
Sbjct  184   MRKPAPPILPKD---KTFFDSLDSDGTCPPWLSEEDISYYADKFEKTGFTGGLNYYRCMD  240

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWEL+A W+G+ I+V  KFIVGD D+TY+ PGVK+ IH+GGLK  VPNL+ VVVMEGV+
Sbjct  241   LNWELSAPWTGAPIKVATKFIVGDLDVTYNVPGVKDYIHKGGLKASVPNLEDVVVMEGVS  300

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+ NQEKP EV+++I EF   F
Sbjct  301   HFCNQEKPNEVSDYICEFFSKF  322



>ref|XP_003556522.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X1 [Glycine 
max]
 ref|XP_006606541.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X2 [Glycine 
max]
Length=322

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 231/324 (71%), Gaps = 6/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGI MHVAE G+G  VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MESIEHRTVEVNGIKMHVAEKGEGAVVLFLHGFPELWYSWRHQILALSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP + +SY+ FH+VGD++AL+D+L + +VFLV HDWGAII W  C+FRPDRIKA
Sbjct  61    GYGDTEAPSTVNSYTCFHLVGDIIALIDSLGVDKVFLVAHDWGAIIGWYLCLFRPDRIKA  120

Query  798   LVNMSVVISP---RHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
              V +SV   P   R+P +K ++     +GDD+YICRFQ+PG+ E     +D   L K  L
Sbjct  121   YVCLSVPFRPFLGRNPKQKTVDFFHSLYGDDYYICRFQEPGKMEAEMAGVDTAYLMKNIL  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T R   PP  P             +T  LP W++Q+D+ YY TKF ++GF+GGLNYYRN 
Sbjct  181   TTRKTGPPTFPKGEYGTGFNPVTPDT--LPSWISQEDLDYYVTKFNKTGFSGGLNYYRNL  238

Query  447   DRNWELTAAWSGSQI-QVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             + NWELTA W+G+ I  VPVKFI G  DL Y  PG+KE IH GG KK VP L++VVV EG
Sbjct  239   NLNWELTAPWTGAGIVDVPVKFITGGVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEG  298

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             VAH+ NQE  E+V+NHI +FI+ F
Sbjct  299   VAHFNNQEAAEDVSNHIYDFIKKF  322



>ref|XP_003626240.1| Epoxide hydrolase [Medicago truncatula]
Length=752

 Score =   402 bits (1032),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 238/321 (74%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  434   MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  493

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S  SY++FH+VGD+VAL+D+L + +VFLV HDWGA+I W  C+FRP++IK
Sbjct  494   RGYGDTDAPASISSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAMIGWYLCLFRPEKIK  553

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  KP++ MR  FGDD+YICRFQ+PG+ E  F    P  L K  LT+
Sbjct  554   AYVCLSVPYLPRNPKMKPVDGMRALFGDDYYICRFQEPGKMESEFAKGGPELLIKNMLTS  613

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R+  PP +P + V  +       T +LP WL+Q+DI YYA+KF ++GF+G LNYYRN + 
Sbjct  614   RNSGPPILPKEGV--IPNPHASGTKALPSWLSQEDITYYASKFEKTGFSGALNYYRNLNL  671

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+ ++I+VPVKFI GD D  Y   G K+ I  GG KK VPNL++VV+ EGVAH
Sbjct  672   NWELTAAWTAAKIKVPVKFITGDLDAVYTSFGTKQYIESGGFKKDVPNLEEVVIQEGVAH  731

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E+++NHI +FI+ F
Sbjct  732   FNNQEAAEDISNHIYDFIKKF  752


 Score =   308 bits (790),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 177/239 (74%), Gaps = 3/239 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEEIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQISALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S  SY++FH+VGD+VAL+D+L +  VFLV HDWGAII W  C+FRP+RIK
Sbjct  61    RGYGDTDAPASISSYTIFHLVGDIVALIDSLGVDRVFLVAHDWGAIIGWYLCLFRPERIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  KP++ MR  +GDD+YICRFQ+PG+ E          L KA LT+
Sbjct  121   AYVCLSVPYLPRNPKLKPVDGMRAVYGDDYYICRFQEPGKMEAEIAKGSSELLIKAMLTS  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
             R+P PP +P + +    +     T+ LP WLT +D+ YYA+KF Q+GF+GGLNYYRNF+
Sbjct  181   RNPGPPILPKEGILS--HPSVSSTMPLPSWLTLEDVAYYASKFEQTGFSGGLNYYRNFN  237


 Score =   110 bits (275),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 71/108 (66%), Gaps = 5/108 (5%)
 Frame = -1

Query  510  YYATKFGQSGFTGGLNYYRNFDR-----NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPG  346
            +++T      F GGL      D      NWELTAAW+GS I+VPVKFI+GD DL Y   G
Sbjct  301  FFSTAAAAQHFQGGLLTAAESDEKMGLINWELTAAWTGSHIKVPVKFIIGDLDLVYTSFG  360

Query  345  VKELIHEGGLKKIVPNLQQVVVMEGVAHYINQEKPEEVNNHILEFIQN  202
             K+ I  GG K  VPNL++VV+ +GVAH+ NQE  EE++NHI +FI+N
Sbjct  361  TKQYIESGGFKNDVPNLEEVVIQKGVAHFNNQEAAEEISNHIYDFIKN  408



>ref|XP_006489041.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=319

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 233/322 (72%), Gaps = 5/322 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH  V VNGINMH+AE G GP +LFLHGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAPP   SY+ FH++GDLV L+D +     +VF+VGHDWGA +AW  C+FRPDR+
Sbjct  61    GFGDTDAPPDVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGAFMAWFLCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SVV +P       +E +R  +GD++Y+CRFQ+PGE E  F  I   T+ K FLT
Sbjct  121   KALVNLSVVFNPFGSINNVIEALRAYYGDNYYMCRFQEPGEIEAEFAQIGTETVIKEFLT  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R P P  +P     +         ++LP WL+++D+K++  KF + GFTGG+NYYRN +
Sbjct  181   FRTPGPIILPK---GKGFGHPPDAPMALPSWLSEEDVKHFTAKFDKKGFTGGINYYRNIN  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              + EL A W+GS++Q+P KFI+GD DL YH PGVKE IH+GG K+ VP L++VV+MEGV 
Sbjct  238   LSQELLAPWAGSRLQIPTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVIMEGVG  297

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+INQEK +E++ HI +F   F
Sbjct  298   HFINQEKGDEISKHIYDFFNKF  319



>ref|XP_007147005.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
 gb|ESW18999.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
Length=318

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 227/320 (71%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H TV VNGI MHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S+GY A+APDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+AP S  SY+ F IVGDLVAL+D L + +VFLV HDWGA+I W  CMFRP+++KA
Sbjct  61    GYGDTEAPASMSSYTCFDIVGDLVALIDLLGVEQVFLVAHDWGAVIGWYLCMFRPEKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV +  R P  KP++ MR  +GDD+YICRFQ+PGE E     +    + K  LT R
Sbjct  121   YVCLSVPLRRRDPKVKPVDVMRAVYGDDYYICRFQKPGEMEAQMAEVGTEYVLKNILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP  P              T SLP WL+Q D+ YY +KF ++GFTG LNYYRN + N
Sbjct  181   KPGPPIFPMGEYGTGF--NPDMTNSLPSWLSQHDLAYYVSKFQKTGFTGPLNYYRNLNPN  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA WSG +I+VPVKFI G+ D+ Y    +KE IH GG K+ VPNL++V+V +GVAH+
Sbjct  239   WELTAPWSGVKIEVPVKFITGELDMVYTSLNMKEYIHGGGFKEHVPNLEEVIVQKGVAHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  EE++N+I EFI  F
Sbjct  299   NNQETAEEISNYIYEFINKF  318



>ref|XP_004981166.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=330

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 234/324 (72%), Gaps = 10/324 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIA  991
             M  ++H  V  NGI+MHVAE G      PAVLF+HGFPELWY+WRHQM +LA++GYR +A
Sbjct  1     MAAVRHRQVEANGISMHVAEAGPEGSSAPAVLFVHGFPELWYSWRHQMGYLAARGYRCVA  60

Query  990   PDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPD  811
             PDLRGYG T APP   SY+ FH+VGDL+ALLDAL+LP+VF+VGHDWGAI++WN C+ RPD
Sbjct  61    PDLRGYGGTTAPPEPSSYTAFHVVGDLIALLDALRLPKVFVVGHDWGAIVSWNLCVLRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R++ALVN+SV   PR P  KP+E  R  +GDD+Y+CRFQ+PG  E  F + D  + FK  
Sbjct  121   RVRALVNLSVAFMPRRPGVKPVEYFRAAYGDDYYVCRFQEPG-VEAEFAAFDLKSFFKLA  179

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT        +  + +     +   + ++LP WL+++D+ Y A+ + ++GF GG+NYYR 
Sbjct  180   LTVNTTGSSSMNLRKM-----QAYNKEIALPSWLSEEDVSYLASVYAKTGFAGGVNYYRC  234

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWEL A W+G+++QVP KFIVGD DL YH PGV+  IH+GGLK+ VP L++VVV++G
Sbjct  235   LDLNWELMAPWTGAKVQVPTKFIVGDGDLAYHHPGVRSYIHKGGLKRDVPMLEEVVVIKG  294

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
               H+I QE+ +E++ HI ++I+ F
Sbjct  295   AGHFIQQERAQEISKHIYDYIKKF  318



>tpg|DAA53983.1| TPA: epoxide hydrolase 2 [Zea mays]
Length=325

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/325 (55%), Positives = 230/325 (71%), Gaps = 7/325 (2%)
 Frame = -1

Query  1161  GMERIQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAI  994
              +E ++H T+  NG+ +HVAE G      P VL LHGFP+LWY WRHQM  LA++GYRA+
Sbjct  4     AVEGVRHRTLEANGVRLHVAEAGPEEGSAPVVLLLHGFPDLWYGWRHQMSALAARGYRAV  63

Query  993   APDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRP  814
             APDLRGYGD+D+PP A SY+ FH+VGDLVAL+  L   +VF+VGHDWGA +AW  C+ RP
Sbjct  64    APDLRGYGDSDSPPDASSYTTFHVVGDLVALISDLGQRQVFVVGHDWGATVAWQLCLLRP  123

Query  813   DRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKA  634
             D ++ALVN+SVV  PR P   PL+ +R   G+D Y+CRFQ+ G AE  F   D   +FK 
Sbjct  124   DLVRALVNLSVVYHPRRPEMSPLQAIRAACGEDHYMCRFQEFGVAEAEFALYDIKWVFKK  183

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
                 R P P  +P     +  ++      + PPWL+++DI YYA KF ++GFTGGLNYYR
Sbjct  184   TFGMRKPAPLILPKD---KSFFDSLDSDGTCPPWLSEEDISYYAEKFAKTGFTGGLNYYR  240

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
               DR+WEL+AAW+G+ I+VP KFIVGD D+TY+ PGV + IH+GG K  VPNL+ VVVME
Sbjct  241   CIDRSWELSAAWTGAPIKVPSKFIVGDLDITYNAPGVPDYIHKGGFKASVPNLEDVVVME  300

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             GV+H+INQEKP EV++HI EF   F
Sbjct  301   GVSHFINQEKPNEVSDHICEFFSKF  325



>ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=321

 Score =   387 bits (993),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 235/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+VNG+NMH+AE+G G  +LF+HGFPELWY+WRHQM++LA +GYRA+APDLR
Sbjct  1     MEKIEHKMVNVNGLNMHIAELGQGSTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+FH+VGDLVALL+A+   E  VF+V HDWGAIIAW+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSIFHLVGDLVALLEAIAPNEEKVFVVAHDWGAIIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+SV    R+P    +E ++  +G+D YI RFQ PGE E  F  I   ++ K  
Sbjct  121   KVKALVNLSVHFPRRNPKMNTVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RD  P   P  S    L +      +L  WL+++++ YYA K+ Q+GFTG +NYYR 
Sbjct  181   LTYRDTAPLYFPKGSGLDALPDA---PAALSSWLSEEELDYYANKYEQTGFTGAVNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             F  NWELTA W+G+Q++VP KFIVG+ DL YH PGVKE IH GG KK VP L++VVV+EG
Sbjct  238   FPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGVKEYIHNGGFKKDVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH++NQE+P E+N HI +FIQ F
Sbjct  298   AAHFVNQERPHEINKHIYDFIQKF  321



>ref|XP_010434902.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   388 bits (996),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 237/331 (72%), Gaps = 14/331 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAE---------IGDGPAVLFLHGFPELWYTWRHQMLFLASKG  1006
             ++ ++H T+ +NGINMHVAE          G  P +LF+HGFPELWYTWRHQM+ L+S G
Sbjct  51    LDGVEHKTLKLNGINMHVAEKPASGSGTGSGKDPIILFIHGFPELWYTWRHQMVALSSLG  110

Query  1005  YRAIAPDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWN  832
             YR IAPDLRGYGDTDAP   + Y+  ++VGDLVAL++A+   +  VF+VGHDWGA++AW 
Sbjct  111   YRTIAPDLRGYGDTDAPEKVEDYTYLNVVGDLVALINAVTDGDKAVFVVGHDWGAMLAWQ  170

Query  831   FCMFRPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDP  652
              C +RPD++KALVNMSV+ SPR+  R P+  +R TFGDD+YICRFQ+PGE E  F  +  
Sbjct  171   LCQYRPDKVKALVNMSVLFSPRNSQRVPVTTLRHTFGDDYYICRFQKPGEIEAEFKKLGT  230

Query  651   TTLFKAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTG  472
               + K FLT + P P  +P     + L     +  +LPPWLTQ+D+ YY TK+ + GFTG
Sbjct  231   EKVLKEFLTYKTPGPLHLPKGKCFERL---ENDACALPPWLTQEDLDYYVTKYDKKGFTG  287

Query  471   GLNYYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQ  292
              +NYYRN DRNWELTA W+G++I VPVKFIVG QDLTY+FPG KE I++GG K+ VP L 
Sbjct  288   PINYYRNIDRNWELTAPWTGAKIHVPVKFIVGGQDLTYNFPGAKEYINDGGFKRDVPLLD  347

Query  291   QVVVMEGVAHYINQEKPEEVNNHILEFIQNF  199
             + VV++G+ H++++E P+ +N HI  F   F
Sbjct  348   ETVVLKGLGHFLHEEDPDVINQHIHNFFHKF  378



>ref|XP_011090999.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   385 bits (990),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 233/324 (72%), Gaps = 11/324 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H  + VNGI MHVAE+G GP VLF+HGFPELWY+WRHQM+FLA+ GYRA+APD+R
Sbjct  1     MENIEHKIIPVNGIKMHVAELGKGPLVLFVHGFPELWYSWRHQMVFLAAHGYRAVAPDMR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYG+T   P  D   ++V H+VGDL+ LLDA+   E  VF+VGHDWGA++AW+ C++RPD
Sbjct  61    GYGETTGAPLDDPSKFTVLHLVGDLILLLDAIAPGEEKVFVVGHDWGALVAWHLCLYRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             R+KALVN+SV   PR+P   P+E  R  +GDD YICRFQ+PG+ E  F +I    + K  
Sbjct  121   RVKALVNLSVAFYPRNPEVNPVEMFRGLYGDDHYICRFQEPGDIEAEFANIGVKEVVKNI  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
                R P P   P         +  G ++   PWLT++D+ YY + F Q+GFTGG+NYYR 
Sbjct  181   FAFRTPGPFYFPKG-------KGFGYSLERAPWLTEEDLDYYVSTFEQTGFTGGVNYYRA  233

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             F  NWEL A WSG+Q++VP KFIVG+ D+TYH PG K+ IH+GG KK VP LQ+VVV+EG
Sbjct  234   FGLNWELNAPWSGAQVKVPAKFIVGEFDITYHVPGTKDHIHKGGFKKFVPLLQEVVVLEG  293

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH+INQE+P+E+N HI  F++ F
Sbjct  294   AAHFINQERPDEINEHIYAFLKQF  317



>ref|XP_007015342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32961.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   386 bits (991),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 230/323 (71%), Gaps = 5/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME IQH TV VNGINMH+AE G+GP +LFLHGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MEGIQHKTVRVNGINMHLAEKGEGPVILFLHGFPELWYSWRHQINGLASLGYRALAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             GYG+TDAP S  SY+  H+VGDL+ALLDA+     +VF+VGHDWGAIIAW  C+FRPDR+
Sbjct  61    GYGETDAPASIASYTCLHVVGDLIALLDAVAPDQEKVFVVGHDWGAIIAWYMCLFRPDRV  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KAL N+SV   P +P  KP+E  +  FG+D YI RFQ+PG  E  F  I         L+
Sbjct  121   KALFNLSVPFIPYNPRFKPVETWKAYFGNDHYIVRFQEPGVIEAEFEEIGLGRAVLELLS  180

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R P P  +P      +        V LPPWL+ QD  YYAT+F ++G T  LNYYRNFD
Sbjct  181   YRVPDPLYLPK---GNLFGHPLDGPVDLPPWLSHQDANYYATQFEKTGITPALNYYRNFD  237

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             RNWEL+A WSGSQI+VPVKF++GD DL Y  PG+KE IH GG K+ VP L++ VVM+GV 
Sbjct  238   RNWELSAPWSGSQIKVPVKFVMGDLDLVYTMPGMKEYIHNGGFKRDVPFLEEAVVMKGVT  297

Query  264   HYINQEKPEEVNNHILEFIQNFH  196
             H+INQEKP+++N  + +F   FH
Sbjct  298   HWINQEKPDDINKQMFDFFSKFH  320



>ref|XP_004229258.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=325

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 236/321 (74%), Gaps = 9/321 (3%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+++H T+ VNGINMH+AE+G GP VLFLHGFPELWY+WRHQMLF+A+ GY  +APDLR
Sbjct  1     MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMLFMAAHGYHVVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLP-EVFLVGHDWGAIIAWNFCMFRPDR  808
             G+GDT   P  D   ++  H+VGDLV LL+ +    +VFLVGHDWGA+IAW  C++RPD+
Sbjct  61    GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPDRKVFLVGHDWGAMIAWALCLYRPDK  120

Query  807   IKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
             I ALVNMSV   PR+P  +P+E +R  +GD++YI +FQ+PG+ E  F  I   T+ +  L
Sbjct  121   INALVNMSVPYFPRNPIIRPIEALRAIYGDEYYIIKFQEPGKIEAEFAQIGTKTVLEKIL  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T RDP P ++P               V LPPWLT++D+ YYATK+  +GFTGGLNYYR  
Sbjct  181   TMRDPDPLKMPKGKPFD------DSPVILPPWLTEEDVDYYATKYEHTGFTGGLNYYRAI  234

Query  447   DRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGV  268
             D NWELTA W+G++I+VPVKFIVGD DLTY+  GVK+ I++GG KK VP L+ VV+++GV
Sbjct  235   DLNWELTAPWTGAKIEVPVKFIVGDLDLTYNLVGVKDYINKGGFKKNVPLLEDVVILKGV  294

Query  267   AHYINQEKPEEVNNHILEFIQ  205
             AH++ QE+P+EVN HI  F Q
Sbjct  295   AHFLQQEEPDEVNQHIHVFFQ  315



>gb|AFK39155.1| unknown [Medicago truncatula]
Length=316

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 234/321 (73%), Gaps = 6/321 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MEGIVHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTD P S +SY++FH+VGD+VAL+D+L + +VFLV HDWGAI+ W  C+FRP+R+K
Sbjct  61    RGYGDTDVPSSVNSYTIFHLVGDVVALIDSLGVDQVFLVAHDWGAIVGWYLCLFRPERVK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV   PR+P  KP++ MR   GDD+YICRFQ+ G+ E          + K+ LT 
Sbjct  121   AYVCLSVPYLPRNPKVKPVDGMRALSGDDYYICRFQELGKMEAEIAKDSSEQVIKSMLTG  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   P  +P +   + L+     T  LP WL+Q+D+ YYA+KF ++GF+GGLN+YRN + 
Sbjct  181   RTTGPLILPKE---RFLFHP--STKPLPSWLSQEDVAYYASKFEKTGFSGGLNFYRNLNL  235

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTAAW+G+QI+VP+KFI GD DL Y   G K+ I  GG KK VPNL++VV+ EGVAH
Sbjct  236   NWELTAAWTGAQIKVPLKFITGDFDLVYTSSGTKQYIESGGFKKDVPNLEEVVIQEGVAH  295

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  E+++NHI +FI+ F
Sbjct  296   FNNQEAAEDISNHIYDFIKKF  316



>emb|CDO98837.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/323 (55%), Positives = 233/323 (72%), Gaps = 7/323 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V VNGINMHVAEIG GP VLFLHGFPE WYTWRHQM F+AS G+RA+APDLR
Sbjct  1     MEKIEHKNVEVNGINMHVAEIGQGPVVLFLHGFPECWYTWRHQMSFMASHGHRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             G+G T   P  D   ++  H+VGD++ LL  +   E  VFLVGHDWGA++AW  C++RPD
Sbjct  61    GFGGTTGAPIDDPSKFTTLHVVGDIIELLKIVAPDEDKVFLVGHDWGAVMAWALCLYRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KAL NMSV   PR+P RKP+E +R   G D+Y+CRFQ+PGE EE F  +    + + F
Sbjct  121   KVKALFNMSVSFGPRNPKRKPIETLRAVCGPDYYVCRFQEPGEIEEEFAKVGTKRVLENF  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             L+ R P P  +P      +  +      +LP WL+++D+ YY  ++ QSGFTG LNYYR 
Sbjct  181   LSYRAPGPLFLPK---GILFGDSPDAPTTLPSWLSEEDVAYYVNQYAQSGFTGALNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
              D NWELTA W+G+Q++VPVKF+VGD DLTY+ PG K+ +H+GGLKK VP L QVVVM+ 
Sbjct  238   LDINWELTAPWTGAQVKVPVKFVVGDLDLTYNAPGTKDYLHKGGLKKDVPFLDQVVVMKE  297

Query  270   VAHYINQEKPEEVNNHILEFIQN  202
             V H++++EKP+E+N +I +FIQ 
Sbjct  298   VGHFLHEEKPDEINKYIHQFIQK  320



>ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81892.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 237/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+VNG+NMH+AE+G+GP +LF+HGFPELWY+WRHQM++LA +GYRA+APDLR
Sbjct  1     MEKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+ H+VGD+VALL+A+   E  VF+V HDWGA+IAW+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+SV  S R+P    +E ++  +G+D YI RFQ PGE E  F  I   ++ K  
Sbjct  121   KVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RDP P   P     + + +     V+L  WL+++++ YYA KF Q+GFTG +NYYR 
Sbjct  181   LTYRDPAPFYFPKGKGLEAIPDA---PVALSSWLSEEELDYYANKFEQTGFTGAVNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                NWELTA W+G+Q++VP KFIVG+ DL YH PG KE IH GG KK VP L++VVV+EG
Sbjct  238   LPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH+++QE+P E++ HI +FIQ F
Sbjct  298   AAHFVSQERPHEISKHIYDFIQKF  321



>ref|XP_003554635.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43313.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 229/320 (72%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME + H TV VNGI MH+AE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MEGVIHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS DSY+ FHIVGDLVAL+D+L + +VFLV HDWGA++ W  CMFRP+++KA
Sbjct  61    GYGDTEAPPSIDSYTCFHIVGDLVALIDSLGVQQVFLVAHDWGALMGWYLCMFRPEKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  + ++ +R  +G+D+YI RFQ+PGE E     +    + K  LT R
Sbjct  121   YVCLSVPFIPRNPNVRTVDGLRAMYGEDYYISRFQKPGEMEAQMAEVGTEYVLKNLLTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                PP  P              T  LP WLT++D+ YY +KF ++GFTGGLNYYRN + N
Sbjct  181   KTGPPTFPKGEYGTGF--NPNMTDILPSWLTEEDLAYYVSKFEKTGFTGGLNYYRNINSN  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+  QI+VPVKFI G+ D+ Y   G+KE IH GG K+ VPNL+QV+V +GVAH+
Sbjct  239   WELTTPWTRVQIKVPVKFIAGELDMVYTSLGIKEYIHGGGFKEDVPNLEQVIVQKGVAHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  E+++N+I +FI  F
Sbjct  299   NNQEAAEDISNYIHDFINKF  318



>gb|AFK41660.1| unknown [Lotus japonicus]
Length=318

 Score =   384 bits (986),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/318 (56%), Positives = 227/318 (71%), Gaps = 2/318 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGI MH+AE G GP VLFLHGFPELWY+WRHQ+L L+S+GY A+APDLR
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGQGPVVLFLHGFPELWYSWRHQILTLSSRGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD+P S  +Y+ FHIVG +VAL+D L   +VFLV HDWG+II W  CM RP+R+KA
Sbjct  61    GYGDTDSPISITTYTCFHIVGGIVALIDHLGAKQVFLVAHDWGSIIGWYLCMLRPERVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  + ++ MR  +GDD+YICRF++PGE E     +    + K  LT R
Sbjct  121   YVCLSVPFLPRNPEIRTVDGMRHAYGDDYYICRFREPGEMEAQMAEVGTEYVLKNILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP  P              T  LP WLTQ+D+ Y+ +KF ++GFTGGLNYYRN + N
Sbjct  181   KPGPPIFPKGEYGTGFNPDTPNT--LPSWLTQEDLAYFVSKFEKTGFTGGLNYYRNLNLN  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA WSG +I VPVKFI G+ D+ Y    +KE IH+GG K+ VPNL++V+V +GVAH+
Sbjct  239   WELTAPWSGGKINVPVKFITGELDMVYTSLNMKEYIHDGGFKEDVPNLEEVIVQKGVAHF  298

Query  258   INQEKPEEVNNHILEFIQ  205
              NQE P+E++NHI +FI+
Sbjct  299   NNQETPDEISNHIYDFIK  316



>ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81891.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   384 bits (986),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 234/324 (72%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+VNG+NMH+AE+G GP +LFLHGFPELWY+WRHQM++LA +GYRA+AP LR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAERGYRAVAPVLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+  +VGD+VALL+A+   E  VF+V HDWGA+IAW+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSILQLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN SV   PR+P    +E ++  +G+D YI RFQ PGE E  F  I   ++ K  
Sbjct  121   KVKALVNSSVHFLPRNPKMNTVEGLKAVYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RDP P   P     + L +     V+L  WL+++++ YYA KF Q+GFTGG+NYYR 
Sbjct  181   LTFRDPAPFYFPKGKGLEALPDA---PVALSSWLSEEELDYYANKFEQTGFTGGVNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                NWELTA W+G+Q++VP KFIVG+ DL YH PG KE IH GG KK VP L++VVV+EG
Sbjct  238   LSINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH++NQE+P E++ HI +FIQ F
Sbjct  298   AAHFVNQERPHEISKHIYDFIQKF  321



>pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
 pdb|3CXU|B Chain B, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
Length=328

 Score =   384 bits (986),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 237/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H  V+VNG+NMH+AE+G+GP +LF+HGFPELWY+WRHQM++LA +GYRA+APDLR
Sbjct  8     MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+ H+VGD+VALL+A+   E  VF+V HDWGA+IAW+ C+FRPD
Sbjct  68    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  127

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+SV  S R+P    +E ++  FG+D YI RFQ PGE E  F  I   ++ K  
Sbjct  128   KVKALVNLSVHFSKRNPKMNVVEGLKAIFGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  187

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RDP P   P     + + +     V+L  WL+++++ YYA KF Q+GFTG +NYYR 
Sbjct  188   LTYRDPAPFYFPKGKGLEAIPDA---PVALSSWLSEEELDYYANKFEQTGFTGAVNYYRA  244

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                NWELTA W+G+Q++VP KFIVG+ DL YH PG KE IH GG KK VP L++VVV+EG
Sbjct  245   LPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEG  304

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH+++QE+P E++ HI +FIQ F
Sbjct  305   AAHFVSQERPHEISKHIYDFIQKF  328



>ref|XP_002463580.1| hypothetical protein SORBIDRAFT_01g002410 [Sorghum bicolor]
 gb|EER90578.1| hypothetical protein SORBIDRAFT_01g002410 [Sorghum bicolor]
Length=333

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 234/322 (73%), Gaps = 12/322 (4%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ++H  +  NGI+MHVAE G      PAVLF+HGFPELWY+WRHQM +LA++GYR +APDL
Sbjct  6     VRHRQLEANGISMHVAEAGPVDASAPAVLFVHGFPELWYSWRHQMDYLAARGYRCVAPDL  65

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYG T APP   SY+ FHIVGDLVALLDAL LP+VF+VGHDWGAI++WN C+ RPDR++
Sbjct  66    RGYGGTTAPPEPSSYTAFHIVGDLVALLDALHLPQVFVVGHDWGAIVSWNLCLLRPDRVR  125

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPG-EAEEVFGSIDPTTLFKAFLT  625
             ALVN+SV   PR+P  KPLE  R  +GDD+Y+CRFQ+PG EAE  F + D  + FK  LT
Sbjct  126   ALVNLSVAFMPRNPGVKPLEYFRAAYGDDYYVCRFQEPGLEAE--FAAFDLKSFFKLALT  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R      +  + +     +   + + LP WL+++D+ Y A+ + ++GF GG+NYYR  D
Sbjct  184   LRATGSSVMDLRKM-----QTYAKQIELPSWLSEEDVNYLASVYSKTGFAGGVNYYRCLD  238

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
              NWEL A W+ +++QVP KFIVGD DL YH PGVK  IH+GGLK+ VP L++VVV++G  
Sbjct  239   LNWELMAPWTRAKVQVPTKFIVGDGDLAYHHPGVKSYIHKGGLKRDVPMLEEVVVIKGAG  298

Query  264   HYINQEKPEEVNNHILEFIQNF  199
             H+I QE+ +E++ HI ++I+ F
Sbjct  299   HFIQQERAQEISEHIHDYIKKF  320



>ref|NP_001055069.1| Os05g0273800 [Oryza sativa Japonica Group]
 dbj|BAF16983.1| Os05g0273800 [Oryza sativa Japonica Group]
 gb|EAY97338.1| hypothetical protein OsI_19261 [Oryza sativa Indica Group]
 dbj|BAG87495.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63064.1| hypothetical protein OsJ_17872 [Oryza sativa Japonica Group]
Length=331

 Score =   384 bits (986),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 229/321 (71%), Gaps = 9/321 (3%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAEIG--DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRG  976
             I H TV  NG+ MHVAE G    P VL LHGFP++WY WRHQM  LA  GYRA+APDLRG
Sbjct  12    ITHRTVDANGLRMHVAEAGPPGAPPVLLLHGFPQVWYAWRHQMRALADAGYRAVAPDLRG  71

Query  975   YGDTDAPPSADSYSVFHIVGDLVALLDAL--QLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             YGD+DAP +   Y+  H+VGDLVALLDA+      VF+V HDWGA+ AWN C+FRPDR++
Sbjct  72    YGDSDAPAAELQYTAMHVVGDLVALLDAVVGAGKPVFVVAHDWGALTAWNLCLFRPDRVR  131

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             ALV++SV  +PR P R+P++ +R  +GDD+YICR Q+PG  E  F  +    + + FL  
Sbjct  132   ALVSLSVAFTPRSPARRPVDGLRALYGDDYYICRIQEPGAIEAEFARLGTELVLRKFLAY  191

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R P P  +P        +    + V LP W+T++DIKYYA+KF ++ FTGGLNYYR  ++
Sbjct  192   RTPGPLMMPKSG-----WGSPDDEVPLPSWITEEDIKYYASKFDKTNFTGGLNYYRALNK  246

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
              WELTA W+G++I+VPVKFIVGD DLTYH PG+++ IH+GG KK VP L  VVVM+GV H
Sbjct  247   TWELTAPWTGAEIKVPVKFIVGDLDLTYHTPGIQDFIHKGGFKKYVPLLDDVVVMKGVGH  306

Query  261   YINQEKPEEVNNHILEFIQNF  199
             +I++EKP+EV+ H++ FI+  
Sbjct  307   FISEEKPKEVSEHVISFIRKL  327



>gb|AFK34299.1| unknown [Lotus japonicus]
Length=318

 Score =   384 bits (985),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 228/319 (71%), Gaps = 2/319 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGI MH+AE G GP VLFLHGFPELWY+WRHQ+L L+S+GY A+APDLR
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGQGPVVLFLHGFPELWYSWRHQILTLSSRGYHAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTD+P S  +Y+ FHIVGD+VAL+D L   +VFLV HDWG+II    CMFRP+R+KA
Sbjct  61    GYGDTDSPISITTYTCFHIVGDIVALIDHLGAKQVFLVAHDWGSIIGRYLCMFRPERVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  + ++ MR  +GDD+YICRFQ+PGE E     +    + K  LT R
Sbjct  121   YVCLSVPFLPRNPEIRTVDGMRHAYGDDYYICRFQEPGEMEAQMAEVGTEYVLKNILTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
              P PP  P              T  LP WLTQ+D+ Y+ +KF ++GFTGGLNYYRN + N
Sbjct  181   KPGPPIFPKGEYGTGFNPDTPNT--LPSWLTQEDLAYFVSKFEKTGFTGGLNYYRNLNLN  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELTA WSG +I VPVKFI G+ D+ Y    +KE IH+GG K+ VP+L++V+V +GVAH+
Sbjct  239   WELTAPWSGRKINVPVKFITGELDMVYTSLNMKEYIHDGGFKEDVPDLEEVIVQKGVAHF  298

Query  258   INQEKPEEVNNHILEFIQN  202
              NQE P+E++NHI +FI+ 
Sbjct  299   NNQETPDEISNHIYDFIKK  317



>emb|CAJ19276.1| putative epoxide hydrolase [Solanum commersonii]
Length=321

 Score =   383 bits (984),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 236/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+VNG+NMH+AE+G GP +LF+HGFPELWY+WRHQM++LA +GYR +APDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRTVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+FHIVGD+VALL+A+   E  VF+V HDWGA IAW+ C+FRP+
Sbjct  61    GYGDTTGAPINDPSKFSIFHIVGDVVALLEAIAPNEGKVFVVAHDWGAFIAWHLCLFRPE  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+SV   P++    P+E ++  +G+D+YICRFQ PG+ E  F  I   ++ K  
Sbjct  121   KVKALVNLSVHYPPKNSNMNPIEGLKALYGEDYYICRFQVPGDIEAEFAPIGAKSVLKKM  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RDP P   P     + + +     ++L  WL+++++ YYA+KF Q+GFTG LNYYR 
Sbjct  181   LTYRDPAPFYFPKGKGLEAIADA---PIALSTWLSEEELDYYASKFEQTGFTGALNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                + ELTA W+G++++VP KFIVG+ DL YH  G KE IH GG KK VP L++VVV+EG
Sbjct  238   LSISSELTAPWTGAEVKVPTKFIVGEFDLVYHMQGAKEYIHNGGFKKYVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH+INQE+P E++ HI +FIQ F
Sbjct  298   AAHFINQERPHEISKHIYDFIQKF  321



>ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   383 bits (984),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 236/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H  V+VNG+NMH+AE+G GP +LF+HGFPELWY+WRHQM++LA +GYRA+APDLR
Sbjct  1     MDKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+FH+VGD+VALL+A+   E  VF+V HDWGA+IAW+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSIFHLVGDVVALLEAISPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN SV   PR+P    +E ++  +G+D YI RFQ PG+ E  F  I   ++ K  
Sbjct  121   KVKALVNSSVHFFPRNPNMNTVEGLKAVYGEDHYISRFQVPGDIEAEFAPIGAKSVLKKI  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RD  P   P     + L +     V+L  WL+++++ YYA KF ++GFTGG+NYYR 
Sbjct  181   LTFRDTAPFYFPKGKGLEALPDA---PVALSSWLSEEELDYYANKFEKTGFTGGVNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                NWELTA W+G+Q++VP KFIVG+ DL YH PG KE IH GG K  VP L++VVV+EG
Sbjct  238   LPINWELTAPWTGAQLKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKNDVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH++NQE+P E++ HI +FIQNF
Sbjct  298   AAHFVNQERPHEISKHIYDFIQNF  321



>gb|ACF83934.1| unknown [Zea mays]
 tpg|DAA52331.1| TPA: epoxide hydrolase 2 [Zea mays]
Length=331

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 234/325 (72%), Gaps = 12/325 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIA  991
             M  ++H  +  NGI MHVAE G      PAVLF+HGFPELWY+WRHQM +LA++GYR +A
Sbjct  1     MAAVRHRQLEANGITMHVAEAGPVNASAPAVLFVHGFPELWYSWRHQMGYLAARGYRCVA  60

Query  990   PDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPD  811
             PDLRGYG T APP  +SY+VFHIVGD+VALLDAL LP+VF+VGHDWGAI++WN C+ RPD
Sbjct  61    PDLRGYGGTTAPPEPNSYTVFHIVGDIVALLDALHLPQVFVVGHDWGAIVSWNLCLLRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPG-EAEEVFGSIDPTTLFKA  634
             R++ALVN+SV   PR P  KPLE  R  +GD++Y+CRFQ+PG EAE  F + D  + F  
Sbjct  121   RVRALVNLSVAFMPRRPGVKPLEYFRAAYGDEYYVCRFQEPGLEAE--FATFDLKSFFTL  178

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
              LT R      +  + +     +   + + LP WL+++D+ Y A+ + ++GF GG+NYYR
Sbjct  179   ALTLRATGSSAMDLRKM-----QTYSKQMVLPSWLSEEDVSYLASVYSKTGFAGGVNYYR  233

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
               D NWEL A W+G+++QVP KFIVGD DL YH PGVK  IH+GG K+ VP L++VVV++
Sbjct  234   CLDLNWELMAPWTGAKVQVPTKFIVGDGDLAYHHPGVKRYIHKGGFKRDVPMLEEVVVIK  293

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             G  H+I QE+ +E++ HI ++I+ F
Sbjct  294   GAGHFIQQERAQEISEHIHDYIKKF  318



>ref|XP_006342825.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=334

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 235/320 (73%), Gaps = 8/320 (3%)
 Frame = -1

Query  1152  RIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLRGY  973
             +++H TV+VNGINMH  EIG+GP VLF+HGFPE WY+WRHQM F+A +GYRA+APDLRGY
Sbjct  4     QVEHKTVAVNGINMHFVEIGEGPIVLFIHGFPECWYSWRHQMSFMAKQGYRAVAPDLRGY  63

Query  972   GDTDAPPSAD--SYSVFHIVGDLVALLD--ALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             GDT   P+ D   ++   IVGDLV LL+  A Q  +VF+VGHDWGA+++W  C++RPD++
Sbjct  64    GDTTGAPNDDPSKFTTLDIVGDLVELLNNIAPQEEKVFVVGHDWGAVVSWALCLYRPDKV  123

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KA V +SV  +PR+P +KPLE +R+ +GDD+Y+ RFQ+PG  E  F  +    + K FLT
Sbjct  124   KAFVCLSVAFNPRNPVKKPLETLRKVYGDDYYVVRFQEPGVIEGEFEELGIKNVVKKFLT  183

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R P P  +         +E    T  LP WL+ +DI +YA K+ Q GFTG LNYYR+ D
Sbjct  184   YRTPGPLYLKKGKP----FEDASSTDELPGWLSDEDIDFYANKYKQIGFTGALNYYRSID  239

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVA  265
             RNWE+TAAW+G++IQVPVKFIVGD D+TY+ PG K+ +H+GG KK+VP L+ VVV++GV 
Sbjct  240   RNWEVTAAWTGAKIQVPVKFIVGDLDITYNAPGAKDYLHKGGFKKLVPLLEDVVVLQGVG  299

Query  264   HYINQEKPEEVNNHILEFIQ  205
             H+I+QEKP+E+N HI  +I 
Sbjct  300   HFIHQEKPKEINEHIYNYIS  319



>gb|ACU23321.1| unknown [Glycine max]
Length=318

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 228/320 (71%), Gaps = 2/320 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME + H TV VNGI MH+AE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MEGVIHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+ PPS DSY+ FHIVGDLVAL+D+L + +VFLV HDWGA++ W  CMFRP+++KA
Sbjct  61    GYGDTETPPSIDSYTCFHIVGDLVALIDSLGVQQVFLVAHDWGALMGWYLCMFRPEKVKA  120

Query  798   LVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTNR  619
              V +SV   PR+P  + ++ +R  +G+D+YI RFQ+PGE E     +    + K  LT R
Sbjct  121   YVCLSVPFIPRNPNVRTVDGLRAMYGEDYYISRFQKPGEMEAQMAEVGTEYVLKNLLTTR  180

Query  618   DPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDRN  439
                PP  P              T  LP WLT++D+ YY +KF ++GFTGGLNYYRN + N
Sbjct  181   KTGPPTFPKGEYGTGF--NPNMTDILPSWLTEEDLAYYVSKFEKTGFTGGLNYYRNINSN  238

Query  438   WELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAHY  259
             WELT  W+  QI+VPVKFI G+ D+ Y   G+KE IH GG K+ VPNL+QV+V +GVAH+
Sbjct  239   WELTTPWTRVQIKVPVKFIAGELDMVYTSLGIKEYIHGGGFKEDVPNLEQVIVQKGVAHF  298

Query  258   INQEKPEEVNNHILEFIQNF  199
              NQE  E+++N+I +FI  F
Sbjct  299   NNQEAAEDISNYIHDFINKF  318



>pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
 pdb|2CJP|B Chain B, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
Length=328

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 237/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M++I+H  V+VNG+NMH+AE+G+GP +LF+HGFPELWY+WRHQM++LA +GYRA+APDLR
Sbjct  8     MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+ H+VGD+VALL+A+   E  VF+V HDWGA+IAW+ C+FRPD
Sbjct  68    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  127

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+SV  S R+P    +E ++  +G+D YI RFQ PGE E  F  I   ++ K  
Sbjct  128   KVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  187

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RDP P   P     + + +     V+L  WL+++++ YYA KF Q+GFTG +NYYR 
Sbjct  188   LTYRDPAPFYFPKGKGLEAIPDA---PVALSSWLSEEELDYYANKFEQTGFTGAVNYYRA  244

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                NWELTA W+G+Q++VP KFIVG+ DL YH PG KE IH GG KK VP L++VVV+EG
Sbjct  245   LPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEG  304

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH+++QE+P E++ HI +FIQ F
Sbjct  305   AAHFVSQERPHEISKHIYDFIQKF  328



>gb|AFK46740.1| unknown [Lotus japonicus]
Length=323

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 231/325 (71%), Gaps = 7/325 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I+H TV VNGI MH+AE G+GP VLFLHGFPELWY+WRHQ+L L+S+GYRA+APDLR
Sbjct  1     MESIKHRTVQVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILALSSQGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDT+APPS  SY+ F+IVGD+VAL+D+L + +VFLVGHDWGAII W  C+FRPD+IKA
Sbjct  61    GYGDTEAPPSVTSYNCFNIVGDIVALIDSLGVDQVFLVGHDWGAIIGWYVCLFRPDKIKA  120

Query  798   LVNMSVV----ISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
              V +SV     +       K ++  R  +GDDFY+CRFQ+PG+ E     +    + K  
Sbjct  121   YVCLSVAYRSFVRSADSQVKIVDAFRALYGDDFYVCRFQEPGKMEAEIAEVGTEYMHKNI  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT R   PP  P             E  +LP WL+QQD+ YY ++F ++GF+G LNYYRN
Sbjct  181   LTMRKTGPPIFPKGEFGTGFNPDMPE--NLPSWLSQQDLDYYVSQFNKTGFSGALNYYRN  238

Query  450   FDRNWELTAAWSGSQI-QVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
              + NWELTA W+G  I  VPVKFIVGD D+ Y+F G+KE IH GG KK VP L++VVV E
Sbjct  239   LNLNWELTAPWTGVPITNVPVKFIVGDVDIAYNFSGMKEYIHNGGFKKDVPGLEEVVVQE  298

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             GVAH+ NQE  E+V+NHI +FI+ F
Sbjct  299   GVAHFNNQEAAEDVSNHIYDFIKKF  323



>ref|XP_007144960.1| hypothetical protein PHAVU_007G198000g [Phaseolus vulgaris]
 gb|ESW16954.1| hypothetical protein PHAVU_007G198000g [Phaseolus vulgaris]
Length=322

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 225/324 (69%), Gaps = 6/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME I H  V +NGINMHVAE G+GP VLFLHGFPELWY+WRHQ+L L+S GYRA+APDLR
Sbjct  1     MENILHRMVELNGINMHVAEKGEGPVVLFLHGFPELWYSWRHQILHLSSLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIKA  799
             GYGDTDAP    +Y+ FH+VGD+VAL+D+L + +VFLV HDWGAI+ W  C+FRPDR+KA
Sbjct  61    GYGDTDAPAPLTTYTCFHLVGDIVALIDSLGVDKVFLVAHDWGAILGWYLCLFRPDRVKA  120

Query  798   LVNMSVVISP---RHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFL  628
              V +SV   P   R+P +K L+     +GDD+YICRFQ+PG+ E   G +D   L K   
Sbjct  121   YVALSVPFRPFLGRNPQQKTLDIFHALYGDDYYICRFQEPGKMEAELGRVDTAYLMKNMF  180

Query  627   TNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNF  448
             T R   PP  P             +T  LP WLTQQD+ YY TK  +SGFTGGLNYYRN 
Sbjct  181   TTRQTGPPIFPKGEYGTGFNPHTPDT--LPSWLTQQDLDYYVTKVERSGFTGGLNYYRNL  238

Query  447   DRNWELTAAWSGSQIQ-VPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             + NWELTA W+G  I+ VPVKFI G  DL Y  PG+KE IH GG KK VP L++VVV EG
Sbjct  239   NINWELTAPWTGVGIENVPVKFITGSVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEG  298

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
             V H+ NQE   +V NHI +FI+ F
Sbjct  299   VGHFNNQEAAHDVANHIYDFIKKF  322



>ref|NP_001150215.1| epoxide hydrolase 2 [Zea mays]
 gb|ACG38274.1| epoxide hydrolase 2 [Zea mays]
Length=331

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 233/325 (72%), Gaps = 12/325 (4%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG----DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIA  991
             M  ++H  +  NGI MHVAE G      PAVLF+HGFPELWY+WRHQM +LA++GYR +A
Sbjct  1     MAAVRHRQLEANGITMHVAEAGPVNASAPAVLFVHGFPELWYSWRHQMGYLAARGYRCVA  60

Query  990   PDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPD  811
             PDLRGYG T APP   SY+VFHIVGD+VALLDAL LP+VF+VGHDWGAI++WN C+ RPD
Sbjct  61    PDLRGYGGTTAPPEPTSYTVFHIVGDIVALLDALHLPQVFVVGHDWGAIVSWNLCLLRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPG-EAEEVFGSIDPTTLFKA  634
             R++ALVN+SV   PR P  KPLE  R  +GD++Y+CRFQ+PG EAE  F + D  + F  
Sbjct  121   RVRALVNLSVAFMPRRPGVKPLEYFRAAYGDEYYVCRFQEPGLEAE--FATFDLKSFFTL  178

Query  633   FLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYR  454
              LT R      +  + +     +   + + LP WL+++D+ Y A+ + ++GF GG+NYYR
Sbjct  179   ALTLRATGSSAMDLRKM-----QTYSKQMVLPSWLSEEDVSYLASVYSKTGFAGGVNYYR  233

Query  453   NFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVME  274
               D NWEL A W+G+++QVP KFIVGD DL YH PGVK  IH+GG K+ VP L++VVV++
Sbjct  234   CLDLNWELMAPWTGAKVQVPTKFIVGDGDLAYHHPGVKRYIHKGGFKRDVPMLEEVVVIK  293

Query  273   GVAHYINQEKPEEVNNHILEFIQNF  199
             G  H+I QE+ +E++ HI ++I+ F
Sbjct  294   GAGHFIQQERAQEISEHIHDYIKKF  318



>ref|XP_009598630.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=321

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 235/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V VNG+ MHVAE+G GP +LF+HGFPELWY+WRHQ+ +LA +GYRA+APDLR
Sbjct  1     MEKIEHKMVDVNGLQMHVAELGQGPIILFIHGFPELWYSWRHQIFYLAERGYRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT   P  D   +S+FH+VGDL+AL++A+   E  VF+VGHDWGAIIAW+ C+FRPD
Sbjct  61    GYGDTTGAPINDHTKFSIFHLVGDLIALIEAIAPNEDKVFVVGHDWGAIIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+S+   P +P    ++ +R  +GDD Y+ RFQ PGE E  F  I   ++ K F
Sbjct  121   KVKALVNLSIHYFPTNPQMNTVDGLRAIYGDDHYVWRFQVPGEIEAEFAPIGVKSVLKKF  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             L  RD  P   P     + + +     + L  WLT++D+ YY++KF Q+GFTGG+NYYR 
Sbjct  181   LRFRDSAPFYFPKGKGVEAIPDA---PIELSSWLTEEDLDYYSSKFEQTGFTGGVNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
             F  NWELTA W+G+Q++VP KF+VG+ DL YH PG K+ IH G  KK VP L++VVV+EG
Sbjct  238   FPINWELTAPWTGAQVKVPAKFMVGELDLVYHIPGAKDYIHNGEFKKDVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH++NQE+P+E+N HI +FIQ F
Sbjct  298   AAHFVNQERPDEINKHIFDFIQKF  321



>ref|XP_008775992.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=319

 Score =   382 bits (980),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 239/323 (74%), Gaps = 6/323 (2%)
 Frame = -1

Query  1164  KGMERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPD  985
             +G   I H TV  NGI MHVAE G G  VL LHGFPELWYTWRHQ+  LA++GYRAIAPD
Sbjct  2     EGASGISHRTVEANGIRMHVAEKGKGLPVLLLHGFPELWYTWRHQIAGLAARGYRAIAPD  61

Query  984   LRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRI  805
             LRGYGDTDAPP   SY++FH+VGDLVALLDAL L +VF+VGHDWGA +AW+ C+FRPDR+
Sbjct  62    LRGYGDTDAPPDVASYTIFHLVGDLVALLDALALSQVFVVGHDWGAFVAWHLCLFRPDRV  121

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SV   PR+P  KPL ++R   GD++YI RFQ+ G  E  F  +   T+ + FLT
Sbjct  122   KALVNLSVPFMPRNPAAKPLNHVRALNGDEYYISRFQEHGAVEAEFARLGTATVLRKFLT  181

Query  624   NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFD  445
              R+P P  IP +      +    E ++LP WL+++DI Y+ +KF +SGFTG +NYYR  D
Sbjct  182   YRNPGPLFIPKEG-----WGSPNEHITLPSWLSEEDINYFTSKFEKSGFTGPINYYRCLD  236

Query  444   RNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKE-LIHEGGLKKIVPNLQQVVVMEGV  268
              NWEL AAW+G+QI+VP KFI+GD DL YH P  ++  IH+GG KK VP LQ+VVVMEGV
Sbjct  237   LNWELAAAWTGAQIKVPAKFIIGDLDLNYHDPPRRQDYIHKGGFKKDVPLLQEVVVMEGV  296

Query  267   AHYINQEKPEEVNNHILEFIQNF  199
             AH+INQEK +E+ +HI +FIQ F
Sbjct  297   AHFINQEKAQEITDHIFDFIQKF  319



>ref|XP_006419517.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
 gb|ESR32757.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
Length=319

 Score =   381 bits (978),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 230/334 (69%), Gaps = 29/334 (9%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             M+ IQH  V VNGINMH+AE G GP +LFLHGFPELWY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MDGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  978   GYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPDRI  805
             G+GDTDAPP   SY+ FH++GDLV L+D +   +  VF+VGHDWGA++AW  C+FRPDRI
Sbjct  61    GFGDTDAPPEVTSYTCFHVIGDLVGLIDTVAPSDEKVFVVGHDWGALMAWFLCLFRPDRI  120

Query  804   KALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLT  625
             KALVN+SVV +P       +E +R  +GD++Y+CRFQ+PGE E  F  I   T+ K F T
Sbjct  121   KALVNLSVVFNPFGSNDNLIEALRAYYGDNYYMCRFQKPGEIEAEFAQIGTETVIKEFFT  180

Query  624   ------------NRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSG  481
                             RPP  P               ++LP WL+++D+KY+ TKF + G
Sbjct  181   FWTGDRIFLPKGKGFGRPPNTP---------------IALPSWLSEEDVKYFTTKFDKKG  225

Query  480   FTGGLNYYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVP  301
             FTG +NYYRN + N EL A W+GSQIQ+P KFI+GD D+TYH PGV+E IH+GG K+ VP
Sbjct  226   FTGAMNYYRNINLNHELLAPWAGSQIQIPTKFIIGDLDMTYHMPGVQEYIHKGGFKRDVP  285

Query  300   NLQQVVVMEGVAHYINQEKPEEVNNHILEFIQNF  199
              L++VV+MEGV H+INQ K  E++ HI +F   F
Sbjct  286   LLEKVVIMEGVGHFINQGKSNEISKHIYDFFNKF  319



>ref|XP_004494577.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=347

 Score =   382 bits (981),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 233/327 (71%), Gaps = 3/327 (1%)
 Frame = -1

Query  1176  LYTCKGMERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYR  1000
             L + K +E I+H T+  NGI +H+AE G +GP VLFLHGFPELWYTWRHQ+  L S+GYR
Sbjct  23    LGSSKELEGIEHRTIKANGIKIHIAEKGKEGPVVLFLHGFPELWYTWRHQIAALGSRGYR  82

Query  999   AIAPDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMF  820
             A+APDLRGYGDTDAP S  +Y++ H+V D+V ++DAL + +VFLVGHDWGA + W+ C+F
Sbjct  83    AVAPDLRGYGDTDAPGSISNYTIIHLVNDIVGVIDALGVDKVFLVGHDWGAGVGWHLCLF  142

Query  819   RPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLF  640
              P+R+KA V +SV  +PR+P  KPL+  R  +GDD+Y+CRFQQPG+AE  F  +    + 
Sbjct  143   HPERVKAYVALSVPYAPRNPKVKPLDAARALYGDDYYMCRFQQPGKAEAEFAKVGTEMVV  202

Query  639   KAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNY  460
             K  LT R   P  +P   +   +         LP WL+Q+D+ YY +K  +SGFTGGLNY
Sbjct  203   KVLLTGRTSGPLILPKGGLGSNV--DPSHPPPLPSWLSQKDVSYYVSKLKKSGFTGGLNY  260

Query  459   YRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVV  280
             YRN + NWELTAAW+G++++VPVKFI GD D+ Y+  G KE IH GG K+ VPNL++VV+
Sbjct  261   YRNLNTNWELTAAWTGAKVKVPVKFITGDLDVIYNSSGNKEYIHGGGFKRYVPNLKEVVI  320

Query  279   MEGVAHYINQEKPEEVNNHILEFIQNF  199
              +GVAH+I QE  E V +HI +FI  F
Sbjct  321   KKGVAHFIQQEAAEFVTDHIYKFINKF  347



>ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81889.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   381 bits (978),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 235/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDLR  979
             ME+I+H  V+VNG+NMH+AE+G GP +LFLHGFPELWY+WRHQM++LA  GYRA+APDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAECGYRAVAPDLR  60

Query  978   GYGDTDAPPSAD--SYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCMFRPD  811
             GYGDT      D   +S+ H+VGD+VALL+A+   E  VF+V HDWGA+IAW+ C+FRPD
Sbjct  61    GYGDTTGASLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  810   RIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAF  631
             ++KALVN+SV   PR+P    +E ++  +G+D YI RFQ PGE E  F  I   ++ K  
Sbjct  121   KVKALVNLSVHFLPRNPKMNTVEWLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSILKKI  180

Query  630   LTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRN  451
             LT RDP P   P     + L +     V+L  WL+++++ YYA KF Q+GFTGG+NYYR 
Sbjct  181   LTYRDPAPFYFPKGKGLEALPDA---PVALSSWLSEEELDYYANKFEQTGFTGGVNYYRA  237

Query  450   FDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEG  271
                +WELTA W+G+Q++VP KFIVG+ DL YH PG KE IH GG K+ VP L++VVV+EG
Sbjct  238   LPISWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKEDVPLLEEVVVLEG  297

Query  270   VAHYINQEKPEEVNNHILEFIQNF  199
              AH++NQE+P E++ HI +FIQ F
Sbjct  298   SAHFVNQERPHEISKHIYDFIQKF  321



>ref|XP_010449872.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   383 bits (983),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 232/328 (71%), Gaps = 14/328 (4%)
 Frame = -1

Query  1149  IQHNTVSVNGINMHVAE---------IGDGPAVLFLHGFPELWYTWRHQMLFLASKGYRA  997
             ++H T+ VNGINMHVAE          G+ P +LF+HGFPELWYTWRHQM  L+S GYR 
Sbjct  54    VEHKTLKVNGINMHVAEKPASGSGTGSGEDPIILFIHGFPELWYTWRHQMAALSSLGYRT  113

Query  996   IAPDLRGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPE--VFLVGHDWGAIIAWNFCM  823
             IAPDLRGYGDTDAP   + Y+  ++VGDLVAL++A+   +  VF+VGHDWGA++AW  C 
Sbjct  114   IAPDLRGYGDTDAPEKVEDYTYLNVVGDLVALINAVTDGDKAVFVVGHDWGAMLAWQLCQ  173

Query  822   FRPDRIKALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTL  643
             +RPD++KALVNMSV+ SPR+  R P+  +R  FGDD+YICRFQ+PGE E  F  +    +
Sbjct  174   YRPDKVKALVNMSVLFSPRNSERVPVPTLRHIFGDDYYICRFQKPGEIEAEFMKLGTEKV  233

Query  642   FKAFLTNRDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLN  463
              K FLT + P P  +P     +       +  +LPPWLTQ+D+ YY TK+ + GFTG +N
Sbjct  234   LKEFLTYKTPGPLHLPKGKCFEC---SENDACALPPWLTQEDLDYYVTKYDKKGFTGPIN  290

Query  462   YYRNFDRNWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVV  283
             YYRN DRNWELTA W+G++I VPVKFIVGDQDLTY+FPG KE I+ G  K+ VP L + V
Sbjct  291   YYRNIDRNWELTAPWTGAKIHVPVKFIVGDQDLTYNFPGAKEYINGGCFKREVPLLDETV  350

Query  282   VMEGVAHYINQEKPEEVNNHILEFIQNF  199
             V++G+ H++++E P+ +N HI  F   F
Sbjct  351   VLKGLGHFLHEEDPDVINQHIHSFFHKF  378



>gb|AES82420.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 228/321 (71%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             MERI+H TV VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ+  L S GYRA+APDL
Sbjct  1     MERIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTD P S  SY+ FH+VGD+V+L+D L + +VFLVGHD GAII W  CMFRP+RIK
Sbjct  61    RGYGDTDVPSSISSYTCFHVVGDIVSLIDLLGVEQVFLVGHDMGAIIGWYLCMFRPERIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV    R+P  + ++ MR  +GDD+YICRFQ+PGE E     +  T + K  LT 
Sbjct  121   AYVCLSVPFLHRNPKIRTVDGMRAVYGDDYYICRFQEPGEMEAQMAEVGTTYVMKNILTT  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   PP  P             +  +LP WLT+ D+ Y+ +KF ++GFTGGLNYYRNF+ 
Sbjct  181   RKTGPPIFPKGEYGTGFNPDTPD--NLPSWLTEDDLAYFVSKFEKTGFTGGLNYYRNFNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWELTA W+G +I+VPVKFI G+ D+ Y    +KE IH GG K+ VPNL++V++ +GVAH
Sbjct  239   NWELTAPWTGVKIKVPVKFITGELDMVYTSFNLKEYIHGGGFKEDVPNLEEVIIQKGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++N+I EFI  F
Sbjct  299   FNNQEAEEEISNYIYEFIMKF  319



>ref|XP_003626244.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08021.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82462.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 228/321 (71%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H  V VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ++ L+S GYRA+APDL
Sbjct  1     MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALSSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S  SY+ FHIVGDLVAL+D L + +VFLV HDWGAII W  CMFRP+RIK
Sbjct  61    RGYGDTDAPSSVSSYTGFHIVGDLVALIDFLGVDQVFLVAHDWGAIIGWYLCMFRPERIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV +  R+P  + ++ M   +GDD+YICRFQ+PG+ E     +    + K+ LT 
Sbjct  121   AYVCLSVPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLTT  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   PP  P             +T  LP WLT+ D+ Y+ +KF ++GFTG LNYYRNF+ 
Sbjct  181   RKTGPPIFPKGEFGTGFNSDTPDT--LPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWEL A W+G +I+VPVKFI GD D+ Y    +KE IH GG K+ VPNL++V++ +GVAH
Sbjct  239   NWELMAPWNGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++NHI EFI+ F
Sbjct  299   FNNQEAAEEISNHIYEFIKKF  319



>gb|AFK45529.1| unknown [Medicago truncatula]
Length=319

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 228/321 (71%), Gaps = 3/321 (1%)
 Frame = -1

Query  1158  MERIQHNTVSVNGINMHVAEIG-DGPAVLFLHGFPELWYTWRHQMLFLASKGYRAIAPDL  982
             ME I+H  V VNGI MH+AE G +GP VLFLHGFPELWY+WRHQ++ L+S GYRA+APDL
Sbjct  1     MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALSSLGYRAVAPDL  60

Query  981   RGYGDTDAPPSADSYSVFHIVGDLVALLDALQLPEVFLVGHDWGAIIAWNFCMFRPDRIK  802
             RGYGDTDAP S  SY+ FHIVGDLVAL+D L + +VFLV HDWGAII W  CMFRP+RIK
Sbjct  61    RGYGDTDAPSSVSSYTGFHIVGDLVALIDFLGVDQVFLVAHDWGAIIGWYLCMFRPERIK  120

Query  801   ALVNMSVVISPRHPTRKPLENMRETFGDDFYICRFQQPGEAEEVFGSIDPTTLFKAFLTN  622
             A V +SV +  R+P  + ++ M   +GDD+YICRFQ+PG+ E     +    + K+ LT 
Sbjct  121   AYVCLSVPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLTT  180

Query  621   RDPRPPRIPHQSVAQVLYEKRGETVSLPPWLTQQDIKYYATKFGQSGFTGGLNYYRNFDR  442
             R   PP  P             +T  LP WLT+ D+ Y+ +KF ++GFTG LNYYRNF+ 
Sbjct  181   RKTGPPIFPRGEFGTGFNSDTPDT--LPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNL  238

Query  441   NWELTAAWSGSQIQVPVKFIVGDQDLTYHFPGVKELIHEGGLKKIVPNLQQVVVMEGVAH  262
             NWEL A W+G +I+VPVKFI GD D+ Y    +KE IH GG K+ VPNL++V++ +GVAH
Sbjct  239   NWELMAPWNGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAH  298

Query  261   YINQEKPEEVNNHILEFIQNF  199
             + NQE  EE++NHI EFI+ F
Sbjct  299   FNNQEAAEEISNHIYEFIKKF  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3025133731368