BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25969_g2_i3 len=4810 path=[17377:0-51 947:52-119 12993:120-147
19971:148-305 1201:306-336 19985:337-347 19996:348-368 1264:369-470
1366:471-472 1368:473-474 1370:475-513 15043:514-516 15046:517-549
1445:550-589 20097:590-632 20121:633-653 20142:654-654 1550:655-709
1605:710-777 1673:778-789 1685:790-848 20194:849-918 20244:919-921
19033:922-936 1832:937-947 1843:948-1018 1914:1019-1103
1999:1104-1143 2039:1144-1149 2045:1150-1176 20293:1177-1181
15845:1182-1182 2078:1183-1194 2090:1195-1344 20358:1345-1359
2255:1360-1412 20392:1413-1425 20405:1426-1432 20412:1433-1433
20413:1434-1439 20419:1440-1449 2345:1450-1480 2376:1481-1482
2378:1483-1508 13676:1509-1538 2434:1539-1574 20499:1575-1575
16760:1576-1580 11824:1581-1585 2481:1586-1613 20523:1614-1664
2560:1665-1690 2586:1691-1739 2635:1740-1838 2734:1839-1871
2767:1872-1971 2867:1972-2022 2918:2023-2103 2999:2104-2160
3056:2161-2180 3076:2181-2228 3124:2229-2464 3360:2465-2571
3467:2572-2584 3480:2585-2624 16686:2625-2675 3571:2676-2705
3601:2706-2987 3883:2988-3039 3935:3040-3059 3955:3060-3096
17865:3097-3128 4029:3129-3153 14420:3154-3168 4073:3169-3217
16480:3218-3236 4129:3237-3293 4186:3294-3769 4662:3770-3932
4825:3933-3958 4851:3959-4027 14068:4028-4063 4957:4064-4104
17150:4105-4156 5024:4157-4207 14826:4208-4229 5097:4230-4272
18169:4273-4328 5188:4329-4366 5226:4367-4396 5256:4397-4423
13496:4424-4444 5297:4445-4481 17107:4482-4501 5372:4502-4608
5479:4609-4632 5503:4633-4734 5605:4735-4809]

Length=4810
                                                                      Score     E

ref|XP_004231252.1|  PREDICTED: pentatricopeptide repeat-containi...   1006   0.0      
ref|XP_010312265.1|  PREDICTED: pentatricopeptide repeat-containi...   1004   0.0      
ref|XP_010312264.1|  PREDICTED: pentatricopeptide repeat-containi...   1004   0.0      
ref|XP_006347831.1|  PREDICTED: pentatricopeptide repeat-containi...    999   0.0      
ref|XP_009602768.1|  PREDICTED: pentatricopeptide repeat-containi...    997   0.0      
ref|XP_009798335.1|  PREDICTED: pentatricopeptide repeat-containi...    992   0.0      
ref|XP_002277923.1|  PREDICTED: pentatricopeptide repeat-containi...    963   0.0      Vitis vinifera
emb|CBI30210.3|  unnamed protein product                                962   0.0      
ref|XP_011094448.1|  PREDICTED: pentatricopeptide repeat-containi...    949   0.0      
ref|XP_007203128.1|  hypothetical protein PRUPE_ppa024044mg             942   0.0      
ref|XP_008241336.1|  PREDICTED: pentatricopeptide repeat-containi...    936   0.0      
ref|XP_009378231.1|  PREDICTED: pentatricopeptide repeat-containi...    934   0.0      
ref|XP_008386565.1|  PREDICTED: pentatricopeptide repeat-containi...    931   0.0      
ref|XP_006430347.1|  hypothetical protein CICLE_v10011036mg             930   0.0      
emb|CDP15329.1|  unnamed protein product                                928   0.0      
ref|XP_002323489.2|  hypothetical protein POPTR_0016s11000g             921   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010098867.1|  hypothetical protein L484_022634                   920   0.0      
gb|KDO60991.1|  hypothetical protein CISIN_1g040319mg                   917   0.0      
ref|XP_006481930.1|  PREDICTED: pentatricopeptide repeat-containi...    916   0.0      
ref|XP_011012417.1|  PREDICTED: pentatricopeptide repeat-containi...    914   0.0      
ref|XP_004305376.1|  PREDICTED: pentatricopeptide repeat-containi...    910   0.0      
ref|XP_007027561.1|  Pentatricopeptide repeat (PPR) superfamily p...    904   0.0      
gb|KDP29229.1|  hypothetical protein JCGZ_16618                         895   0.0      
ref|XP_010683940.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    884   0.0      
ref|XP_010247796.1|  PREDICTED: pentatricopeptide repeat-containi...    878   0.0      
ref|XP_010037103.1|  PREDICTED: pentatricopeptide repeat-containi...    858   0.0      
ref|XP_008462517.1|  PREDICTED: pentatricopeptide repeat-containi...    848   0.0      
ref|XP_010543483.1|  PREDICTED: pentatricopeptide repeat-containi...    844   0.0      
ref|XP_004143370.1|  PREDICTED: pentatricopeptide repeat-containi...    835   0.0      
ref|XP_004156326.1|  PREDICTED: pentatricopeptide repeat-containi...    834   0.0      
ref|XP_004494120.1|  PREDICTED: pentatricopeptide repeat-containi...    824   0.0      
ref|XP_010423659.1|  PREDICTED: pentatricopeptide repeat-containi...    823   0.0      
gb|KEH24079.1|  PPR containing plant-like protein                       823   0.0      
ref|XP_010452278.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    818   0.0      
ref|XP_002873115.1|  EMB175                                             818   0.0      
ref|XP_010490873.1|  PREDICTED: pentatricopeptide repeat-containi...    817   0.0      
ref|XP_003520676.1|  PREDICTED: pentatricopeptide repeat-containi...    811   0.0      
ref|XP_007162829.1|  hypothetical protein PHAVU_001G184400g             811   0.0      
ref|NP_196000.2|  pentatricopeptide repeat protein EMB175               806   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398839.1|  hypothetical protein EUTSA_v10012634mg             803   0.0      
ref|XP_008805381.1|  PREDICTED: pentatricopeptide repeat-containi...    799   0.0      
gb|KFK24838.1|  hypothetical protein AALP_AA8G031300                    798   0.0      
ref|XP_006287028.1|  hypothetical protein CARUB_v10000176mg             795   0.0      
ref|XP_010908658.1|  PREDICTED: pentatricopeptide repeat-containi...    789   0.0      
emb|CDY14176.1|  BnaC02g02930D                                          788   0.0      
emb|CDY04897.1|  BnaAnng00790D                                          781   0.0      
ref|XP_009125519.1|  PREDICTED: pentatricopeptide repeat-containi...    760   0.0      
ref|XP_009398362.1|  PREDICTED: pentatricopeptide repeat-containi...    748   0.0      
gb|EPS58257.1|  hypothetical protein M569_16559                         739   0.0      
emb|CAB85500.1|  putative protein                                       722   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955587.1|  PREDICTED: pentatricopeptide repeat-containi...    712   0.0      
ref|XP_002461524.1|  hypothetical protein SORBIDRAFT_02g004050          698   0.0      Sorghum bicolor [broomcorn]
dbj|BAK00347.1|  predicted protein                                      694   0.0      
ref|XP_006402229.1|  hypothetical protein EUTSA_v10015790mg             691   0.0      
ref|XP_010228310.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    691   0.0      
ref|XP_008670964.1|  PREDICTED: pentatricopeptide repeat-containi...    687   0.0      
gb|EAZ38850.1|  hypothetical protein OsJ_23267                          681   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058999.1|  Os07g0172600                                       680   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EYU41564.1|  hypothetical protein MIMGU_mgv1a001413mg                657   0.0      
gb|EMT05832.1|  hypothetical protein F775_12454                         655   0.0      
emb|CAN82063.1|  hypothetical protein VITISV_016431                     637   0.0      Vitis vinifera
gb|EAZ02927.1|  hypothetical protein OsI_25067                          633   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006658315.1|  PREDICTED: pentatricopeptide repeat-containi...    630   0.0      
gb|EMT14333.1|  hypothetical protein F775_08151                         627   0.0      
ref|XP_011094447.1|  PREDICTED: beta-galactosidase 15-like              619   0.0      
ref|XP_010683945.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    599   0.0      
ref|XP_010245925.1|  PREDICTED: beta-galactosidase 15-like              601   0.0      
ref|XP_010245924.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    597   0.0      
ref|XP_010050189.1|  PREDICTED: beta-galactosidase 15-like              597   0.0      
gb|KCW89294.1|  hypothetical protein EUGRSUZ_A01583                     596   0.0      
ref|XP_006583477.1|  PREDICTED: beta-galactosidase-like                 583   0.0      
ref|XP_003530083.1|  PREDICTED: beta-galactosidase-like                 581   0.0      
ref|XP_010518958.1|  PREDICTED: beta-galactosidase 15-like              580   0.0      
ref|XP_010540711.1|  PREDICTED: beta-galactosidase 15                   578   0.0      
emb|CDY65885.1|  BnaCnng48970D                                          577   0.0      
emb|CDY36652.1|  BnaA07g04050D                                          565   5e-180   
emb|CDX79397.1|  BnaC06g19060D                                          564   1e-179   
emb|CDX67790.1|  BnaA07g18300D                                          571   2e-179   
ref|XP_009119501.1|  PREDICTED: beta-galactosidase 15-like              565   6e-179   
emb|CDX79398.1|  BnaC06g19050D                                          565   3e-178   
gb|KFK44946.1|  hypothetical protein AALP_AA1G323300                    568   3e-178   
emb|CDY69031.1|  BnaCnng61490D                                          560   4e-178   
ref|XP_006306017.1|  hypothetical protein CARUB_v10011312mg             565   3e-177   
ref|XP_010999621.1|  PREDICTED: beta-galactosidase 15-like              565   5e-177   
emb|CAJ09953.1|  beta-galactosidase                                     563   2e-176   Mangifera indica
ref|XP_011000544.1|  PREDICTED: beta-galactosidase 15-like              563   2e-176   
ref|XP_009359758.1|  PREDICTED: beta-galactosidase 15                   563   4e-176   
emb|CDX93659.1|  BnaA06g03890D                                          562   5e-176   
ref|XP_003533125.1|  PREDICTED: beta-galactosidase-like                 562   6e-176   
gb|KHN07882.1|  Beta-galactosidase 7                                    559   9e-176   
ref|XP_009620959.1|  PREDICTED: beta-galactosidase 15-like              560   2e-175   
ref|XP_010499714.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    560   3e-175   
gb|KHN27597.1|  Beta-galactosidase                                      560   4e-175   
ref|XP_003541315.2|  PREDICTED: beta-galactosidase-like                 559   6e-175   
ref|XP_009616320.1|  PREDICTED: beta-galactosidase 15-like              558   1e-174   
ref|XP_007204034.1|  hypothetical protein PRUPE_ppa020752mg             558   2e-174   
gb|KHN00663.1|  Beta-galactosidase                                      558   3e-174   
emb|CDP03052.1|  unnamed protein product                                557   4e-174   
ref|XP_003519945.2|  PREDICTED: beta-galactosidase-like                 557   4e-174   
ref|XP_008337885.1|  PREDICTED: beta-galactosidase 15-like              557   4e-174   
ref|XP_002284027.2|  PREDICTED: beta-galactosidase 15-like              556   8e-174   Vitis vinifera
ref|XP_004288998.1|  PREDICTED: beta-galactosidase-like                 556   1e-173   
ref|XP_003519946.2|  PREDICTED: beta-galactosidase-like                 555   2e-173   
gb|KHN17741.1|  Beta-galactosidase 7                                    555   3e-173   
ref|XP_004288329.1|  PREDICTED: beta-galactosidase 15-like              554   5e-173   
gb|EYU41565.1|  hypothetical protein MIMGU_mgv1a026878mg                550   8e-173   
gb|KHN00665.1|  Beta-galactosidase                                      556   1e-172   
ref|XP_006601406.1|  PREDICTED: beta-galactosidase 7-like               552   4e-172   
ref|XP_004243920.1|  PREDICTED: beta-galactosidase 15-like              549   3e-171   
ref|XP_002516256.1|  beta-galactosidase, putative                       550   3e-171   Ricinus communis
ref|XP_002297749.2|  hypothetical protein POPTR_0001s06310g             549   3e-171   Populus trichocarpa [western balsam poplar]
ref|XP_009801177.1|  PREDICTED: beta-galactosidase 15-like              551   4e-171   
ref|XP_006367886.1|  PREDICTED: beta-galactosidase 15-like              548   5e-171   
emb|CBI30211.3|  unnamed protein product                                549   5e-171   
ref|XP_007022965.1|  Beta-galactosidase 7                               548   6e-171   
ref|XP_002516237.1|  beta-galactosidase, putative                       548   8e-171   Ricinus communis
ref|XP_009790181.1|  PREDICTED: beta-galactosidase 15-like              546   3e-170   
gb|KHN25095.1|  Beta-galactosidase                                      546   4e-170   
emb|CDP15330.1|  unnamed protein product                                545   1e-169   
gb|KCW79363.1|  hypothetical protein EUGRSUZ_C00782                     544   2e-169   
ref|XP_002276918.2|  PREDICTED: beta-galactosidase 15                   545   2e-169   Vitis vinifera
ref|XP_010050435.1|  PREDICTED: beta-galactosidase 15-like              544   3e-169   
ref|XP_011000543.1|  PREDICTED: beta-galactosidase 7-like               540   2e-168   
ref|XP_008439370.1|  PREDICTED: beta-galactosidase 7-like               540   1e-167   
gb|EYU39588.1|  hypothetical protein MIMGU_mgv1a001416mg                539   2e-167   
ref|XP_011076997.1|  PREDICTED: beta-galactosidase 15-like              538   7e-167   
gb|KGN66324.1|  hypothetical protein Csa_1G597710                       532   1e-165   
ref|XP_010478588.1|  PREDICTED: beta-galactosidase 15-like              534   2e-165   
ref|XP_004144130.1|  PREDICTED: beta-galactosidase 15-like              533   3e-165   
ref|XP_008450952.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    532   8e-165   
ref|XP_007012588.1|  Beta-galactosidase 7                               531   2e-164   
gb|EYU25828.1|  hypothetical protein MIMGU_mgv1a026608mg                531   2e-164   
ref|XP_004171681.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    530   4e-164   
ref|XP_006475097.1|  PREDICTED: beta-galactosidase 7-like               530   5e-164   
emb|CDY32304.1|  BnaC05g28820D                                          531   1e-163   
ref|XP_010535801.1|  PREDICTED: beta-galactosidase 7                    528   2e-163   
ref|XP_004288999.1|  PREDICTED: beta-galactosidase 15-like              528   2e-163   
ref|XP_006452850.1|  hypothetical protein CICLE_v10010454mg             529   2e-163   
ref|XP_006368617.1|  hypothetical protein POPTR_0001s06300g             526   3e-163   
ref|XP_009120777.1|  PREDICTED: beta-galactosidase                      526   1e-162   
gb|AAK76465.1|  putative beta-galactosidase                             519   1e-162   
ref|XP_003595331.1|  Beta-galactosidase                                 524   1e-161   
sp|P49676.1|BGAL_BRAOL  RecName: Full=Beta-galactosidase; Short=L...    522   4e-161   Brassica oleracea
ref|XP_006290000.1|  hypothetical protein CARUB_v10003630mg             522   6e-161   
ref|XP_010541689.1|  PREDICTED: beta-galactosidase 7-like isoform X1    521   7e-161   
emb|CAB64743.1|  putative beta-galactosidase                            520   1e-160   
ref|NP_568399.4|  beta-galactosidase 7                                  520   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811417.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    517   3e-159   
ref|XP_009775909.1|  PREDICTED: beta-galactosidase 7-like               513   8e-159   
ref|XP_009390322.1|  PREDICTED: beta-galactosidase-like                 516   9e-159   
ref|XP_006400640.1|  hypothetical protein EUTSA_v10012695mg             516   9e-159   
ref|XP_010558976.1|  PREDICTED: beta-galactosidase 15-like              516   1e-158   
ref|XP_002871955.1|  beta-galactosidase 7                               515   2e-158   
emb|CAN82062.1|  hypothetical protein VITISV_016430                     513   3e-158   Vitis vinifera
ref|XP_006843913.1|  hypothetical protein AMTR_s00007p00269020          512   2e-157   
ref|XP_009398904.1|  PREDICTED: beta-galactosidase 1-like               505   6e-157   
gb|KFK26294.1|  hypothetical protein AALP_AA8G229300                    510   1e-156   
ref|XP_009621302.1|  PREDICTED: beta-galactosidase 7-like               506   2e-156   
ref|XP_008811996.1|  PREDICTED: beta-galactosidase 1-like               509   3e-156   
ref|XP_009400604.1|  PREDICTED: beta-galactosidase 1-like               508   4e-156   
gb|EPS73924.1|  hypothetical protein M569_00825                         508   1e-155   
ref|XP_008462666.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    508   1e-155   
ref|XP_009400603.1|  PREDICTED: beta-galactosidase 13-like              502   1e-153   
ref|XP_010273985.1|  PREDICTED: beta-galactosidase 15-like              502   2e-153   
emb|CDY34975.1|  BnaA01g27590D                                          500   3e-153   
ref|XP_007138632.1|  hypothetical protein PHAVU_009G2251001g            491   5e-153   
gb|KGN66624.1|  hypothetical protein Csa_1G650110                       498   3e-152   
gb|KHN04556.1|  Beta-galactosidase                                      496   5e-152   
gb|KDP29226.1|  hypothetical protein JCGZ_16615                         498   5e-152   
ref|XP_003547766.1|  PREDICTED: beta-galactosidase 7-like               496   2e-151   
emb|CDY28339.1|  BnaC01g35090D                                          494   3e-151   
emb|CDY53917.1|  BnaA07g38250D                                          501   9e-151   
ref|XP_008437707.1|  PREDICTED: beta-galactosidase 7-like               492   1e-150   
ref|XP_002324727.2|  hypothetical protein POPTR_0018s07470g             494   4e-150   Populus trichocarpa [western balsam poplar]
ref|XP_008437703.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    492   4e-150   
ref|XP_011006177.1|  PREDICTED: beta-galactosidase 7-like               493   5e-150   
gb|KDO73841.1|  hypothetical protein CISIN_1g036343mg                   491   6e-150   
gb|ABR17838.1|  unknown                                                 490   9e-150   Picea sitchensis
gb|KDP33944.1|  hypothetical protein JCGZ_07515                         490   3e-149   
gb|KDP29228.1|  hypothetical protein JCGZ_16617                         490   4e-149   
ref|XP_002528629.1|  beta-galactosidase, putative                       488   2e-148   Ricinus communis
ref|XP_008444022.1|  PREDICTED: beta-galactosidase-like                 488   2e-148   
ref|XP_010688541.1|  PREDICTED: beta-galactosidase 15-like              484   2e-147   
ref|XP_008464891.1|  PREDICTED: beta-galactosidase-like                 483   1e-146   
ref|XP_004171705.1|  PREDICTED: beta-galactosidase 7-like               481   6e-146   
ref|XP_008459141.1|  PREDICTED: beta-galactosidase 15-like              481   7e-146   
ref|XP_002314911.1|  pentatricopeptide repeat-containing family p...    477   2e-145   Populus trichocarpa [western balsam poplar]
ref|XP_007226966.1|  hypothetical protein PRUPE_ppa025241mg             474   2e-144   
ref|XP_003612351.1|  Beta-galactosidase                                 476   2e-144   
ref|XP_008452141.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    477   2e-144   
ref|XP_008451143.1|  PREDICTED: beta-galactosidase 15-like              480   3e-144   
ref|XP_011009234.1|  PREDICTED: putative pentatricopeptide repeat...    473   7e-144   
ref|XP_008358674.1|  PREDICTED: pentatricopeptide repeat-containi...    476   5e-143   
emb|CAN74095.1|  hypothetical protein VITISV_023708                     475   6e-143   Vitis vinifera
ref|XP_008243776.1|  PREDICTED: putative pentatricopeptide repeat...    470   6e-143   
ref|XP_008447673.1|  PREDICTED: beta-galactosidase 15-like              473   9e-143   
ref|XP_007214178.1|  hypothetical protein PRUPE_ppa019185mg             473   2e-142   
ref|XP_004135782.1|  PREDICTED: beta-galactosidase 7-like               472   3e-142   
ref|XP_002516236.1|  beta-galactosidase, putative                       469   5e-142   Ricinus communis
ref|XP_010272360.1|  PREDICTED: pentatricopeptide repeat-containi...    471   7e-142   
gb|KGN66613.1|  hypothetical protein Csa_1G643050                       469   8e-142   
gb|EEC66762.1|  hypothetical protein OsI_33138                          469   1e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_004154711.1|  PREDICTED: beta-galactosidase 7-like               468   2e-141   
ref|XP_010272359.1|  PREDICTED: pentatricopeptide repeat-containi...    471   6e-141   
ref|XP_007040803.1|  Beta-galactosidase 7                               478   1e-140   
ref|XP_002273710.2|  PREDICTED: pentatricopeptide repeat-containi...    469   2e-140   Vitis vinifera
gb|EEE50782.1|  hypothetical protein OsJ_31141                          466   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010250314.1|  PREDICTED: putative pentatricopeptide repeat...    463   3e-140   
ref|XP_003572734.1|  PREDICTED: beta-galactosidase 1-like               466   3e-140   
ref|XP_010518772.1|  PREDICTED: pentatricopeptide repeat-containi...    469   5e-140   
ref|XP_009352868.1|  PREDICTED: pentatricopeptide repeat-containi...    468   8e-140   
ref|XP_010261411.1|  PREDICTED: pentatricopeptide repeat-containi...    465   8e-140   
gb|AEB39774.1|  pentatricopeptide repeat protein 65                     461   3e-139   
gb|KDP33931.1|  hypothetical protein JCGZ_07502                         462   3e-139   
ref|XP_008446484.1|  PREDICTED: putative pentatricopeptide repeat...    460   4e-139   
ref|XP_004139151.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    462   4e-139   
ref|XP_008225136.1|  PREDICTED: pentatricopeptide repeat-containi...    465   1e-138   
ref|XP_007025555.1|  Tetratricopeptide repeat-like superfamily pr...    464   3e-138   
ref|XP_006654247.1|  PREDICTED: pentatricopeptide repeat-containi...    462   3e-138   
gb|KDO77668.1|  hypothetical protein CISIN_1g046775mg                   457   1e-137   
ref|NP_001052259.1|  Os04g0218100                                       460   1e-137   Oryza sativa Japonica Group [Japonica rice]
emb|CAD39781.1|  OSJNBa0060B20.9                                        461   1e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002305120.2|  hypothetical protein POPTR_0004s04740g             459   1e-137   Populus trichocarpa [western balsam poplar]
gb|KGN58141.1|  hypothetical protein Csa_3G550690                       456   4e-137   
ref|XP_002267613.1|  PREDICTED: putative pentatricopeptide repeat...    454   5e-137   Vitis vinifera
ref|XP_010091655.1|  hypothetical protein L484_026509                   454   5e-137   
gb|KDP21001.1|  hypothetical protein JCGZ_21472                         457   6e-137   
ref|XP_011027784.1|  PREDICTED: pentatricopeptide repeat-containi...    460   8e-137   
ref|XP_010647598.1|  PREDICTED: pentatricopeptide repeat-containi...    454   9e-137   
ref|XP_006449392.1|  hypothetical protein CICLE_v10018358mg             459   2e-136   
ref|XP_004135421.1|  PREDICTED: putative pentatricopeptide repeat...    452   2e-136   
ref|XP_006475096.1|  PREDICTED: beta-galactosidase 7-like               455   2e-136   
ref|XP_004498096.1|  PREDICTED: pentatricopeptide repeat-containi...    456   2e-136   
emb|CBI23556.3|  unnamed protein product                                455   3e-136   
ref|XP_006452854.1|  hypothetical protein CICLE_v10010771mg             455   3e-136   
ref|NP_001168270.1|  beta-galactosidase precursor                       454   3e-136   Zea mays [maize]
ref|XP_007045718.1|  Pentatricopeptide repeat-containing protein        453   6e-136   
ref|XP_001754449.1|  predicted protein                                  450   8e-136   
gb|AEB39781.1|  pentatricopeptide repeat protein 79                     453   8e-136   
ref|NP_001043252.1|  Os01g0533400                                       453   9e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004239007.1|  PREDICTED: putative pentatricopeptide repeat...    450   1e-135   
ref|XP_006381590.1|  hypothetical protein POPTR_0006s14130g             452   1e-135   
gb|KCW44369.1|  hypothetical protein EUGRSUZ_L02158                     451   1e-135   
gb|KDO73840.1|  hypothetical protein CISIN_1g046585mg                   451   3e-135   
ref|XP_004301089.1|  PREDICTED: pentatricopeptide repeat-containi...    456   3e-135   
ref|XP_002439335.1|  hypothetical protein SORBIDRAFT_09g004560          453   4e-135   Sorghum bicolor [broomcorn]
ref|XP_010915655.1|  PREDICTED: pentatricopeptide repeat-containi...    452   4e-135   
gb|EEE63176.1|  hypothetical protein OsJ_17985                          449   5e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006467747.1|  PREDICTED: pentatricopeptide repeat-containi...    455   6e-135   
ref|XP_011003872.1|  PREDICTED: pentatricopeptide repeat-containi...    452   7e-135   
gb|KDP23741.1|  hypothetical protein JCGZ_23574                         451   1e-134   
ref|XP_006452851.1|  hypothetical protein CICLE_v10010541mg             450   2e-134   
ref|XP_003566745.1|  PREDICTED: beta-galactosidase 13-like              449   3e-134   
ref|XP_010912774.1|  PREDICTED: pentatricopeptide repeat-containi...    451   3e-134   
ref|XP_009591690.1|  PREDICTED: pentatricopeptide repeat-containi...    449   5e-134   
ref|NP_001055148.1|  Os05g0305300                                       449   5e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007138310.1|  hypothetical protein PHAVU_009G197900g             446   6e-134   
ref|XP_010041412.1|  PREDICTED: pentatricopeptide repeat-containi...    451   7e-134   
gb|EAZ01758.1|  hypothetical protein OsI_23787                          448   9e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_003545972.2|  PREDICTED: pentatricopeptide repeat-containi...    451   1e-133   
ref|XP_010942245.1|  PREDICTED: putative pentatricopeptide repeat...    445   1e-133   
gb|KHN07701.1|  Pentatricopeptide repeat-containing protein, chlo...    451   1e-133   
ref|XP_008791801.1|  PREDICTED: pentatricopeptide repeat-containi...    449   1e-133   
ref|XP_009401142.1|  PREDICTED: pentatricopeptide repeat-containi...    448   2e-133   
gb|EMT11227.1|  hypothetical protein F775_16951                         449   3e-133   
ref|XP_008389362.1|  PREDICTED: putative pentatricopeptide repeat...    443   5e-133   
ref|XP_004157227.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    447   5e-133   
ref|XP_011039947.1|  PREDICTED: beta-galactosidase-like                 445   6e-133   
gb|KCW74539.1|  hypothetical protein EUGRSUZ_E03251                     444   7e-133   
ref|XP_007141456.1|  hypothetical protein PHAVU_008G197200g             446   7e-133   
ref|XP_002321443.2|  hypothetical protein POPTR_0015s02060g             448   8e-133   Populus trichocarpa [western balsam poplar]
ref|XP_003541343.1|  PREDICTED: putative pentatricopeptide repeat...    442   1e-132   
ref|XP_004308608.1|  PREDICTED: pentatricopeptide repeat-containi...    446   1e-132   
gb|EYU25390.1|  hypothetical protein MIMGU_mgv1a027153mg                441   2e-132   
ref|XP_008797615.1|  PREDICTED: putative pentatricopeptide repeat...    441   2e-132   
gb|KGN57354.1|  hypothetical protein Csa_3G180420                       447   3e-132   
ref|NP_001064366.1|  Os10g0330600                                       444   3e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008662262.1|  PREDICTED: uncharacterized protein LOC100384...    445   3e-132   
ref|XP_008240482.1|  PREDICTED: pentatricopeptide repeat-containi...    444   3e-132   
gb|EEC66744.1|  hypothetical protein OsI_33101                          443   4e-132   
ref|XP_009356472.1|  PREDICTED: putative pentatricopeptide repeat...    441   4e-132   
ref|XP_006437829.1|  hypothetical protein CICLE_v10033304mg             441   4e-132   
gb|AAL31090.1|AC091749_19  putative beta-galactosidase                  443   4e-132   
gb|ABU49386.1|  beta-galactosidase 15                                   443   4e-132   
ref|XP_003628710.1|  Pentatricopeptide repeat-containing protein        441   5e-132   
ref|XP_007153023.1|  hypothetical protein PHAVU_003G001300g             443   9e-132   
ref|XP_003612510.1|  Beta-galactosidase                                 442   1e-131   
gb|AES95468.2|  beta-galactosidase-like protein                         442   1e-131   
gb|AET03186.2|  PPR containing plant-like protein                       439   1e-131   
ref|XP_009796439.1|  PREDICTED: pentatricopeptide repeat-containi...    442   1e-131   
emb|CDP14825.1|  unnamed protein product                                439   1e-131   
ref|XP_010069456.1|  PREDICTED: pentatricopeptide repeat-containi...    442   2e-131   
ref|XP_011000737.1|  PREDICTED: pentatricopeptide repeat-containi...    442   2e-131   
ref|XP_010057372.1|  PREDICTED: pentatricopeptide repeat-containi...    444   3e-131   
ref|XP_008455181.1|  PREDICTED: pentatricopeptide repeat-containi...    442   3e-131   
gb|AEB39778.1|  pentatricopeptide repeat protein 77                     450   3e-131   
ref|XP_006348632.1|  PREDICTED: putative pentatricopeptide repeat...    438   3e-131   
gb|KHN44977.1|  Putative pentatricopeptide repeat-containing protein    434   5e-131   
gb|EAZ15685.1|  hypothetical protein OsJ_31098                          440   5e-131   
ref|XP_010929649.1|  PREDICTED: putative pentatricopeptide repeat...    437   5e-131   
ref|XP_010276946.1|  PREDICTED: pentatricopeptide repeat-containi...    441   6e-131   
sp|Q7XFK2.1|BGA14_ORYSJ  RecName: Full=Beta-galactosidase 14; Sho...    439   6e-131   
ref|XP_004516023.1|  PREDICTED: pentatricopeptide repeat-containi...    443   6e-131   
ref|XP_002271725.2|  PREDICTED: pentatricopeptide repeat-containi...    441   7e-131   
ref|XP_010929651.1|  PREDICTED: putative pentatricopeptide repeat...    437   7e-131   
ref|XP_004509764.1|  PREDICTED: putative pentatricopeptide repeat...    437   8e-131   
ref|XP_010657139.1|  PREDICTED: putative pentatricopeptide repeat...    439   9e-131   
ref|XP_009400315.1|  PREDICTED: pentatricopeptide repeat-containi...    440   1e-130   
gb|EYU28903.1|  hypothetical protein MIMGU_mgv1a018770mg                434   1e-130   
ref|XP_006471568.1|  PREDICTED: pentatricopeptide repeat-containi...    439   2e-130   
ref|XP_009355981.1|  PREDICTED: pentatricopeptide repeat-containi...    439   2e-130   
ref|XP_004298334.1|  PREDICTED: putative pentatricopeptide repeat...    436   2e-130   
ref|XP_008789295.1|  PREDICTED: pentatricopeptide repeat-containi...    443   3e-130   
ref|XP_004137054.1|  PREDICTED: pentatricopeptide repeat-containi...    439   4e-130   
ref|XP_011083805.1|  PREDICTED: pentatricopeptide repeat-containi...    438   5e-130   
ref|XP_010318328.1|  PREDICTED: pentatricopeptide repeat-containi...    437   6e-130   
ref|XP_009767245.1|  PREDICTED: putative pentatricopeptide repeat...    434   7e-130   
ref|XP_004969297.1|  PREDICTED: pentatricopeptide repeat-containi...    439   8e-130   
ref|XP_006422178.1|  hypothetical protein CICLE_v10006927mg             437   1e-129   
gb|KDO46745.1|  hypothetical protein CISIN_1g002975mg                   437   1e-129   
dbj|BAD67156.2|  PpPPR_77                                               444   1e-129   
ref|XP_010245939.1|  PREDICTED: pentatricopeptide repeat-containi...    441   1e-129   
ref|XP_011076005.1|  PREDICTED: pentatricopeptide repeat-containi...    437   2e-129   
emb|CDX75336.1|  BnaA01g03660D                                          441   2e-129   
ref|XP_007038997.1|  Tetratricopeptide repeat-like superfamily pr...    437   2e-129   
emb|CAN79811.1|  hypothetical protein VITISV_018821                     437   2e-129   
ref|XP_006475095.1|  PREDICTED: beta-galactosidase-like                 436   2e-129   
ref|XP_010686415.1|  PREDICTED: pentatricopeptide repeat-containi...    439   2e-129   
gb|KDP42927.1|  hypothetical protein JCGZ_23869                         436   3e-129   
gb|KEH20172.1|  PPR containing plant-like protein                       433   3e-129   
emb|CDX92439.1|  BnaA10g14780D                                          433   5e-129   
emb|CBI41122.3|  unnamed protein product                                427   8e-129   
ref|XP_003635637.1|  PREDICTED: pentatricopeptide repeat-containi...    427   8e-129   
emb|CDP05081.1|  unnamed protein product                                435   8e-129   
gb|EPS66947.1|  hypothetical protein M569_07825                         432   1e-128   
ref|XP_010492619.1|  PREDICTED: pentatricopeptide repeat-containi...    434   1e-128   
ref|XP_006363979.1|  PREDICTED: pentatricopeptide repeat-containi...    434   1e-128   
ref|XP_009409238.1|  PREDICTED: pentatricopeptide repeat-containi...    438   1e-128   
ref|XP_011077894.1|  PREDICTED: putative pentatricopeptide repeat...    431   2e-128   
ref|XP_002457961.1|  hypothetical protein SORBIDRAFT_03g023500          433   2e-128   
ref|XP_004301456.1|  PREDICTED: pentatricopeptide repeat-containi...    433   2e-128   
gb|KDP26863.1|  hypothetical protein JCGZ_18021                         431   2e-128   
ref|XP_007019744.1|  Tetratricopeptide repeat (TPR)-like superfam...    433   3e-128   
ref|XP_004975518.1|  PREDICTED: pentatricopeptide repeat-containi...    434   3e-128   
gb|KDO70236.1|  hypothetical protein CISIN_1g006388mg                   426   4e-128   
ref|XP_010096120.1|  hypothetical protein L484_012475                   432   6e-128   
ref|XP_007019743.1|  Tetratricopeptide repeat (TPR)-like superfam...    432   8e-128   
ref|XP_008783966.1|  PREDICTED: pentatricopeptide repeat-containi...    432   8e-128   
ref|XP_010549831.1|  PREDICTED: pentatricopeptide repeat-containi...    431   1e-127   
gb|EYU24289.1|  hypothetical protein MIMGU_mgv1a024266mg                431   2e-127   
ref|XP_010238621.1|  PREDICTED: pentatricopeptide repeat-containi...    432   2e-127   
gb|EYU34910.1|  hypothetical protein MIMGU_mgv1a001179mg                431   3e-127   
gb|KEH41004.1|  pentatricopeptide (PPR) repeat protein                  426   4e-127   
ref|XP_008799870.1|  PREDICTED: putative pentatricopeptide repeat...    425   4e-127   
ref|NP_195043.1|  pentatricopeptide repeat-containing protein           434   4e-127   
ref|XP_008802215.1|  PREDICTED: putative pentatricopeptide repeat...    429   6e-127   
ref|XP_009373739.1|  PREDICTED: pentatricopeptide repeat-containi...    429   6e-127   
ref|XP_010447274.1|  PREDICTED: pentatricopeptide repeat-containi...    434   6e-127   
ref|XP_009404489.1|  PREDICTED: pentatricopeptide repeat-containi...    430   6e-127   
ref|XP_008375033.1|  PREDICTED: pentatricopeptide repeat-containi...    429   7e-127   
ref|XP_004961435.1|  PREDICTED: pentatricopeptide repeat-containi...    429   8e-127   
ref|XP_008791051.1|  PREDICTED: putative pentatricopeptide repeat...    427   2e-126   
ref|XP_009627609.1|  PREDICTED: putative pentatricopeptide repeat...    425   2e-126   
gb|AEB39777.1|  pentatricopeptide repeat protein 91                     429   2e-126   
ref|XP_011020847.1|  PREDICTED: putative pentatricopeptide repeat...    427   3e-126   
ref|XP_008230331.1|  PREDICTED: pentatricopeptide repeat-containi...    427   3e-126   
ref|XP_006287060.1|  hypothetical protein CARUB_v10000209mg             427   3e-126   
ref|XP_006646769.1|  PREDICTED: putative pentatricopeptide repeat...    422   4e-126   
gb|ABK24373.1|  unknown                                                 427   5e-126   
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               427   6e-126   
ref|XP_009381889.1|  PREDICTED: pentatricopeptide repeat-containi...    424   6e-126   
ref|XP_010271776.1|  PREDICTED: pentatricopeptide repeat-containi...    430   6e-126   
ref|XP_008441615.1|  PREDICTED: pentatricopeptide repeat-containi...    426   8e-126   
gb|EYU25211.1|  hypothetical protein MIMGU_mgv1a001568mg                424   1e-125   
ref|XP_002871739.1|  pentatricopeptide repeat-containing protein        426   1e-125   
gb|KCW57817.1|  hypothetical protein EUGRSUZ_H00570                     420   2e-125   
sp|Q67VU7.1|BGA10_ORYSJ  RecName: Full=Putative beta-galactosidas...    424   3e-125   
ref|XP_008790066.1|  PREDICTED: pentatricopeptide repeat-containi...    426   3e-125   
ref|XP_002452563.1|  hypothetical protein SORBIDRAFT_04g028180          421   4e-125   
ref|XP_009105448.1|  PREDICTED: putative pentatricopeptide repeat...    421   4e-125   
ref|XP_010437793.1|  PREDICTED: pentatricopeptide repeat-containi...    429   4e-125   
ref|XP_007204618.1|  hypothetical protein PRUPE_ppa002349mg             419   5e-125   
ref|XP_010228112.1|  PREDICTED: pentatricopeptide repeat-containi...    420   6e-125   
ref|XP_007029385.1|  Tetratricopeptide-like helical, putative iso...    421   7e-125   
ref|XP_009799984.1|  PREDICTED: pentatricopeptide repeat-containi...    422   8e-125   
gb|KCW88451.1|  hypothetical protein EUGRSUZ_A00839                     423   1e-124   
ref|XP_009398434.1|  PREDICTED: beta-galactosidase 8-like               423   1e-124   
ref|XP_010044231.1|  PREDICTED: pentatricopeptide repeat-containi...    423   1e-124   
ref|XP_004306045.1|  PREDICTED: pentatricopeptide repeat-containi...    422   2e-124   
ref|NP_001183681.1|  uncharacterized protein LOC100502275               419   2e-124   
ref|XP_010255496.1|  PREDICTED: pentatricopeptide repeat-containi...    421   4e-124   
ref|XP_010646134.1|  PREDICTED: pentatricopeptide repeat-containi...    423   4e-124   
ref|XP_006645968.1|  PREDICTED: beta-galactosidase 1-like               418   5e-124   
ref|XP_002284011.2|  PREDICTED: pentatricopeptide repeat-containi...    426   5e-124   
ref|XP_010045232.1|  PREDICTED: pentatricopeptide repeat-containi...    422   5e-124   
ref|XP_002306231.2|  hypothetical protein POPTR_0004s19560g             417   8e-124   
ref|XP_007207165.1|  hypothetical protein PRUPE_ppa023637mg             417   8e-124   
ref|XP_006412384.1|  hypothetical protein EUTSA_v10027494mg             424   1e-123   
ref|XP_010694640.1|  PREDICTED: pentatricopeptide repeat-containi...    419   1e-123   
ref|XP_010458522.1|  PREDICTED: pentatricopeptide repeat-containi...    419   2e-123   
ref|XP_010458521.1|  PREDICTED: pentatricopeptide repeat-containi...    419   2e-123   
ref|XP_006450982.1|  hypothetical protein CICLE_v10010823mg             416   2e-123   
ref|XP_006475804.1|  PREDICTED: pentatricopeptide repeat-containi...    416   2e-123   
ref|XP_008445930.1|  PREDICTED: pentatricopeptide repeat-containi...    419   2e-123   
ref|NP_001045627.1|  Os02g0106300                                       416   2e-123   
ref|XP_010245960.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    424   3e-123   
gb|KFK29928.1|  hypothetical protein AALP_AA7G196500                    423   3e-123   
ref|XP_006854486.1|  hypothetical protein AMTR_s00175p00032740          420   3e-123   
ref|XP_006349730.1|  PREDICTED: pentatricopeptide repeat-containi...    422   3e-123   
ref|XP_010927665.1|  PREDICTED: pentatricopeptide repeat-containi...    417   3e-123   
ref|XP_010681168.1|  PREDICTED: putative pentatricopeptide repeat...    416   4e-123   
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     419   5e-123   
ref|XP_004160443.1|  PREDICTED: pentatricopeptide repeat-containi...    416   5e-123   
gb|AAQ21371.2|  beta-galactosidase                                      417   6e-123   
emb|CAN82070.1|  hypothetical protein VITISV_010010                     422   7e-123   
ref|XP_007012844.1|  Beta-galactosidase                                 418   8e-123   
gb|ABF95029.1|  Beta-galactosidase precursor, putative, expressed       413   8e-123   
ref|XP_004984470.1|  PREDICTED: putative pentatricopeptide repeat...    415   8e-123   
emb|CBI28351.3|  unnamed protein product                                416   8e-123   
ref|XP_010940790.1|  PREDICTED: pentatricopeptide repeat-containi...    417   9e-123   
ref|XP_004137551.1|  PREDICTED: pentatricopeptide repeat-containi...    416   9e-123   
gb|EYU46528.1|  hypothetical protein MIMGU_mgv1a023600mg                417   1e-122   
ref|XP_008794668.1|  PREDICTED: pentatricopeptide repeat-containi...    415   1e-122   
ref|XP_008465565.1|  PREDICTED: beta-galactosidase 7-like               405   1e-122   
ref|XP_010248664.1|  PREDICTED: pentatricopeptide repeat-containi...    412   1e-122   
ref|NP_197188.1|  pentatricopeptide repeat-containing protein           417   1e-122   
ref|XP_009421324.1|  PREDICTED: pentatricopeptide repeat-containi...    422   1e-122   
gb|EAY84114.1|  hypothetical protein OsI_05496                          414   2e-122   
emb|CDX98326.1|  BnaC06g16870D                                          404   2e-122   
ref|XP_009398744.1|  PREDICTED: putative pentatricopeptide repeat...    413   2e-122   
ref|XP_006644537.1|  PREDICTED: pentatricopeptide repeat-containi...    411   3e-122   
ref|XP_010492590.1|  PREDICTED: pentatricopeptide repeat-containi...    415   3e-122   
emb|CBI20738.3|  unnamed protein product                                417   3e-122   
ref|XP_010458523.1|  PREDICTED: pentatricopeptide repeat-containi...    415   3e-122   
ref|XP_010228859.1|  PREDICTED: beta-galactosidase 6                    416   3e-122   
ref|XP_003624159.1|  Pentatricopeptide repeat-containing protein        413   4e-122   
gb|AEB39775.1|  pentatricopeptide repeat protein 71                     416   4e-122   
ref|XP_009117053.1|  PREDICTED: pentatricopeptide repeat-containi...    415   5e-122   
ref|XP_008453471.1|  PREDICTED: pentatricopeptide repeat-containi...    414   5e-122   
dbj|BAK07511.1|  predicted protein                                      415   5e-122   
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          415   6e-122   
ref|XP_006285430.1|  hypothetical protein CARUB_v10006847mg             420   6e-122   
ref|XP_006371982.1|  hypothetical protein POPTR_0018s06910g             416   7e-122   
ref|XP_004492833.1|  PREDICTED: pentatricopeptide repeat-containi...    412   7e-122   
gb|KHM99215.1|  Putative beta-galactosidase 10                          409   8e-122   
gb|KDP40584.1|  hypothetical protein JCGZ_24583                         414   8e-122   
ref|XP_006340153.1|  PREDICTED: beta-galactosidase 8-like               415   8e-122   
ref|XP_006649762.1|  PREDICTED: beta-galactosidase 6-like               413   8e-122   
ref|XP_010032010.1|  PREDICTED: beta-galactosidase 8                    415   9e-122   
ref|XP_008393567.1|  PREDICTED: pentatricopeptide repeat-containi...    419   9e-122   
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    414   1e-121   
ref|XP_006391071.1|  hypothetical protein EUTSA_v10019713mg             411   1e-121   
ref|XP_006410248.1|  hypothetical protein EUTSA_v10016243mg             414   1e-121   
emb|CDX69414.1|  BnaA10g17630D                                          414   1e-121   
ref|XP_008240058.1|  PREDICTED: pentatricopeptide repeat-containi...    418   2e-121   
gb|KDO73224.1|  hypothetical protein CISIN_1g003095mg                   410   2e-121   
ref|XP_010646133.1|  PREDICTED: pentatricopeptide repeat-containi...    417   2e-121   
ref|XP_010242634.1|  PREDICTED: pentatricopeptide repeat-containi...    418   2e-121   
ref|XP_010526036.1|  PREDICTED: pentatricopeptide repeat-containi...    419   2e-121   
ref|XP_010910537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    414   3e-121   
ref|XP_004155042.1|  PREDICTED: pentatricopeptide repeat-containi...    417   3e-121   
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    413   3e-121   
dbj|BAD20774.2|  beta-galactosidase                                     414   3e-121   
ref|XP_002892635.1|  pentatricopeptide repeat-containing protein        412   3e-121   
ref|XP_007157720.1|  hypothetical protein PHAVU_002G092700g             412   4e-121   
ref|XP_010035970.1|  PREDICTED: putative pentatricopeptide repeat...    408   4e-121   
gb|ABF95028.1|  Beta-galactosidase precursor, putative, expressed       411   5e-121   
gb|EEC70819.1|  hypothetical protein OsI_02284                          412   6e-121   
ref|XP_010470830.1|  PREDICTED: putative pentatricopeptide repeat...    409   6e-121   
ref|XP_009121431.1|  PREDICTED: pentatricopeptide repeat-containi...    412   7e-121   
ref|XP_010688893.1|  PREDICTED: pentatricopeptide repeat-containi...    411   8e-121   
ref|XP_002887214.1|  pentatricopeptide repeat-containing protein        409   9e-121   
ref|XP_006301711.1|  hypothetical protein CARUB_v10022169mg             409   1e-120   
ref|XP_007148792.1|  hypothetical protein PHAVU_005G014700g             411   1e-120   
ref|XP_008808560.1|  PREDICTED: pentatricopeptide repeat-containi...    412   1e-120   
ref|XP_003570784.1|  PREDICTED: putative pentatricopeptide repeat...    409   1e-120   
gb|KHN26409.1|  Pentatricopeptide repeat-containing protein             411   1e-120   
ref|XP_010909807.1|  PREDICTED: pentatricopeptide repeat-containi...    412   1e-120   
ref|XP_003526349.1|  PREDICTED: pentatricopeptide repeat-containi...    411   1e-120   
ref|XP_008785768.1|  PREDICTED: pentatricopeptide repeat-containi...    407   1e-120   
gb|KHN29666.1|  Pentatricopeptide repeat-containing protein             411   1e-120   
gb|EAY89299.1|  hypothetical protein OsI_10800                          412   2e-120   
ref|XP_010244917.1|  PREDICTED: pentatricopeptide repeat-containi...    406   2e-120   
gb|EAZ24672.1|  hypothetical protein OsJ_08441                          412   2e-120   
ref|XP_010275265.1|  PREDICTED: pentatricopeptide repeat-containi...    409   2e-120   
ref|XP_010111070.1|  hypothetical protein L484_015125                   407   2e-120   
sp|Q10NX8.2|BGAL6_ORYSJ  RecName: Full=Beta-galactosidase 6; Shor...    411   2e-120   
emb|CDX72037.1|  BnaC08g28370D                                          412   2e-120   
ref|XP_004138328.1|  PREDICTED: pentatricopeptide repeat-containi...    415   2e-120   
ref|XP_006347856.1|  PREDICTED: pentatricopeptide repeat-containi...    411   2e-120   
ref|XP_010426426.1|  PREDICTED: pentatricopeptide repeat-containi...    411   3e-120   
ref|XP_006602844.1|  PREDICTED: putative pentatricopeptide repeat...    408   3e-120   
ref|XP_006304494.1|  hypothetical protein CARUB_v10011264mg             409   3e-120   
gb|KGN55390.1|  hypothetical protein Csa_4G649600                       415   3e-120   
gb|KFK25916.1|  hypothetical protein AALP_AA8G179700                    408   3e-120   
ref|XP_010098210.1|  Beta-galactosidase 8                               412   4e-120   
gb|EMT18371.1|  Beta-galactosidase 6                                    405   4e-120   
gb|ABE80149.1|  Tetratricopeptide-like helical                          408   4e-120   
ref|NP_001189624.1|  beta-galactosidase 8                               410   4e-120   
ref|XP_008791518.1|  PREDICTED: beta-galactosidase 6 isoform X2         409   4e-120   



>ref|XP_004231252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
isoform X1 [Solanum lycopersicum]
Length=891

 Score =  1006 bits (2600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/723 (68%), Positives = 591/723 (82%), Gaps = 1/723 (0%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +++  GIEPNE+++VA+LTACIRS NLELG QVH L+I+LGY   TYVVNALMGLYSKCG
Sbjct  168   EMKDLGIEPNEFTYVAILTACIRSLNLELGCQVHGLVIRLGYSSYTYVVNALMGLYSKCG  227

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+FV+ LF+ +P+RDI SWNT+I+ MV+ SM+ RAFE+++++ RN CL  D+ TLSTLL
Sbjct  228   LLEFVVLLFNAMPQRDIVSWNTVIACMVEHSMYDRAFEMYSELCRNKCLIADHFTLSTLL  287

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              A S C  +R GQELH HAL+ G+  NLSVNNALI FYT+CG++K+V+ +FERM V+D F
Sbjct  288   AASSRCLAVREGQELHRHALKRGFHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVF  347

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             +W EMI AYME G VDLA E+F+ +PE+N+V YNA+LAGF QN EG KA+A F RM++  
Sbjct  348   SWTEMIVAYMEFGHVDLAMEIFNSMPERNSVSYNALLAGFSQNHEGFKALALFCRMLEGG  407

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +E +DFTLTS+ NACG +MERK S+QIH FILK G + ND IE +L+DMCTRCGRM+DAE
Sbjct  408   MELTDFTLTSVVNACGSVMERKISEQIHAFILKCGLKSNDRIETSLIDMCTRCGRMDDAE  467

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             K+F  +PL H   +ALTSM+  YA+NGQPE AISLF     E  +VVDEVA AT+LGVCG
Sbjct  468   KLFDDLPLDHDNSIALTSMICAYARNGQPEEAISLFLVRHSEKSLVVDEVALATILGVCG  527

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG+LKLGE +HC A KHG +SD  VGNA+ISMY+KCGE  +AVK FE M + DL SWN 
Sbjct  528   TLGILKLGEQIHCYAWKHGLMSDAGVGNAMISMYSKCGETQSAVKTFEAMPTHDLVSWNG  587

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             LL  YVLHR+GD ALDTW++MERLG+ PDS TC+ ++SAYRHT+ N+V+ CQ FF SMQS
Sbjct  588   LLTCYVLHRQGDGALDTWAKMERLGVDPDSITCVLVISAYRHTSTNLVDCCQKFFSSMQS  647

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
             +Y V P S+HYA  V VLGYWGLLEEAE+ IN MPFEPK+SVW ALLD C +H+N+ IGK
Sbjct  648   SYNVNPTSEHYAGFVGVLGYWGLLEEAEKIINAMPFEPKASVWHALLDGCRLHVNAIIGK  707

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             R +K ILS+ PQDPSTFILKSNLYSASGRWQCSELVRAEM+EKG QKIPG+SW+I   K 
Sbjct  708   RAMKNILSIVPQDPSTFILKSNLYSASGRWQCSELVRAEMREKGIQKIPGRSWIIFGDKV  767

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSFFARD  H QSKDIYS L ILILEC+KAGYVPDTS VLHEVEE+QKKDFLF+HSAKL+
Sbjct  768   HSFFARDKLHSQSKDIYSGLQILILECLKAGYVPDTSLVLHEVEEHQKKDFLFYHSAKLS  827

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             +T+GLLMT+ GKPVRVMKN+LLCGDCHTFFK  S++TKR+IHVRD SGFH F+NGKCSC 
Sbjct  828   VTFGLLMTRPGKPVRVMKNVLLCGDCHTFFKYVSVITKRDIHVRDASGFHHFVNGKCSCG  887

Query  2279  DRW  2271
             D W
Sbjct  888   DNW  890


 Score =   145 bits (366),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 151/602 (25%), Positives = 259/602 (43%), Gaps = 91/602 (15%)
 Frame = -3

Query  4529  PCLILFPPRPSYRVLQKSTVKLKPWSSSMR*DLRGS-GIEPNEYSFVALLTACIRSQNLE  4353
             P L L  P  S+ V      K          D  GS   E N   +  LL   +R  ++E
Sbjct  46    PSLFLQNPSKSHLVQPPQQFK----------DSNGSVDSETNCIDYANLLRISVRCGDVE  95

Query  4352  LGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMV  4173
             L   +H+ ++K    D  Y+ NAL+  Y K G L+    +FD+L   D+ S+  +IS   
Sbjct  96    LTKIIHSSLVKFEEED-VYLKNALIAAYIKLGCLNLAERVFDSLRSPDVVSYTAIISAFA  154

Query  4172  KESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNL  3996
             K +    AFELF +M ++  +  +  T   +L AC     +  G ++H   +R+GY S  
Sbjct  155   KSNREREAFELFLEM-KDLGIEPNEFTYVAILTACIRSLNLELGCQVHGLVIRLGYSSYT  213

Query  3995  SVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEK  3816
              V NAL+  Y++CG ++ V+ LF  M  RD  +WN +I   +E  + D A E++  L   
Sbjct  214   YVVNALMGLYSKCGLLEFVVLLFNAMPQRDIVSWNTVIACMVEHSMYDRAFEMYSEL---  270

Query  3815  NAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIH  3636
                         C+N               + +    FTL+++  A    +  +  +++H
Sbjct  271   ------------CRN---------------KCLIADHFTLSTLLAASSRCLAVREGQELH  303

Query  3635  GFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPL----------------GHGR  3504
                LK G   N  +  AL+   T+CG +++   +F RMP+                GH  
Sbjct  304   RHALKRGFHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVFSWTEMIVAYMEFGHVD  363

Query  3503  L-------------VALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvc  3363
             L             V+  ++L G++QN +   A++LF    LEG + + +    +V+  C
Sbjct  364   LAMEIFNSMPERNSVSYNALLAGFSQNHEGFKALALFCR-MLEGGMELTDFTLTSVVNAC  422

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFE--LMSSRDLCS  3189
             G++   K+ E +H   LK G  S+  +  ++I M  +CG +D+A K F+   +   +  +
Sbjct  423   GSVMERKISEQIHAFILKCGLKSNDRIETSLIDMCTRCGRMDDAEKLFDDLPLDHDNSIA  482

Query  3188  WNSLLAGYVLHRRGDEALDTW-SRMERLGIVPDSFTCLHILSAYRHTTKNVVN-----RC  3027
               S++  Y  + + +EA+  +  R     +V D      IL      T  ++       C
Sbjct  483   LTSMICAYARNGQPEEAISLFLVRHSEKSLVVDEVALATILGVC--GTLGILKLGEQIHC  540

Query  3026  QSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCI  2847
              ++   + S  GV  A      ++S+    G  + A +T   MP     S W  LL   +
Sbjct  541   YAWKHGLMSDAGVGNA------MISMYSKCGETQSAVKTFEAMPTHDLVS-WNGLLTCYV  593

Query  2846  MH  2841
             +H
Sbjct  594   LH  595


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 67/129 (52%), Gaps = 33/129 (26%)
 Frame = -2

Query  4734  PAFLLSNASLS--IQEPLLSSDPLINSSISTYPEQHAVDYADFLKL--------------  4603
             P+  L N S S  +Q P    D   N S+ +  E + +DYA+ L++              
Sbjct  46    PSLFLQNPSKSHLVQPPQQFKDS--NGSVDS--ETNCIDYANLLRISVRCGDVELTKIIH  101

Query  4602  -------EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
                    EED  L NALI+AY+KLG ++ A  VFDSL SP      AIIS FAK NRE E
Sbjct  102   SSLVKFEEEDVYLKNALIAAYIKLGCLNLAERVFDSLRSPDVVSYTAIISAFAKSNRERE  161

Query  4461  AVELFYEMR  4435
             A ELF EM+
Sbjct  162   AFELFLEMK  170



>ref|XP_010312265.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
isoform X3 [Solanum lycopersicum]
Length=723

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/722 (68%), Positives = 590/722 (82%), Gaps = 1/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             ++  GIEPNE+++VA+LTACIRS NLELG QVH L+I+LGY   TYVVNALMGLYSKCG 
Sbjct  1     MKDLGIEPNEFTYVAILTACIRSLNLELGCQVHGLVIRLGYSSYTYVVNALMGLYSKCGL  60

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             L+FV+ LF+ +P+RDI SWNT+I+ MV+ SM+ RAFE+++++ RN CL  D+ TLSTLL 
Sbjct  61    LEFVVLLFNAMPQRDIVSWNTVIACMVEHSMYDRAFEMYSELCRNKCLIADHFTLSTLLA  120

Query  4073  ACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             A S C  +R GQELH HAL+ G+  NLSVNNALI FYT+CG++K+V+ +FERM V+D F+
Sbjct  121   ASSRCLAVREGQELHRHALKRGFHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVFS  180

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EMI AYME G VDLA E+F+ +PE+N+V YNA+LAGF QN EG KA+A F RM++  +
Sbjct  181   WTEMIVAYMEFGHVDLAMEIFNSMPERNSVSYNALLAGFSQNHEGFKALALFCRMLEGGM  240

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +DFTLTS+ NACG +MERK S+QIH FILK G + ND IE +L+DMCTRCGRM+DAEK
Sbjct  241   ELTDFTLTSVVNACGSVMERKISEQIHAFILKCGLKSNDRIETSLIDMCTRCGRMDDAEK  300

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F  +PL H   +ALTSM+  YA+NGQPE AISLF     E  +VVDEVA AT+LGVCGT
Sbjct  301   LFDDLPLDHDNSIALTSMICAYARNGQPEEAISLFLVRHSEKSLVVDEVALATILGVCGT  360

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG+LKLGE +HC A KHG +SD  VGNA+ISMY+KCGE  +AVK FE M + DL SWN L
Sbjct  361   LGILKLGEQIHCYAWKHGLMSDAGVGNAMISMYSKCGETQSAVKTFEAMPTHDLVSWNGL  420

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             L  YVLHR+GD ALDTW++MERLG+ PDS TC+ ++SAYRHT+ N+V+ CQ FF SMQS+
Sbjct  421   LTCYVLHRQGDGALDTWAKMERLGVDPDSITCVLVISAYRHTSTNLVDCCQKFFSSMQSS  480

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             Y V P S+HYA  V VLGYWGLLEEAE+ IN MPFEPK+SVW ALLD C +H+N+ IGKR
Sbjct  481   YNVNPTSEHYAGFVGVLGYWGLLEEAEKIINAMPFEPKASVWHALLDGCRLHVNAIIGKR  540

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
              +K ILS+ PQDPSTFILKSNLYSASGRWQCSELVRAEM+EKG QKIPG+SW+I   K H
Sbjct  541   AMKNILSIVPQDPSTFILKSNLYSASGRWQCSELVRAEMREKGIQKIPGRSWIIFGDKVH  600

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
             SFFARD  H QSKDIYS L ILILEC+KAGYVPDTS VLHEVEE+QKKDFLF+HSAKL++
Sbjct  601   SFFARDKLHSQSKDIYSGLQILILECLKAGYVPDTSLVLHEVEEHQKKDFLFYHSAKLSV  660

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
             T+GLLMT+ GKPVRVMKN+LLCGDCHTFFK  S++TKR+IHVRD SGFH F+NGKCSC D
Sbjct  661   TFGLLMTRPGKPVRVMKNVLLCGDCHTFFKYVSVITKRDIHVRDASGFHHFVNGKCSCGD  720

Query  2276  RW  2271
              W
Sbjct  721   NW  722



>ref|XP_010312264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
isoform X2 [Solanum lycopersicum]
Length=780

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/723 (68%), Positives = 591/723 (82%), Gaps = 1/723 (0%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +++  GIEPNE+++VA+LTACIRS NLELG QVH L+I+LGY   TYVVNALMGLYSKCG
Sbjct  57    EMKDLGIEPNEFTYVAILTACIRSLNLELGCQVHGLVIRLGYSSYTYVVNALMGLYSKCG  116

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+FV+ LF+ +P+RDI SWNT+I+ MV+ SM+ RAFE+++++ RN CL  D+ TLSTLL
Sbjct  117   LLEFVVLLFNAMPQRDIVSWNTVIACMVEHSMYDRAFEMYSELCRNKCLIADHFTLSTLL  176

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              A S C  +R GQELH HAL+ G+  NLSVNNALI FYT+CG++K+V+ +FERM V+D F
Sbjct  177   AASSRCLAVREGQELHRHALKRGFHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVF  236

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             +W EMI AYME G VDLA E+F+ +PE+N+V YNA+LAGF QN EG KA+A F RM++  
Sbjct  237   SWTEMIVAYMEFGHVDLAMEIFNSMPERNSVSYNALLAGFSQNHEGFKALALFCRMLEGG  296

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +E +DFTLTS+ NACG +MERK S+QIH FILK G + ND IE +L+DMCTRCGRM+DAE
Sbjct  297   MELTDFTLTSVVNACGSVMERKISEQIHAFILKCGLKSNDRIETSLIDMCTRCGRMDDAE  356

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             K+F  +PL H   +ALTSM+  YA+NGQPE AISLF     E  +VVDEVA AT+LGVCG
Sbjct  357   KLFDDLPLDHDNSIALTSMICAYARNGQPEEAISLFLVRHSEKSLVVDEVALATILGVCG  416

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG+LKLGE +HC A KHG +SD  VGNA+ISMY+KCGE  +AVK FE M + DL SWN 
Sbjct  417   TLGILKLGEQIHCYAWKHGLMSDAGVGNAMISMYSKCGETQSAVKTFEAMPTHDLVSWNG  476

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             LL  YVLHR+GD ALDTW++MERLG+ PDS TC+ ++SAYRHT+ N+V+ CQ FF SMQS
Sbjct  477   LLTCYVLHRQGDGALDTWAKMERLGVDPDSITCVLVISAYRHTSTNLVDCCQKFFSSMQS  536

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
             +Y V P S+HYA  V VLGYWGLLEEAE+ IN MPFEPK+SVW ALLD C +H+N+ IGK
Sbjct  537   SYNVNPTSEHYAGFVGVLGYWGLLEEAEKIINAMPFEPKASVWHALLDGCRLHVNAIIGK  596

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             R +K ILS+ PQDPSTFILKSNLYSASGRWQCSELVRAEM+EKG QKIPG+SW+I   K 
Sbjct  597   RAMKNILSIVPQDPSTFILKSNLYSASGRWQCSELVRAEMREKGIQKIPGRSWIIFGDKV  656

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSFFARD  H QSKDIYS L ILILEC+KAGYVPDTS VLHEVEE+QKKDFLF+HSAKL+
Sbjct  657   HSFFARDKLHSQSKDIYSGLQILILECLKAGYVPDTSLVLHEVEEHQKKDFLFYHSAKLS  716

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             +T+GLLMT+ GKPVRVMKN+LLCGDCHTFFK  S++TKR+IHVRD SGFH F+NGKCSC 
Sbjct  717   VTFGLLMTRPGKPVRVMKNVLLCGDCHTFFKYVSVITKRDIHVRDASGFHHFVNGKCSCG  776

Query  2279  DRW  2271
             D W
Sbjct  777   DNW  779


 Score =   128 bits (321),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 127/515 (25%), Positives = 224/515 (43%), Gaps = 79/515 (15%)
 Frame = -3

Query  4271  YSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYIT  4092
             Y K G L+    +FD+L   D+ S+  +IS   K +    AFELF +M ++  +  +  T
Sbjct  11    YIKLGCLNLAERVFDSLRSPDVVSYTAIISAFAKSNREREAFELFLEM-KDLGIEPNEFT  69

Query  4091  LSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERML  3915
                +L AC     +  G ++H   +R+GY S   V NAL+  Y++CG ++ V+ LF  M 
Sbjct  70    YVAILTACIRSLNLELGCQVHGLVIRLGYSSYTYVVNALMGLYSKCGLLEFVVLLFNAMP  129

Query  3914  VRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYR  3735
              RD  +WN +I   +E  + D A E++  L               C+N            
Sbjct  130   QRDIVSWNTVIACMVEHSMYDRAFEMYSEL---------------CRN------------  162

Query  3734  MIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGR  3555
                + +    FTL+++  A    +  +  +++H   LK G   N  +  AL+   T+CG 
Sbjct  163   ---KCLIADHFTLSTLLAASSRCLAVREGQELHRHALKRGFHGNLSVNNALIGFYTKCGT  219

Query  3554  MEDAEKIFHRMPL----------------GHGRL-------------VALTSMLRGYAQN  3462
             +++   +F RMP+                GH  L             V+  ++L G++QN
Sbjct  220   LKNVVDVFERMPVKDVFSWTEMIVAYMEFGHVDLAMEIFNSMPERNSVSYNALLAGFSQN  279

Query  3461  GQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVV  3282
              +   A++LF    LEG + + +    +V+  CG++   K+ E +H   LK G  S+  +
Sbjct  280   HEGFKALALFCR-MLEGGMELTDFTLTSVVNACGSVMERKISEQIHAFILKCGLKSNDRI  338

Query  3281  GNAVISMYAKCGELDNAVKAFE--LMSSRDLCSWNSLLAGYVLHRRGDEALDTW-SRMER  3111
               ++I M  +CG +D+A K F+   +   +  +  S++  Y  + + +EA+  +  R   
Sbjct  339   ETSLIDMCTRCGRMDDAEKLFDDLPLDHDNSIALTSMICAYARNGQPEEAISLFLVRHSE  398

Query  3110  LGIVPDSFTCLHILSAYRHTTKNVVN-----RCQSFFFSMQSAYGVLPASDHYACLVSVL  2946
               +V D      IL      T  ++       C ++   + S  GV  A      ++S+ 
Sbjct  399   KSLVVDEVALATILGVC--GTLGILKLGEQIHCYAWKHGLMSDAGVGNA------MISMY  450

Query  2945  GYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMH  2841
                G  + A +T   MP     S W  LL   ++H
Sbjct  451   SKCGETQSAVKTFEAMPTHDLVS-WNGLLTCYVLH  484


 Score =   111 bits (277),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/256 (27%), Positives = 129/256 (50%), Gaps = 2/256 (1%)
 Frame = -3

Query  3884  ITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSD  3705
             + AY++ G ++LA+ +FD L   + V Y A+++ F ++    +A   F  M    IE ++
Sbjct  8     LLAYIKLGCLNLAERVFDSLRSPDVVSYTAIISAFAKSNREREAFELFLEMKDLGIEPNE  67

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHR  3525
             FT  +I  AC   +  +   Q+HG +++ G      +  AL+ + ++CG +E    +F+ 
Sbjct  68    FTYVAILTACIRSLNLELGCQVHGLVIRLGYSSYTYVVNALMGLYSKCGLLEFVVLLFNA  127

Query  3524  MPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgll  3345
             MP     +V+  +++    ++   + A  ++ E      ++ D    +T+L        +
Sbjct  128   MP--QRDIVSWNTVIACMVEHSMYDRAFEMYSELCRNKCLIADHFTLSTLLAASSRCLAV  185

Query  3344  klGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGY  3165
             + G+ LH  ALK GF  ++ V NA+I  Y KCG L N V  FE M  +D+ SW  ++  Y
Sbjct  186   REGQELHRHALKRGFHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVFSWTEMIVAY  245

Query  3164  VLHRRGDEALDTWSRM  3117
             +     D A++ ++ M
Sbjct  246   MEFGHVDLAMEIFNSM  261



>ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Solanum tuberosum]
Length=894

 Score =   999 bits (2584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/723 (67%), Positives = 590/723 (82%), Gaps = 1/723 (0%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++R  GIEPNE+++VA+LTACIRS NLELG QVH L+I+LGY    YVVNALMGLYSKCG
Sbjct  171   EMRDLGIEPNEFTYVAILTACIRSLNLELGCQVHGLVIRLGYSSYIYVVNALMGLYSKCG  230

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+FV+ LF+ +P+RDI SWNT+I+  V++SM+ RAFE++ +++RN+CL+ D+ TLSTLL
Sbjct  231   LLEFVVLLFNAMPQRDIVSWNTVIACKVEQSMYDRAFEMYRELRRNECLKADHFTLSTLL  290

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              A S C  +R GQELH +AL+ G   NLSVNNALI FYT+CG++K+V+ +FERM V+D F
Sbjct  291   AASSRCLAVREGQELHRYALKNGLHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVF  350

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             +W EMI AYME G VDLA E+F+ +PE+N+V YNA+LAGF QN EG KA+A F RM++  
Sbjct  351   SWTEMIVAYMEFGHVDLAMEIFNSMPERNSVSYNALLAGFSQNHEGFKALALFCRMLEGG  410

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +E +DF LTS+ NACG +MERK S+QIH FILK G + ND IE +L+DMCTRCGRM+DAE
Sbjct  411   MELTDFALTSVLNACGSMMERKISEQIHAFILKCGLKLNDHIETSLVDMCTRCGRMDDAE  470

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             KIFH +PL H   +ALTSM+  YA+NGQPE AISLF     E  +VVDEV  AT+LGVCG
Sbjct  471   KIFHDLPLDHDNSIALTSMICAYARNGQPEEAISLFLVRHSEKSLVVDEVGLATILGVCG  530

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG+LKLGE +HC A KHG +SD  VGNA+ISMY+KCGE+ +AVK FE M + DL SWN 
Sbjct  531   TLGILKLGEQIHCYAWKHGLMSDTGVGNAMISMYSKCGEMQSAVKTFEAMPTHDLVSWNG  590

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             LL  YVLHR+GD ALDTW++MERLG+ PDS TC+ ++SAYRHT+ N+V+ CQ FF SMQS
Sbjct  591   LLTCYVLHRQGDGALDTWAKMERLGVDPDSITCVLVISAYRHTSTNLVDCCQKFFSSMQS  650

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
             +Y V P S+HYA  V VLGYWGLLEEAE+ I+ MPFEPK+SVW ALLD C +H+N+ IGK
Sbjct  651   SYNVNPTSEHYAGFVGVLGYWGLLEEAEKIISAMPFEPKASVWHALLDGCRLHVNAIIGK  710

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             R +K ILS+ PQDPSTFILKSNLYSASGRWQCSELVRAEM+EKG +KIPG+SW+I   K 
Sbjct  711   RAMKNILSIVPQDPSTFILKSNLYSASGRWQCSELVRAEMREKGIRKIPGRSWIIFGDKV  770

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSFFARD  H QSKDIYS L ILILEC+KAGYVPDTS VLHEVEE+QKKDFLF+HSAKL+
Sbjct  771   HSFFARDKLHSQSKDIYSGLQILILECLKAGYVPDTSLVLHEVEEHQKKDFLFYHSAKLS  830

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             +T+GLLMT+ GKPVRVMKN+LLCGDCHTFFK  S+VTKR+IHVRD SGFH F+NGKC C 
Sbjct  831   VTFGLLMTRPGKPVRVMKNVLLCGDCHTFFKYVSVVTKRDIHVRDASGFHHFVNGKCLCG  890

Query  2279  DRW  2271
             D W
Sbjct  891   DNW  893


 Score =   145 bits (367),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 142/563 (25%), Positives = 250/563 (44%), Gaps = 80/563 (14%)
 Frame = -3

Query  4415  EPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIE  4236
             + N   +  LL   +R  ++ L   +H+ ++K    D  Y+ NAL+  Y K G L+    
Sbjct  78    DTNCIDYANLLRISVRCGDVVLTKIIHSSLVKFEEED-VYLKNALIAAYIKLGCLNLAER  136

Query  4235  LFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF  4056
             +FD+L   D+ S+  +IS   K +    AFELF +M R+  +  +  T   +L AC    
Sbjct  137   VFDSLMSPDVVSYTAIISAFAKSNREREAFELFLEM-RDLGIEPNEFTYVAILTACIRSL  195

Query  4055  -MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMIT  3879
              +  G ++H   +R+GY S + V NAL+  Y++CG ++ V+ LF  M  RD  +WN +I 
Sbjct  196   NLELGCQVHGLVIRLGYSSYIYVVNALMGLYSKCGLLEFVVLLFNAMPQRDIVSWNTVIA  255

Query  3878  AYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFT  3699
               +E  + D A E++  L                +  E LKA                FT
Sbjct  256   CKVEQSMYDRAFEMYREL----------------RRNECLKA--------------DHFT  285

Query  3698  LTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP  3519
             L+++  A    +  +  +++H + LK+G   N  +  AL+   T+CG +++   +F RMP
Sbjct  286   LSTLLAASSRCLAVREGQELHRYALKNGLHGNLSVNNALIGFYTKCGTLKNVVDVFERMP  345

Query  3518  L----------------GHGRL-------------VALTSMLRGYAQNGQPENAISLFFE  3426
             +                GH  L             V+  ++L G++QN +   A++LF  
Sbjct  346   VKDVFSWTEMIVAYMEFGHVDLAMEIFNSMPERNSVSYNALLAGFSQNHEGFKALALFCR  405

Query  3425  TQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG  3246
               LEG + + + A  +VL  CG++   K+ E +H   LK G   +  +  +++ M  +CG
Sbjct  406   -MLEGGMELTDFALTSVLNACGSMMERKISEQIHAFILKCGLKLNDHIETSLVDMCTRCG  464

Query  3245  ELDNAVKAFE--LMSSRDLCSWNSLLAGYVLHRRGDEALDTW-SRMERLGIVPDSFTCLH  3075
              +D+A K F    +   +  +  S++  Y  + + +EA+  +  R     +V D      
Sbjct  465   RMDDAEKIFHDLPLDHDNSIALTSMICAYARNGQPEEAISLFLVRHSEKSLVVDEVGLAT  524

Query  3074  ILSAYRHTTKNVVN-----RCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEET  2910
             IL      T  ++       C ++   + S  GV  A      ++S+    G ++ A +T
Sbjct  525   ILGVC--GTLGILKLGEQIHCYAWKHGLMSDTGVGNA------MISMYSKCGEMQSAVKT  576

Query  2909  INTMPFEPKSSVWRALLDSCIMH  2841
                MP     S W  LL   ++H
Sbjct  577   FEAMPTHDLVS-WNGLLTCYVLH  598


 Score =   120 bits (301),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 105/424 (25%), Positives = 190/424 (45%), Gaps = 55/424 (13%)
 Frame = -3

Query  4007  ESNLSVNN--------ALIKFYTRCGS------IKSVMALFERMLVRDAFTWNEMITAYM  3870
             +SN+SV++         L++   RCG       I S +  FE     D +  N +I AY+
Sbjct  70    DSNVSVDSDTNCIDYANLLRISVRCGDVVLTKIIHSSLVKFEE---EDVYLKNALIAAYI  126

Query  3869  ESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTS  3690
             + G ++LA+ +FD L   + V Y A+++ F ++    +A   F  M    IE ++FT  +
Sbjct  127   KLGCLNLAERVFDSLMSPDVVSYTAIISAFAKSNREREAFELFLEMRDLGIEPNEFTYVA  186

Query  3689  IANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGH  3510
             I  AC   +  +   Q+HG +++ G      +  AL+ + ++CG +E    +F+ MP   
Sbjct  187   ILTACIRSLNLELGCQVHGLVIRLGYSSYIYVVNALMGLYSKCGLLEFVVLLFNAMP--Q  244

Query  3509  GRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGEN  3330
               +V+  +++    +    + A  ++ E +    +  D    +T+L        ++ G+ 
Sbjct  245   RDIVSWNTVIACKVEQSMYDRAFEMYRELRRNECLKADHFTLSTLLAASSRCLAVREGQE  304

Query  3329  LHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW------------  3186
             LH  ALK+G   ++ V NA+I  Y KCG L N V  FE M  +D+ SW            
Sbjct  305   LHRYALKNGLHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVFSWTEMIVAYMEFGH  364

Query  3185  -------------------NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
                                N+LLAG+  +  G +AL  + RM   G+    F    +L+A
Sbjct  365   VDLAMEIFNSMPERNSVSYNALLAGFSQNHEGFKALALFCRMLEGGMELTDFALTSVLNA  424

Query  3062  YRHTTKNVVNRCQSFFFSMQSAYGVLPASDHY-ACLVSVLGYWGLLEEAEETINTMPFEP  2886
                  +  ++  Q   F ++     L  +DH    LV +    G +++AE+  + +P + 
Sbjct  425   CGSMMERKISE-QIHAFILKCG---LKLNDHIETSLVDMCTRCGRMDDAEKIFHDLPLDH  480

Query  2885  KSSV  2874
              +S+
Sbjct  481   DNSI  484


 Score = 79.7 bits (195),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 69/128 (54%), Gaps = 28/128 (22%)
 Frame = -2

Query  4734  PAFLLSNAS-LSIQEPLLSSDPLINSSISTYPEQHAVDYADFLKL---------------  4603
             P+  L N S   + +PLL+     +S++S   + + +DYA+ L++               
Sbjct  46    PSLFLQNPSKYHLVQPLLTPQQFKDSNVSVDSDTNCIDYANLLRISVRCGDVVLTKIIHS  105

Query  4602  ------EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEA  4459
                   EED  L NALI+AY+KLG ++ A  VFDSL SP      AIIS FAK NRE EA
Sbjct  106   SLVKFEEEDVYLKNALIAAYIKLGCLNLAERVFDSLMSPDVVSYTAIISAFAKSNREREA  165

Query  4458  VELFYEMR  4435
              ELF EMR
Sbjct  166   FELFLEMR  173



>ref|XP_009602768.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Nicotiana tomentosiformis]
Length=890

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/723 (67%), Positives = 587/723 (81%), Gaps = 1/723 (0%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++R  GIEPNEY+FVA+LTACIRS NLELG QVH L++KLGYL  TYVVNALMGLYSKCG
Sbjct  168   EMRDLGIEPNEYTFVAILTACIRSLNLELGCQVHGLVVKLGYLSYTYVVNALMGLYSKCG  227

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+ VI LF+++P+RDI SWNTMIS MV+E M+ R FEL+ +++RNDCL +D+ TLSTLL
Sbjct  228   LLESVILLFNDMPQRDIVSWNTMISCMVEECMYERVFELYRELRRNDCLIVDHFTLSTLL  287

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              A S C  +R GQELH HAL+ G   NLSVNNALI FYT+CG++K+V+ +FERM V+D F
Sbjct  288   AASSRCLAVREGQELHMHALKSGLHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVF  347

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             +W EMI AYME G VD A E+F+ +PE+N V YNA+LAGF QN EG KA+  F RM++  
Sbjct  348   SWTEMIVAYMEFGYVDFAMEIFNSMPERNCVSYNALLAGFIQNHEGFKALGLFCRMLEGG  407

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +E +DFTLTS+ NACG +MERK S+QIH FILK G E ND IE ALLDMCTRCGRM+DA+
Sbjct  408   LELTDFTLTSVLNACGSVMERKISEQIHAFILKLGLESNDRIETALLDMCTRCGRMDDAK  467

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             K+FH+ PL H   +ALTSM+  YA+NG PE AISLF     E  +VVDEVA AT+LGVCG
Sbjct  468   KLFHQPPLDHDNSIALTSMMCAYARNGHPEEAISLFLVRHSEESLVVDEVALATILGVCG  527

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG+LKLGE +H  A+KHG +SD  VGNA+ISMY+KC E+ +A+KAFE M + DL SWN 
Sbjct  528   TLGILKLGEQIHSYAVKHGIISDTGVGNAMISMYSKCDEMQSAIKAFEAMPTHDLVSWNG  587

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             LL  YVLHR+GD ALD W++ME+LG+ PDS TC+ ++SAYRHT++N+V+ CQ FF SMQ+
Sbjct  588   LLTCYVLHRQGDAALDMWAKMEKLGVNPDSITCVLVISAYRHTSRNLVDCCQKFFSSMQT  647

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y + P S+HYA  V+VL YWGLLEEAE+ I+ M FEPK+SVW ALLD C +H N+ IGK
Sbjct  648   LYNIEPTSEHYAGFVAVLSYWGLLEEAEQIISAMRFEPKASVWHALLDGCRIHANAIIGK  707

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             R +K+ILS+ P+DPSTFILKSNLYSASGRWQCSELVRAEM+EKGF+KIPG+SW+I   K 
Sbjct  708   RAMKEILSIVPRDPSTFILKSNLYSASGRWQCSELVRAEMREKGFRKIPGRSWIILGDKV  767

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSFF RD  H QSKDIYS L ILI EC+KAGYVPDTS+VLHEVEE+QKKDFLF+HS+KLA
Sbjct  768   HSFFGRDKLHSQSKDIYSGLQILIPECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSSKLA  827

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             +T+GLLMT+ GKPVRVMKN+ LCGDCHTFFK  S+VTKR+IHVRD SGFH F+NGKCSC 
Sbjct  828   VTFGLLMTRPGKPVRVMKNVHLCGDCHTFFKYVSVVTKRDIHVRDASGFHHFVNGKCSCR  887

Query  2279  DRW  2271
             D W
Sbjct  888   DNW  890


 Score =   140 bits (354),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 117/459 (25%), Positives = 208/459 (45%), Gaps = 65/459 (14%)
 Frame = -3

Query  4415  EPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIE  4236
             + N   +  LL   +R  ++EL   +H+ ++KL   D  Y+ NAL+  Y K G L+   +
Sbjct  75    DTNRIDYANLLRISVRCGDVELAKIIHSSILKLEEED-VYLKNALIAAYLKLGHLNLAEK  133

Query  4235  LFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF  4056
             +FD+L   D+ S+  +IS   K +    AFELF +M R+  +  +  T   +L AC    
Sbjct  134   VFDSLLSPDVVSFTAIISAFAKSNRQREAFELFLEM-RDLGIEPNEYTFVAILTACIRSL  192

Query  4055  -MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMIT  3879
              +  G ++H   +++GY S   V NAL+  Y++CG ++SV+ LF  M  RD  +WN MI+
Sbjct  193   NLELGCQVHGLVVKLGYLSYTYVVNALMGLYSKCGLLESVILLFNDMPQRDIVSWNTMIS  252

Query  3878  AYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFT  3699
               +E  + +   EL+  L   + ++ +                               FT
Sbjct  253   CMVEECMYERVFELYRELRRNDCLIVD------------------------------HFT  282

Query  3698  LTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP  3519
             L+++  A    +  +  +++H   LKSG   N  +  AL+   T+CG +++   +F RMP
Sbjct  283   LSTLLAASSRCLAVREGQELHMHALKSGLHGNLSVNNALIGFYTKCGTLKNVVDVFERMP  342

Query  3518  -----------------------------LGHGRLVALTSMLRGYAQNGQPENAISLFFE  3426
                                          +     V+  ++L G+ QN +   A+ LF  
Sbjct  343   VKDVFSWTEMIVAYMEFGYVDFAMEIFNSMPERNCVSYNALLAGFIQNHEGFKALGLFCR  402

Query  3425  TQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG  3246
               LEG + + +    +VL  CG++   K+ E +H   LK G  S+  +  A++ M  +CG
Sbjct  403   -MLEGGLELTDFTLTSVLNACGSVMERKISEQIHAFILKLGLESNDRIETALLDMCTRCG  461

Query  3245  ELDNAVKAFEL--MSSRDLCSWNSLLAGYVLHRRGDEAL  3135
              +D+A K F    +   +  +  S++  Y  +   +EA+
Sbjct  462   RMDDAKKLFHQPPLDHDNSIALTSMMCAYARNGHPEEAI  500


 Score = 73.2 bits (178),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 68/128 (53%), Gaps = 28/128 (22%)
 Frame = -2

Query  4734  PAFLLSNASLSIQ-EPLLSSDPLINSSISTYPEQHAVDYADFLKL---------------  4603
             P+F L   S S   +PLL      +S+++   + + +DYA+ L++               
Sbjct  43    PSFFLQYPSKSRPFQPLLIPQHFKDSNVTVAADTNRIDYANLLRISVRCGDVELAKIIHS  102

Query  4602  ------EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEA  4459
                   EED  L NALI+AYLKLG ++ A  VFDSL SP      AIIS FAK NR+ EA
Sbjct  103   SILKLEEEDVYLKNALIAAYLKLGHLNLAEKVFDSLLSPDVVSFTAIISAFAKSNRQREA  162

Query  4458  VELFYEMR  4435
              ELF EMR
Sbjct  163   FELFLEMR  170



>ref|XP_009798335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Nicotiana sylvestris]
Length=890

 Score =   992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/723 (67%), Positives = 586/723 (81%), Gaps = 1/723 (0%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++R  GIEPNEY+FVA+LTACIRS NLELG QVH L++KLGYL  TYVVNALMGLYSKCG
Sbjct  168   EMRDLGIEPNEYTFVAILTACIRSLNLELGRQVHGLVVKLGYLSYTYVVNALMGLYSKCG  227

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+ VI LF+++P++DI SWNT IS MV+E M+ RAFE++ +++RNDCL +D+ TLSTLL
Sbjct  228   LLESVILLFNDMPQKDIVSWNTTISCMVEECMYERAFEMYRELRRNDCLIVDHFTLSTLL  287

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              A S C  +R GQELHAHAL+ G   NLSVNNALI FYT+CG++K+V+ +FERM V+D F
Sbjct  288   AASSRCLAVREGQELHAHALKSGLHGNLSVNNALIGFYTKCGTLKNVVDVFERMPVKDVF  347

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             +W EMI AYME G VD A E+F+ +PE+N V YNA+LAGF QN EG KA+  F +M++  
Sbjct  348   SWTEMIVAYMEFGYVDFAMEIFNSMPERNCVSYNALLAGFTQNHEGFKALGLFCQMLEGG  407

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +E +DFTLTS+ NA G + ERK S+QIH FILK G E ND IE ALLDMCTRC RM+DA+
Sbjct  408   MELTDFTLTSVLNASGSMTERKISEQIHAFILKLGLESNDRIETALLDMCTRCERMDDAK  467

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             KIFH++PL H   VALTSM+  YA++G PE AISLF     E  +VVDEVA AT+LGVCG
Sbjct  468   KIFHQLPLDHDNSVALTSMMCAYARDGHPEEAISLFLVRHSEESLVVDEVALATILGVCG  527

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG+LKLGE +HC ALKHG +SD  VGNA+ISMY+KC E+ +A+KAFE M + DL SWN 
Sbjct  528   TLGILKLGEQIHCYALKHGLMSDTGVGNAMISMYSKCDEMQSAIKAFEAMPTHDLVSWNG  587

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             LL  YVLHR+GD AL+ W++ME LG+ PDS TC+ ++SAYRHT+ N+V+ CQ FF SMQS
Sbjct  588   LLTCYVLHRQGDAALNMWAKMENLGVKPDSITCVLVISAYRHTSSNLVDCCQKFFSSMQS  647

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
             +Y V P S+HYA  V VLG WGLLEEAE+ I+ MPFEP +SVW ALL+ C + +N+ IGK
Sbjct  648   SYNVKPTSEHYAGFVGVLGNWGLLEEAEQIISAMPFEPTASVWHALLEGCRISVNAIIGK  707

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             R +K+ILS+ PQDPSTFILKSNLYSASGRWQCSELVRAEM+EKGF+KIPG+SW++   K 
Sbjct  708   RAMKEILSIAPQDPSTFILKSNLYSASGRWQCSELVRAEMREKGFRKIPGRSWIVLGDKV  767

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSFFARD  H QSKDIYS L ILI EC+KAGYVPDTS+VLHEVEE+QKKDFLF+HS+KLA
Sbjct  768   HSFFARDKLHSQSKDIYSGLQILIPECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSSKLA  827

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             +T+GLLMT+ GKPVRVMKN+ LCGDCHTFFK  S+VTKR+IH+RD SGFH F+NGKCSC 
Sbjct  828   VTFGLLMTRPGKPVRVMKNVHLCGDCHTFFKYVSVVTKRDIHIRDASGFHHFVNGKCSCR  887

Query  2279  DRW  2271
             D W
Sbjct  888   DNW  890


 Score =   140 bits (352),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 113/461 (25%), Positives = 207/461 (45%), Gaps = 65/461 (14%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G +     +  LL   +R  ++EL   +H+ ++KL   D  Y+ NAL+  Y K G L+  
Sbjct  73    GADTTRIDYANLLRISVRCGDVELAKIIHSSILKLEEED-VYLKNALIAAYLKLGHLNLA  131

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
              ++FD+L   D+ S+  +IS   K +    AFELF +M R+  +  +  T   +L AC  
Sbjct  132   EKVFDSLLSPDVVSYTAIISAFAKSNRQREAFELFLEM-RDLGIEPNEYTFVAILTACIR  190

Query  4061  CF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                +  G+++H   +++GY S   V NAL+  Y++CG ++SV+ LF  M  +D  +WN  
Sbjct  191   SLNLELGRQVHGLVVKLGYLSYTYVVNALMGLYSKCGLLESVILLFNDMPQKDIVSWNTT  250

Query  3884  ITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSD  3705
             I+  +E  + + A E++  L   + ++ +                               
Sbjct  251   ISCMVEECMYERAFEMYRELRRNDCLIVD------------------------------H  280

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHR  3525
             FTL+++  A    +  +  +++H   LKSG   N  +  AL+   T+CG +++   +F R
Sbjct  281   FTLSTLLAASSRCLAVREGQELHAHALKSGLHGNLSVNNALIGFYTKCGTLKNVVDVFER  340

Query  3524  MP-----------------------------LGHGRLVALTSMLRGYAQNGQPENAISLF  3432
             MP                             +     V+  ++L G+ QN +   A+ LF
Sbjct  341   MPVKDVFSWTEMIVAYMEFGYVDFAMEIFNSMPERNCVSYNALLAGFTQNHEGFKALGLF  400

Query  3431  FETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAK  3252
              +  LEG + + +    +VL   G++   K+ E +H   LK G  S+  +  A++ M  +
Sbjct  401   CQ-MLEGGMELTDFTLTSVLNASGSMTERKISEQIHAFILKLGLESNDRIETALLDMCTR  459

Query  3251  CGELDNAVKAFELMS--SRDLCSWNSLLAGYVLHRRGDEAL  3135
             C  +D+A K F  +     +  +  S++  Y      +EA+
Sbjct  460   CERMDDAKKIFHQLPLDHDNSVALTSMMCAYARDGHPEEAI  500


 Score = 74.7 bits (182),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 69/135 (51%), Gaps = 28/135 (21%)
 Frame = -2

Query  4755  KPNHKFNPAFLLSNASLSIQ-EPLLSSDPLINSSISTYPEQHAVDYADFLKL--------  4603
             K  +K  P+F L   S S   +PLL      +S ++   +   +DYA+ L++        
Sbjct  36    KTKYKQKPSFFLQYPSKSRPFQPLLIPQHFKDSFVTVGADTTRIDYANLLRISVRCGDVE  95

Query  4602  -------------EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAK  4480
                          EED  L NALI+AYLKLG ++ A  VFDSL SP      AIIS FAK
Sbjct  96    LAKIIHSSILKLEEEDVYLKNALIAAYLKLGHLNLAEKVFDSLLSPDVVSYTAIISAFAK  155

Query  4479  INREIEAVELFYEMR  4435
              NR+ EA ELF EMR
Sbjct  156   SNRQREAFELFLEMR  170



>ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Vitis vinifera]
Length=882

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/721 (64%), Positives = 579/721 (80%), Gaps = 0/721 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGIE NE+SFVA+LT CIR  +LELG Q+HA++IK+G+L+ T+V NALMGLY KCG 
Sbjct  162   MRSSGIELNEFSFVAILTVCIRLLDLELGCQLHAIVIKMGFLNYTFVSNALMGLYGKCGY  221

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD V++LFD +P RDIASWNT+IS +VKE M+ RAFELF DM+R D  RID+ TLST+L 
Sbjct  222   LDSVLQLFDEMPHRDIASWNTVISSVVKEMMYERAFELFRDMRRIDGFRIDHFTLSTILV  281

Query  4073  ACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTW  3894
             A        G+E+HAH ++IG+ESN+SV NALI+FYT+CGSIK V+ALFE+M VRD  TW
Sbjct  282   AARGLASMVGREIHAHVIKIGFESNISVINALIRFYTKCGSIKHVVALFEKMRVRDVITW  341

Query  3893  NEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIE  3714
              EMITAYME GL DLA E+FD +P +N++ YNA+L+GFCQNGEG KA+AFF RM++E +E
Sbjct  342   TEMITAYMEFGLTDLALEVFDKMPARNSISYNAILSGFCQNGEGSKALAFFCRMVEEGVE  401

Query  3713  FSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKI  3534
              +DFTLT + NACGLLME K SKQIHGFILK G   N CIEAALLDMCTRCGRM DA+K+
Sbjct  402   LTDFTLTGVLNACGLLMEAKISKQIHGFILKFGFGSNACIEAALLDMCTRCGRMADAQKM  461

Query  3533  FHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtl  3354
             F +        +  TSM+ GYA+N QPE AISLF ++QLEG +VVD+VA+  VLGVCGTL
Sbjct  462   FSQGSFSQSGSIIWTSMICGYARNAQPEEAISLFCQSQLEGAMVVDKVASTAVLGVCGTL  521

Query  3353  gllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLL  3174
                ++G+ +HC ALK GFLSD+ VGN++I+MY+KC  +D+A+K F +M + D+ SWN L+
Sbjct  522   AFHEMGKQIHCHALKSGFLSDLGVGNSIITMYSKCSNMDDAIKVFNVMPAHDIVSWNGLI  581

Query  3173  AGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAY  2994
             AG++LHR+GDEAL  WS+ME+ GI PD+ T + I+SAYRHT  N+V+ C+  F SM++ Y
Sbjct  582   AGHLLHRQGDEALSVWSKMEKAGIKPDTVTFVLIISAYRHTNSNLVDNCRRLFLSMKTIY  641

Query  2993  GVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRV  2814
              + P  +HY  LV VLGYWGLLEEAEE IN MP EP++SVWRALLD+C +H N++IGKR 
Sbjct  642   HIDPTVEHYTSLVGVLGYWGLLEEAEEMINKMPIEPEASVWRALLDACRIHSNTTIGKRA  701

Query  2813  IKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHS  2634
              K +L+M+P DPST+IL SNLYSA GRW CS++VR EM+ KGF+K PG+SW+I ++K HS
Sbjct  702   AKHLLAMKPLDPSTYILVSNLYSAYGRWHCSDMVREEMRVKGFRKHPGRSWIIHENKVHS  761

Query  2633  FFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALT  2454
             F+ARD SH Q+KDI+S L++LI+EC+KAGYVPDTS+VLHEVEE+QKKDFLF+HSAK+A T
Sbjct  762   FYARDKSHPQAKDIHSGLELLIMECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSAKIAAT  821

Query  2453  YGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDR  2274
             YGLLMT+ G+P+R++KNILLCGDCHTF K  SIVT REI +RD SG HCFLNG+CSC D 
Sbjct  822   YGLLMTRPGRPIRIVKNILLCGDCHTFLKYVSIVTGREIFLRDASGHHCFLNGQCSCKDY  881

Query  2273  W  2271
             W
Sbjct  882   W  882


 Score =   127 bits (319),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 140/589 (24%), Positives = 252/589 (43%), Gaps = 89/589 (15%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL   +R  ++EL   VHA + KL   +  ++ NAL+  Y K G +    ++F  L   +
Sbjct  78    LLDLSVRYDDVELIKAVHASIFKLA--EDIHLANALIVAYLKLGMVPNAYKVFVGLSCPN  135

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  MISG  K +   +A E+F  M R+  + ++  +   +L  C     +  G +LH
Sbjct  136   VVSYTAMISGFAKSNRERQAMEIFFRM-RSSGIELNEFSFVAILTVCIRLLDLELGCQLH  194

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
             A  +++G+ +   V+NAL+  Y +CG + SV+ LF+ M  RD  +WN +I++ ++  + +
Sbjct  195   AIVIKMGFLNYTFVSNALMGLYGKCGYLDSVLQLFDEMPHRDIASWNTVISSVVKEMMYE  254

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A ELF  +           + GF                         FTL++I  A  
Sbjct  255   RAFELFRDMRR---------IDGF---------------------RIDHFTLSTILVAAR  284

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG------------RMED------  3546
              L      ++IH  ++K G E N  +  AL+   T+CG            R+ D      
Sbjct  285   GLAS-MVGREIHAHVIKIGFESNISVINALIRFYTKCGSIKHVVALFEKMRVRDVITWTE  343

Query  3545  -------------AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLV  3405
                          A ++F +MP  +   ++  ++L G+ QNG+   A++ F     EG+ 
Sbjct  344   MITAYMEFGLTDLALEVFDKMPARNS--ISYNAILSGFCQNGEGSKALAFFCRMVEEGVE  401

Query  3404  VVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVK  3225
             + D   T  +      +      + +H   LK GF S+  +  A++ M  +CG + +A K
Sbjct  402   LTDFTLTGVLNACGLLMEAKISKQ-IHGFILKFGFGSNACIEAALLDMCTRCGRMADAQK  460

Query  3224  AFELMSSRDLCS--WNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILS----  3066
              F   S     S  W S++ GY  + + +EA+  + + +  G +V D      +L     
Sbjct  461   MFSQGSFSQSGSIIWTSMICGYARNAQPEEAISLFCQSQLEGAMVVDKVASTAVLGVCGT  520

Query  3065  -AYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFE  2889
              A+    K +   C +      S  GV  +      ++++      +++A +  N MP  
Sbjct  521   LAFHEMGKQI--HCHALKSGFLSDLGVGNS------IITMYSKCSNMDDAIKVFNVMPAH  572

Query  2888  PKSSVWRALLDSCIMHLNSSIGKRVIKKI--LSMEPQDPSTFILKSNLY  2748
                S W  L+   ++H        V  K+    ++P D  TF+L  + Y
Sbjct  573   DIVS-WNGLIAGHLLHRQGDEALSVWSKMEKAGIKP-DTVTFVLIISAY  619


 Score =   118 bits (296),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 106/395 (27%), Positives = 184/395 (47%), Gaps = 23/395 (6%)
 Frame = -3

Query  4004  SNLSVNNA--LIKFYTRCGSIKSVMALFERM--LVRDAFTWNEMITAYMESGLVDLAKEL  3837
             SN +VN+   L+    R   ++ + A+   +  L  D    N +I AY++ G+V  A ++
Sbjct  68    SNDTVNDHYYLLDLSVRYDDVELIKAVHASIFKLAEDIHLANALIVAYLKLGMVPNAYKV  127

Query  3836  FDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMER  3657
             F  L   N V Y A+++GF ++    +AM  F+RM    IE ++F+  +I   C  L++ 
Sbjct  128   FVGLSCPNVVSYTAMISGFAKSNRERQAMEIFFRMRSSGIELNEFSFVAILTVCIRLLDL  187

Query  3656  KSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLR  3477
             +   Q+H  ++K G      +  AL+ +  +CG ++   ++F  MP  H  + +  +++ 
Sbjct  188   ELGCQLHAIVIKMGFLNYTFVSNALMGLYGKCGYLDSVLQLFDEMP--HRDIASWNTVIS  245

Query  3476  GYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFL  3297
                +    E A  LF + +      +D    +T+L     L  +   E +H   +K GF 
Sbjct  246   SVVKEMMYERAFELFRDMRRIDGFRIDHFTLSTILVAARGLASMVGRE-IHAHVIKIGFE  304

Query  3296  SDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
             S++ V NA+I  Y KCG + + V  FE M  RD+ +W  ++  Y+     D AL+ + +M
Sbjct  305   SNISVINALIRFYTKCGSIKHVVALFEKMRVRDVITWTEMITAYMEFGLTDLALEVFDKM  364

Query  3116  ERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYW  2937
                    +S +   ILS +    +   ++  +FF  M    GV   +D    L  VL   
Sbjct  365   P----ARNSISYNAILSGFCQNGEG--SKALAFFCRMVEE-GV-ELTDF--TLTGVLNAC  414

Query  2936  GLLEEAEET------INTMPFEPKSSVWRALLDSC  2850
             GLL EA+ +      I    F   + +  ALLD C
Sbjct  415   GLLMEAKISKQIHGFILKFGFGSNACIEAALLDMC  449


 Score = 70.5 bits (171),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A   KL ED  L+NALI AYLKLG+V  A  VF  LS P      A+ISGFAK NRE +
Sbjct  95    HASIFKLAEDIHLANALIVAYLKLGMVPNAYKVFVGLSCPNVVSYTAMISGFAKSNRERQ  154

Query  4461  AVELFYEMR  4435
             A+E+F+ MR
Sbjct  155   AMEIFFRMR  163



>emb|CBI30210.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/721 (64%), Positives = 579/721 (80%), Gaps = 0/721 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGIE NE+SFVA+LT CIR  +LELG Q+HA++IK+G+L+ T+V NALMGLY KCG 
Sbjct  180   MRSSGIELNEFSFVAILTVCIRLLDLELGCQLHAIVIKMGFLNYTFVSNALMGLYGKCGY  239

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD V++LFD +P RDIASWNT+IS +VKE M+ RAFELF DM+R D  RID+ TLST+L 
Sbjct  240   LDSVLQLFDEMPHRDIASWNTVISSVVKEMMYERAFELFRDMRRIDGFRIDHFTLSTILV  299

Query  4073  ACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTW  3894
             A        G+E+HAH ++IG+ESN+SV NALI+FYT+CGSIK V+ALFE+M VRD  TW
Sbjct  300   AARGLASMVGREIHAHVIKIGFESNISVINALIRFYTKCGSIKHVVALFEKMRVRDVITW  359

Query  3893  NEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIE  3714
              EMITAYME GL DLA E+FD +P +N++ YNA+L+GFCQNGEG KA+AFF RM++E +E
Sbjct  360   TEMITAYMEFGLTDLALEVFDKMPARNSISYNAILSGFCQNGEGSKALAFFCRMVEEGVE  419

Query  3713  FSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKI  3534
              +DFTLT + NACGLLME K SKQIHGFILK G   N CIEAALLDMCTRCGRM DA+K+
Sbjct  420   LTDFTLTGVLNACGLLMEAKISKQIHGFILKFGFGSNACIEAALLDMCTRCGRMADAQKM  479

Query  3533  FHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtl  3354
             F +        +  TSM+ GYA+N QPE AISLF ++QLEG +VVD+VA+  VLGVCGTL
Sbjct  480   FSQGSFSQSGSIIWTSMICGYARNAQPEEAISLFCQSQLEGAMVVDKVASTAVLGVCGTL  539

Query  3353  gllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLL  3174
                ++G+ +HC ALK GFLSD+ VGN++I+MY+KC  +D+A+K F +M + D+ SWN L+
Sbjct  540   AFHEMGKQIHCHALKSGFLSDLGVGNSIITMYSKCSNMDDAIKVFNVMPAHDIVSWNGLI  599

Query  3173  AGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAY  2994
             AG++LHR+GDEAL  WS+ME+ GI PD+ T + I+SAYRHT  N+V+ C+  F SM++ Y
Sbjct  600   AGHLLHRQGDEALSVWSKMEKAGIKPDTVTFVLIISAYRHTNSNLVDNCRRLFLSMKTIY  659

Query  2993  GVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRV  2814
              + P  +HY  LV VLGYWGLLEEAEE IN MP EP++SVWRALLD+C +H N++IGKR 
Sbjct  660   HIDPTVEHYTSLVGVLGYWGLLEEAEEMINKMPIEPEASVWRALLDACRIHSNTTIGKRA  719

Query  2813  IKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHS  2634
              K +L+M+P DPST+IL SNLYSA GRW CS++VR EM+ KGF+K PG+SW+I ++K HS
Sbjct  720   AKHLLAMKPLDPSTYILVSNLYSAYGRWHCSDMVREEMRVKGFRKHPGRSWIIHENKVHS  779

Query  2633  FFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALT  2454
             F+ARD SH Q+KDI+S L++LI+EC+KAGYVPDTS+VLHEVEE+QKKDFLF+HSAK+A T
Sbjct  780   FYARDKSHPQAKDIHSGLELLIMECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSAKIAAT  839

Query  2453  YGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDR  2274
             YGLLMT+ G+P+R++KNILLCGDCHTF K  SIVT REI +RD SG HCFLNG+CSC D 
Sbjct  840   YGLLMTRPGRPIRIVKNILLCGDCHTFLKYVSIVTGREIFLRDASGHHCFLNGQCSCKDY  899

Query  2273  W  2271
             W
Sbjct  900   W  900


 Score =   118 bits (295),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 106/395 (27%), Positives = 184/395 (47%), Gaps = 23/395 (6%)
 Frame = -3

Query  4004  SNLSVNNA--LIKFYTRCGSIKSVMALFERM--LVRDAFTWNEMITAYMESGLVDLAKEL  3837
             SN +VN+   L+    R   ++ + A+   +  L  D    N +I AY++ G+V  A ++
Sbjct  86    SNDTVNDHYYLLDLSVRYDDVELIKAVHASIFKLAEDIHLANALIVAYLKLGMVPNAYKV  145

Query  3836  FDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMER  3657
             F  L   N V Y A+++GF ++    +AM  F+RM    IE ++F+  +I   C  L++ 
Sbjct  146   FVGLSCPNVVSYTAMISGFAKSNRERQAMEIFFRMRSSGIELNEFSFVAILTVCIRLLDL  205

Query  3656  KSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLR  3477
             +   Q+H  ++K G      +  AL+ +  +CG ++   ++F  MP  H  + +  +++ 
Sbjct  206   ELGCQLHAIVIKMGFLNYTFVSNALMGLYGKCGYLDSVLQLFDEMP--HRDIASWNTVIS  263

Query  3476  GYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFL  3297
                +    E A  LF + +      +D    +T+L     L  +   E +H   +K GF 
Sbjct  264   SVVKEMMYERAFELFRDMRRIDGFRIDHFTLSTILVAARGLASMVGRE-IHAHVIKIGFE  322

Query  3296  SDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
             S++ V NA+I  Y KCG + + V  FE M  RD+ +W  ++  Y+     D AL+ + +M
Sbjct  323   SNISVINALIRFYTKCGSIKHVVALFEKMRVRDVITWTEMITAYMEFGLTDLALEVFDKM  382

Query  3116  ERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYW  2937
                    +S +   ILS +    +   ++  +FF  M    GV   +D    L  VL   
Sbjct  383   P----ARNSISYNAILSGFCQNGEG--SKALAFFCRMVEE-GV-ELTDF--TLTGVLNAC  432

Query  2936  GLLEEAEET------INTMPFEPKSSVWRALLDSC  2850
             GLL EA+ +      I    F   + +  ALLD C
Sbjct  433   GLLMEAKISKQIHGFILKFGFGSNACIEAALLDMC  467


 Score = 70.5 bits (171),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A   KL ED  L+NALI AYLKLG+V  A  VF  LS P      A+ISGFAK NRE +
Sbjct  113   HASIFKLAEDIHLANALIVAYLKLGMVPNAYKVFVGLSCPNVVSYTAMISGFAKSNRERQ  172

Query  4461  AVELFYEMR  4435
             A+E+F+ MR
Sbjct  173   AMEIFFRMR  181



>ref|XP_011094448.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Sesamum indicum]
Length=903

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/753 (62%), Positives = 580/753 (77%), Gaps = 3/753 (0%)
 Frame = -3

Query  4520  ILFPPRPSYRVLQKSTVKL--KPWSSSMR*DLRGSGIEPNEYSFVALLTACIRSQNLELG  4347
             IL P   SY  +     KL  +  +  +  ++RGSGIEPNEY+FVALLTAC+R  +LELG
Sbjct  151   ILSPDVVSYTAMLSGLAKLGREDEAVGLFLEMRGSGIEPNEYTFVALLTACMRLLDLELG  210

Query  4346  FQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKE  4167
              Q+HA  IK G+++ TYV NALMGLY KC  LD V+ LF ++PKRD+ SWNT+IS +VK+
Sbjct  211   SQIHACSIKTGHINCTYVANALMGLYGKCSCLDAVVNLFSDMPKRDVVSWNTVISCVVKD  270

Query  4166  SMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSV  3990
              M+ RAFELF DM R +  R+DY TLS+LL AC+ C   R G E+HA+A +IGY  +LSV
Sbjct  271   GMYDRAFELFLDMLRLEGCRVDYFTLSSLLVACARCLATREGMEIHAYAHKIGYGGHLSV  330

Query  3989  NNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNA  3810
              NALI+FY +CG ++ V +LF RM V+DAFTW EMI AYM  GL+DLA E F  +PEKN 
Sbjct  331   KNALIQFYAKCGCVEDVESLFNRMPVQDAFTWTEMINAYMGFGLMDLAVETFVRMPEKNP  390

Query  3809  VLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGF  3630
             V YNA+LAGFCQNGEG +A+  F R+++  +E SDFTLT++ +ACGL+ +R+ S+QI  F
Sbjct  391   VSYNALLAGFCQNGEGFRALRLFCRLVEGGMELSDFTLTTVFHACGLMKDRRLSEQIQAF  450

Query  3629  ILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPE  3450
             +LK    PND + AALLDMCTRCGRM+DAEKIF R+ +     + LT+M+ GYA+N +P+
Sbjct  451   VLKIDFGPNDWVLAALLDMCTRCGRMDDAEKIFRRLEMEQSSSIMLTTMICGYARNSEPD  510

Query  3449  NAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAV  3270
              AISL    + E  VV+DEV  A+VLGVCG LG  KLGE  HC ALK+GFL DV VGN++
Sbjct  511   KAISLICRWRYEEHVVMDEVELASVLGVCGDLGFQKLGEQFHCYALKYGFLFDVGVGNSI  570

Query  3269  ISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDS  3090
             ISMY+KCG ++ A K F  +S+ D+ SWNSLLAG++L+R+G EALD W +M++ G+ PD+
Sbjct  571   ISMYSKCGNMEEASKVFGSISAHDIVSWNSLLAGHILNRQGGEALDVWKKMQKAGVQPDT  630

Query  3089  FTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEET  2910
              T   I+SAYRHT  N+V  C  FF SM+S Y + P SDHYACLV VLGYWGLLEEA+E 
Sbjct  631   ITSFLIISAYRHTDSNLVEHCHDFFHSMKSVYQIEPNSDHYACLVGVLGYWGLLEEADEI  690

Query  2909  INTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRW  2730
             I  MPFEPK+SVWRALLDSC +H N +IG+R  KKILSMEPQDPST+ILKSNLYSASGRW
Sbjct  691   IKKMPFEPKASVWRALLDSCRVHRNVTIGRRAAKKILSMEPQDPSTYILKSNLYSASGRW  750

Query  2729  QCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKA  2550
             +CS+LVR EM+E+GF+K PG+SW+I Q K HSFF+RD SH QSKDIYSALDIL LEC+KA
Sbjct  751   RCSDLVREEMRERGFRKFPGRSWIIHQSKVHSFFSRDKSHPQSKDIYSALDILCLECLKA  810

Query  2549  GYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFF  2370
             GYV DTS+VLHEVEE+QK +FL +HS KLA+TYGLL TK G+PVRV+KNI LCGDCHTFF
Sbjct  811   GYVSDTSFVLHEVEEHQKMNFLLYHSGKLAVTYGLLTTKLGEPVRVIKNIHLCGDCHTFF  870

Query  2369  KSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             K  S+VTKREIHVRD+SGFHCF NG+CSC D W
Sbjct  871   KYVSVVTKREIHVRDSSGFHCFANGECSCKDYW  903


 Score =   127 bits (319),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 137/573 (24%), Positives = 242/573 (42%), Gaps = 79/573 (14%)
 Frame = -3

Query  4361  NLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMIS  4182
             +++L   VHA ++K+ +   T + N+L+  Y + G L +   +F ++   D+ S+  M+S
Sbjct  107   DIQLSKAVHASILKVQH--DTRLFNSLITSYIELGCLSYAENVFSSILSPDVVSYTAMLS  164

Query  4181  GMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYE  4005
             G+ K      A  LF +M R   +  +  T   LL AC     +  G ++HA +++ G+ 
Sbjct  165   GLAKLGREDEAVGLFLEM-RGSGIEPNEYTFVALLTACMRLLDLELGSQIHACSIKTGHI  223

Query  4004  SNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHL  3825
             +   V NAL+  Y +C  + +V+ LF  M  RD  +WN +I+  ++ G+ D A EL    
Sbjct  224   NCTYVANALMGLYGKCSCLDAVVNLFSDMPKRDVVSWNTVISCVVKDGMYDRAFEL----  279

Query  3824  PEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSDFTLTSIANACGLLMERKSS  3648
                                        F  M++ E      FTL+S+  AC   +  +  
Sbjct  280   ---------------------------FLDMLRLEGCRVDYFTLSSLLVACARCLATREG  312

Query  3647  KQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP--------------LGH  3510
              +IH +  K G   +  ++ AL+    +CG +ED E +F+RMP              +G 
Sbjct  313   MEIHAYAHKIGYGGHLSVKNALIQFYAKCGCVEDVESLFNRMPVQDAFTWTEMINAYMGF  372

Query  3509  GRL---------------VALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtv  3375
             G +               V+  ++L G+ QNG+   A+ LF    +EG + + +    TV
Sbjct  373   GLMDLAVETFVRMPEKNPVSYNALLAGFCQNGEGFRALRLFCRL-VEGGMELSDFTLTTV  431

Query  3374  lgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDL  3195
                CG +   +L E +    LK  F  +  V  A++ M  +CG +D+A K F  +     
Sbjct  432   FHACGLMKDRRLSEQIQAFVLKIDFGPNDWVLAALLDMCTRCGRMDDAEKIFRRLEMEQS  491

Query  3194  CS--WNSLLAGYVLHRRGDEALD---TWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNR  3030
              S    +++ GY  +   D+A+     W   E   +V D      +L            +
Sbjct  492   SSIMLTTMICGYARNSEPDKAISLICRWRYEEH--VVMDEVELASVLGVCGDLG---FQK  546

Query  3029  CQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSC  2850
                 F      YG L        ++S+    G +EEA +   ++      S W +LL   
Sbjct  547   LGEQFHCYALKYGFLFDVGVGNSIISMYSKCGNMEEASKVFGSISAHDIVS-WNSLLAGH  605

Query  2849  IMHLNSSIGKRVIKKI--LSMEPQDPSTFILKS  2757
             I++        V KK+    ++P   ++F++ S
Sbjct  606   ILNRQGGEALDVWKKMQKAGVQPDTITSFLIIS  638



>ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica]
 gb|EMJ04327.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica]
Length=905

 Score =   942 bits (2434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/722 (62%), Positives = 574/722 (80%), Gaps = 1/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGI+PNE+SFVA+LTACIR   L+LG QVHAL +K+GYLD  +V NALM LY KC  
Sbjct  184   MRNSGIDPNEFSFVAVLTACIRILELDLGLQVHALAVKMGYLDCVFVSNALMSLYGKCSC  243

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD+V++LFD+LP+RDIASWNT++S +VKE  +  AFELF ++ R +   ID  T+STLL 
Sbjct  244   LDYVLKLFDHLPERDIASWNTVMSSLVKEFRYAEAFELFRELWRTEGFGIDRFTVSTLLT  303

Query  4073  ACS-ECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             AC+     R G+ +HA+A++IG E+NLSV NALI+FY  CGS+  V +LFERM VRD  T
Sbjct  304   ACTGSSAFRAGKLVHAYAIKIGLEANLSVTNALIRFYAACGSVNGVKSLFERMPVRDVIT  363

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EMITAYME GLVDLA E+FD++PE+N V YNA+LAGFC+NGEGL+A+  F +M++E +
Sbjct  364   WTEMITAYMEVGLVDLAIEMFDNMPERNPVSYNALLAGFCRNGEGLRALDLFTKMLEEGM  423

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +DFTLTS+ NACGL+M+ K+S+QIHGF++K G   N CIEAALLDMCTRCGRM DA+K
Sbjct  424   EMTDFTLTSVVNACGLVMDCKTSEQIHGFLIKFGFGSNACIEAALLDMCTRCGRMADAKK  483

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F R P    R V LTS++ GYA+NGQ + AISLF   Q EG + +DEV++ ++LG+CGT
Sbjct  484   MFLRWPAEQDRSVILTSIIGGYARNGQLDEAISLFNLNQSEGRMDMDEVSSTSLLGLCGT  543

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             +G  +LG+ +HC A K GFL+DV VGNA ISMY KC  +++ VK F +M + D+ SWN L
Sbjct  544   IGFHELGKQIHCHAFKRGFLTDVGVGNATISMYTKCWNMEDGVKLFNMMPTHDVVSWNGL  603

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             LAGY+LHR+GDEAL  WS+MER GI PD  T + I+SAYRHT  N+V+ C+S F S+++ 
Sbjct  604   LAGYLLHRQGDEALAFWSKMERTGIKPDKITFVLIISAYRHTNSNLVDNCRSLFLSLKTV  663

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             YG+ P S+H+A  ++VLGYWGLL+EAEE I  MPFEP+ SVWRALLDSC + +N+++GKR
Sbjct  664   YGIEPTSEHFASFIAVLGYWGLLDEAEEIICKMPFEPEVSVWRALLDSCRLRMNTTVGKR  723

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V+K+IL+MEP+DPS++IL SNLYSASGRW CSE+VR +M++KGF+K PGQSW+I   K H
Sbjct  724   VVKRILAMEPKDPSSYILVSNLYSASGRWHCSEMVRDKMRKKGFRKHPGQSWIIHNKKIH  783

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
              F+ARD SH Q+KDIYS L+ILILEC+KAGYVPDTS+VL EVEE+QKKDFL++HSAKLA 
Sbjct  784   PFYARDKSHPQAKDIYSGLEILILECLKAGYVPDTSFVLQEVEEHQKKDFLYYHSAKLAA  843

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
             TYGLL +K GKPVR++KNILLCGDCHTF K  SIVT+R I+VRD SG H F +G+CSC D
Sbjct  844   TYGLLTSKPGKPVRIVKNILLCGDCHTFLKYMSIVTRRTIYVRDASGVHYFSSGQCSCKD  903

Query  2276  RW  2271
              W
Sbjct  904   YW  905


 Score =   121 bits (303),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 130/548 (24%), Positives = 231/548 (42%), Gaps = 81/548 (15%)
 Frame = -3

Query  4370  RSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNT  4191
             R  + EL   VHA ++K  + +  ++ NAL+  Y K G +     +F +L   ++ S+ T
Sbjct  106   RHGDHELARAVHASILK--FEEDNHLGNALISAYLKLGLVPDAYRVFQSLSCPNVVSFTT  163

Query  4190  MISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRI  4014
             ++SG  K      A ELF  M RN  +  +  +   +L AC     +  G ++HA A+++
Sbjct  164   LVSGFSKAGREDEAVELFFGM-RNSGIDPNEFSFVAVLTACIRILELDLGLQVHALAVKM  222

Query  4013  GYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELF  3834
             GY   + V+NAL+  Y +C  +  V+ LF+ +  RD  +WN ++++ ++      A ELF
Sbjct  223   GYLDCVFVSNALMSLYGKCSCLDYVLKLFDHLPERDIASWNTVMSSLVKEFRYAEAFELF  282

Query  3833  DHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERK  3654
               L                            +R   E      FT++++  AC      +
Sbjct  283   REL----------------------------WR--TEGFGIDRFTVSTLLTACTGSSAFR  312

Query  3653  SSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP---------------  3519
             + K +H + +K G E N  +  AL+     CG +   + +F RMP               
Sbjct  313   AGKLVHAYAIKIGLEANLSVTNALIRFYAACGSVNGVKSLFERMPVRDVITWTEMITAYM  372

Query  3518  --------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATA  3381
                           +     V+  ++L G+ +NG+   A+ LF +   EG+ + D   T+
Sbjct  373   EVGLVDLAIEMFDNMPERNPVSYNALLAGFCRNGEGLRALDLFTKMLEEGMEMTDFTLTS  432

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
              V+  CG +   K  E +H   +K GF S+  +  A++ M  +CG + +A K F    + 
Sbjct  433   -VVNACGLVMDCKTSEQIHGFLIKFGFGSNACIEAALLDMCTRCGRMADAKKMFLRWPAE  491

Query  3200  DLCS--WNSLLAGYVLHRRGDEALDTWS------RMERLGIVPDSFTCLHILSAYRHTTK  3045
                S    S++ GY  + + DEA+  ++      RM+   +   S   L     +    K
Sbjct  492   QDRSVILTSIIGGYARNGQLDEAISLFNLNQSEGRMDMDEVSSTSLLGLCGTIGFHELGK  551

Query  3044  NVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRA  2865
              +   C +F     +  GV  A+      +S+      +E+  +  N MP     S W  
Sbjct  552   QI--HCHAFKRGFLTDVGVGNAT------ISMYTKCWNMEDGVKLFNMMPTHDVVS-WNG  602

Query  2864  LLDSCIMH  2841
             LL   ++H
Sbjct  603   LLAGYLLH  610


 Score = 75.5 bits (184),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LK EED  L NALISAYLKLGLV  A  VF SLS P       ++SGF+K  RE E
Sbjct  117   HASILKFEEDNHLGNALISAYLKLGLVPDAYRVFQSLSCPNVVSFTTLVSGFSKAGREDE  176

Query  4461  AVELFYEMR  4435
             AVELF+ MR
Sbjct  177   AVELFFGMR  185



>ref|XP_008241336.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Prunus mume]
Length=905

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/722 (61%), Positives = 571/722 (79%), Gaps = 1/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGI+PNE+SFVA+LTACIR   L+LG QVH+L +K+GYLD  +V NALM LY KC  
Sbjct  184   MRNSGIDPNEFSFVAVLTACIRILELDLGLQVHSLAVKMGYLDCVFVSNALMSLYGKCSC  243

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD+V++LFD+LP+RDIASWNT++S +VKE  +  AFELF ++ R +   ID  T+STLL 
Sbjct  244   LDYVLKLFDHLPERDIASWNTVMSSLVKEFRYAEAFELFRELWRTEGFGIDGFTVSTLLT  303

Query  4073  ACS-ECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             AC+     R G+ +HAHA++IG E+NLSV NALI+FY  CGS+  V +LFERM V+D  T
Sbjct  304   ACTGSSAFREGKLVHAHAIKIGLEANLSVTNALIRFYAACGSVNGVKSLFERMPVKDVIT  363

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EM+TAYME GLVDLA E+FD++PE+N V YNA+LAGFC+NGEGL+A+  F +M++E +
Sbjct  364   WTEMVTAYMEVGLVDLAIEMFDNMPERNPVSYNALLAGFCRNGEGLRALDLFTKMLEEGM  423

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E ++FTLTS+ NACGL+M+ K+S+QIHGF++K G   N CIEAALLDMCTRCGRM DA+K
Sbjct  424   ELTNFTLTSVVNACGLVMDCKTSEQIHGFLIKFGFGSNACIEAALLDMCTRCGRMADAKK  483

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F R P    R V LTS++  YA+NG+ + AISLF   Q EG + +DEV++ ++LG+CGT
Sbjct  484   MFLRWPAKQDRSVILTSIIGAYARNGELDEAISLFNLNQSEGRMYMDEVSSTSLLGLCGT  543

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             +G  +LG+ +HC A K GFL+DV VGNA ISMY KC  +++ VK F +M + D+ SWN L
Sbjct  544   IGFHELGKQIHCHAFKRGFLTDVGVGNATISMYTKCWNMEDGVKLFNMMPTHDIVSWNGL  603

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             LAGY+LHR+GDEAL  WS+MER GI PD  T + I+SAYRHT  N+V+ C+S F SM++ 
Sbjct  604   LAGYLLHRQGDEALAFWSKMERTGIKPDKITFVLIISAYRHTNSNLVDNCRSLFLSMKTV  663

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             YG+ P S+H+A  ++VLGYWGLL+EAEE I  MPFEP+ SVWRALLDSC + +N+++GKR
Sbjct  664   YGIEPTSEHFASFIAVLGYWGLLDEAEEIICKMPFEPEVSVWRALLDSCRLRMNTTVGKR  723

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V+K+IL+MEP+DPS++IL SNLYSASGRW CSE+VR +M++KGF+K PGQSW+I   K H
Sbjct  724   VVKRILAMEPKDPSSYILVSNLYSASGRWHCSEMVRDKMRKKGFRKHPGQSWIIHNQKIH  783

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
              F+ARD SH Q+KDIYS L+ILILEC+KAGY PDTS+VL EVEE+QKKDFL++HSAKLA 
Sbjct  784   PFYARDKSHPQAKDIYSGLEILILECLKAGYAPDTSFVLQEVEEHQKKDFLYYHSAKLAA  843

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
             TYGLL +K GKPVR++KNILLCGDCHTF K  SIVT R I+VRD SG H F +G+CSC D
Sbjct  844   TYGLLTSKPGKPVRIVKNILLCGDCHTFLKYMSIVTGRAIYVRDASGVHYFSSGQCSCKD  903

Query  2276  RW  2271
              W
Sbjct  904   YW  905


 Score =   115 bits (287),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 111/450 (25%), Positives = 195/450 (43%), Gaps = 66/450 (15%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL    R  + EL   VHA ++KL   +  ++ NAL+  Y K G +     +F +L   +
Sbjct  100   LLRLSARHGDHELARAVHASILKLE--EDNHLGNALISAYLKLGLVPDADRVFQSLSCPN  157

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+ T++SG  K      A ELF  M RN  +  +  +   +L AC     +  G ++H
Sbjct  158   VVSFTTLVSGFSKAGREDEAVELFFGM-RNSGIDPNEFSFVAVLTACIRILELDLGLQVH  216

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
             + A+++GY   + V+NAL+  Y +C  +  V+ LF+ +  RD  +WN ++++ ++     
Sbjct  217   SLAVKMGYLDCVFVSNALMSLYGKCSCLDYVLKLFDHLPERDIASWNTVMSSLVKEFRYA  276

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A ELF  L             GF  +G                     FT++++  AC 
Sbjct  277   EAFELFRELWRTE---------GFGIDG---------------------FTVSTLLTACT  306

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP---------  3519
                  +  K +H   +K G E N  +  AL+     CG +   + +F RMP         
Sbjct  307   GSSAFREGKLVHAHAIKIGLEANLSVTNALIRFYAACGSVNGVKSLFERMPVKDVITWTE  366

Query  3518  --------------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                                 +     V+  ++L G+ +NG+   A+ LF +   EG+ + 
Sbjct  367   MVTAYMEVGLVDLAIEMFDNMPERNPVSYNALLAGFCRNGEGLRALDLFTKMLEEGMELT  426

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
             +   T+ V+  CG +   K  E +H   +K GF S+  +  A++ M  +CG + +A K F
Sbjct  427   NFTLTS-VVNACGLVMDCKTSEQIHGFLIKFGFGSNACIEAALLDMCTRCGRMADAKKMF  485

Query  3218  ELMSSRDLCS--WNSLLAGYVLHRRGDEAL  3135
                 ++   S    S++  Y  +   DEA+
Sbjct  486   LRWPAKQDRSVILTSIIGAYARNGELDEAI  515


 Score = 91.7 bits (226),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 75/316 (24%), Positives = 140/316 (44%), Gaps = 33/316 (10%)
 Frame = -3

Query  3917  LVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFY  3738
             L  D    N +I+AY++ GLV  A  +F  L   N V +  +++GF + G   +A+  F+
Sbjct  123   LEEDNHLGNALISAYLKLGLVPDADRVFQSLSCPNVVSFTTLVSGFSKAGREDEAVELFF  182

Query  3737  RMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG  3558
              M    I+ ++F+  ++  AC  ++E     Q+H   +K G      +  AL+ +  +C 
Sbjct  183   GMRNSGIDPNEFSFVAVLTACIRILELDLGLQVHSLAVKMGYLDCVFVSNALMSLYGKCS  242

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAt  3378
              ++   K+F  +P     + +  +++    +  +   A  LF E        +D    +T
Sbjct  243   CLDYVLKLFDHLP--ERDIASWNTVMSSLVKEFRYAEAFELFRELWRTEGFGIDGFTVST  300

Query  3377  vlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRD  3198
             +L  C      + G+ +H  A+K G  +++ V NA+I  YA CG ++     FE M  +D
Sbjct  301   LLTACTGSSAFREGKLVHAHAIKIGLEANLSVTNALIRFYAACGSVNGVKSLFERMPVKD  360

Query  3197  LCSW-------------------------------NSLLAGYVLHRRGDEALDTWSRMER  3111
             + +W                               N+LLAG+  +  G  ALD +++M  
Sbjct  361   VITWTEMVTAYMEVGLVDLAIEMFDNMPERNPVSYNALLAGFCRNGEGLRALDLFTKMLE  420

Query  3110  LGIVPDSFTCLHILSA  3063
              G+   +FT   +++A
Sbjct  421   EGMELTNFTLTSVVNA  436


 Score = 75.9 bits (185),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 47/69 (68%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LKLEED  L NALISAYLKLGLV  A  VF SLS P       ++SGF+K  RE E
Sbjct  117   HASILKLEEDNHLGNALISAYLKLGLVPDADRVFQSLSCPNVVSFTTLVSGFSKAGREDE  176

Query  4461  AVELFYEMR  4435
             AVELF+ MR
Sbjct  177   AVELFFGMR  185



>ref|XP_009378231.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Pyrus x bretschneideri]
Length=906

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/722 (62%), Positives = 570/722 (79%), Gaps = 1/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGI+PNEYSFVA+LTACIR   L+LG QVHAL++KLGYLD  +V NALMGLY KC  
Sbjct  185   MRNSGIKPNEYSFVAILTACIRVLELDLGLQVHALVVKLGYLDYVFVSNALMGLYGKCLC  244

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD+V++LF  LP+RD AS NT++S +VKE M+  AFELF ++++ +   +D+ T+STLL 
Sbjct  245   LDYVLKLFHQLPERDTASLNTVMSSLVKEFMYDEAFELFRELRQTEGFGVDHFTVSTLLT  304

Query  4073  ACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             ACS     R G+E+HAHA++IG E+NLSV+NALI+FY  CGS+  V ALF RM V+D  T
Sbjct  305   ACSGSNAFREGKEVHAHAIKIGLEANLSVSNALIRFYAVCGSVNGVNALFARMPVKDVIT  364

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EMITAYM+ GLVDLA ++FD++PE+N+V +NAVLAGFC+NGEGL A+  F +M+KE +
Sbjct  365   WTEMITAYMKFGLVDLAIKMFDNMPERNSVSHNAVLAGFCRNGEGLGALDLFTKMLKEGM  424

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +DFTLTS+ NAC LL + K+S+QIHG I+K     N CIEAALLDM TRCGRM DA+K
Sbjct  425   EMTDFTLTSVVNACALLRDCKTSEQIHGLIIKFDFGSNACIEAALLDMYTRCGRMTDAKK  484

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +FH  P      V LTSM+ GY++NGQP+ AISLF   Q EG +V+DEV++ ++LG+CGT
Sbjct  485   LFHWWPAEQDSSVLLTSMIGGYSRNGQPDEAISLFHLHQSEGRMVMDEVSSTSLLGLCGT  544

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG+ +LG+ +HC ALK GFL+D+ VGNA ISMY KC  +++ VK F  M + D+ SWN L
Sbjct  545   LGINELGKQIHCHALKCGFLTDLGVGNATISMYTKCWNMEDGVKLFNTMPTHDIVSWNGL  604

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             LAGY+LHR+GDEAL  WS MER GI PD  T + I+SAYRHTT N+V+ C+S F SM++ 
Sbjct  605   LAGYLLHRQGDEALAVWSNMERTGIKPDQITFILIISAYRHTTSNLVDDCRSLFLSMKTV  664

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             Y + P S+H+A  V VLGYWGLL+EAEETI+ MPFEP+  VWRALLDSC +  N++IGKR
Sbjct  665   YDIEPTSEHFASFVGVLGYWGLLDEAEETISKMPFEPEFIVWRALLDSCRIQTNTTIGKR  724

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V+K+IL+MEP+DPS +IL SNLYSASGRW CSE+VR +M++KGF+K P QSW +  +K H
Sbjct  725   VVKRILAMEPKDPSAYILVSNLYSASGRWHCSEMVREDMRKKGFRKHPSQSWTVHNNKIH  784

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
              F+ARD SH Q+KDIYS L+ILILEC+KAGYVPDTS+VLHEVEE+QKKDFL++HSAKLA 
Sbjct  785   PFYARDKSHPQAKDIYSGLEILILECIKAGYVPDTSFVLHEVEEHQKKDFLYYHSAKLAA  844

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
             TYGLL TK GKP+RV+KNILLCGDCH F K  SIVT+R I+VRD SGFHC  +G+CSC D
Sbjct  845   TYGLLTTKPGKPIRVVKNILLCGDCHAFLKYMSIVTRRAIYVRDASGFHCISSGQCSCKD  904

Query  2276  RW  2271
              W
Sbjct  905   YW  906


 Score =   120 bits (301),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 138/581 (24%), Positives = 241/581 (41%), Gaps = 84/581 (14%)
 Frame = -3

Query  4370  RSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNT  4191
             R  + EL    HA ++KL   + T++ NAL+  Y K G +     +F +L   ++ S+ T
Sbjct  107   RHGDRELARAAHASILKLQ--EDTHLGNALISAYLKLGLVSDAHLVFLSLSCPNVVSFTT  164

Query  4190  MISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRI  4014
             ++SG  K      A E F  M RN  ++ +  +   +L AC     +  G ++HA  +++
Sbjct  165   LVSGFSKAGREEEAVEFFFQM-RNSGIKPNEYSFVAILTACIRVLELDLGLQVHALVVKL  223

Query  4013  GYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELF  3834
             GY   + V+NAL+  Y +C  +  V+ LF ++  RD  + N ++++ ++  + D A ELF
Sbjct  224   GYLDYVFVSNALMGLYGKCLCLDYVLKLFHQLPERDTASLNTVMSSLVKEFMYDEAFELF  283

Query  3833  DHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERK  3654
               L +                               E      FT++++  AC      +
Sbjct  284   RELRQ------------------------------TEGFGVDHFTVSTLLTACSGSNAFR  313

Query  3653  SSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP---------------  3519
               K++H   +K G E N  +  AL+     CG +     +F RMP               
Sbjct  314   EGKEVHAHAIKIGLEANLSVSNALIRFYAVCGSVNGVNALFARMPVKDVITWTEMITAYM  373

Query  3518  --------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATA  3381
                           +     V+  ++L G+ +NG+   A+ LF +   EG+ + D   T+
Sbjct  374   KFGLVDLAIKMFDNMPERNSVSHNAVLAGFCRNGEGLGALDLFTKMLKEGMEMTDFTLTS  433

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
              V+  C  L   K  E +H L +K  F S+  +  A++ MY +CG + +A K F    + 
Sbjct  434   -VVNACALLRDCKTSEQIHGLIIKFDFGSNACIEAALLDMYTRCGRMTDAKKLFHWWPAE  492

Query  3200  DLCS--WNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILSAYRHTTKNVVNR  3030
                S    S++ GY  + + DEA+  +   +  G +V D  +   +L        N + +
Sbjct  493   QDSSVLLTSMIGGYSRNGQPDEAISLFHLHQSEGRMVMDEVSSTSLLGLCGTLGINELGK  552

Query  3029  ---CQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALL  2859
                C +      +  GV  A+      +S+      +E+  +  NTMP     S W  LL
Sbjct  553   QIHCHALKCGFLTDLGVGNAT------ISMYTKCWNMEDGVKLFNTMPTHDIVS-WNGLL  605

Query  2858  DSCIMHLNSSIGKRVIKKILSME----PQDPSTFILKSNLY  2748
                ++H     G   +    +ME      D  TFIL  + Y
Sbjct  606   AGYLLHRQ---GDEALAVWSNMERTGIKPDQITFILIISAY  643


 Score = 76.3 bits (186),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LKL+EDT L NALISAYLKLGLV  A  VF SLS P       ++SGF+K  RE E
Sbjct  118   HASILKLQEDTHLGNALISAYLKLGLVSDAHLVFLSLSCPNVVSFTTLVSGFSKAGREEE  177

Query  4461  AVELFYEMR  4435
             AVE F++MR
Sbjct  178   AVEFFFQMR  186



>ref|XP_008386565.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Malus domestica]
 ref|XP_008386567.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Malus domestica]
Length=905

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/722 (62%), Positives = 570/722 (79%), Gaps = 2/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGI PNEYSFVA+LTACIR   L+LG QVHAL++KLGYLD  +V NALMGLY KC  
Sbjct  185   MRNSGIMPNEYSFVAILTACIRVLELDLGLQVHALVVKLGYLDYVFVSNALMGLYGKCCC  244

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD+V++LF  LP+RD AS NT++S + KE M+  AFELF ++Q+ +   +D+ T+STLL 
Sbjct  245   LDYVLKLFHQLPERDSASLNTVMSSLAKEFMYDEAFELFRELQQTEGFGVDHFTVSTLLT  304

Query  4073  ACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             ACS    +R G+E+HAHA++IG E+NLSV+NALI+FY  CGS+  V ALF RM V+D  T
Sbjct  305   ACSGSNALREGKEVHAHAIKIGLEANLSVSNALIRFYAVCGSVNGVNALFARMPVKDVIT  364

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EMITAYM+ GLVDLA ++FD++PE+N+V +NAVLAGFC+NGEGL A+  F +M+KE +
Sbjct  365   WTEMITAYMKFGLVDLAIKMFDNMPEQNSVSHNAVLAGFCRNGEGLGALDLFTKMLKEGM  424

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +DFTLTS+ NAC LL + K+S+QIHGFI+K     N CIEAALLDM TRCGRM DA+K
Sbjct  425   EMTDFTLTSVVNACALLRDCKTSEQIHGFIIKFDFGSNACIEAALLDMYTRCGRMTDAKK  484

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +FHR P      V LTSM+ GY++NGQ + AISLF   Q EG +V+DEV + ++LG+CGT
Sbjct  485   LFHRWPAEQDSSVLLTSMIGGYSRNGQLDEAISLFHHHQSEGRMVMDEVXSTSLLGLCGT  544

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG+ +LG+ +HC ALK GFL+D+ VGNA ISMY KC  +++ VK F  M + D+ SWN L
Sbjct  545   LGIYELGKQIHCHALKCGFLTDLGVGNATISMYTKCWNMEDGVKLFNTMPTHDIVSWNGL  604

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             LAGY+LHR+GDEAL  WS ME+ GI PD  T + I+SAYRHTT N+V+ C+S F SM++ 
Sbjct  605   LAGYLLHRQGDEALAVWSNMEKTGIKPDQITFILIISAYRHTTSNLVDACRSLFLSMKTV  664

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             Y + P S+H+A  V VLGYWGLL+EAEETI+ MPFEP+  VWRALLDSC +  N++IGKR
Sbjct  665   YDIEPTSEHFASFVGVLGYWGLLDEAEETISKMPFEPEFIVWRALLDSCRIQTNTTIGKR  724

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V+K+IL+MEP+DPS +IL SNLYSASGRW CSE+VR +M++KGF+K P QSW++  +K H
Sbjct  725   VVKRILAMEPKDPSAYILVSNLYSASGRWHCSEMVREDMRKKGFRKHPSQSWIV-HNKIH  783

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
              F+ARD SH Q+KDIYS L+ILILEC+KAGYVPDTS+VLHEVEE+QKKDFL++HSAKLA 
Sbjct  784   PFYARDKSHPQAKDIYSGLEILILECIKAGYVPDTSFVLHEVEEHQKKDFLYYHSAKLAA  843

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
             TYGLL TK GKP+RV+KNILLCGDCH F K  SIVT+R I+VRD SGFHC  +G+CSC D
Sbjct  844   TYGLLTTKPGKPIRVVKNILLCGDCHAFLKYMSIVTRRAIYVRDASGFHCISSGQCSCKD  903

Query  2276  RW  2271
              W
Sbjct  904   YW  905


 Score =   121 bits (303),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 115/465 (25%), Positives = 200/465 (43%), Gaps = 66/465 (14%)
 Frame = -3

Query  4403  YSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDN  4224
             +  + LL    R  + EL   VHA ++KL   + T++ NAL+  Y K G +     +F +
Sbjct  96    HHLIHLLRLSARHGDRELARAVHASILKLQ--EDTHLGNALISAYLKLGLVSDAHLVFLS  153

Query  4223  LPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRR  4047
             L   ++ S+ T++SG  K      A ELF  M RN  +  +  +   +L AC     +  
Sbjct  154   LSCPNVVSFTTLVSGFSKAGREEEAVELFFRM-RNSGIMPNEYSFVAILTACIRVLELDL  212

Query  4046  GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYME  3867
             G ++HA  +++GY   + V+NAL+  Y +C  +  V+ LF ++  RD+ + N ++++  +
Sbjct  213   GLQVHALVVKLGYLDYVFVSNALMGLYGKCCCLDYVLKLFHQLPERDSASLNTVMSSLAK  272

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSI  3687
               + D A ELF  L                Q  EG                   FT++++
Sbjct  273   EFMYDEAFELFREL----------------QQTEGFGV--------------DHFTVSTL  302

Query  3686  ANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP----  3519
               AC      +  K++H   +K G E N  +  AL+     CG +     +F RMP    
Sbjct  303   LTACSGSNALREGKEVHAHAIKIGLEANLSVSNALIRFYAVCGSVNGVNALFARMPVKDV  362

Query  3518  -------------------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLE  3414
                                      +     V+  ++L G+ +NG+   A+ LF +   E
Sbjct  363   ITWTEMITAYMKFGLVDLAIKMFDNMPEQNSVSHNAVLAGFCRNGEGLGALDLFTKMLKE  422

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDN  3234
             G+ + D   T+ V+  C  L   K  E +H   +K  F S+  +  A++ MY +CG + +
Sbjct  423   GMEMTDFTLTS-VVNACALLRDCKTSEQIHGFIIKFDFGSNACIEAALLDMYTRCGRMTD  481

Query  3233  AVKAFELMSSRDLCS--WNSLLAGYVLHRRGDEALDTWSRMERLG  3105
             A K F    +    S    S++ GY  + + DEA+  +   +  G
Sbjct  482   AKKLFHRWPAEQDSSVLLTSMIGGYSRNGQLDEAISLFHHHQSEG  526


 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 145/316 (46%), Gaps = 33/316 (10%)
 Frame = -3

Query  3917  LVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFY  3738
             L  D    N +I+AY++ GLV  A  +F  L   N V +  +++GF + G   +A+  F+
Sbjct  124   LQEDTHLGNALISAYLKLGLVSDAHLVFLSLSCPNVVSFTTLVSGFSKAGREEEAVELFF  183

Query  3737  RMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG  3558
             RM    I  ++++  +I  AC  ++E     Q+H  ++K G      +  AL+ +  +C 
Sbjct  184   RMRNSGIMPNEYSFVAILTACIRVLELDLGLQVHALVVKLGYLDYVFVSNALMGLYGKCC  243

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAt  3378
              ++   K+FH++P       +L +++   A+    + A  LF E Q      VD    +T
Sbjct  244   CLDYVLKLFHQLP--ERDSASLNTVMSSLAKEFMYDEAFELFRELQQTEGFGVDHFTVST  301

Query  3377  vlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRD  3198
             +L  C     L+ G+ +H  A+K G  +++ V NA+I  YA CG ++     F  M  +D
Sbjct  302   LLTACSGSNALREGKEVHAHAIKIGLEANLSVSNALIRFYAVCGSVNGVNALFARMPVKD  361

Query  3197  LCSW-------------------------------NSLLAGYVLHRRGDEALDTWSRMER  3111
             + +W                               N++LAG+  +  G  ALD +++M +
Sbjct  362   VITWTEMITAYMKFGLVDLAIKMFDNMPEQNSVSHNAVLAGFCRNGEGLGALDLFTKMLK  421

Query  3110  LGIVPDSFTCLHILSA  3063
              G+    FT   +++A
Sbjct  422   EGMEMTDFTLTSVVNA  437


 Score = 77.0 bits (188),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LKL+EDT L NALISAYLKLGLV  A  VF SLS P       ++SGF+K  RE E
Sbjct  118   HASILKLQEDTHLGNALISAYLKLGLVSDAHLVFLSLSCPNVVSFTTLVSGFSKAGREEE  177

Query  4461  AVELFYEMR  4435
             AVELF+ MR
Sbjct  178   AVELFFRMR  186



>ref|XP_006430347.1| hypothetical protein CICLE_v10011036mg [Citrus clementina]
 gb|ESR43587.1| hypothetical protein CICLE_v10011036mg [Citrus clementina]
Length=893

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/723 (62%), Positives = 566/723 (78%), Gaps = 2/723 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG-  4257
             +R  GI PNE+SFVA+LTACIR   LELGFQ+HAL++K+G +DS +V NALMGLY K   
Sbjct  171   MRSEGIVPNEHSFVAILTACIRVLELELGFQIHALIVKMGCVDSVFVANALMGLYGKFSF  230

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              LD+V++LFD LP +D  SWNT+IS +V E  + +AFELF+DM+R++   +DY T+STLL
Sbjct  231   CLDYVLKLFDELPHKDTVSWNTVISSVVNEFEYEKAFELFHDMKRDNGFIVDYFTISTLL  290

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              AC+ CF +  G+ +HAHA+RIG E+NLSVNNALI FYT+CG +K V+ALFERM V D  
Sbjct  291   TACTGCFALMEGRAVHAHAIRIGLEANLSVNNALIGFYTKCGRVKDVVALFERMPVMDII  350

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             T  EMI AYME G VDLA E+FD +PEKN+V YNA+LAG+C+NG+ ++A+  F ++++E 
Sbjct  351   TLTEMIIAYMEFGYVDLAMEIFDKMPEKNSVSYNALLAGYCKNGKAMEALGLFVKLLEEG  410

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +  ++FTLTS+ NACGL+ME K S+QIHGF++K G   NDCIEAALLDM TRCGRM DAE
Sbjct  411   LVLTEFTLTSVVNACGLIMEAKLSEQIHGFVMKFGLGSNDCIEAALLDMLTRCGRMADAE  470

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             K+F+R P      +  TSM+ GYA++G+PE+AI LF  +Q E  VV DE+A  +VLGVCG
Sbjct  471   KMFYRWPTDRDDSIFWTSMICGYARSGKPEHAILLFHRSQSEATVVPDEIALTSVLGVCG  530

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG  ++G+ +H  ALK GF SD+ V N+ +SMY KC  + NA+KAF  M S D+ SWN 
Sbjct  531   TLGFHEMGKQIHSYALKTGFSSDLGVANSTVSMYFKCCNMSNAIKAFNKMPSHDIVSWNG  590

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L+AG++LHR+GDEAL  WS ME+  I PD+ T + I+SAYR+T  N+V+ C+  F SM++
Sbjct  591   LIAGHLLHRQGDEALAVWSSMEKASIKPDAITFVLIISAYRYTNSNLVDSCRKLFLSMKT  650

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y + P S+HYA LVSVLGYWG LEEAEETIN MPF+PK SVWRALLDSC + LN++IGK
Sbjct  651   IYNIEPTSEHYASLVSVLGYWGFLEEAEETINNMPFQPKVSVWRALLDSCRIRLNTTIGK  710

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             RV K ILSMEPQDP+T+IL SNLYS+SGRW  SELVR +M+EKGF+K P +SW+I Q+K 
Sbjct  711   RVAKHILSMEPQDPATYILVSNLYSSSGRWHNSELVREDMREKGFRKHPSRSWIIHQNKV  770

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSF+ RD SH Q KDIYS L+ILILEC+KAGYVPDTS+VLHEVEE+QKKDFLF+HSAKLA
Sbjct  771   HSFYVRDKSHPQEKDIYSGLEILILECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSAKLA  830

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
              TYGLL T  G+PVR++KNIL CGDCH+F K  S+VT+REI +RD SGFH FLNG+CSC 
Sbjct  831   ATYGLLTTPAGQPVRIVKNILTCGDCHSFLKYVSVVTRREIFLRDASGFHHFLNGQCSCK  890

Query  2279  DRW  2271
             D W
Sbjct  891   DYW  893


 Score =   124 bits (311),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 115/478 (24%), Positives = 207/478 (43%), Gaps = 66/478 (14%)
 Frame = -3

Query  4400  SFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNL  4221
             SF   L   ++   + L   +HA +IKL     T   N L+  Y K G +    ++F  L
Sbjct  81    SFFNSLRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAYLKLGHVSDAYKIFYGL  140

Query  4220  PKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRG  4044
                ++ S+ ++ISG+ K      A ELF  M R++ +  +  +   +L AC     +  G
Sbjct  141   SSPNVVSFTSLISGLAKLGREEEAIELFFRM-RSEGIVPNEHSFVAILTACIRVLELELG  199

Query  4043  QELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNEMITAYME  3867
              ++HA  +++G   ++ V NAL+  Y +    +  V+ LF+ +  +D  +WN +I++ + 
Sbjct  200   FQIHALIVKMGCVDSVFVANALMGLYGKFSFCLDYVLKLFDELPHKDTVSWNTVISSVVN  259

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSI  3687
                 + A ELF  +   N  + +                               FT++++
Sbjct  260   EFEYEKAFELFHDMKRDNGFIVDY------------------------------FTISTL  289

Query  3686  ANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPL---  3516
               AC         + +H   ++ G E N  +  AL+   T+CGR++D   +F RMP+   
Sbjct  290   LTACTGCFALMEGRAVHAHAIRIGLEANLSVNNALIGFYTKCGRVKDVVALFERMPVMDI  349

Query  3515  -------------GHGRL-------------VALTSMLRGYAQNGQPENAISLFFETQLE  3414
                          G+  L             V+  ++L GY +NG+   A+ LF +   E
Sbjct  350   ITLTEMIIAYMEFGYVDLAMEIFDKMPEKNSVSYNALLAGYCKNGKAMEALGLFVKLLEE  409

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDN  3234
             GLV+ +   T+ V+  CG +   KL E +H   +K G  S+  +  A++ M  +CG + +
Sbjct  410   GLVLTEFTLTS-VVNACGLIMEAKLSEQIHGFVMKFGLGSNDCIEAALLDMLTRCGRMAD  468

Query  3233  AVKAFELMSS--RDLCSWNSLLAGYVLHRRGDEALDTWSRME-RLGIVPDSFTCLHIL  3069
             A K F    +   D   W S++ GY    + + A+  + R +    +VPD      +L
Sbjct  469   AEKMFYRWPTDRDDSIFWTSMICGYARSGKPEHAILLFHRSQSEATVVPDEIALTSVL  526


 Score =   102 bits (255),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 87/341 (26%), Positives = 158/341 (46%), Gaps = 38/341 (11%)
 Frame = -3

Query  3977  IKFYTRCGSI---KSVMA-LFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNA  3810
             ++   +CG +   K++ A L + +L +D    N +I+AY++ G V  A ++F  L   N 
Sbjct  86    LRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAYLKLGHVSDAYKIFYGLSSPNV  145

Query  3809  VLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGF  3630
             V + ++++G  + G   +A+  F+RM  E I  ++ +  +I  AC  ++E +   QIH  
Sbjct  146   VSFTSLISGLAKLGREEEAIELFFRMRSEGIVPNEHSFVAILTACIRVLELELGFQIHAL  205

Query  3629  ILKSGCEPNDCIEAALLDMCTRCGRMED-AEKIFHRMPLGHGRLVALTSMLRGYAQNGQP  3453
             I+K GC  +  +  AL+ +  +     D   K+F  +P  H   V+  +++       + 
Sbjct  206   IVKMGCVDSVFVANALMGLYGKFSFCLDYVLKLFDELP--HKDTVSWNTVISSVVNEFEY  263

Query  3452  ENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNA  3273
             E A  LF + + +   +VD    +T+L  C     L  G  +H  A++ G  +++ V NA
Sbjct  264   EKAFELFHDMKRDNGFIVDYFTISTLLTACTGCFALMEGRAVHAHAIRIGLEANLSVNNA  323

Query  3272  VISMYAKCGELDNAVKAFELMSSRDL-------------------------------CSW  3186
             +I  Y KCG + + V  FE M   D+                                S+
Sbjct  324   LIGFYTKCGRVKDVVALFERMPVMDIITLTEMIIAYMEFGYVDLAMEIFDKMPEKNSVSY  383

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
             N+LLAGY  + +  EAL  + ++   G+V   FT   +++A
Sbjct  384   NALLAGYCKNGKAMEALGLFVKLLEEGLVLTEFTLTSVVNA  424


 Score = 69.3 bits (168),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 6/67 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVEL  4450
             L LE+DTR  N LISAYLKLG V  A  +F  LSSP      ++ISG AK+ RE EA+EL
Sbjct  108   LLLEQDTRFGNPLISAYLKLGHVSDAYKIFYGLSSPNVVSFTSLISGLAKLGREEEAIEL  167

Query  4449  FYEMRLE  4429
             F+ MR E
Sbjct  168   FFRMRSE  174



>emb|CDP15329.1| unnamed protein product [Coffea canephora]
Length=905

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/725 (63%), Positives = 563/725 (78%), Gaps = 3/725 (0%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++RGSGIEPNE+SFVALLTACIR  NLELG QVHA ++KL +L STYVVNALMGLYS CG
Sbjct  181   EMRGSGIEPNEHSFVALLTACIRLLNLELGLQVHAFVLKLDFLGSTYVVNALMGLYSNCG  240

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+FVIELF ++  RDI SWNT+IS +VK+ M   AFE F DM R D  R+DY T+S+LL
Sbjct  241   CLNFVIELFYDMLVRDIVSWNTVISSLVKKGMCDEAFESFRDMLRIDGFRVDYFTISSLL  300

Query  4076  NAC---SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
              +        M  G E+HA A+++G+ESNLSVNNALI+FYT+ GS++ V  LFERM  +D
Sbjct  301   ASAAAAGRSGMTEGGEIHACAIKLGFESNLSVNNALIRFYTKRGSVEDVKVLFERMPEKD  360

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
              FTW EMITAYME GLVDLA + FD +P++    YNA+LAG+C+N +GL+A+  F  M++
Sbjct  361   VFTWTEMITAYMEFGLVDLAVQTFDMMPDRTCESYNALLAGYCRNNKGLRALNLFCDMVE  420

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMED  3546
             E IE +DFTLTS  NACG +M++ +S+QIH FILK GC  N  +EAALLDMCT C RM D
Sbjct  421   EGIELNDFTLTSAINACGSVMQKSTSEQIHAFILKFGCARNSHVEAALLDMCTWCERMAD  480

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             AE IF R P    R + LT+M+ GYA+N Q + AISLF + Q E   V+DEV   T+L +
Sbjct  481   AENIFLRWPKDWERTIVLTAMICGYARNRQLDQAISLFCQGQSEESFVLDEVVATTMLSI  540

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW  3186
             CG LG  K GE LHC ++K+G LSD  + NA ISMYAKCG ++ A+K F+ M   D  SW
Sbjct  541   CGLLGFCKFGEQLHCFSIKYGLLSDTKMANATISMYAKCGRMEAAIKVFDAMLVHDTVSW  600

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             NSLLAG+VLHR+GDEAL  W +ME LG+ PD+ TCL I+SAYR+T  ++++ C  FF SM
Sbjct  601   NSLLAGHVLHRQGDEALAVWMKMESLGVQPDTVTCLFIISAYRYTGSDLIDCCHRFFSSM  660

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSI  2826
             +S Y + P S+HYA LV VLG+WGLL+EAE  I  MPF PK++ WRALLDSC +H N++I
Sbjct  661   ESRYQIKPTSEHYANLVGVLGHWGLLKEAEAIILKMPFVPKAAAWRALLDSCRVHQNAAI  720

Query  2825  GKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQH  2646
             GKRV K+IL +EPQDPS FILKSNLYSASGRW CS+ VR +M+EKG +K PGQSW+I Q+
Sbjct  721   GKRVAKEILHVEPQDPSMFILKSNLYSASGRWHCSDTVREKMREKGLRKFPGQSWIIHQN  780

Query  2645  KFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAK  2466
             + HSFFARDTSH QSKDIYS L IL+LEC+KAGYVPDTS+VLHE EE+QKKDFLF+HSAK
Sbjct  781   RIHSFFARDTSHPQSKDIYSGLQILLLECLKAGYVPDTSFVLHEAEEHQKKDFLFYHSAK  840

Query  2465  LALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCS  2286
             LA+T+GLLMTK GKPVR+ KNILLCGDCHTFFK+ S+VTKREI+VRD+SGFHCF NGKCS
Sbjct  841   LAMTFGLLMTKPGKPVRIFKNILLCGDCHTFFKNVSVVTKREIYVRDSSGFHCFSNGKCS  900

Query  2285  CNDRW  2271
             C D+W
Sbjct  901   CKDQW  905


 Score =   132 bits (332),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 153/622 (25%), Positives = 268/622 (43%), Gaps = 90/622 (14%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             + +  N+YS + LL+A  R  ++EL   VHA + K  + + TY+ NAL+  Y K G +DF
Sbjct  88    TDLPSNDYSHLLLLSA--RYGDVELAKAVHASIFK--HEEDTYLSNALIVAYLKLGRIDF  143

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
                +F N+   D+ S+  +IS + K +    A ELF +M R   +  +  +   LL AC 
Sbjct  144   AHRVFKNMSSPDVVSYTALISDLAKSNRENEAIELFLEM-RGSGIEPNEHSFVALLTACI  202

Query  4064  ECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
                 +  G ++HA  L++ +  +  V NAL+  Y+ CG +  V+ LF  MLVRD  +WN 
Sbjct  203   RLLNLELGLQVHAFVLKLDFLGSTYVVNALMGLYSNCGCLNFVIELFYDMLVRDIVSWNT  262

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             +I++ ++ G+ D A E F  +   +                        +R+   +I   
Sbjct  263   VISSLVKKGMCDEAFESFRDMLRIDG-----------------------FRVDYFTISSL  299

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
               +  +   + G+        +IH   +K G E N  +  AL+   T+ G +ED + +F 
Sbjct  300   LASAAAAGRS-GM----TEGGEIHACAIKLGFESNLSVNNALIRFYTKRGSVEDVKVLFE  354

Query  3527  RMP----------------LGHGRLVALT-------------SMLRGYAQNGQPENAISL  3435
             RMP                 G   L   T             ++L GY +N +   A++L
Sbjct  355   RMPEKDVFTWTEMITAYMEFGLVDLAVQTFDMMPDRTCESYNALLAGYCRNNKGLRALNL  414

Query  3434  FFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYA  3255
             F +   EG+ + D   T+  +  CG++      E +H   LK G   +  V  A++ M  
Sbjct  415   FCDMVEEGIELNDFTLTS-AINACGSVMQKSTSEQIHAFILKFGCARNSHVEAALLDMCT  473

Query  3254  KCGELDNAVKAFELMSSRDLCSW------NSLLAGYVLHRRGDEALDTWSRMERLGIVPD  3093
              C  + +A   F L   +D   W       +++ GY  +R+ D+A+  + +    G   +
Sbjct  474   WCERMADAENIF-LRWPKD---WERTIVLTAMICGYARNRQLDQAISLFCQ----GQSEE  525

Query  3092  SFTCLHILSAYRHTTKNVVNRC----QSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLE  2925
             SF    +++    +   ++  C    Q   FS++  YG+L  +      +S+    G +E
Sbjct  526   SFVLDEVVATTMLSICGLLGFCKFGEQLHCFSIK--YGLLSDTKMANATISMYAKCGRME  583

Query  2924  EAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQDPST----FILKS  2757
              A +  + M      S W +LL   ++H        V  K+ S+  Q P T    FI+ +
Sbjct  584   AAIKVFDAMLVHDTVS-WNSLLAGHVLHRQGDEALAVWMKMESLGVQ-PDTVTCLFIISA  641

Query  2756  NLYSASGRWQCSELVRAEMKEK  2691
               Y+ S    C     + M+ +
Sbjct  642   YRYTGSDLIDCCHRFFSSMESR  663


 Score = 74.7 bits (182),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 79/148 (53%), Gaps = 30/148 (20%)
 Frame = -2

Query  4803  SAFLSASNPISSLSVIKP-NHKFNPAFLLSNASLSIQEPLL----SSDPLINSSISTYPE  4639
             S+FLS S P +     KP N + +P FL S +    + P L    +S+P I + + +   
Sbjct  41    SSFLSPSKPKT-----KPQNLRLSPQFLPSPSISPSKSPPLDLPLTSEPSIKTDLPSNDY  95

Query  4638  QH----AVDYAD----------FLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP-  4504
              H    +  Y D            K EEDT LSNALI AYLKLG +D+A  VF ++SSP 
Sbjct  96    SHLLLLSARYGDVELAKAVHASIFKHEEDTYLSNALIVAYLKLGRIDFAHRVFKNMSSPD  155

Query  4503  -----AIISGFAKINREIEAVELFYEMR  4435
                  A+IS  AK NRE EA+ELF EMR
Sbjct  156   VVSYTALISDLAKSNRENEAIELFLEMR  183



>ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa]
 gb|EEF05250.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa]
Length=915

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/750 (60%), Positives = 571/750 (76%), Gaps = 3/750 (0%)
 Frame = -3

Query  4511  PPRPSYRVLQKSTVKLKPWSSSMR*--DLRGSGIEPNEYSFVALLTACIRSQNLELGFQV  4338
             P   SY  L  S  KL   + +++    +R SGIEPNEYSFVA+LTACIRS  LE+G QV
Sbjct  166   PDVVSYSALISSFSKLNRETEAIQLFFRMRISGIEPNEYSFVAILTACIRSLELEMGLQV  225

Query  4337  HALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMF  4158
             HAL IKLGY    +V NAL+GLY KCG LD  I LFD +P+RDIASWNTMIS +VK   +
Sbjct  226   HALAIKLGYSQLVFVANALIGLYGKCGCLDHAIHLFDEMPQRDIASWNTMISSLVKGLSY  285

Query  4157  TRAFELFNDMQRNDCLRIDYITLSTLLNACSECFMR-RGQELHAHALRIGYESNLSVNNA  3981
              +A ELF  + +N   + D  TLSTLL AC+ C  R +G+E+HA+A+RIG E+NLSV+NA
Sbjct  286   EKALELFRVLNQNKGFKADQFTLSTLLTACARCHARIQGREIHAYAIRIGLENNLSVSNA  345

Query  3980  LIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLY  3801
             +I FYTRCGS+  V ALFERM VRD  TW EMITAYME GLVDLA ++F+ +PEKN+V Y
Sbjct  346   IIGFYTRCGSLNHVAALFERMPVRDIITWTEMITAYMEFGLVDLAVDMFNKMPEKNSVSY  405

Query  3800  NAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILK  3621
             NA+L GFC+N EGLKA+  F RM++E  E +DFTLT + NACGLL++ + S+QIHGFI+K
Sbjct  406   NALLTGFCKNNEGLKALNLFVRMVQEGAELTDFTLTGVINACGLLLKLEISRQIHGFIIK  465

Query  3620  SGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAI  3441
              G   N CIEAAL+DMC++CGRM+DA+++F  +    G  +  TSM+ GYA+NG PE AI
Sbjct  466   FGFRSNACIEAALIDMCSKCGRMDDADRMFQSLSTDGGNSIIQTSMICGYARNGLPEEAI  525

Query  3440  SLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISM  3261
              LF+  Q EG +V+DEVA  ++LGVCGTLG  ++G+ +HC ALK GF +++ VGN++ISM
Sbjct  526   CLFYRCQSEGTMVLDEVAFTSILGVCGTLGFHEVGKQIHCQALKTGFHAELGVGNSIISM  585

Query  3260  YAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTC  3081
             Y+KC  +D+A+KAF  M   D+ SWN L+AG +LHR+GDEAL  WS ME+ GI PD+ T 
Sbjct  586   YSKCYNIDDAIKAFNTMPGHDVVSWNGLIAGQLLHRQGDEALAIWSSMEKAGIKPDAITF  645

Query  3080  LHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINT  2901
             + I+SAY+ T+ N+++ C+S F SM+  + + P S+HYA LV VLGYWGLLEEAEE IN 
Sbjct  646   VLIVSAYKFTSSNLLDECRSLFLSMKMIHDLEPTSEHYASLVGVLGYWGLLEEAEELINK  705

Query  2900  MPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCS  2721
             MPF+P+ SVWRALLD C +H N+SIGKRV K I+ MEP+DPST++L SNLY+ASGRW CS
Sbjct  706   MPFDPEVSVWRALLDGCRLHANTSIGKRVAKHIIGMEPRDPSTYVLVSNLYAASGRWHCS  765

Query  2720  ELVRAEMKEKGFQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYV  2541
             E+VR  M+++G +K P +SWVI + + H+F+ARD SH QSKDIYS LDILIL+C+KAGY 
Sbjct  766   EMVRENMRDRGLRKHPCRSWVIIKKQLHTFYARDKSHPQSKDIYSGLDILILKCLKAGYE  825

Query  2540  PDTSYVLHEVEEYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSA  2361
             PD S+VL EVEE QKKDFLF+HSAKLA TYGLL T+ G+P+RV+KNILLC DCHTF K A
Sbjct  826   PDMSFVLQEVEEQQKKDFLFYHSAKLAATYGLLKTRPGEPIRVVKNILLCRDCHTFLKYA  885

Query  2360  SIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             ++VT+REI  RD SGFHCF NG+CSC   W
Sbjct  886   TVVTQREIIFRDASGFHCFSNGQCSCKGYW  915


 Score =   149 bits (376),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 145/589 (25%), Positives = 254/589 (43%), Gaps = 88/589 (15%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL   ++  +++L   +HA ++KLG  + T++ NA++  Y K G +    E+F  +   D
Sbjct  110   LLRLSVKYTDIDLARALHASILKLG--EDTHLGNAVIAAYIKLGLVVDAYEVFMGMSTPD  167

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S++ +IS   K +  T A +LF  M+ +     +Y +   +L AC     +  G ++H
Sbjct  168   VVSYSALISSFSKLNRETEAIQLFFRMRISGIEPNEY-SFVAILTACIRSLELEMGLQVH  226

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
             A A+++GY   + V NALI  Y +CG +   + LF+ M  RD  +WN MI++ ++    +
Sbjct  227   ALAIKLGYSQLVFVANALIGLYGKCGCLDHAIHLFDEMPQRDIASWNTMISSLVKGLSYE  286

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A ELF  L +                 +G KA                FTL+++  AC 
Sbjct  287   KALELFRVLNQN----------------KGFKA--------------DQFTLSTLLTACA  316

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP---------  3519
                 R   ++IH + ++ G E N  +  A++   TRCG +     +F RMP         
Sbjct  317   RCHARIQGREIHAYAIRIGLENNLSVSNAIIGFYTRCGSLNHVAALFERMPVRDIITWTE  376

Query  3518  --------------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                                 +     V+  ++L G+ +N +   A++LF     EG  + 
Sbjct  377   MITAYMEFGLVDLAVDMFNKMPEKNSVSYNALLTGFCKNNEGLKALNLFVRMVQEGAELT  436

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
             D   T  +      L L    + +H   +K GF S+  +  A+I M +KCG +D+A + F
Sbjct  437   DFTLTGVINACGLLLKLEISRQ-IHGFIIKFGFRSNACIEAALIDMCSKCGRMDDADRMF  495

Query  3218  ELMSSRDLCS--WNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILS-----A  3063
             + +S+    S    S++ GY  +   +EA+  + R +  G +V D      IL       
Sbjct  496   QSLSTDGGNSIIQTSMICGYARNGLPEEAICLFYRCQSEGTMVLDEVAFTSILGVCGTLG  555

Query  3062  YRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPK  2883
             +    K +   CQ+      +  GV  +      ++S+      +++A +  NTMP    
Sbjct  556   FHEVGKQI--HCQALKTGFHAELGVGNS------IISMYSKCYNIDDAIKAFNTMPGHDV  607

Query  2882  SSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQ----DPSTFILKSNLY  2748
              S W  L+   ++H     G   +    SME      D  TF+L  + Y
Sbjct  608   VS-WNGLIAGQLLHRQ---GDEALAIWSSMEKAGIKPDAITFVLIVSAY  652


 Score = 73.6 bits (179),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 6/70 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LKL EDT L NA+I+AY+KLGLV  A  VF  +S+P      A+IS F+K+NRE E
Sbjct  127   HASILKLGEDTHLGNAVIAAYIKLGLVVDAYEVFMGMSTPDVVSYSALISSFSKLNRETE  186

Query  4461  AVELFYEMRL  4432
             A++LF+ MR+
Sbjct  187   AIQLFFRMRI  196



>ref|XP_010098867.1| hypothetical protein L484_022634 [Morus notabilis]
 gb|EXB75955.1| hypothetical protein L484_022634 [Morus notabilis]
Length=911

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/722 (61%), Positives = 570/722 (79%), Gaps = 1/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R  GIEPNEY FVA+LTACIR   LE G QVHAL+IKLG+LD  +V NAL+G+Y KCG 
Sbjct  190   MRRLGIEPNEYGFVAILTACIRVLELEFGSQVHALVIKLGFLDCVFVGNALLGVYGKCGC  249

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LDF +++FD +P+RD+ASWN+ IS  VK  ++  A ELF +MQR+D  R+D+ T+STLL 
Sbjct  250   LDFALKMFDEMPQRDLASWNSAISSAVKMGLYGEALELFCEMQRSDGFRVDFFTVSTLLT  309

Query  4073  ACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             AC+ C  + +G+E+HAHAL+ G ESNLSV N+LI FYT+CG ++ V ALF +M VRD  T
Sbjct  310   ACAGCNALAQGKEVHAHALKCGLESNLSVGNSLIGFYTKCGGVEDVKALFLKMPVRDVIT  369

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EMITAYME GLVD A E F  + E+N++  NA+LAGFC+NGEGL+A+  F  +++  +
Sbjct  370   WTEMITAYMEFGLVDSALEAFAKMSERNSISCNALLAGFCKNGEGLRALELFVGVVRGRM  429

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E SDFTLTS  NACGLL ++K S+QIHGF+LKSGC  N CIE+ALLDMCTRCGRM DAEK
Sbjct  430   ELSDFTLTSAVNACGLLGDKKVSEQIHGFVLKSGCGSNSCIESALLDMCTRCGRMPDAEK  489

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F + P+     V LTSM+ GYA+NG+ E+A+ LF  +QLEG +V+DEVA  +VLG+CG+
Sbjct  490   LFLQWPIDWDVSVVLTSMICGYARNGRLEDAVYLFVMSQLEGTMVLDEVALTSVLGICGS  549

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             L   ++G+ +HC ALK GF SD+ VGNA++SMYAKC  +++AV  F+ +++RD+ SWN L
Sbjct  550   LAFHEMGKQIHCYALKSGFSSDLGVGNAMVSMYAKCWNMEDAVNVFDSLAARDVVSWNGL  609

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             +AG++LHR+GD+AL  WS M+  GI PD+ T   ++SAYRHT  N+V  C+SF++S+   
Sbjct  610   IAGHLLHRQGDKALAVWSEMKNAGIKPDNVTFTLVISAYRHTNFNLVKDCRSFYYSLDLD  669

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             YG+ P S+H A  V VLGYWGLLEEAEE +  +PFEP++SV RALLDS  + LN++IGKR
Sbjct  670   YGIEPTSEHLASFVGVLGYWGLLEEAEEMVYKLPFEPEASVLRALLDSSRIRLNTAIGKR  729

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V K+IL+M+P+D S++IL SNLYSASGRW C+E VR +M+EKGF+K PGQSW++ ++K H
Sbjct  730   VAKRILAMQPKDLSSYILVSNLYSASGRWHCAETVREDMREKGFKKHPGQSWIVHENKIH  789

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
             +F+ARD SH Q+KDIYSAL+ILILEC+KAGYVPDTS+VLHEVEE QKK+FLF+HSAKLA 
Sbjct  790   AFYARDKSHPQAKDIYSALEILILECLKAGYVPDTSFVLHEVEEQQKKNFLFYHSAKLAA  849

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
             TYG+L  K GKPVR++KNI LCGDCHTFFK  SIVT+R+I +RDTSGFHCF +G+CSC D
Sbjct  850   TYGVLTAKPGKPVRIVKNIALCGDCHTFFKYVSIVTRRDIFLRDTSGFHCFSSGQCSCKD  909

Query  2276  RW  2271
              W
Sbjct  910   YW  911


 Score =   132 bits (331),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 109/420 (26%), Positives = 189/420 (45%), Gaps = 64/420 (15%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL   +R  ++EL   VHA ++KLG  +  Y+ N+L+  Y K G +    E+F  +   D
Sbjct  106   LLQLSVRYNDVELAKAVHASVVKLG--EDVYLGNSLISAYLKLGFVSEAYEVFMAMASPD  163

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  MISG  K      A ELF  M+R      +Y     +L AC     +  G ++H
Sbjct  164   LVSYTAMISGFSKSGREDEAVELFFRMRRLGIEPNEY-GFVAILTACIRVLELEFGSQVH  222

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
             A  +++G+   + V NAL+  Y +CG +   + +F+ M  RD  +WN  I++ ++ GL  
Sbjct  223   ALVIKLGFLDCVFVGNALLGVYGKCGCLDFALKMFDEMPQRDLASWNSAISSAVKMGLYG  282

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A ELF  +                Q  +G +            ++F  FT++++  AC 
Sbjct  283   EALELFCEM----------------QRSDGFR------------VDF--FTVSTLLTACA  312

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP---------  3519
                     K++H   LK G E N  +  +L+   T+CG +ED + +F +MP         
Sbjct  313   GCNALAQGKEVHAHALKCGLESNLSVGNSLIGFYTKCGGVEDVKALFLKMPVRDVITWTE  372

Query  3518  --------------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                                 +     ++  ++L G+ +NG+   A+ LF    + G + +
Sbjct  373   MITAYMEFGLVDSALEAFAKMSERNSISCNALLAGFCKNGEGLRALELFVGV-VRGRMEL  431

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
              +    + +  CG LG  K+ E +H   LK G  S+  + +A++ M  +CG + +A K F
Sbjct  432   SDFTLTSAVNACGLLGDKKVSEQIHGFVLKSGCGSNSCIESALLDMCTRCGRMPDAEKLF  491


 Score =   119 bits (299),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 174/363 (48%), Gaps = 20/363 (6%)
 Frame = -3

Query  3917  LVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFY  3738
             L  D +  N +I+AY++ G V  A E+F  +   + V Y A+++GF ++G   +A+  F+
Sbjct  129   LGEDVYLGNSLISAYLKLGFVSEAYEVFMAMASPDLVSYTAMISGFSKSGREDEAVELFF  188

Query  3737  RMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG  3558
             RM +  IE +++   +I  AC  ++E +   Q+H  ++K G      +  ALL +  +CG
Sbjct  189   RMRRLGIEPNEYGFVAILTACIRVLELEFGSQVHALVIKLGFLDCVFVGNALLGVYGKCG  248

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAt  3378
              ++ A K+F  MP     L +  S +    + G    A+ LF E Q      VD    +T
Sbjct  249   CLDFALKMFDEMP--QRDLASWNSAISSAVKMGLYGEALELFCEMQRSDGFRVDFFTVST  306

Query  3377  vlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRD  3198
             +L  C     L  G+ +H  ALK G  S++ VGN++I  Y KCG +++    F  M  RD
Sbjct  307   LLTACAGCNALAQGKEVHAHALKCGLESNLSVGNSLIGFYTKCGGVEDVKALFLKMPVRD  366

Query  3197  LCSWNSLLAGYVLHRRGDEALDTWSRM-ERLGIVPDSFTCLHILSAYRHTTKNVVNRCQS  3021
             + +W  ++  Y+     D AL+ +++M ER     +S +C  +L+ +    + +  R   
Sbjct  367   VITWTEMITAYMEFGLVDSALEAFAKMSER-----NSISCNALLAGFCKNGEGL--RALE  419

Query  3020  FFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSS------VWRALL  2859
              F  +    G +  SD    L S +   GLL + + +     F  KS       +  ALL
Sbjct  420   LFVGV--VRGRMELSDF--TLTSAVNACGLLGDKKVSEQIHGFVLKSGCGSNSCIESALL  475

Query  2858  DSC  2850
             D C
Sbjct  476   DMC  478


 Score = 69.7 bits (169),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  +KL ED  L N+LISAYLKLG V  A  VF +++SP      A+ISGF+K  RE E
Sbjct  123   HASVVKLGEDVYLGNSLISAYLKLGFVSEAYEVFMAMASPDLVSYTAMISGFSKSGREDE  182

Query  4461  AVELFYEMR  4435
             AVELF+ MR
Sbjct  183   AVELFFRMR  191



>gb|KDO60991.1| hypothetical protein CISIN_1g040319mg, partial [Citrus sinensis]
Length=812

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/723 (61%), Positives = 565/723 (78%), Gaps = 2/723 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG-  4257
             +R  GI PNE+SFVA+LTACIR   LELGFQ+HAL++K+G +DS +V NALMGLY K   
Sbjct  90    MRSEGIVPNEHSFVAILTACIRLLELELGFQIHALIVKMGCVDSVFVTNALMGLYGKFSF  149

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              LD++++LFD LP +D  SWNT+IS +V E  + +AFELF DM+R++   +DY T+STLL
Sbjct  150   CLDYLLKLFDELPHKDTVSWNTVISSVVNEFEYEKAFELFRDMKRDNGFTVDYFTISTLL  209

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              AC+ CF +  G+ +HAHA+RIG  +NLSVNNALI FYT+CG +K V+AL ERM V D  
Sbjct  210   TACTGCFVLMEGRAVHAHAIRIGLGANLSVNNALIGFYTKCGRVKDVVALLERMPVMDII  269

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             T  E+I AYME G VDLA E+FD +PEKN+V YNA+LAG+C+NG+ ++A+  F ++++E 
Sbjct  270   TLTEIIIAYMEFGYVDLAVEIFDKMPEKNSVSYNALLAGYCKNGKAMEALGLFVKLLEEG  329

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +  ++FTLTS+ NACGL+ME K S+QIHGF++K G   NDCIEAALLDM TRCGRM DAE
Sbjct  330   LVLTEFTLTSVVNACGLIMEAKLSEQIHGFVMKFGLGSNDCIEAALLDMLTRCGRMADAE  389

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             K+F+R P      +  TSM+ GYA++G+PE+AI LF ++Q E  VV DE+A  +VLGVCG
Sbjct  390   KMFYRWPTDRDDSIIWTSMICGYARSGKPEHAILLFHQSQSEATVVPDEIALTSVLGVCG  449

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG  ++G+ +H  ALK GF SD+ V N+++SMY KC  + NA+KAF  M S D+ SWN 
Sbjct  450   TLGFHEMGKQIHSYALKTGFSSDLGVANSMVSMYFKCCNMSNAIKAFNKMPSHDIVSWNG  509

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L+AG++LHR+GDEAL  WS ME+  I PD+ T + I+SAYR+T  N+V+ C+  F SM++
Sbjct  510   LIAGHLLHRQGDEALAVWSSMEKASIKPDAITFVLIISAYRYTNLNLVDSCRKLFLSMKT  569

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y + P S+HYA LVSVLGYWG LEEAEETIN MPF+PK SVWRALLDSC + LN++IGK
Sbjct  570   IYNIEPTSEHYASLVSVLGYWGFLEEAEETINNMPFQPKVSVWRALLDSCRIRLNTTIGK  629

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             RV K IL+MEPQDP+T+IL SNLYS+SGRW  SELVR +M+EKGF+K P +SW+I Q+K 
Sbjct  630   RVAKHILAMEPQDPATYILVSNLYSSSGRWHNSELVREDMREKGFRKHPSRSWIIHQNKV  689

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSF+ RD SH + KDIYS L+ILILEC+KAGYVPDTS+VLHEVEE+QKKDFLF+HSAKLA
Sbjct  690   HSFYVRDKSHPREKDIYSGLEILILECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSAKLA  749

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
              TYGLL T  G+PVR++KNIL CGDCH+F K  S+VT+REI +RD SGFH FLNG+CSC 
Sbjct  750   ATYGLLTTPAGQPVRIVKNILTCGDCHSFLKYVSVVTRREIFLRDASGFHHFLNGQCSCK  809

Query  2279  DRW  2271
             D W
Sbjct  810   DYW  812


 Score =   114 bits (286),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 115/477 (24%), Positives = 207/477 (43%), Gaps = 66/477 (14%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             F   L   ++   + L   +HA +IKL     T   N L+  Y K G +    ++F  L 
Sbjct  1     FFNSLRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAYLKLGHVADAYKIFYGLS  60

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQ  4041
               ++ S+ ++ISG+ K      A ELF  M R++ +  +  +   +L AC     +  G 
Sbjct  61    SPNVVSFTSLISGLAKLGREEEAIELFFRM-RSEGIVPNEHSFVAILTACIRLLELELGF  119

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNEMITAYMES  3864
             ++HA  +++G   ++ V NAL+  Y +    +  ++ LF+ +  +D  +WN +I++ +  
Sbjct  120   QIHALIVKMGCVDSVFVTNALMGLYGKFSFCLDYLLKLFDELPHKDTVSWNTVISSVVNE  179

Query  3863  GLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIA  3684
                + A ELF  +   N         GF  +                   F+  TL +  
Sbjct  180   FEYEKAFELFRDMKRDN---------GFTVD------------------YFTISTLLTAC  212

Query  3683  NACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPL----  3516
               C +LME    + +H   ++ G   N  +  AL+   T+CGR++D   +  RMP+    
Sbjct  213   TGCFVLME---GRAVHAHAIRIGLGANLSVNNALIGFYTKCGRVKDVVALLERMPVMDII  269

Query  3515  ------------GHGRL-------------VALTSMLRGYAQNGQPENAISLFFETQLEG  3411
                         G+  L             V+  ++L GY +NG+   A+ LF +   EG
Sbjct  270   TLTEIIIAYMEFGYVDLAVEIFDKMPEKNSVSYNALLAGYCKNGKAMEALGLFVKLLEEG  329

Query  3410  LVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNA  3231
             LV+ +   T+ V+  CG +   KL E +H   +K G  S+  +  A++ M  +CG + +A
Sbjct  330   LVLTEFTLTS-VVNACGLIMEAKLSEQIHGFVMKFGLGSNDCIEAALLDMLTRCGRMADA  388

Query  3230  VKAFELMSS--RDLCSWNSLLAGYVLHRRGDEALDTWSRME-RLGIVPDSFTCLHIL  3069
              K F    +   D   W S++ GY    + + A+  + + +    +VPD      +L
Sbjct  389   EKMFYRWPTDRDDSIIWTSMICGYARSGKPEHAILLFHQSQSEATVVPDEIALTSVL  445


 Score =   100 bits (250),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 88/341 (26%), Positives = 160/341 (47%), Gaps = 38/341 (11%)
 Frame = -3

Query  3977  IKFYTRCGSI---KSVMA-LFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNA  3810
             ++   +CG +   K++ A L + +L +D    N +I+AY++ G V  A ++F  L   N 
Sbjct  5     LRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAYLKLGHVADAYKIFYGLSSPNV  64

Query  3809  VLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGF  3630
             V + ++++G  + G   +A+  F+RM  E I  ++ +  +I  AC  L+E +   QIH  
Sbjct  65    VSFTSLISGLAKLGREEEAIELFFRMRSEGIVPNEHSFVAILTACIRLLELELGFQIHAL  124

Query  3629  ILKSGCEPNDCIEAALLDMCTRCGRMED-AEKIFHRMPLGHGRLVALTSMLRGYAQNGQP  3453
             I+K GC  +  +  AL+ +  +     D   K+F  +P  H   V+  +++       + 
Sbjct  125   IVKMGCVDSVFVTNALMGLYGKFSFCLDYLLKLFDELP--HKDTVSWNTVISSVVNEFEY  182

Query  3452  ENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNA  3273
             E A  LF + + +    VD    +T+L  C    +L  G  +H  A++ G  +++ V NA
Sbjct  183   EKAFELFRDMKRDNGFTVDYFTISTLLTACTGCFVLMEGRAVHAHAIRIGLGANLSVNNA  242

Query  3272  VISMYAKCGE-------------------------------LDNAVKAFELMSSRDLCSW  3186
             +I  Y KCG                                +D AV+ F+ M  ++  S+
Sbjct  243   LIGFYTKCGRVKDVVALLERMPVMDIITLTEIIIAYMEFGYVDLAVEIFDKMPEKNSVSY  302

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
             N+LLAGY  + +  EAL  + ++   G+V   FT   +++A
Sbjct  303   NALLAGYCKNGKAMEALGLFVKLLEEGLVLTEFTLTSVVNA  343


 Score = 68.6 bits (166),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 6/67 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVEL  4450
             L LE+DTR  N LISAYLKLG V  A  +F  LSSP      ++ISG AK+ RE EA+EL
Sbjct  27    LLLEQDTRFGNPLISAYLKLGHVADAYKIFYGLSSPNVVSFTSLISGLAKLGREEEAIEL  86

Query  4449  FYEMRLE  4429
             F+ MR E
Sbjct  87    FFRMRSE  93



>ref|XP_006481930.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Citrus sinensis]
Length=893

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/723 (61%), Positives = 564/723 (78%), Gaps = 2/723 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG-  4257
             +R  GI PNE+SFVA+LTACIR   LELGFQ+HAL++K+G +DS +V NALMGLY K   
Sbjct  171   MRSEGIVPNEHSFVAILTACIRLLELELGFQIHALIVKMGCVDSVFVTNALMGLYGKFSF  230

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              LD++++LFD LP +D  SWNT+IS +V E  + +AFELF DM+R++   +DY T+STLL
Sbjct  231   CLDYLLKLFDELPHKDTVSWNTVISSVVNEFEYEKAFELFRDMKRDNGFTVDYFTISTLL  290

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              AC+ CF +  G+ +HAHA+RIG  +NLSVNNALI FYT+CG +K V+AL ERM V D  
Sbjct  291   TACTGCFVLMEGRAVHAHAIRIGLGANLSVNNALIGFYTKCGRVKDVVALLERMPVMDII  350

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             T  E+I AYME G VDLA E+FD +PEKN+V YNA+LAG+C+NG+ ++A+  F ++++E 
Sbjct  351   TLTEIIIAYMEFGYVDLAVEIFDKMPEKNSVSYNALLAGYCKNGKAMEALGLFVKLLEEG  410

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +  ++FTLTS+ NACGL+ E K S+QIHGF++K G   NDCIEAALLDM TRCGRM DAE
Sbjct  411   LVLTEFTLTSVVNACGLIKEVKLSEQIHGFVMKFGLGSNDCIEAALLDMLTRCGRMADAE  470

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             K+F+R P      +  TSM+ GYA++G+PE+AI LF ++Q E  VV DE+A  +VLGVCG
Sbjct  471   KMFYRWPTDRDDSIIWTSMICGYARSGKPEHAILLFHQSQSEATVVPDEIALTSVLGVCG  530

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG  ++G+ +H  ALK GF SD+ V N+++SMY KC  + NA+KAF  M S D+ SWN 
Sbjct  531   TLGFHEMGKQIHSYALKTGFSSDLGVANSMVSMYFKCCNMSNAIKAFNKMPSHDIVSWNG  590

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L+AG++LHR+GDEAL  WS ME+  I PD+ T + I+SAYR+T  N+V+ C+  F SM++
Sbjct  591   LIAGHLLHRQGDEALAVWSSMEKASIKPDAITFVLIISAYRYTNLNLVDSCRKLFLSMKT  650

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y + P S+HYA LVSVLGYWG LEEAEETIN MPF+PK SVWRALLDSC + LN++IGK
Sbjct  651   IYNIEPTSEHYASLVSVLGYWGFLEEAEETINNMPFQPKVSVWRALLDSCRIRLNTTIGK  710

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             RV K IL+MEPQDP+T+IL SNLYS+SGRW  SELVR +M+EKGF+K P +SW+I Q+K 
Sbjct  711   RVAKHILAMEPQDPATYILVSNLYSSSGRWHNSELVREDMREKGFRKHPSRSWIIHQNKV  770

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSF+ RD SH + KDIYS L+ILILEC+KAGYVPDTS+VLHEVEE+QKKDFLF+HSAKLA
Sbjct  771   HSFYVRDKSHPREKDIYSGLEILILECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSAKLA  830

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
              TYGLL T  G+PVR++KNIL CGDCH+F K  S+VT+REI +RD SGFH FLNG+CSC 
Sbjct  831   ATYGLLTTPAGQPVRIVKNILTCGDCHSFLKYVSVVTRREIFLRDASGFHHFLNGQCSCK  890

Query  2279  DRW  2271
             D W
Sbjct  891   DYW  893


 Score =   116 bits (291),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 116/478 (24%), Positives = 209/478 (44%), Gaps = 66/478 (14%)
 Frame = -3

Query  4400  SFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNL  4221
             SF   L   ++   + L   +HA +IKL     T   N L+  Y K G +    ++F  L
Sbjct  81    SFFNSLRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAYLKLGHVSDAYKIFYGL  140

Query  4220  PKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRG  4044
                ++ S+ ++ISG+ K      A ELF  M R++ +  +  +   +L AC     +  G
Sbjct  141   SSPNVVSFTSLISGLAKLGREEEAIELFFRM-RSEGIVPNEHSFVAILTACIRLLELELG  199

Query  4043  QELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNEMITAYME  3867
              ++HA  +++G   ++ V NAL+  Y +    +  ++ LF+ +  +D  +WN +I++ + 
Sbjct  200   FQIHALIVKMGCVDSVFVTNALMGLYGKFSFCLDYLLKLFDELPHKDTVSWNTVISSVVN  259

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSI  3687
                 + A ELF  +   N         GF  +                   F+  TL + 
Sbjct  260   EFEYEKAFELFRDMKRDN---------GFTVD------------------YFTISTLLTA  292

Query  3686  ANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPL---  3516
                C +LME    + +H   ++ G   N  +  AL+   T+CGR++D   +  RMP+   
Sbjct  293   CTGCFVLME---GRAVHAHAIRIGLGANLSVNNALIGFYTKCGRVKDVVALLERMPVMDI  349

Query  3515  -------------GHGRL-------------VALTSMLRGYAQNGQPENAISLFFETQLE  3414
                          G+  L             V+  ++L GY +NG+   A+ LF +   E
Sbjct  350   ITLTEIIIAYMEFGYVDLAVEIFDKMPEKNSVSYNALLAGYCKNGKAMEALGLFVKLLEE  409

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDN  3234
             GLV+ +   T+ V+  CG +  +KL E +H   +K G  S+  +  A++ M  +CG + +
Sbjct  410   GLVLTEFTLTS-VVNACGLIKEVKLSEQIHGFVMKFGLGSNDCIEAALLDMLTRCGRMAD  468

Query  3233  AVKAFELMSS--RDLCSWNSLLAGYVLHRRGDEALDTWSRME-RLGIVPDSFTCLHIL  3069
             A K F    +   D   W S++ GY    + + A+  + + +    +VPD      +L
Sbjct  469   AEKMFYRWPTDRDDSIIWTSMICGYARSGKPEHAILLFHQSQSEATVVPDEIALTSVL  526


 Score =   101 bits (252),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 103/410 (25%), Positives = 187/410 (46%), Gaps = 42/410 (10%)
 Frame = -3

Query  3977  IKFYTRCGSI---KSVMA-LFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNA  3810
             ++   +CG +   K++ A L + +L +D    N +I+AY++ G V  A ++F  L   N 
Sbjct  86    LRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAYLKLGHVSDAYKIFYGLSSPNV  145

Query  3809  VLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGF  3630
             V + ++++G  + G   +A+  F+RM  E I  ++ +  +I  AC  L+E +   QIH  
Sbjct  146   VSFTSLISGLAKLGREEEAIELFFRMRSEGIVPNEHSFVAILTACIRLLELELGFQIHAL  205

Query  3629  ILKSGCEPNDCIEAALLDMCTRCGRMED-AEKIFHRMPLGHGRLVALTSMLRGYAQNGQP  3453
             I+K GC  +  +  AL+ +  +     D   K+F  +P  H   V+  +++       + 
Sbjct  206   IVKMGCVDSVFVTNALMGLYGKFSFCLDYLLKLFDELP--HKDTVSWNTVISSVVNEFEY  263

Query  3452  ENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNA  3273
             E A  LF + + +    VD    +T+L  C    +L  G  +H  A++ G  +++ V NA
Sbjct  264   EKAFELFRDMKRDNGFTVDYFTISTLLTACTGCFVLMEGRAVHAHAIRIGLGANLSVNNA  323

Query  3272  VISMYAKCGE-------------------------------LDNAVKAFELMSSRDLCSW  3186
             +I  Y KCG                                +D AV+ F+ M  ++  S+
Sbjct  324   LIGFYTKCGRVKDVVALLERMPVMDIITLTEIIIAYMEFGYVDLAVEIFDKMPEKNSVSY  383

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             N+LLAGY  + +  EAL  + ++   G+V   FT   +++A     K V    Q   F M
Sbjct  384   NALLAGYCKNGKAMEALGLFVKLLEEGLVLTEFTLTSVVNACG-LIKEVKLSEQIHGFVM  442

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSS-VWRALL  2859
             +   G     +  A L+ +L   G + +AE+     P +   S +W +++
Sbjct  443   KFGLGSNDCIE--AALLDMLTRCGRMADAEKMFYRWPTDRDDSIIWTSMI  490


 Score = 69.3 bits (168),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 6/67 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVEL  4450
             L LE+DTR  N LISAYLKLG V  A  +F  LSSP      ++ISG AK+ RE EA+EL
Sbjct  108   LLLEQDTRFGNPLISAYLKLGHVSDAYKIFYGLSSPNVVSFTSLISGLAKLGREEEAIEL  167

Query  4449  FYEMRLE  4429
             F+ MR E
Sbjct  168   FFRMRSE  174



>ref|XP_011012417.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Populus euphratica]
Length=915

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/750 (59%), Positives = 570/750 (76%), Gaps = 3/750 (0%)
 Frame = -3

Query  4511  PPRPSYRVLQKSTVKLKPWSSSMR*--DLRGSGIEPNEYSFVALLTACIRSQNLELGFQV  4338
             P   SY  L  S  KL   + +++    +R SGIEPNEYSFVA+LTACIRS  LE+G QV
Sbjct  166   PDVVSYSALISSFSKLNRETEAIQLFFRMRISGIEPNEYSFVAILTACIRSLELEMGLQV  225

Query  4337  HALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMF  4158
             HAL IKLGY    +V NAL+GLY KCG LD  I LFD +P+RDIASWNTMIS +VK   +
Sbjct  226   HALAIKLGYSQLVFVANALIGLYGKCGCLDHAIHLFDEMPQRDIASWNTMISSLVKGLSY  285

Query  4157  TRAFELFNDMQRNDCLRIDYITLSTLLNACSECFMR-RGQELHAHALRIGYESNLSVNNA  3981
              +A ELF  + +N   + D  TLSTLL AC+ C  R +G+E+HA+A+R G E+NLSV+NA
Sbjct  286   EKALELFRVLNQNKGFKADQFTLSTLLTACARCHARIQGREIHAYAIRNGLENNLSVSNA  345

Query  3980  LIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLY  3801
             +I FYTRCG++  V+ALFERM  RD  TW EMITAYME GL DLA ++F+ +PEKN+V Y
Sbjct  346   IIGFYTRCGNLNHVVALFERMPFRDIITWTEMITAYMEFGLADLAVDMFNKMPEKNSVSY  405

Query  3800  NAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILK  3621
             NA+L GFC+N EGLKA+  F RM++E  E +DFTLTS+ NACGLL++ + S+QIHGFI+K
Sbjct  406   NALLTGFCKNNEGLKALNLFVRMVQEGAELTDFTLTSVINACGLLLKLEISRQIHGFIIK  465

Query  3620  SGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAI  3441
              G   N CIEAAL+ MC++CGRM+DA+++F  +    G  +  TSM+ GYA+NGQPE AI
Sbjct  466   FGFRSNACIEAALIHMCSKCGRMDDADRMFQSLSTDGGNSIIQTSMICGYARNGQPEEAI  525

Query  3440  SLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISM  3261
              LF+ +Q EG +V+DEVA  ++LG+CGTLG  + G+ +HC ALK GF +++ VGN++ISM
Sbjct  526   CLFYRSQSEGTMVLDEVAFTSILGICGTLGFHEAGKQIHCQALKTGFHAELGVGNSIISM  585

Query  3260  YAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTC  3081
             Y+KC  +D+A+K F  M + ++ SWN L+AG +LHR+GDEAL  WS ME+ GI PD+ T 
Sbjct  586   YSKCYNIDDAIKVFNTMPAHNVVSWNGLIAGQLLHRQGDEALAIWSSMEKAGIKPDAITF  645

Query  3080  LHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINT  2901
             + I+SAY++T+ N+++ C+S F SM+  + + P S+HYA LV VLGYWGLLEEAEE IN 
Sbjct  646   VLIVSAYKYTSSNLLDECRSMFLSMKMIHDLEPTSEHYASLVGVLGYWGLLEEAEELINK  705

Query  2900  MPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCS  2721
             MPF+P+ SVWRALLD C +H N+SIGKRV K I+ MEP+DPST++L SNLY+ASGRW CS
Sbjct  706   MPFDPEVSVWRALLDGCRLHANTSIGKRVAKHIIGMEPRDPSTYVLVSNLYAASGRWHCS  765

Query  2720  ELVRAEMKEKGFQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYV  2541
             ELVR  M+++G +K P +SWVI + + H+F+ARD SH QSKDIYS LDILIL+C+KAGY 
Sbjct  766   ELVRENMRDRGLRKHPCRSWVINKKQLHTFYARDKSHPQSKDIYSGLDILILKCLKAGYE  825

Query  2540  PDTSYVLHEVEEYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSA  2361
             PD ++VL EVEE QKKDFLF+HSAKLA TYGLL T+ G+P+RV+KNILLC DCHTF K A
Sbjct  826   PDMNFVLQEVEEQQKKDFLFYHSAKLAATYGLLKTRPGEPIRVVKNILLCRDCHTFLKYA  885

Query  2360  SIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             ++VT+REI  RD SGFHCF NG CSC   W
Sbjct  886   TVVTQREIIFRDASGFHCFSNGHCSCKGYW  915


 Score =   147 bits (371),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 144/589 (24%), Positives = 254/589 (43%), Gaps = 88/589 (15%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL   ++  +++L   +HA ++KLG  + T + NA++  Y K G +     +F  +   D
Sbjct  110   LLRLSVKYTDIDLARALHASILKLG--EDTDLGNAVIAAYIKLGLVVDAYGVFMGMSTPD  167

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S++ +IS   K +  T A +LF  M R   +  +  +   +L AC     +  G ++H
Sbjct  168   VVSYSALISSFSKLNRETEAIQLFFRM-RISGIEPNEYSFVAILTACIRSLELEMGLQVH  226

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
             A A+++GY   + V NALI  Y +CG +   + LF+ M  RD  +WN MI++ ++    +
Sbjct  227   ALAIKLGYSQLVFVANALIGLYGKCGCLDHAIHLFDEMPQRDIASWNTMISSLVKGLSYE  286

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A ELF  L +                 +G KA                FTL+++  AC 
Sbjct  287   KALELFRVLNQN----------------KGFKA--------------DQFTLSTLLTACA  316

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP---------  3519
                 R   ++IH + +++G E N  +  A++   TRCG +     +F RMP         
Sbjct  317   RCHARIQGREIHAYAIRNGLENNLSVSNAIIGFYTRCGNLNHVVALFERMPFRDIITWTE  376

Query  3518  --------------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                                 +     V+  ++L G+ +N +   A++LF     EG  + 
Sbjct  377   MITAYMEFGLADLAVDMFNKMPEKNSVSYNALLTGFCKNNEGLKALNLFVRMVQEGAELT  436

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
             D   T+ +      L L    + +H   +K GF S+  +  A+I M +KCG +D+A + F
Sbjct  437   DFTLTSVINACGLLLKLEISRQ-IHGFIIKFGFRSNACIEAALIHMCSKCGRMDDADRMF  495

Query  3218  ELMSSRDLCS--WNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILS-----A  3063
             + +S+    S    S++ GY  + + +EA+  + R +  G +V D      IL       
Sbjct  496   QSLSTDGGNSIIQTSMICGYARNGQPEEAICLFYRSQSEGTMVLDEVAFTSILGICGTLG  555

Query  3062  YRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPK  2883
             +    K +   CQ+      +  GV  +      ++S+      +++A +  NTMP    
Sbjct  556   FHEAGKQI--HCQALKTGFHAELGVGNS------IISMYSKCYNIDDAIKVFNTMPAHNV  607

Query  2882  SSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQ----DPSTFILKSNLY  2748
              S W  L+   ++H     G   +    SME      D  TF+L  + Y
Sbjct  608   VS-WNGLIAGQLLHRQ---GDEALAIWSSMEKAGIKPDAITFVLIVSAY  652


 Score = 73.6 bits (179),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 6/70 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LKL EDT L NA+I+AY+KLGLV  A  VF  +S+P      A+IS F+K+NRE E
Sbjct  127   HASILKLGEDTDLGNAVIAAYIKLGLVVDAYGVFMGMSTPDVVSYSALISSFSKLNRETE  186

Query  4461  AVELFYEMRL  4432
             A++LF+ MR+
Sbjct  187   AIQLFFRMRI  196



>ref|XP_004305376.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like, 
partial [Fragaria vesca subsp. vesca]
Length=807

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/724 (60%), Positives = 564/724 (78%), Gaps = 4/724 (1%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGIEPNEYSFVA+LTACIR  +LELG QVH L +K+GYLD  +V NA+MGLY KCG 
Sbjct  85    MRRSGIEPNEYSFVAMLTACIRVFDLELGQQVHGLAVKMGYLDRAFVSNAVMGLYGKCGC  144

Query  4253  LDFVIELFDNLP-KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             LD+ ++LFD +P  RDIASWNT+++G+V E M+   F+L   + R++    D ITLST+L
Sbjct  145   LDYALKLFDEMPHNRDIASWNTVMAGLVSEGMYDEVFDLLRQLLRSEGCVADNITLSTVL  204

Query  4076  NAC--SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDA  3903
              AC  S  ++  GQ +HA+A++ G E +LSV NALI  Y  CGS+  V ALFERM  RDA
Sbjct  205   TACTGSNAYLE-GQGVHAYAVKNGLEGDLSVGNALIGLYGECGSVGDVAALFERMPARDA  263

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE  3723
              TW EMITAYM  G+V+LA E+FD +PE+N+  YNA++AGFC+NGEGL+A+  F +M++E
Sbjct  264   ITWTEMITAYMGFGMVELAVEMFDQMPERNSYSYNALIAGFCRNGEGLRALDLFMKMMEE  323

Query  3722  SIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDA  3543
              +E ++FTL+S+  ACGLLM+ KSS+QIHGF++K G + N CI AALLDMCTRCGRM DA
Sbjct  324   GVELTEFTLSSVVGACGLLMDCKSSEQIHGFVIKFGFDSNVCIGAALLDMCTRCGRMGDA  383

Query  3542  EKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvc  3363
              K+FH+ P    + V LTS++ GYA+NGQ + AIS+F   Q EG +V+DEVA+ ++LG+C
Sbjct  384   MKLFHQWPTEQEKSVILTSIICGYARNGQLDEAISIFDRYQSEGTMVMDEVASTSLLGLC  443

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
             GT+G  +LG+ +H  A+K+GFL+DV VGNA ISMY KC  +D  +K F +M + D+ SWN
Sbjct  444   GTIGYHELGKQIHSYAVKYGFLADVGVGNATISMYTKCWNMDEGIKIFGMMRTHDIVSWN  503

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQ  3003
              LLAGY+LHRRGDEAL  WS+ME+ GI PD  T + I+SA+RHT  + V+ C+S F SM+
Sbjct  504   VLLAGYLLHRRGDEALAVWSKMEKTGIKPDKITFILIISAHRHTNSSSVDNCRSLFLSMK  563

Query  3002  SAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIG  2823
             + Y + P  +H+A  + VLGYWGLL+EAE+TI+ MPF+P+ SVWRALLDSC + +N+++G
Sbjct  564   AVYDIDPTPEHFASFIGVLGYWGLLDEAEDTISKMPFKPEVSVWRALLDSCRIRMNTAVG  623

Query  2822  KRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHK  2643
             KRV+K+IL+MEP+DPS++IL SNLYSA GRW CSE+VR +M+++GF+K PG+SW I  +K
Sbjct  624   KRVVKRILAMEPKDPSSYILLSNLYSACGRWDCSEMVRDDMRKRGFRKHPGRSWFIHNNK  683

Query  2642  FHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKL  2463
              H F+ARD SH Q KDIYSAL+ILI+ECMKAGY+PDTS+VLHEVEE+QKKDFL++HSAKL
Sbjct  684   IHPFYARDKSHPQVKDIYSALEILIVECMKAGYIPDTSFVLHEVEEHQKKDFLYYHSAKL  743

Query  2462  ALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             A TYGLL  K GKP+RV+KNILLCGDCHTF K  SIV KR IHVRD SGFH F NG+CSC
Sbjct  744   AATYGLLTNKPGKPIRVVKNILLCGDCHTFLKYLSIVAKRAIHVRDASGFHYFSNGQCSC  803

Query  2282  NDRW  2271
              D W
Sbjct  804   KDYW  807


 Score =   139 bits (350),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 122/461 (26%), Positives = 209/461 (45%), Gaps = 67/461 (15%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL    R  + +L   VHA  +KL     T++ NAL+  Y K G +     +F +LP  +
Sbjct  1     LLRLSARHADADLARAVHASALKLE--SDTHLGNALVSAYLKLGLVPQAYRVFQSLPSPN  58

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  M+SG  K     +A ELF  M+R+     +Y +   +L AC   F +  GQ++H
Sbjct  59    VVSFTAMVSGFAKSGREQQAAELFCRMRRSGIEPNEY-SFVAMLTACIRVFDLELGQQVH  117

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERML-VRDAFTWNEMITAYMESGLV  3855
               A+++GY     V+NA++  Y +CG +   + LF+ M   RD  +WN ++   +  G+ 
Sbjct  118   GLAVKMGYLDRAFVSNAVMGLYGKCGCLDYALKLFDEMPHNRDIASWNTVMAGLVSEGMY  177

Query  3854  DLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANAC  3675
             D   E+FD L +                 EG  A               + TL+++  AC
Sbjct  178   D---EVFDLLRQ-------------LLRSEGCVA--------------DNITLSTVLTAC  207

Query  3674  GLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP--------  3519
                      + +H + +K+G E +  +  AL+ +   CG + D   +F RMP        
Sbjct  208   TGSNAYLEGQGVHAYAVKNGLEGDLSVGNALIGLYGECGSVGDVAALFERMPARDAITWT  267

Query  3518  ------LGHGRL---------------VALTSMLRGYAQNGQPENAISLFFETQLEGLVV  3402
                   +G G +                +  +++ G+ +NG+   A+ LF +   EG V 
Sbjct  268   EMITAYMGFGMVELAVEMFDQMPERNSYSYNALIAGFCRNGEGLRALDLFMKMMEEG-VE  326

Query  3401  VDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKA  3222
             + E   ++V+G CG L   K  E +H   +K GF S+V +G A++ M  +CG + +A+K 
Sbjct  327   LTEFTLSSVVGACGLLMDCKSSEQIHGFVIKFGFDSNVCIGAALLDMCTRCGRMGDAMKL  386

Query  3221  FELMSSRDLCS--WNSLLAGYVLHRRGDEALDTWSRMERLG  3105
             F    +    S    S++ GY  + + DEA+  + R +  G
Sbjct  387   FHQWPTEQEKSVILTSIICGYARNGQLDEAISIFDRYQSEG  427


 Score =   122 bits (306),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 147/317 (46%), Gaps = 34/317 (11%)
 Frame = -3

Query  3917  LVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFY  3738
             L  D    N +++AY++ GLV  A  +F  LP  N V + A+++GF ++G   +A   F 
Sbjct  24    LESDTHLGNALVSAYLKLGLVPQAYRVFQSLPSPNVVSFTAMVSGFAKSGREQQAAELFC  83

Query  3737  RMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG  3558
             RM +  IE ++++  ++  AC  + + +  +Q+HG  +K G      +  A++ +  +CG
Sbjct  84    RMRRSGIEPNEYSFVAMLTACIRVFDLELGQQVHGLAVKMGYLDRAFVSNAVMGLYGKCG  143

Query  3557  RMEDAEKIFHRMPLGHGRLVA-LTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATA  3381
              ++ A K+F  MP  H R +A   +++ G    G  +    L  +       V D +  +
Sbjct  144   CLDYALKLFDEMP--HNRDIASWNTVMAGLVSEGMYDEVFDLLRQLLRSEGCVADNITLS  201

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
             TVL  C        G+ +H  A+K+G   D+ VGNA+I +Y +CG + +    FE M +R
Sbjct  202   TVLTACTGSNAYLEGQGVHAYAVKNGLEGDLSVGNALIGLYGECGSVGDVAALFERMPAR  261

Query  3200  DLCSW-------------------------------NSLLAGYVLHRRGDEALDTWSRME  3114
             D  +W                               N+L+AG+  +  G  ALD + +M 
Sbjct  262   DAITWTEMITAYMGFGMVELAVEMFDQMPERNSYSYNALIAGFCRNGEGLRALDLFMKMM  321

Query  3113  RLGIVPDSFTCLHILSA  3063
               G+    FT   ++ A
Sbjct  322   EEGVELTEFTLSSVVGA  338


 Score = 73.2 bits (178),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LKLE DT L NAL+SAYLKLGLV  A  VF SL SP      A++SGFAK  RE +
Sbjct  18    HASALKLESDTHLGNALVSAYLKLGLVPQAYRVFQSLPSPNVVSFTAMVSGFAKSGREQQ  77

Query  4461  AVELFYEMR  4435
             A ELF  MR
Sbjct  78    AAELFCRMR  86



>ref|XP_007027561.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
[Theobroma cacao]
 gb|EOY08063.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
[Theobroma cacao]
Length=876

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/724 (60%), Positives = 560/724 (77%), Gaps = 4/724 (1%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKC-G  4257
             +R  GI PNE++FVA+LTACIR   LELGFQVH L+IK+G+LD  +V NALMGLY K  G
Sbjct  154   MRNEGIMPNEFTFVAILTACIRVLELELGFQVHGLVIKMGFLDRVFVANALMGLYGKFNG  213

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             +L FV ++FD +P RD+ASWNT+IS +VK+ M+ +AFEL   MQ     R D+ T+ST+L
Sbjct  214   ALGFVYKMFDEMPHRDVASWNTVISSLVKQGMYEKAFELSGVMQGIGSFRADFFTISTVL  273

Query  4076  NAC--SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDA  3903
             +AC  S   M+ G+E+HAHA+RIG   NLSVNNALI FY++CGS+  V+ALFE M VRD 
Sbjct  274   SACEGSNALMK-GKEVHAHAIRIGLVGNLSVNNALIGFYSKCGSVGDVVALFESMPVRDV  332

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE  3723
              TW EMI+AYME GLVD A E+FD +PEKN V YNA++AGFC+NGEGLKA+  F  M++E
Sbjct  333   ITWTEMISAYMEFGLVDFAVEVFDKMPEKNCVSYNALMAGFCRNGEGLKAVKLFIEMVEE  392

Query  3722  SIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDA  3543
              +E +DF+L+S+ NAC L+M+ K+S+QIHGF +K G   N C+EAALLDMC RCGRM DA
Sbjct  393   GLELTDFSLSSVINACALVMDAKTSEQIHGFCVKFGFRSNACVEAALLDMCMRCGRMADA  452

Query  3542  EKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvc  3363
             EK+F   P      V  TSM+ GYA+NGQP+NAIS F   +LEG + +D+V   +VLGVC
Sbjct  453   EKMFCMWPSELDSSVVCTSMVCGYARNGQPDNAISFFLRRRLEGTMDMDDVTLTSVLGVC  512

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
             GTLG  ++GE +HC ALK GF+SD+VV N+VISMYAKCG ++ A+K F  M  RD+ SWN
Sbjct  513   GTLGFEEMGEQIHCHALKIGFVSDLVVLNSVISMYAKCGNMNGAIKVFNNMPIRDVVSWN  572

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQ  3003
             +L+AG++LHR+G+EAL  WS ME   I  D+ T + ++ AYRHT  ++V+ C+  F SM+
Sbjct  573   ALIAGHILHRQGEEALAVWSMMEEADIKADTITLILVILAYRHTNSDLVDNCRKLFLSMK  632

Query  3002  SAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIG  2823
             + Y + P   HYA  VSVLG W LLEEAE+ I+ M  EPK+S WRALLDSC +HLN++IG
Sbjct  633   TNYNIEPTPQHYASFVSVLGRWSLLEEAEKMIDKMTAEPKASAWRALLDSCRIHLNTTIG  692

Query  2822  KRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHK  2643
             KRV K IL+M+P+DP T+IL SNLYSASGRW CS+ +R +M+EKGF+K P +SW+I Q+K
Sbjct  693   KRVAKHILAMKPRDPPTYILVSNLYSASGRWHCSDTIREDMREKGFRKHPARSWIIHQNK  752

Query  2642  FHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKL  2463
              HSF+ARD SH Q+KDIYS L+IL+LEC+KAGYVPDTS+VLHEVEE+QKKDFL +HSAKL
Sbjct  753   VHSFYARDKSHPQTKDIYSGLEILVLECVKAGYVPDTSFVLHEVEEHQKKDFLLYHSAKL  812

Query  2462  ALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             A TYGLLM++ G+P+R++KNILLCGDCHTF K  S+VT+REI +RD SGFHCF +G+CSC
Sbjct  813   ATTYGLLMSRPGEPIRIVKNILLCGDCHTFLKFVSVVTRREIFLRDASGFHCFRSGQCSC  872

Query  2282  NDRW  2271
              + W
Sbjct  873   KNYW  876


 Score =   105 bits (263),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 136/265 (51%), Gaps = 3/265 (1%)
 Frame = -3

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMI  3729
             D    N ++ AY++ GL++ + ++F  L   + V Y+++++GF ++ +G +A+  F +M 
Sbjct  96    DTHLGNSLVLAYLKLGLLNHSFKVFTFLSCPSVVTYSSLISGFAKSSQGNEAIKLFMKMR  155

Query  3728  KESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC-GRM  3552
              E I  ++FT  +I  AC  ++E +   Q+HG ++K G      +  AL+ +  +  G +
Sbjct  156   NEGIMPNEFTFVAILTACIRVLELELGFQVHGLVIKMGFLDRVFVANALMGLYGKFNGAL  215

Query  3551  EDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvl  3372
                 K+F  MP  H  + +  +++    + G  E A  L    Q  G    D    +TVL
Sbjct  216   GFVYKMFDEMP--HRDVASWNTVISSLVKQGMYEKAFELSGVMQGIGSFRADFFTISTVL  273

Query  3371  gvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLC  3192
               C     L  G+ +H  A++ G + ++ V NA+I  Y+KCG + + V  FE M  RD+ 
Sbjct  274   SACEGSNALMKGKEVHAHAIRIGLVGNLSVNNALIGFYSKCGSVGDVVALFESMPVRDVI  333

Query  3191  SWNSLLAGYVLHRRGDEALDTWSRM  3117
             +W  +++ Y+     D A++ + +M
Sbjct  334   TWTEMISAYMEFGLVDFAVEVFDKM  358


 Score = 63.9 bits (154),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 19/126 (15%)
 Frame = -2

Query  4755  KPNHKFNPAFLLSNASL---SIQEPLLSSDPLINSSIS--TYPEQHA------VDYADFL  4609
             KP        L S  SL   ++ +PL+ +D  INS +S      QH+        +A  L
Sbjct  34    KPKSHHRHLLLSSTTSLPRHTLSKPLIFND--INSPLSLLHLSVQHSDADLAKAVHACSL  91

Query  4608  KLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSPAI------ISGFAKINREIEAVELF  4447
             K +EDT L N+L+ AYLKLGL++++  VF  LS P++      ISGFAK ++  EA++LF
Sbjct  92    KSQEDTHLGNSLVLAYLKLGLLNHSFKVFTFLSCPSVVTYSSLISGFAKSSQGNEAIKLF  151

Query  4446  YEMRLE  4429
              +MR E
Sbjct  152   MKMRNE  157


 Score = 55.1 bits (131),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  3293  DVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRME  3114
             D  +GN+++  Y K G L+++ K F  +S   + +++SL++G+    +G+EA+  + +M 
Sbjct  96    DTHLGNSLVLAYLKLGLLNHSFKVFTFLSCPSVVTYSSLISGFAKSSQGNEAIKLFMKMR  155

Query  3113  RLGIVPDSFTCLHILSA  3063
               GI+P+ FT + IL+A
Sbjct  156   NEGIMPNEFTFVAILTA  172



>gb|KDP29229.1| hypothetical protein JCGZ_16618 [Jatropha curcas]
Length=887

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/722 (60%), Positives = 555/722 (77%), Gaps = 1/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SG+E NEYS +A+L ACIR   LELG QVH L+IKLGYL+ TY+ NALM LY K G 
Sbjct  165   MRSSGVEVNEYSLLAILIACIRISELELGLQVHGLIIKLGYLECTYIANALMSLYDKSGC  224

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
              D+V +LFD +P+RDI +WNT IS +V + ++ +A  LF D+      R D  TL T+L+
Sbjct  225   FDYVTQLFDEMPQRDIVTWNTAISSLVNQWLYEKALRLFQDLHLTTGFRADRCTLLTVLS  284

Query  4073  ACSECFMRRG-QELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             AC+ C    G +E+HAHA+RIG E+NLS+NNA+I FYT+CGS+K V+A+FE+M V+D  T
Sbjct  285   ACAGCHAAMGGREVHAHAIRIGLEANLSINNAIIGFYTKCGSLKDVLAVFEKMPVKDIIT  344

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
               +M  AYME G+VDLA E+F+++PE+N V  NA+LAGFC+NGEG KA+  F +M++E +
Sbjct  345   RTQMFMAYMEFGVVDLAVEVFENMPERNTVSCNALLAGFCKNGEGSKALDLFLKMVQERV  404

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +D TLTSI NACG+LM  + S+QIHGF+ K G   N CIE ALLDM TRCGRM+DA+K
Sbjct  405   ELTDLTLTSIVNACGILMSFEISRQIHGFVTKVGFGSNACIETALLDMYTRCGRMKDADK  464

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             IF   P      +  TSML GYA+NG PE AISLF ++QLEG +VVDEVA A++LGVCGT
Sbjct  465   IFRSWPSDWDSSIIRTSMLCGYARNGMPEEAISLFHQSQLEGAIVVDEVALASILGVCGT  524

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG  ++GE +H  ALK GFL++VVVGN++ISMY+KC  +++A+K+F +M   D+ SWN L
Sbjct  525   LGFHEMGEQIHSHALKSGFLANVVVGNSIISMYSKCCNMNDAIKSFNIMPIHDIVSWNCL  584

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             +AG++LHR+GD ALD WSRM + GI PDS T + I+ AYRHT  N+V+ C++ F SM+ A
Sbjct  585   IAGHLLHRQGDGALDVWSRMVKEGIKPDSVTFILIILAYRHTNSNLVDDCRNLFLSMKKA  644

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             Y V P S+HYA LVSVLGYWGLLEEAEE I  MPFEP++ VWRALL+SC  HLN S+G R
Sbjct  645   YEVDPTSEHYASLVSVLGYWGLLEEAEEMIIKMPFEPEAFVWRALLESCRYHLNMSMGLR  704

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V+K+I++MEPQDPST+ L SNLY ASGRW CSELVR +M++KG +K P +SW+I Q + H
Sbjct  705   VVKRIVAMEPQDPSTYALVSNLYLASGRWHCSELVREDMRKKGLRKHPCRSWIIHQKEVH  764

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
             SF  RD SH Q+KDIYS +D LILEC+K GYVP+TS+ L +VEE+QKK++LF+HSAKLA 
Sbjct  765   SFCVRDQSHYQTKDIYSGIDRLILECLKLGYVPNTSFTLQDVEEHQKKEYLFYHSAKLAA  824

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
             TYGLL+TK GKP+R++KNILLCGDCH F K  S+VT+REI +RDTSGFH F NG CSC D
Sbjct  825   TYGLLLTKRGKPIRIVKNILLCGDCHMFLKYVSVVTRREIILRDTSGFHHFSNGHCSCKD  884

Query  2276  RW  2271
              W
Sbjct  885   YW  886


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 120/494 (24%), Positives = 203/494 (41%), Gaps = 81/494 (16%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             L  S IE ++ S   LL   ++  N++L   VHA  +KL   + T + NAL+  Y K G 
Sbjct  68    LGSSYIETDDLS--NLLRLSVKYSNIDLARAVHAASVKLD--EDTQLGNALISAYVKLG-  122

Query  4253  LDFVIE---LFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
               FV++   +F +L   D  +++T+ISG  K +    A   F  M+ +     +Y  L+ 
Sbjct  123   --FVVDAHGVFKHLSSPDAVAYSTLISGFAKVNKENEAIVHFFRMRSSGVEVNEYSLLAI  180

Query  4082  LLNACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDA  3903
             L+       +  G ++H   +++GY     + NAL+  Y + G    V  LF+ M  RD 
Sbjct  181   LIACIRISELELGLQVHGLIIKLGYLECTYIANALMSLYDKSGCFDYVTQLFDEMPQRDI  240

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE  3723
              TWN  I++ +   L + A  LF  L      L     A  C                  
Sbjct  241   VTWNTAISSLVNQWLYEKALRLFQDLH-----LTTGFRADRC------------------  277

Query  3722  SIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDA  3543
                    TL ++ +AC         +++H   ++ G E N  I  A++   T+CG ++D 
Sbjct  278   -------TLLTVLSACAGCHAAMGGREVHAHAIRIGLEANLSINNAIIGFYTKCGSLKDV  330

Query  3542  EKIFHRMP-----------------------------LGHGRLVALTSMLRGYAQNGQPE  3450
               +F +MP                             +     V+  ++L G+ +NG+  
Sbjct  331   LAVFEKMPVKDIITRTQMFMAYMEFGVVDLAVEVFENMPERNTVSCNALLAGFCKNGEGS  390

Query  3449  NAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAV  3270
              A+ LF +   E + + D   T+ V      +      + +H    K GF S+  +  A+
Sbjct  391   KALDLFLKMVQERVELTDLTLTSIVNACGILMSFEISRQ-IHGFVTKVGFGSNACIETAL  449

Query  3269  ISMYAKCGELDNAVKAFELMSSRDLCSWN------SLLAGYVLHRRGDEALDTWSRMERL  3108
             + MY +CG + +A K F    S     W+      S+L GY  +   +EA+  + + +  
Sbjct  450   LDMYTRCGRMKDADKIFRSWPS----DWDSSIIRTSMLCGYARNGMPEEAISLFHQSQLE  505

Query  3107  G-IVPDSFTCLHIL  3069
             G IV D      IL
Sbjct  506   GAIVVDEVALASIL  519


 Score =   101 bits (252),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 95/382 (25%), Positives = 166/382 (43%), Gaps = 36/382 (9%)
 Frame = -3

Query  3917  LVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFY  3738
             L  D    N +I+AY++ G V  A  +F HL   +AV Y+ +++GF +  +  +A+  F+
Sbjct  104   LDEDTQLGNALISAYVKLGFVVDAHGVFKHLSSPDAVAYSTLISGFAKVNKENEAIVHFF  163

Query  3737  RMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG  3558
             RM    +E ++++L +I  AC  + E +   Q+HG I+K G      I  AL+ +  + G
Sbjct  164   RMRSSGVEVNEYSLLAILIACIRISELELGLQVHGLIIKLGYLECTYIANALMSLYDKSG  223

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAt  3378
               +   ++F  MP     +V   + +         E A+ LF +  L      D     T
Sbjct  224   CFDYVTQLFDEMP--QRDIVTWNTAISSLVNQWLYEKALRLFQDLHLTTGFRADRCTLLT  281

Query  3377  vlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL--------------  3240
             VL  C        G  +H  A++ G  +++ + NA+I  Y KCG L              
Sbjct  282   VLSACAGCHAAMGGREVHAHAIRIGLEANLSINNAIIGFYTKCGSLKDVLAVFEKMPVKD  341

Query  3239  -----------------DNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMER  3111
                              D AV+ FE M  R+  S N+LLAG+  +  G +ALD + +M +
Sbjct  342   IITRTQMFMAYMEFGVVDLAVEVFENMPERNTVSCNALLAGFCKNGEGSKALDLFLKMVQ  401

Query  3110  LGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGL  2931
               +     T   I++A        ++R Q   F  +  +G     +    L+ +    G 
Sbjct  402   ERVELTDLTLTSIVNACGILMSFEISR-QIHGFVTKVGFGSNACIE--TALLDMYTRCGR  458

Query  2930  LEEAEETINTMPFEPKSSVWRA  2865
             +++A++   + P +  SS+ R 
Sbjct  459   MKDADKIFRSWPSDWDSSIIRT  480


 Score = 70.5 bits (171),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  +KL+EDT+L NALISAY+KLG V  A  VF  LSSP       +ISGFAK+N+E E
Sbjct  98    HAASVKLDEDTQLGNALISAYVKLGFVVDAHGVFKHLSSPDAVAYSTLISGFAKVNKENE  157

Query  4461  AVELFYEMR  4435
             A+  F+ MR
Sbjct  158   AIVHFFRMR  166



>ref|XP_010683940.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g03800 [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/723 (60%), Positives = 554/723 (77%), Gaps = 2/723 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R  GIEPNE++FVA LTAC R   L+LGFQVH+L++K GYL ST+VVNALMGLYSKCG 
Sbjct  177   MRERGIEPNEFTFVAFLTACSRIYGLQLGFQVHSLVVKFGYLCSTFVVNALMGLYSKCGC  236

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD  ++LFD + +RD+A+WNT+ISG+V E M+ R F+LF +MQR+D  R ++IT+S+L++
Sbjct  237   LDDALQLFDEMSERDVATWNTVISGVVSEGMYDRGFQLFCEMQRSDGFRANHITISSLIS  296

Query  4073  ACSECFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             AC+ C  R  G+E+HAHAL++G+++NLSV+N+LI FYT+CG  K V A+F RM ++D  +
Sbjct  297   ACAGCSARVLGREIHAHALKMGFDNNLSVSNSLIGFYTKCGGAKDVQAVFGRMPIKDVIS  356

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W  MITA ME G+ +LA ELF  +PE+NAV +NAVLAG C N EGLKA+ FF RM+   +
Sbjct  357   WTSMITALMEFGMAELALELFGKMPERNAVSFNAVLAGLCLNMEGLKALYFFCRMVNHGV  416

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E ++ TLTS+ +AC LL E+  S+QIHGF++K G   N CIEAALLDMCTRCGR+ DAEK
Sbjct  417   ELTEHTLTSVISACSLLAEKDFSEQIHGFVVKFGFRSNACIEAALLDMCTRCGRITDAEK  476

Query  3536  IFHRMPLGHGRL-VALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             +FH+       L V  TS++ GYA+N QPE A++LF   Q + ++ VDEV   T+LG+CG
Sbjct  477   MFHQXSKRDQSLSVKWTSLISGYARNAQPEEAMNLFKWGQSQEILXVDEVVATTILGICG  536

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
              LG  ++GE +HC ALK G L DVV+ NA+ISMY+KCG+++ AV+ F  +  RD+ SWN 
Sbjct  537   ALGFQEMGEQMHCHALKCGHLYDVVLENAIISMYSKCGDMEGAVRIFNSLPIRDVVSWNC  596

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L+AGY+L R+GDE L  W RM+R  I PDS T + I+S++RHT  N+++ C+  F SM  
Sbjct  597   LIAGYLLLRQGDEVLAVWLRMKRSHIRPDSITLILIISSFRHTRSNMLHDCRKLFSSMTR  656

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y V P SDHYA  VSVLG WG LEEAE+ I  MPFEPK+SVW+ALL SC +H +S I K
Sbjct  657   EYDVKPTSDHYASFVSVLGDWGFLEEAEDIILKMPFEPKTSVWQALLRSCDIHSDSVIRK  716

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             R+ K+IL+ +P+DPSTFIL SNL+SASGRW CSE VR EM++KG +K P +SW++ Q K 
Sbjct  717   RIAKRILAKQPKDPSTFILVSNLFSASGRWHCSENVREEMRKKGIRKHPARSWIVRQDKV  776

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSF+ RD +H QSKDIYS L+ILILEC+KAGYVPDTS+VLHEVEE+QKKDFLF+HSAKLA
Sbjct  777   HSFYTRDRNHSQSKDIYSGLEILILECLKAGYVPDTSFVLHEVEEHQKKDFLFYHSAKLA  836

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             +TYGLL T  GKP+ V KN+LLCGDCH FFK  S VTKR+I VRDTSGFHCF +GKCSC 
Sbjct  837   VTYGLLTTMPGKPITVTKNVLLCGDCHNFFKYVSRVTKRDISVRDTSGFHCFSDGKCSCR  896

Query  2279  DRW  2271
             D W
Sbjct  897   DHW  899


 Score =   103 bits (258),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 129/268 (48%), Gaps = 3/268 (1%)
 Frame = -3

Query  3917  LVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQN-GEGLKAMAFF  3741
             L  D +  N +ITAY++ G +  A  +F  +   + V Y A+++GF ++ G   +A+   
Sbjct  115   LQEDNYLLNSLITAYIKLGFLSDAYNVFSGISNPDVVSYTAIISGFSKSVGFEFEAIRML  174

Query  3740  YRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
              RM +  IE ++FT  +   AC  +   +   Q+H  ++K G   +  +  AL+ + ++C
Sbjct  175   MRMRERGIEPNEFTFVAFLTACSRIYGLQLGFQVHSLVVKFGYLCSTFVVNALMGLYSKC  234

Query  3560  GRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATA  3381
             G ++DA ++F  M      +    +++ G    G  +    LF E Q       + +  +
Sbjct  235   GCLDDALQLFDEM--SERDVATWNTVISGVVSEGMYDRGFQLFCEMQRSDGFRANHITIS  292

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
             +++  C       LG  +H  ALK GF +++ V N++I  Y KCG   +    F  M  +
Sbjct  293   SLISACAGCSARVLGREIHAHALKMGFDNNLSVSNSLIGFYTKCGGAKDVQAVFGRMPIK  352

Query  3200  DLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
             D+ SW S++   +     + AL+ + +M
Sbjct  353   DVISWTSMITALMEFGMAELALELFGKM  380


 Score = 55.1 bits (131),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 7/66 (11%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAK-INREIEAVE  4453
             LKL+ED  L N+LI+AY+KLG +  A  VF  +S+P      AIISGF+K +  E EA+ 
Sbjct  113   LKLQEDNYLLNSLITAYIKLGFLSDAYNVFSGISNPDVVSYTAIISGFSKSVGFEFEAIR  172

Query  4452  LFYEMR  4435
             +   MR
Sbjct  173   MLMRMR  178



>ref|XP_010247796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Nelumbo nucifera]
Length=931

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/748 (57%), Positives = 554/748 (74%), Gaps = 28/748 (4%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +RGSGIEPNE+SFVA+LTACIR  +L+LG+Q+H+L IK GY    YV NALMG+Y +   
Sbjct  185   MRGSGIEPNEFSFVAILTACIRLSDLQLGYQIHSLAIKTGYSYCVYVSNALMGVYIRSEC  244

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             ++   +LF  + +RD++SWNT+IS  VKE  + RAF+LF DMQ+ D LR+D  TLS+LL 
Sbjct  245   INHAYQLFGEMAERDVSSWNTIISAAVKELQYERAFDLFRDMQQIDQLRVDSFTLSSLLA  304

Query  4073  ACSECFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             A +    R  GQ++HAHAL+IG +SN+SVNN+LI FYT+CGSI+ V+A+FE+M V+D  +
Sbjct  305   ASTGSLARMEGQKIHAHALKIGLQSNVSVNNSLIGFYTKCGSIEDVVAVFEKMPVKDIIS  364

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W  MIT YME G +  A  +FD +PE+N + YNA+LAG+CQNGEG KA+  F  M++E +
Sbjct  365   WTGMITGYMEFGFIKSALNIFDSMPERNYISYNAMLAGYCQNGEGSKALELFRGMVEEGM  424

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             + SDFTLTS  NAC +L E ++SKQIHGF++KSG   N  IEAALLDMCT+C RM+DA+K
Sbjct  425   DISDFTLTSAVNACSILSEMETSKQIHGFVIKSGFGSNSWIEAALLDMCTKCARMDDAQK  484

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F +        V  TSM+ GYA+NGQ   A++LF+  Q+E ++V DEVA+  VLGVCG+
Sbjct  485   MFTQWSYNEEISVVWTSMICGYARNGQLIEALNLFYTMQVEDMIV-DEVASTAVLGVCGS  543

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG  ++G  +H   LK GF+SD+ +G+A+ SMY+KCG +D+A+K+F +M   D+ SWN L
Sbjct  544   LGFHEMGIQIHAYVLKSGFVSDIGLGSAIFSMYSKCGNIDDAIKSFNVMPKHDMASWNGL  603

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             +AG++LHR+GDEAL  WS+ME++GI PDSFT + ILSAYR+T  N V++C S F SM+S 
Sbjct  604   IAGHLLHRKGDEALSIWSKMEKIGIKPDSFTLVLILSAYRYTRSNCVDKCHSLFLSMRSL  663

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPK-SSVWRALLDSCIMHLNSSIGK  2820
             YG+ P  +HYA +V V GYWG  +EAEE IN MP E   S+ WRALLDSC + LN+S+G+
Sbjct  664   YGIEPTPEHYASMVDVFGYWGYFKEAEELINNMPHESDGSAAWRALLDSCRLWLNASLGR  723

Query  2819  R-------------------------VIKKILSMEPQDPSTFILKSNLYSASGRWQCSEL  2715
                                         K +L++EPQDPS +IL SNLYSASGRW C+E 
Sbjct  724   SDGKHLSDMGPRDPSMYILVSNLGRLAAKHLLAIEPQDPSMYILVSNLYSASGRWHCAER  783

Query  2714  VRAEMKEKGFQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPD  2535
             VR EM+EKG QKIPG+SW I Q+K +SF+ARD S+ QSKDIYS L+ILILEC+K GYVPD
Sbjct  784   VREEMREKGLQKIPGRSWYIHQNKVYSFYARDKSYSQSKDIYSGLEILILECLKVGYVPD  843

Query  2534  TSYVLHEVEEYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASI  2355
             TS+VLHEVEE+QKKDFLF+HSAKLA+TYGLLMTKHG+P+RV KNI LCGDCHTFFK  S 
Sbjct  844   TSFVLHEVEEHQKKDFLFYHSAKLAVTYGLLMTKHGRPIRVTKNISLCGDCHTFFKYVST  903

Query  2354  VTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             VT REI +RD SGFH F NG+CSC D W
Sbjct  904   VTGREISLRDASGFHNFKNGECSCRDYW  931


 Score =   108 bits (271),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 146/311 (47%), Gaps = 14/311 (5%)
 Frame = -3

Query  4058  FMRRGQELHAHALRIGYESNLSV----------NNALIKFYTRCGSIKSVMALFERMLV-  3912
             F+ R Q+L  H       S++S           N+ L++   R G I+   A+   ++  
Sbjct  65    FLTRPQQLQLHNSSQALGSSVSADDDAVSLPDRNHQLLRLSIRHGDIELASAVHASIVKA  124

Query  3911  -RDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYR  3735
               D    N +I AY++   +  A++ F  L   + V Y+A+++ + ++ +  KA+  F++
Sbjct  125   EEDVHLSNSLIAAYLKLDRITDAQKTFACLSSPDVVSYSALVSAYAKSKQEDKAIELFFK  184

Query  3734  MIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGR  3555
             M    IE ++F+  +I  AC  L + +   QIH   +K+G      +  AL+ +  R   
Sbjct  185   MRGSGIEPNEFSFVAILTACIRLSDLQLGYQIHSLAIKTGYSYCVYVSNALMGVYIRSEC  244

Query  3554  MEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtv  3375
             +  A ++F  M      + +  +++    +  Q E A  LF + Q    + VD    +++
Sbjct  245   INHAYQLFGEM--AERDVSSWNTIISAAVKELQYERAFDLFRDMQQIDQLRVDSFTLSSL  302

Query  3374  lgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDL  3195
             L           G+ +H  ALK G  S+V V N++I  Y KCG +++ V  FE M  +D+
Sbjct  303   LAASTGSLARMEGQKIHAHALKIGLQSNVSVNNSLIGFYTKCGSIEDVVAVFEKMPVKDI  362

Query  3194  CSWNSLLAGYV  3162
              SW  ++ GY+
Sbjct  363   ISWTGMITGYM  373


 Score = 58.5 bits (140),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  +K EED  LSN+LI+AYLKL  +  A   F  LSSP      A++S +AK  +E +
Sbjct  118   HASIVKAEEDVHLSNSLIAAYLKLDRITDAQKTFACLSSPDVVSYSALVSAYAKSKQEDK  177

Query  4461  AVELFYEMR  4435
             A+ELF++MR
Sbjct  178   AIELFFKMR  186



>ref|XP_010037103.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Eucalyptus grandis]
 gb|KCW48768.1| hypothetical protein EUGRSUZ_K02412 [Eucalyptus grandis]
Length=906

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/722 (58%), Positives = 536/722 (74%), Gaps = 1/722 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             L GSGI PNEYSFVA+LTACIR   LELG QVHAL+ K GYL+ST+V NALM +Y+KC  
Sbjct  185   LMGSGIHPNEYSFVAILTACIRLTELELGVQVHALVAKTGYLESTFVSNALMAMYNKCEC  244

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD  + LFD +PKRD+ASWNT++SG+VK  M+ RAFE F  M + D  R+D++ LS LL 
Sbjct  245   LDSALALFDEMPKRDVASWNTVVSGLVKAQMYERAFESFRQMDQIDGFRVDHMMLSVLLT  304

Query  4073  ACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             AC++   + RG+E+HAHA+RIG E++LSVNNALI FY + G+I  V ALFE+M  RD  T
Sbjct  305   ACTDASSLIRGKEIHAHAIRIGMETDLSVNNALIGFYIKYGTIDDVEALFEKMATRDVIT  364

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EMI AY E GL+DLA E+F  +PEKN V  NA+LAG C+NG+  + +  F  M++E +
Sbjct  365   WTEMIRAYAEFGLIDLAMEIFHIMPEKNCVSRNALLAGLCENGKAFEVLDLFISMVEEGL  424

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +D+TLT++A ACGLL E K S+Q+ GFI+K G   N C+EAALLDMCT CGRM  A K
Sbjct  425   ELTDYTLTTVAKACGLLGEGKLSEQLQGFIIKFGLLANACVEAALLDMCTHCGRMVAAGK  484

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F R P      +  TSM+ GYA+NG P+ AISLF   + EG +++DE+A+ ++LGVCGT
Sbjct  485   MFKRWPFEWDSSIICTSMICGYARNGLPDEAISLFCRCKAEGSIILDEIASISILGVCGT  544

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG  ++GE +HC  LK G  S++ V NA+ISMY+KC  +D A K F +M + ++ SWN L
Sbjct  545   LGSDRMGEQIHCHVLKSGLFSELEVANALISMYSKCWNMDTAKKVFNIMPAHNIVSWNGL  604

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             ++G+++HRRGD+AL  WS +   GI PD  + L  +SAY++T   +V+ C  FF SMQ+ 
Sbjct  605   ISGFIIHRRGDDALTVWSNLHNAGIKPDKISFLLAISAYKYTKMCLVDECCRFFSSMQTE  664

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             + + P+ +HYA LV VLG+WG LE AE+TI+ MPFEP++SVWRALLD C +H N+ +GKR
Sbjct  665   FDIEPSQEHYASLVGVLGFWGFLELAEKTISNMPFEPEASVWRALLDGCRIHSNAILGKR  724

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             VIK +L MEP+DPST++L +NLYSASGRW CSE VR EM+ KGFQK P +SWVI Q+K  
Sbjct  725   VIKHLLLMEPRDPSTYVLVANLYSASGRWHCSETVRKEMRVKGFQKQPSRSWVIHQNKTI  784

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
             SF+ RD SH Q+KDIYS L+ILI EC KAGY PDTS+VLHEV E+QK DFLF+HSAKLA 
Sbjct  785   SFYTRDKSHSQAKDIYSGLEILISECQKAGYEPDTSFVLHEVGEHQKLDFLFYHSAKLAA  844

Query  2456  TYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCND  2277
              +GLLM + GKP++++KNI LCGDCH F K  S VT R+I +RD SGFH F NG CSCND
Sbjct  845   AFGLLMNRPGKPIKIVKNISLCGDCHQFLKYTSAVTNRQILLRDASGFHYFSNGHCSCND  904

Query  2276  RW  2271
             RW
Sbjct  905   RW  906


 Score =   110 bits (275),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 136/541 (25%), Positives = 234/541 (43%), Gaps = 53/541 (10%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL   +   +++L   VHA+ ++L   ++  + NAL+  Y K G       +F  L +  
Sbjct  99    LLRFSVGCGDVDLARAVHAVFLRLELEENPSLGNALIVAYLKLGRTSDAYGVFGGLSRPS  158

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  ++SG+ K      A E+F  +  +     +Y +   +L AC     +  G ++H
Sbjct  159   VVSYTAVVSGLAKADRGLEAVEVFFRLMGSGIHPNEY-SFVAILTACIRLTELELGVQVH  217

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
             A   + GY  +  V+NAL+  Y +C  + S +ALF+ M  RD  +WN +++  +++ + +
Sbjct  218   ALVAKTGYLESTFVSNALMAMYNKCECLDSALALFDEMPKRDVASWNTVVSGLVKAQMYE  277

Query  3851  LAKELFDHLPEKNAVLYN----AVLAGFCQNGEGL-KAMAFFYRMIKESIEFSDFTLTSI  3687
              A E F  + + +    +    +VL   C +   L +        I+  +E    T  S+
Sbjct  278   RAFESFRQMDQIDGFRVDHMMLSVLLTACTDASSLIRGKEIHAHAIRIGME----TDLSV  333

Query  3686  ANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTR--------------CGRME  3549
              NA            + GF +K G    D +EA    M TR               G ++
Sbjct  334   NNA------------LIGFYIKYG--TIDDVEALFEKMATRDVITWTEMIRAYAEFGLID  379

Query  3548  DAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlg  3369
              A +IFH MP      V+  ++L G  +NG+    + LF     EGL + D   T  V  
Sbjct  380   LAMEIFHIMP--EKNCVSRNALLAGLCENGKAFEVLDLFISMVEEGLELTDYTLTT-VAK  436

Query  3368  vcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFEL----MSSR  3201
              CG LG  KL E L    +K G L++  V  A++ M   CG +  A K F+       S 
Sbjct  437   ACGLLGEGKLSEQLQGFIIKFGLLANACVEAALLDMCTHCGRMVAAGKMFKRWPFEWDSS  496

Query  3200  DLCSWNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILSAYRHTTKNVVNRCQ  3024
              +C+  S++ GY  +   DEA+  + R +  G I+ D    + IL        + +   Q
Sbjct  497   IICT--SMICGYARNGLPDEAISLFCRCKAEGSIILDEIASISILGVCGTLGSDRMGE-Q  553

Query  3023  SFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIM  2844
                  ++S  G+    +    L+S+      ++ A++  N MP     S W  L+   I+
Sbjct  554   IHCHVLKS--GLFSELEVANALISMYSKCWNMDTAKKVFNIMPAHNIVS-WNGLISGFII  610

Query  2843  H  2841
             H
Sbjct  611   H  611


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 6/64 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVEL  4450
             L+LEE+  L NALI AYLKLG    A  VF  LS P      A++SG AK +R +EAVE+
Sbjct  122   LELEENPSLGNALIVAYLKLGRTSDAYGVFGGLSRPSVVSYTAVVSGLAKADRGLEAVEV  181

Query  4449  FYEM  4438
             F+ +
Sbjct  182   FFRL  185



>ref|XP_008462517.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Cucumis melo]
Length=905

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/719 (57%), Positives = 538/719 (75%), Gaps = 1/719 (0%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             SGIEPNEY+FVA+LTACIR+ + +LG QVH +++KLG+L   ++ NALMGLY KCG L  
Sbjct  187   SGIEPNEYTFVAILTACIRNMDYQLGLQVHGIVVKLGFLSCVFICNALMGLYCKCGFLGL  246

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
             V+ LF+ + +RDI SWNT+IS +VKE  +  AF+ F  MQ    LR+D+ +LSTLL AC+
Sbjct  247   VLRLFEEMLERDITSWNTVISSLVKEFKYDEAFDYFRGMQLCKGLRVDHFSLSTLLTACA  306

Query  4064  ECFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
                   +GQ+LHA AL++G ES+LSV+N+LI FYT+CGS   V  LFE M +RD  TW  
Sbjct  307   GSVKPMKGQQLHALALKVGLESHLSVSNSLIGFYTKCGSANDVKDLFETMPIRDVITWTG  366

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             MIT+YME G++DLA E+FD +P++N + YNAVLAG  +NG+G +A+  F  M++E IE S
Sbjct  367   MITSYMEFGMLDLAVEVFDKMPKRNCISYNAVLAGLSRNGDGSRALELFIEMLEEGIEIS  426

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
             D TLTSI  ACGLL   K S+QI GF++K G   N CIE AL+DM TRCGRMEDAEK+FH
Sbjct  427   DCTLTSIITACGLLKSFKVSQQIQGFVVKFGILSNSCIETALVDMYTRCGRMEDAEKMFH  486

Query  3527  RMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgl  3348
             +  L +     LTSM+ GY +NG+   AISLF   Q EG +V+DEV + ++L +CG +G 
Sbjct  487   QRSLENDYTAMLTSMICGYTRNGKLNEAISLFHSGQSEGAIVMDEVVSTSILSLCGNIGF  546

Query  3347  lklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAG  3168
              ++G+ +HC ALK G ++D  VGNA +SMY+KC  +D+AV  F  M+ +D+ SWN L+AG
Sbjct  547   HEMGKQMHCHALKSGLITDTGVGNATVSMYSKCWNMDDAVHVFNTMNMQDIVSWNGLVAG  606

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGV  2988
             +VLH +GD+AL  W +ME+ GI PD+ T   I+SAY+HT  N+V+ C+S F SM++ + +
Sbjct  607   HVLHWQGDKALGIWKKMEKAGIKPDNITFALIISAYKHTELNLVDSCRSLFVSMETEHNI  666

Query  2987  LPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIK  2808
              P  +HYA  +SVLG WGLLEEAE+TI  MPFEP   VWRALL+SC ++ N  + K  ++
Sbjct  667   KPTLEHYASFISVLGRWGLLEEAEQTIRNMPFEPDVYVWRALLNSCKINKNERLEKLAVR  726

Query  2807  KILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFF  2628
              IL++EP+DP ++ILKSNLYSASGRW  SE VR +M+EKGF+K P QSW+I ++K HSF+
Sbjct  727   NILAVEPKDPFSYILKSNLYSASGRWHYSEKVREDMREKGFRKHPSQSWIIHENKIHSFY  786

Query  2627  ARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYG  2448
             ARD SH Q KDIYS L+ILILEC+K GYVPDTS+VL EVEE QKK+FLF+HS KLA T+G
Sbjct  787   ARDRSHPQVKDIYSGLEILILECLKIGYVPDTSFVLQEVEERQKKEFLFYHSGKLAATFG  846

Query  2447  LLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             +LMTK GKP++++KN+ LCGDCHTF K  SIVT+R+I +RDTSGFHCF++G+CSC D W
Sbjct  847   ILMTKPGKPIQIVKNVRLCGDCHTFLKYVSIVTRRKILLRDTSGFHCFIDGQCSCTDYW  905


 Score =   126 bits (316),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 136/567 (24%), Positives = 244/567 (43%), Gaps = 81/567 (14%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL    R  + +L   VHA  +KL   +  ++ NAL+  Y K G +    ++F  L   +
Sbjct  100   LLRLSTRYGDPDLARAVHAQFLKLE--EDIFLGNALISAYLKLGLVRDADKVFSGLSCPN  157

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  +ISG  K +    A ELF  M  +     +Y T   +L AC      + G ++H
Sbjct  158   VVSYTALISGFSKSNWEDEAVELFFAMLDSGIEPNEY-TFVAILTACIRNMDYQLGLQVH  216

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
                +++G+ S + + NAL+  Y +CG +  V+ LFE ML RD  +WN +I++ ++    D
Sbjct  217   GIVVKLGFLSCVFICNALMGLYCKCGFLGLVLRLFEEMLERDITSWNTVISSLVKEFKYD  276

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
                E FD+                     G++        + + +    F+L+++  AC 
Sbjct  277   ---EAFDYF-------------------RGMQ--------LCKGLRVDHFSLSTLLTACA  306

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGH------  3510
               ++    +Q+H   LK G E +  +  +L+   T+CG   D + +F  MP+        
Sbjct  307   GSVKPMKGQQLHALALKVGLESHLSVSNSLIGFYTKCGSANDVKDLFETMPIRDVITWTG  366

Query  3509  --------GRL---------------VALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                     G L               ++  ++L G ++NG    A+ LF E   EG+ + 
Sbjct  367   MITSYMEFGMLDLAVEVFDKMPKRNCISYNAVLAGLSRNGDGSRALELFIEMLEEGIEIS  426

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
             D   T+ ++  CG L   K+ + +    +K G LS+  +  A++ MY +CG +++A K F
Sbjct  427   DCTLTS-IITACGLLKSFKVSQQIQGFVVKFGILSNSCIETALVDMYTRCGRMEDAEKMF  485

Query  3218  ELMSSRD--LCSWNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILS-----A  3063
                S  +       S++ GY  + + +EA+  +   +  G IV D      ILS      
Sbjct  486   HQRSLENDYTAMLTSMICGYTRNGKLNEAISLFHSGQSEGAIVMDEVVSTSILSLCGNIG  545

Query  3062  YRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPK  2883
             +    K +   C +    + +  GV  A+      VS+      +++A    NTM  +  
Sbjct  546   FHEMGKQM--HCHALKSGLITDTGVGNAT------VSMYSKCWNMDDAVHVFNTMNMQDI  597

Query  2882  SSVWRALLDSCIMHLNSSIGKRVIKKI  2802
              S W  L+   ++H        + KK+
Sbjct  598   VS-WNGLVAGHVLHWQGDKALGIWKKM  623


 Score = 82.0 bits (201),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 65/111 (59%), Gaps = 22/111 (20%)
 Frame = -2

Query  4707  LSIQEPLLSSDPLINSSISTY---------------PEQHAVDYADFLKLEEDTRLSNAL  4573
             +S+ EPL +S PL N+S+ST                P+     +A FLKLEED  L NAL
Sbjct  75    VSVSEPLFASRPL-NTSLSTVASPFDLLRLSTRYGDPDLARAVHAQFLKLEEDIFLGNAL  133

Query  4572  ISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVELFYEM  4438
             ISAYLKLGLV  A  VF  LS P      A+ISGF+K N E EAVELF+ M
Sbjct  134   ISAYLKLGLVRDADKVFSGLSCPNVVSYTALISGFSKSNWEDEAVELFFAM  184



>ref|XP_010543483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Tarenaya hassleriana]
Length=894

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/723 (56%), Positives = 532/723 (74%), Gaps = 2/723 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK-CG  4257
             +R  G++PNEY+FVA+LT C+R     LG Q+H L++K GY  S YV NALM +YSK  G
Sbjct  172   MRREGVQPNEYTFVAILTTCVRISRFSLGLQIHGLIVKSGYFHSVYVGNALMDMYSKLSG  231

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L  V+ LFD +P RD+ SWNT+IS +V+E ++  AF+LF  M   + + +D  T+STLL
Sbjct  232   FLSDVLRLFDEMPHRDMVSWNTVISSLVREGLYEEAFDLFYAMDPKEAILVDSFTVSTLL  291

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              A ++    RRG+ELH  A+RIG + +LSVNNALI FYT+CG IK V  LF+ M VRD  
Sbjct  292   TASTDTGESRRGKELHGRAVRIGLKEDLSVNNALIGFYTKCGDIKKVENLFQMMPVRDVV  351

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             TW EMITAYM  G+VD+A E+F+ +PE+N V YNA+LAGFC+NG+GLKA+  F  M++  
Sbjct  352   TWTEMITAYMAFGIVDMALEMFESMPERNGVSYNALLAGFCRNGDGLKALKLFVEMVQGG  411

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +  +DF LTS  +ACGL+ E+K+S+Q+HGF +KSG   N  I  ALLDMCTRCGRM DAE
Sbjct  412   LGMTDFGLTSAVDACGLVTEKKTSEQVHGFCIKSGFASNPFINTALLDMCTRCGRMADAE  471

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             K+F + P     L   TSML GYA+NG PE A+S F  T     +V+DEV+  ++L VCG
Sbjct  472   KMFSQWPSDLDSLKVTTSMLCGYARNGLPEKALSFFLHTMCNEELVLDEVSLTSILAVCG  531

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG L++G  +HC ALK G  SD+V+GN++I MY+KC   D+A++ F  +   ++ SWNS
Sbjct  532   TLGFLEMGCQIHCYALKTGHTSDIVLGNSLIGMYSKCYNSDDAIRVFNGIPRHNVVSWNS  591

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L++ YVL R GD+ LD+WSRM+R G+ PD+ T + ++SAYR+T  N+V+ C+  F SM++
Sbjct  592   LISAYVLQRDGDKGLDSWSRMKREGVKPDTVTLVLVISAYRYTESNLVSSCRDLFLSMKT  651

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y + P S+HY   V VLG+WG LEEAEETI +MPFEP+ SV +ALLDSC +H N+SI K
Sbjct  652   TYSIEPTSEHYTAFVGVLGHWGFLEEAEETIKSMPFEPEVSVLKALLDSCRVHSNTSIAK  711

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             RV   +LSMEP DPS +ILKSN+YSASG W  +E+VR +M+EKGF+K P +SW+I Q+K 
Sbjct  712   RVANLMLSMEPHDPSGYILKSNIYSASGLWHQAEMVREKMREKGFRKHPSRSWIIHQNKV  771

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSF+ARD SH Q KDIY  L+ILI+EC+KAGY PDT +VLHEVEE+QKK FLF+HSAK+A
Sbjct  772   HSFYARDKSHPQEKDIYRGLEILIMECLKAGYEPDTGFVLHEVEEHQKKSFLFYHSAKMA  831

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
              TYG+L +  GKPVRV+KN++LCGDCH F K  S+VTKREI VRD+SGFH  ++GKCSC 
Sbjct  832   ATYGILTSSRGKPVRVVKNVMLCGDCHEFLKYVSVVTKREIVVRDSSGFHHLVSGKCSCR  891

Query  2279  DRW  2271
             D W
Sbjct  892   DLW  894


 Score =   126 bits (317),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 113/451 (25%), Positives = 198/451 (44%), Gaps = 66/451 (15%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL   ++  + EL   VH   +KL   ++T + NAL+  Y K G L     +F +L    
Sbjct  87    LLRLSVQYHDPELAKAVHGSFLKLQE-ENTRLGNALISAYLKLGFLRDAFLVFTSLSSPS  145

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECFMRRGQELHA  4029
             + S+ ++ISG  + +    AF+LF  M+R      +Y  ++ L           G ++H 
Sbjct  146   VVSYTSLISGFARLNREIEAFKLFFGMRREGVQPNEYTFVAILTTCVRISRFSLGLQIHG  205

Query  4028  HALRIGYESNLSVNNALIKFYTR-CGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
               ++ GY  ++ V NAL+  Y++  G +  V+ LF+ M  RD  +WN +I++ +  GL +
Sbjct  206   LIVKSGYFHSVYVGNALMDMYSKLSGFLSDVLRLFDEMPHRDMVSWNTVISSLVREGLYE  265

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A +LF  +  K A+L ++                              FT++++  A  
Sbjct  266   EAFDLFYAMDPKEAILVDS------------------------------FTVSTLLTAST  295

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP---------  3519
                E +  K++HG  ++ G + +  +  AL+   T+CG ++  E +F  MP         
Sbjct  296   DTGESRRGKELHGRAVRIGLKEDLSVNNALIGFYTKCGDIKKVENLFQMMPVRDVVTWTE  355

Query  3518  --------------------LGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                                 +     V+  ++L G+ +NG    A+ LF E    GL + 
Sbjct  356   MITAYMAFGIVDMALEMFESMPERNGVSYNALLAGFCRNGDGLKALKLFVEMVQGGLGMT  415

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
             D   T+  +  CG +   K  E +H   +K GF S+  +  A++ M  +CG + +A K F
Sbjct  416   DFGLTS-AVDACGLVTEKKTSEQVHGFCIKSGFASNPFINTALLDMCTRCGRMADAEKMF  474

Query  3218  ELMSSRDLCSW---NSLLAGYVLHRRGDEAL  3135
                 S DL S     S+L GY  +   ++AL
Sbjct  475   SQWPS-DLDSLKVTTSMLCGYARNGLPEKAL  504


 Score =   121 bits (303),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 144/284 (51%), Gaps = 4/284 (1%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             K+V   F ++   +    N +I+AY++ G +  A  +F  L   + V Y ++++GF +  
Sbjct  101   KAVHGSFLKLQEENTRLGNALISAYLKLGFLRDAFLVFTSLSSPSVVSYTSLISGFARLN  160

Query  3767  EGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEA  3588
               ++A   F+ M +E ++ +++T  +I   C  +       QIHG I+KSG   +  +  
Sbjct  161   REIEAFKLFFGMRREGVQPNEYTFVAILTTCVRISRFSLGLQIHGLIVKSGYFHSVYVGN  220

Query  3587  ALLDMCTR-CGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEG  3411
             AL+DM ++  G + D  ++F  MP  H  +V+  +++    + G  E A  LF+    + 
Sbjct  221   ALMDMYSKLSGFLSDVLRLFDEMP--HRDMVSWNTVISSLVREGLYEEAFDLFYAMDPKE  278

Query  3410  LVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNA  3231
              ++VD    +T+L      G  + G+ LH  A++ G   D+ V NA+I  Y KCG++   
Sbjct  279   AILVDSFTVSTLLTASTDTGESRRGKELHGRAVRIGLKEDLSVNNALIGFYTKCGDIKKV  338

Query  3230  VKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM-ERLGI  3102
                F++M  RD+ +W  ++  Y+     D AL+ +  M ER G+
Sbjct  339   ENLFQMMPVRDVVTWTEMITAYMAFGIVDMALEMFESMPERNGV  382


 Score = 82.4 bits (202),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 7/79 (9%)
 Frame = -2

Query  4644  PEQHAVDYADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSPAI------ISGF  4486
             PE     +  FLKL EE+TRL NALISAYLKLG +  A  VF SLSSP++      ISGF
Sbjct  97    PELAKAVHGSFLKLQEENTRLGNALISAYLKLGFLRDAFLVFTSLSSPSVVSYTSLISGF  156

Query  4485  AKINREIEAVELFYEMRLE  4429
             A++NREIEA +LF+ MR E
Sbjct  157   ARLNREIEAFKLFFGMRRE  175



>ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Cucumis sativus]
 gb|KGN48219.1| hypothetical protein Csa_6G449260 [Cucumis sativus]
Length=908

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/719 (56%), Positives = 536/719 (75%), Gaps = 1/719 (0%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             SGIEPNEY+FVA+LTACIR+ + +LG QVH +++KLG L   ++ NALMGLY KCG LD 
Sbjct  190   SGIEPNEYTFVAILTACIRNMDYQLGSQVHGIVVKLGLLSCVFICNALMGLYCKCGFLDL  249

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
             V+ LF+ +P+RDI SWNT+IS +VKE  +  AF+ F  MQ    L++D+ +LSTLL AC+
Sbjct  250   VLRLFEEMPERDITSWNTVISSLVKEFKYDEAFDYFRGMQLCKGLKVDHFSLSTLLTACA  309

Query  4064  ECFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
                   +GQ+LHA AL++G ES+LSV+++LI FYT+CGS   V  LFE M +RD  TW  
Sbjct  310   GSVKPMKGQQLHALALKVGLESHLSVSSSLIGFYTKCGSANDVTDLFETMPIRDVITWTG  369

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             MIT+YME G++D A E+F+ +P++N + YNAVLAG  +N +G +A+  F  M++E +E S
Sbjct  370   MITSYMEFGMLDSAVEVFNKMPKRNCISYNAVLAGLSRNDDGSRALELFIEMLEEGVEIS  429

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
             D TLTSI  ACGLL   K S+QI GF++K G   N CIE AL+DM TRCGRMEDAEKIF+
Sbjct  430   DCTLTSIITACGLLKSFKVSQQIQGFVMKFGILSNSCIETALVDMYTRCGRMEDAEKIFY  489

Query  3527  RMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgl  3348
             +  L +     LTSM+ GYA+NG+   AISLF   Q EG +V+DEV + ++L +CG++G 
Sbjct  490   QRSLENDYTAMLTSMICGYARNGKLNEAISLFHSGQSEGAIVMDEVMSTSILSLCGSIGF  549

Query  3347  lklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAG  3168
              ++G+ +HC ALK G +++  VGNA +SMY+KC  +D+AV+ F  M+ +D+ SWN L+AG
Sbjct  550   HEMGKQMHCHALKSGLITETGVGNATVSMYSKCWNMDDAVRVFNTMNMQDIVSWNGLVAG  609

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGV  2988
             +VLH +GD+AL  W +ME+ GI PDS T   I+SAY+HT  N+V+ C+S F SM++ + +
Sbjct  610   HVLHWQGDKALGIWKKMEKAGIKPDSITFALIISAYKHTELNLVDSCRSLFVSMETEHNI  669

Query  2987  LPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIK  2808
              P  +HYA  +SVLG WGLLEEAE+TI  MP EP   VWRALL+SC ++ N  + K   +
Sbjct  670   KPTLEHYASFISVLGRWGLLEEAEQTIRNMPLEPDVYVWRALLNSCRINKNERLEKLAAR  729

Query  2807  KILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFF  2628
              IL++EP+DP ++ILKSNLYSASGRW  SE VR +M+EKGF+K P QSW+I ++K HSF+
Sbjct  730   NILAVEPKDPLSYILKSNLYSASGRWYYSEKVREDMREKGFRKHPSQSWIIHENKIHSFY  789

Query  2627  ARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYG  2448
             ARD SH Q KDIYS L+ILILEC+K GYVPDTS+VL EVEE QKK+FLF+HS KLA T+G
Sbjct  790   ARDRSHPQGKDIYSGLEILILECLKVGYVPDTSFVLQEVEERQKKEFLFYHSGKLAATFG  849

Query  2447  LLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             +LMTK GKP++++KN+ LCGDCH F K  SIVT+R+I +RDTSGFH F++G+CSC D W
Sbjct  850   ILMTKPGKPIQIVKNVRLCGDCHNFLKYVSIVTRRKILLRDTSGFHWFIDGQCSCTDYW  908


 Score =   120 bits (301),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 142/587 (24%), Positives = 248/587 (42%), Gaps = 84/587 (14%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL    R  + +L   VHA  +KL   +  ++ NAL+  Y K G +    ++F  L   +
Sbjct  103   LLRLSTRYGDPDLARAVHAQFLKLE--EDIFLGNALISAYLKLGLVRDADKVFSGLSCPN  160

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  +ISG  K      A ELF  M  +     +Y T   +L AC      + G ++H
Sbjct  161   VVSYTALISGFSKSDWEDEAVELFFAMLDSGIEPNEY-TFVAILTACIRNMDYQLGSQVH  219

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
                +++G  S + + NAL+  Y +CG +  V+ LFE M  RD  +WN +I++ ++    D
Sbjct  220   GIVVKLGLLSCVFICNALMGLYCKCGFLDLVLRLFEEMPERDITSWNTVISSLVKEFKYD  279

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A + F  +                Q  +GLK                 F+L+++  AC 
Sbjct  280   EAFDYFRGM----------------QLCKGLKV--------------DHFSLSTLLTACA  309

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGH------  3510
               ++    +Q+H   LK G E +  + ++L+   T+CG   D   +F  MP+        
Sbjct  310   GSVKPMKGQQLHALALKVGLESHLSVSSSLIGFYTKCGSANDVTDLFETMPIRDVITWTG  369

Query  3509  --------GRL---------------VALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                     G L               ++  ++L G ++N     A+ LF E   EG+ + 
Sbjct  370   MITSYMEFGMLDSAVEVFNKMPKRNCISYNAVLAGLSRNDDGSRALELFIEMLEEGVEIS  429

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
             D   T+ ++  CG L   K+ + +    +K G LS+  +  A++ MY +CG +++A K F
Sbjct  430   DCTLTS-IITACGLLKSFKVSQQIQGFVMKFGILSNSCIETALVDMYTRCGRMEDAEKIF  488

Query  3218  ELMSSRD--LCSWNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILS-----A  3063
                S  +       S++ GY  + + +EA+  +   +  G IV D      ILS      
Sbjct  489   YQRSLENDYTAMLTSMICGYARNGKLNEAISLFHSGQSEGAIVMDEVMSTSILSLCGSIG  548

Query  3062  YRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPK  2883
             +    K +   C +    + +  GV  A+      VS+      +++A    NTM  +  
Sbjct  549   FHEMGKQM--HCHALKSGLITETGVGNAT------VSMYSKCWNMDDAVRVFNTMNMQDI  600

Query  2882  SSVWRALLDSCIMHLNSSIGKRVIKKI--LSMEPQDPSTFILKSNLY  2748
              S W  L+   ++H        + KK+    ++P D  TF L  + Y
Sbjct  601   VS-WNGLVAGHVLHWQGDKALGIWKKMEKAGIKP-DSITFALIISAY  645


 Score = 77.0 bits (188),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 77/142 (54%), Gaps = 27/142 (19%)
 Frame = -2

Query  4794  LSASNPISSLSVIKPNHKFNPAFLLSNAS--LSIQEPLLSSDPLINSSISTY--------  4645
             LS SNP   L   +P +  +P    ++    +S+ EPL +S  L N+S+ST         
Sbjct  50    LSLSNPNPCL---RPFNSTSPTQFFTSPQHLVSLSEPLFASRSL-NTSLSTIASPFDLLR  105

Query  4644  -------PEQHAVDYADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------  4504
                    P+     +A FLKLEED  L NALISAYLKLGLV  A  VF  LS P      
Sbjct  106   LSTRYGDPDLARAVHAQFLKLEEDIFLGNALISAYLKLGLVRDADKVFSGLSCPNVVSYT  165

Query  4503  AIISGFAKINREIEAVELFYEM  4438
             A+ISGF+K + E EAVELF+ M
Sbjct  166   ALISGFSKSDWEDEAVELFFAM  187



>ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Cucumis sativus]
Length=908

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/719 (56%), Positives = 535/719 (74%), Gaps = 1/719 (0%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             SGIEPNEY+FVA+LTACIR+ + +LG QVH +++KLG L   ++ NALMGLY KCG LD 
Sbjct  190   SGIEPNEYTFVAILTACIRNMDYQLGSQVHGIVVKLGLLSCVFICNALMGLYCKCGFLDL  249

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
             V+ LF+ +P+RDI SWNT+IS +VKE  +  AF+ F  MQ    L++D+ +LSTLL AC+
Sbjct  250   VLRLFEEMPERDITSWNTVISSLVKEFKYDEAFDYFRGMQLCKGLKVDHFSLSTLLTACA  309

Query  4064  ECFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
                   +GQ+LHA AL++G ES+LSV+++LI FYT+CGS   V  LFE M +RD  TW  
Sbjct  310   GSVKPMKGQQLHALALKVGLESHLSVSSSLIGFYTKCGSANDVTDLFETMPIRDVITWTG  369

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             MIT+YME G++D A E+F+ +P++N + YNAVLAG  +N +G +A+  F  M++E +E S
Sbjct  370   MITSYMEFGMLDSAVEVFNKMPKRNCISYNAVLAGLSRNDDGSRALELFIEMLEEGVEIS  429

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
             D TLTSI  ACGLL   K S+QI GF++K G   N CIE AL+DM TRCGRMEDAEKIF+
Sbjct  430   DCTLTSIITACGLLKSFKVSQQIQGFVMKFGILSNSCIETALVDMYTRCGRMEDAEKIFY  489

Query  3527  RMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgl  3348
             +  L +     LTSM+ GYA+NG+   AISLF   Q EG +V+DEV + ++L +CG++G 
Sbjct  490   QRSLENDYTAMLTSMICGYARNGKLNEAISLFHSGQSEGAIVMDEVMSTSILSLCGSIGF  549

Query  3347  lklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAG  3168
              ++G  +HC ALK G +++  VGNA +SMY+KC  +D+AV+ F  M+ +D+ SWN L+AG
Sbjct  550   HEMGMQMHCHALKSGLITETGVGNATVSMYSKCWNMDDAVRVFNTMNMQDIVSWNGLVAG  609

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGV  2988
             +VLH +GD+AL  W +ME+ GI PDS T   I+SAY+HT  N+V+ C+S F SM++ + +
Sbjct  610   HVLHWQGDKALGIWKKMEKAGIKPDSITFALIISAYKHTELNLVDSCRSLFVSMETEHNI  669

Query  2987  LPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIK  2808
              P  +HYA  +SVLG WGLLEEAE+TI  MP EP   VWRALL+SC ++ N  + K   +
Sbjct  670   KPTLEHYASFISVLGRWGLLEEAEQTIRNMPLEPDVYVWRALLNSCRINKNERLEKLAAR  729

Query  2807  KILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFF  2628
              IL++EP+DP ++ILKSNLYSASGRW  SE VR +M+EKGF+K P QSW+I ++K HSF+
Sbjct  730   NILAVEPKDPLSYILKSNLYSASGRWYYSEKVREDMREKGFRKHPSQSWIIHENKIHSFY  789

Query  2627  ARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYG  2448
             ARD SH Q KDIYS L+ILILEC+K GYVPDTS+VL EVEE QKK+FLF+HS KLA T+G
Sbjct  790   ARDRSHPQGKDIYSGLEILILECLKVGYVPDTSFVLQEVEERQKKEFLFYHSGKLAATFG  849

Query  2447  LLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             +LMTK GKP++++KN+ LCGDCH F K  SIVT+R+I +RDTSGFH F++G+CSC D W
Sbjct  850   ILMTKPGKPIQIVKNVRLCGDCHNFLKYVSIVTRRKILLRDTSGFHWFIDGQCSCTDYW  908


 Score =   119 bits (298),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 119/474 (25%), Positives = 206/474 (43%), Gaps = 67/474 (14%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL    R  + +L   VHA  +KL   +  ++ NAL+  Y K G +    ++F  L   +
Sbjct  103   LLRLSTRYGDPDLARAVHAQFLKLE--EDIFLGNALISAYLKLGLVRDADKVFSGLSCPN  160

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  +ISG  K      A ELF  M  +     +Y T   +L AC      + G ++H
Sbjct  161   VVSYTALISGFSKSDWEDEAVELFFAMLDSGIEPNEY-TFVAILTACIRNMDYQLGSQVH  219

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
                +++G  S + + NAL+  Y +CG +  V+ LFE M  RD  +WN +I++ ++    D
Sbjct  220   GIVVKLGLLSCVFICNALMGLYCKCGFLDLVLRLFEEMPERDITSWNTVISSLVKEFKYD  279

Query  3851  LAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACG  3672
              A + F  +                Q  +GLK                 F+L+++  AC 
Sbjct  280   EAFDYFRGM----------------QLCKGLKV--------------DHFSLSTLLTACA  309

Query  3671  LLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGH------  3510
               ++    +Q+H   LK G E +  + ++L+   T+CG   D   +F  MP+        
Sbjct  310   GSVKPMKGQQLHALALKVGLESHLSVSSSLIGFYTKCGSANDVTDLFETMPIRDVITWTG  369

Query  3509  --------GRL---------------VALTSMLRGYAQNGQPENAISLFFETQLEGLVVV  3399
                     G L               ++  ++L G ++N     A+ LF E   EG+ + 
Sbjct  370   MITSYMEFGMLDSAVEVFNKMPKRNCISYNAVLAGLSRNDDGSRALELFIEMLEEGVEIS  429

Query  3398  DEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAF  3219
             D   T+ ++  CG L   K+ + +    +K G LS+  +  A++ MY +CG +++A K F
Sbjct  430   DCTLTS-IITACGLLKSFKVSQQIQGFVMKFGILSNSCIETALVDMYTRCGRMEDAEKIF  488

Query  3218  ELMSSRD--LCSWNSLLAGYVLHRRGDEALDTWSRMERLG-IVPDSFTCLHILS  3066
                S  +       S++ GY  + + +EA+  +   +  G IV D      ILS
Sbjct  489   YQRSLENDYTAMLTSMICGYARNGKLNEAISLFHSGQSEGAIVMDEVMSTSILS  542


 Score = 77.0 bits (188),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 77/142 (54%), Gaps = 27/142 (19%)
 Frame = -2

Query  4794  LSASNPISSLSVIKPNHKFNPAFLLSNAS--LSIQEPLLSSDPLINSSISTY--------  4645
             LS SNP   L   +P +  +P    ++    +S+ EPL +S  L N+S+ST         
Sbjct  50    LSLSNPNPCL---RPFNSTSPTQFFTSPQHLVSLSEPLFASRSL-NTSLSTIASPFDLLR  105

Query  4644  -------PEQHAVDYADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------  4504
                    P+     +A FLKLEED  L NALISAYLKLGLV  A  VF  LS P      
Sbjct  106   LSTRYGDPDLARAVHAQFLKLEEDIFLGNALISAYLKLGLVRDADKVFSGLSCPNVVSYT  165

Query  4503  AIISGFAKINREIEAVELFYEM  4438
             A+ISGF+K + E EAVELF+ M
Sbjct  166   ALISGFSKSDWEDEAVELFFAM  187



>ref|XP_004494120.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
isoform X1 [Cicer arietinum]
 ref|XP_004494121.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
isoform X2 [Cicer arietinum]
Length=883

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/721 (56%), Positives = 529/721 (73%), Gaps = 3/721 (0%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLD-STYVVNALMGLYSKCGSLD  4248
             S ++PN+Y++VA+LTAC R    + G Q+HA +IK G+ + S ++ NAL+  Y+KCG   
Sbjct  163   SSLQPNDYTYVAVLTACTRILYFQFGLQLHARVIKTGHFNNSVFISNALVSFYTKCGFYQ  222

Query  4247  FVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNAC  4068
                ++FD + +RDIASWNT++   V+E M+  AF LF DMQ  D L++DY TLSTLL AC
Sbjct  223   SAFKVFDEMRQRDIASWNTVMCCAVQEFMYDTAFRLFCDMQVIDGLKVDYFTLSTLLTAC  282

Query  4067  -SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWN  3891
              +   +  G+++HAHA+++G ++ L+V NALI FY  CG++  V+ LFERM VRD  TW 
Sbjct  283   GASALVVEGKQVHAHAVKVGLDAELNVGNALIGFYKNCGNVDDVICLFERMSVRDVITWT  342

Query  3890  EMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEF  3711
             EM+  YM  G VDLA ++F+ +P KN+V YNA+L+GFC+NGEGLKA+  F +M+ E +E 
Sbjct  343   EMMRVYMGFGSVDLALKMFNEMPVKNSVTYNALLSGFCRNGEGLKAVELFIKMVDEGMEL  402

Query  3710  SDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIF  3531
             +DF+L+S  NAC LL +   SKQ+HGF +K G   N C+E ALLDM T+CGRM +A+K+F
Sbjct  403   TDFSLSSGINACSLLGDYGVSKQMHGFAIKFGFGSNVCVEGALLDMYTKCGRMVEAKKMF  462

Query  3530  HRMPLGHG-RLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtl  3354
              R         VA TSM+ GYA+NGQPE AISLF     EG +++DEVA+ +++G+CGT+
Sbjct  463   SRWEESEEVSSVAWTSMMCGYARNGQPEEAISLFHLGHTEGKMIMDEVASTSMIGLCGTV  522

Query  3353  gllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLL  3174
             G L +G+ +HC   K GF S V VGNAV+SMY KCG  D+A+K F  MS  D  SWN+L+
Sbjct  523   GYLDMGKQIHCQVFKFGFQSIVGVGNAVVSMYFKCGNADDAIKMFSNMSFTDTVSWNTLI  582

Query  3173  AGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAY  2994
             +GY++H++G+ AL+ W  M+  GI PD  T + I+ AYRHT  N+V+ C S F SM++ Y
Sbjct  583   SGYLMHKQGNRALEVWLEMQEKGIKPDEVTFVLIILAYRHTNLNLVDDCCSLFNSMKTVY  642

Query  2993  GVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRV  2814
              V P  +HY+  V VL +WGLLEEA ETIN MPF+P + VWRALLD C +H N+ I K  
Sbjct  643   HVEPTFEHYSSFVRVLVHWGLLEEAVETINKMPFKPSALVWRALLDGCRLHKNTIIEKWA  702

Query  2813  IKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHS  2634
              K IL+++P+DPSTFIL SNLYS+SGRW CSE+VR  M+EKGF+K P QSW+I Q K HS
Sbjct  703   AKNILALDPKDPSTFILVSNLYSSSGRWDCSEMVRESMREKGFRKHPAQSWIISQKKMHS  762

Query  2633  FFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALT  2454
             F+ARD SH Q KDIYS L+ILILEC+K GY PDTS+VLHEVEE+ KK+FLFHHS+KLA T
Sbjct  763   FYARDKSHPQEKDIYSGLEILILECLKVGYEPDTSFVLHEVEEHHKKNFLFHHSSKLAAT  822

Query  2453  YGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDR  2274
             YG+LMTK GKP+R++KNILLCGDCHTF K  SIVTKR+I +RD+SGFHCF NG+CSC D 
Sbjct  823   YGILMTKPGKPIRIVKNILLCGDCHTFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDH  882

Query  2273  W  2271
             W
Sbjct  883   W  883


 Score =   100 bits (248),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 88/321 (27%), Positives = 155/321 (48%), Gaps = 17/321 (5%)
 Frame = -3

Query  3989  NNALIKFYTRCGS----IKSVMALFERMLVRDAFTWNE-----MITAYMESGLVDLAKEL  3837
             N +L+ F+ R  S    I    A+   +L R+    N      +I+ Y+   L+  A  L
Sbjct  65    NPSLLSFFLRLSSRHNDINLAKAIHATLLKRNDEIQNTHLSTALISTYINLRLLSYAHHL  124

Query  3836  FDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSDFTLTSIANACGLLME  3660
             F  L     V Y+A+++ F ++    +A+  F  MI   S++ +D+T  ++  AC  ++ 
Sbjct  125   FLSLSSPTVVSYSALISAFSKSNREHQALFLFLHMITTSSLQPNDYTYVAVLTACTRILY  184

Query  3659  RKSSKQIHGFILKSGCEPNDC-IEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSM  3483
              +   Q+H  ++K+G   N   I  AL+   T+CG  + A K+F  M      + +  ++
Sbjct  185   FQFGLQLHARVIKTGHFNNSVFISNALVSFYTKCGFYQSAFKVFDEMR--QRDIASWNTV  242

Query  3482  LRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHG  3303
             +    Q    + A  LF + Q+   + VD    +T+L  CG   L+  G+ +H  A+K G
Sbjct  243   MCCAVQEFMYDTAFRLFCDMQVIDGLKVDYFTLSTLLTACGASALVVEGKQVHAHAVKVG  302

Query  3302  FLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWS  3123
               +++ VGNA+I  Y  CG +D+ +  FE MS RD+ +W  ++  Y+     D AL  ++
Sbjct  303   LDAELNVGNALIGFYKNCGNVDDVICLFERMSVRDVITWTEMMRVYMGFGSVDLALKMFN  362

Query  3122  RMERLGIVPDSFTCLHILSAY  3060
              M     V +S T   +LS +
Sbjct  363   EMP----VKNSVTYNALLSGF  379



>ref|XP_010423659.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Camelina sativa]
Length=886

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/724 (55%), Positives = 539/724 (74%), Gaps = 5/724 (1%)
 Frame = -3

Query  4433  LRGSGI-EPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +R SGI +PNE++FVA+LTAC+R+    LG Q+H L++KLG+L+S +V N+LM LY+K  
Sbjct  165   MRKSGIVQPNEFTFVAILTACVRASRFSLGIQIHGLIVKLGFLNSVFVCNSLMSLYAKGS  224

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             S D V++LFD +P+RD+ SWNT+IS +VKE M  +AF+LF +M R + L +D  TLSTLL
Sbjct  225   SCDDVLKLFDEIPQRDVTSWNTVISSLVKEGMTDKAFDLFYEMNRVEGLGVDRFTLSTLL  284

Query  4076  NACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             ++  +  + RG+ELH  A+RIG    LSVNNALI FY++ G I+ V +L+E M+V+DA T
Sbjct  285   SSSDD--LLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDIEKVESLYEMMMVQDAVT  342

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
               EMITAYM  G+VD A E+F+ + EKN + YNA++AGFC+NG GLKA+  F  M+   +
Sbjct  343   STEMITAYMAFGMVDSAVEIFEDMTEKNTITYNALMAGFCRNGHGLKALKLFTDMLLRGV  402

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEP-NDCIEAALLDMCTRCGRMEDAE  3540
             E +DF+LTS  +ACGL+ E+K S+QIHGF +K GC   N CI+ ALLDMCTRC RM DAE
Sbjct  403   ELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCTRCERMADAE  462

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             ++F + P       A TS+L GYA+NG P+ A+SLF  T  E  +++DEV+   +L VCG
Sbjct  463   EMFDQWPSNLDSSKATTSILGGYARNGLPDKAVSLFHRTLCEEKLLLDEVSLTLILAVCG  522

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG  +LG  +HC ALK G+ S+V +GN++ISMY+KC + D+A+K F+ M   D+ SWNS
Sbjct  523   TLGFRELGYQIHCYALKGGYFSNVALGNSLISMYSKCWDSDDAIKVFKTMQDHDVVSWNS  582

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L++ Y+L R GDEAL  WSRM   GI PD  T   ++SA+R+T  N ++ C+  F SM++
Sbjct  583   LISCYILQRNGDEALALWSRMNDGGIKPDKITLTLVISAFRYTESNKLSSCRDLFLSMKT  642

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y + P ++HY   V VLG+WGLLEEAE+TIN+MPF P+ SV RALLDSC +H N+S+ K
Sbjct  643   VYDIEPTTEHYTAFVRVLGHWGLLEEAEDTINSMPFLPEVSVLRALLDSCRVHSNTSVAK  702

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             RV K ILS +P+ PS +ILKSN+YSASG W  SE++R EM+E+G++K P +SW+I ++K 
Sbjct  703   RVAKLILSTKPESPSEYILKSNIYSASGLWHRSEIIREEMRERGYRKHPAKSWIIHENKV  762

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSF ARDTSH Q KDIYS L+ILI+EC+KAGY P+T +VL EV+E+ KK FLFHHSAKLA
Sbjct  763   HSFHARDTSHPQEKDIYSGLEILIMECLKAGYEPNTEFVLQEVDEFMKKSFLFHHSAKLA  822

Query  2459  LTYGLLMTK-HGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             +TYG+L +   GKPVRV+KN++LCGDCH FFK  S+V K+EI +RD+SGFH F+NGKCSC
Sbjct  823   VTYGILTSNTRGKPVRVVKNVMLCGDCHEFFKYISVVVKKEIVLRDSSGFHHFVNGKCSC  882

Query  2282  NDRW  2271
              DRW
Sbjct  883   RDRW  886


 Score = 84.7 bits (208),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/314 (24%), Positives = 138/314 (44%), Gaps = 38/314 (12%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLG-YLDSTYVVNALMGLYSKC  4260
             D+   G+E  ++S  + + AC      ++  Q+H   IK G  L +  +  AL+ + ++C
Sbjct  396   DMLLRGVELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCTRC  455

Query  4259  GSLDFVIELFDNLPKRDIASWNT--MISGMVKESMFTRAFELFNDMQRNDCLRIDYITLS  4086
               +    E+FD  P    +S  T  ++ G  +  +  +A  LF+     + L +D ++L+
Sbjct  456   ERMADAEEMFDQWPSNLDSSKATTSILGGYARNGLPDKAVSLFHRTLCEEKLLLDEVSLT  515

Query  4085  TLLNACSECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVR  3909
              +L  C     R  G ++H +AL+ GY SN+++ N+LI  Y++C      + +F+ M   
Sbjct  516   LILAVCGTLGFRELGYQIHCYALKGGYFSNVALGNSLISMYSKCWDSDDAIKVFKTMQDH  575

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMI  3729
             D  +WN +I+ Y+                               +NG+  +A+A + RM 
Sbjct  576   DVVSWNSLISCYI-----------------------------LQRNGD--EALALWSRMN  604

Query  3728  KESIEFSDFTLTSIANACGLLMERKSSKQIHGFI-LKS--GCEPNDCIEAALLDMCTRCG  3558
                I+    TLT + +A       K S     F+ +K+    EP      A + +    G
Sbjct  605   DGGIKPDKITLTLVISAFRYTESNKLSSCRDLFLSMKTVYDIEPTTEHYTAFVRVLGHWG  664

Query  3557  RMEDAEKIFHRMPL  3516
              +E+AE   + MP 
Sbjct  665   LLEEAEDTINSMPF  678


 Score = 39.7 bits (91),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVEL  4450
             + + +D   S  +I+AY+  G+VD A+ +F+ ++        A+++GF +    ++A++L
Sbjct  334   MMMVQDAVTSTEMITAYMAFGMVDSAVEIFEDMTEKNTITYNALMAGFCRNGHGLKALKL  393

Query  4449  FYEMRLE  4429
             F +M L 
Sbjct  394   FTDMLLR  400


 Score = 94.0 bits (232),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 99/470 (21%), Positives = 202/470 (43%), Gaps = 76/470 (16%)
 Frame = -3

Query  4418  IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVI  4239
             IE     +  LL    +  ++E+   VHA  +KL  ++ T + NAL+  Y K G      
Sbjct  70    IESMVDGYFYLLRLSAQYDDVEVTRAVHASFLKL-RVEKTRLGNALISTYLKLGFPREAF  128

Query  4238  ELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSEC  4059
              +F ++    + S+  +ISG  + ++   A ++F  M+++  ++ +  T   +L AC   
Sbjct  129   LVFVSMTSPTVVSYTALISGFSRLNLEIEALKVFFRMRKSGIVQPNEFTFVAILTACVRA  188

Query  4058  F-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMI  3882
                  G ++H   +++G+ +++ V N+L+  Y +  S   V+ LF+ +  RD  +WN +I
Sbjct  189   SRFSLGIQIHGLIVKLGFLNSVFVCNSLMSLYAKGSSCDDVLKLFDEIPQRDVTSWNTVI  248

Query  3881  TAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSD  3705
             ++ ++ G+ D                               KA   FY M + E +    
Sbjct  249   SSLVKEGMTD-------------------------------KAFDLFYEMNRVEGLGVDR  277

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHR  3525
             FTL+++ ++   L+     +++HG  ++ G      +  AL+   ++ G +E  E ++  
Sbjct  278   FTLSTLLSSSDDLLR---GRELHGRAIRIGLMQELSVNNALIGFYSKFGDIEKVESLYEM  334

Query  3524  M-----------------------------PLGHGRLVALTSMLRGYAQNGQPENAISLF  3432
             M                              +     +   +++ G+ +NG    A+ LF
Sbjct  335   MMVQDAVTSTEMITAYMAFGMVDSAVEIFEDMTEKNTITYNALMAGFCRNGHGLKALKLF  394

Query  3431  FETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHG-FLSDVVVGNAVISMYA  3255
              +  L G+ + D   T+  +  CG +   K+ E +H   +K G  L +  +  A++ M  
Sbjct  395   TDMLLRGVELTDFSLTS-AVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCT  453

Query  3254  KCGELDNAVKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
             +C  + +A + F+     L SS+   +  S+L GY  +   D+A+  + R
Sbjct  454   RCERMADAEEMFDQWPSNLDSSK---ATTSILGGYARNGLPDKAVSLFHR  500


 Score = 87.0 bits (214),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 133/279 (48%), Gaps = 8/279 (3%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             ++V A F ++ V      N +I+ Y++ G    A  +F  +     V Y A+++GF +  
Sbjct  94    RAVHASFLKLRVEKTRLGNALISTYLKLGFPREAFLVFVSMTSPTVVSYTALISGFSRLN  153

Query  3767  EGLKAMAFFYRMIKESI-EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               ++A+  F+RM K  I + ++FT  +I  AC          QIHG I+K G   +  + 
Sbjct  154   LEIEALKVFFRMRKSGIVQPNEFTFVAILTACVRASRFSLGIQIHGLIVKLGFLNSVFVC  213

Query  3590  AALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE-TQLE  3414
              +L+ +  +    +D  K+F  +P     + +  +++    + G  + A  LF+E  ++E
Sbjct  214   NSLMSLYAKGSSCDDVLKLFDEIP--QRDVTSWNTVISSLVKEGMTDKAFDLFYEMNRVE  271

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDN  3234
             GL  VD    +    +  +   L  G  LH  A++ G + ++ V NA+I  Y+K G+++ 
Sbjct  272   GL-GVDRFTLS---TLLSSSDDLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDIEK  327

Query  3233  AVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
                 +E+M  +D  +   ++  Y+     D A++ +  M
Sbjct  328   VESLYEMMMVQDAVTSTEMITAYMAFGMVDSAVEIFEDM  366


 Score = 68.9 bits (167),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKLE-EDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL  E TRL NALIS YLKLG    A  VF S++SP      A+ISGF+++N EI
Sbjct  97    HASFLKLRVEKTRLGNALISTYLKLGFPREAFLVFVSMTSPTVVSYTALISGFSRLNLEI  156

Query  4464  EAVELFYEMR  4435
             EA+++F+ MR
Sbjct  157   EALKVFFRMR  166



>gb|KEH24079.1| PPR containing plant-like protein [Medicago truncatula]
Length=970

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/718 (56%), Positives = 519/718 (72%), Gaps = 3/718 (0%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             S + PN Y++VA+LTAC R  NL+ G Q+HA +IK GYL S +V NALM  YSKCG    
Sbjct  159   SSLRPNHYTYVAVLTACTRILNLQFGLQLHAAVIKTGYLKSVFVSNALMLFYSKCGFYKN  218

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
               ++FD +P+RDIASWNT++S  V+E M+   F LF DM   D L++DY TLST L AC+
Sbjct  219   AFKVFDEMPERDIASWNTVMSCAVQEFMYDDVFRLFCDMLVIDGLKVDYFTLSTFLTACA  278

Query  4064  EC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
                 +  G+++HAHA+++G E  L+V NALI FYT  G I  V+ LFERM VRD  TW E
Sbjct  279   ASGLLMEGKQVHAHAVKVGLEDELNVGNALIGFYTNFGDIDDVVCLFERMSVRDVITWTE  338

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             M+  YME G VDL  ++FD +PEKN V YN +L+G C+N EGLKA+  F RM++E +E +
Sbjct  339   MVRVYMEFGFVDLGLKIFDEMPEKNCVTYNVLLSGLCRNAEGLKAVELFIRMVEEGVELT  398

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
             DF+L+S  NAC LL + + S+Q+HGF +K G   N  +E ALLDM TRCGRM DAEK++ 
Sbjct  399   DFSLSSGINACSLLADYRVSRQMHGFAIKFGFGSNVFVEGALLDMYTRCGRMVDAEKMWE  458

Query  3527  RMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgl  3348
                L     V  TSM+ GYA+NGQP  A SLF     E  +++DEVA  ++L +CGT+G 
Sbjct  459   E--LEEVSSVVWTSMMCGYARNGQPREAFSLFHLGHSEWKLIMDEVALTSMLSLCGTVGY  516

Query  3347  lklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAG  3168
               +G+ +HC  LK GF S+V VGN V+ MY KCG +D+A+K F  M+S D+ SWN+L++G
Sbjct  517   HDMGKQIHCQVLKFGFHSNVQVGNVVVEMYFKCGNVDDAIKMFSGMASTDIVSWNTLISG  576

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGV  2988
             Y+ HR+GD AL+ W +M+  GI PD  T + I+SAYR T+ N+V+ C+  F SM++ Y +
Sbjct  577   YLTHRQGDRALEIWLKMQEEGIKPDDITFVLIISAYRQTSLNLVDDCRILFNSMKTVYHI  636

Query  2987  LPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIK  2808
              P S HY+  +SVLG+WGLLEEA ETIN M F+P + VWRALLD C +H N+ IGK   K
Sbjct  637   EPTSQHYSSFISVLGHWGLLEEALETINKMSFKPSAFVWRALLDGCRLHKNTMIGKLAAK  696

Query  2807  KILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFF  2628
              IL++EP DPST+IL SNL+S+SGRW CSE  R  M+EKGF+K P QSW+IC+ K HSF+
Sbjct  697   NILALEPNDPSTYILVSNLHSSSGRWDCSERTRENMREKGFRKHPAQSWIICRKKMHSFY  756

Query  2627  ARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYG  2448
             ARD SH Q KDIY  L+ILILEC+K GY P+TS+VLHEVEE+QKK FLF+HS+KLA  YG
Sbjct  757   ARDRSHQQDKDIYRGLEILILECLKVGYEPETSFVLHEVEEHQKKKFLFNHSSKLAAAYG  816

Query  2447  LLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDR  2274
             LLMTK GKP+R++KNILLCGDCHTF K AS VTKR+I +RD+SGFHCF +G+CSC D+
Sbjct  817   LLMTKPGKPIRIVKNILLCGDCHTFLKCASFVTKRDIFLRDSSGFHCFSDGQCSCKDQ  874


 Score = 86.7 bits (213),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 121/243 (50%), Gaps = 3/243 (1%)
 Frame = -3

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEF  3711
             +I+ Y+   L   A  LF      N V Y+A+++ F ++    +++  F  MI   S+  
Sbjct  104   LISTYINLRLFSYAHRLFLSQSPPNIVSYSALISAFSKSNREKQSLFLFLHMITVSSLRP  163

Query  3710  SDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIF  3531
             + +T  ++  AC  ++  +   Q+H  ++K+G   +  +  AL+   ++CG  ++A K+F
Sbjct  164   NHYTYVAVLTACTRILNLQFGLQLHAAVIKTGYLKSVFVSNALMLFYSKCGFYKNAFKVF  223

Query  3530  HRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlg  3351
               MP     + +  +++    Q    ++   LF +  +   + VD    +T L  C   G
Sbjct  224   DEMP--ERDIASWNTVMSCAVQEFMYDDVFRLFCDMLVIDGLKVDYFTLSTFLTACAASG  281

Query  3350  llklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLA  3171
             LL  G+ +H  A+K G   ++ VGNA+I  Y   G++D+ V  FE MS RD+ +W  ++ 
Sbjct  282   LLMEGKQVHAHAVKVGLEDELNVGNALIGFYTNFGDIDDVVCLFERMSVRDVITWTEMVR  341

Query  3170  GYV  3162
              Y+
Sbjct  342   VYM  344



>ref|XP_010452278.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g03800 [Camelina sativa]
Length=890

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/726 (55%), Positives = 540/726 (74%), Gaps = 5/726 (1%)
 Frame = -3

Query  4433  LRGSGI-EPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +R SGI +PNEY+FVA+LTAC+R     LG Q+H L++K G+L+S +V N+LM LY+K  
Sbjct  165   MRKSGIVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLNSVFVCNSLMSLYAKGS  224

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             S D V+++FD +P+RD+ SWNT+ISG+VKE M  RAF+LF +M R + L +D  TLSTLL
Sbjct  225   SCDDVLKVFDEIPQRDVTSWNTVISGLVKEGMSDRAFDLFYEMNRVEGLGVDCFTLSTLL  284

Query  4076  NACSECF--MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDA  3903
             ++C++    + RG+ELH  A+RIG    LSVNNALI FY++ G I+ V +L+E M+V+DA
Sbjct  285   SSCTDSSDDLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDIRKVESLYEMMVVQDA  344

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE  3723
              T  EMITAYM  G++D A E+ + + +KN + YNA++AGFC++G GLKA+  F  M++ 
Sbjct  345   VTSTEMITAYMAFGMLDSAVEISEDITKKNTITYNALMAGFCRHGHGLKALKLFTEMLQR  404

Query  3722  SIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEP-NDCIEAALLDMCTRCGRMED  3546
              +E +DF+LTS  +ACGL+ E+K S+QIHGF +K GC   N CI+ ALLDMCTRC RM D
Sbjct  405   GVELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCTRCERMAD  464

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             AE++F + P       A TS+L GYA+NG P+ A+SLF  T  E  +++DEV+   +L V
Sbjct  465   AEEMFDQWPSNLDSSKATTSLLGGYARNGLPDKAVSLFHRTLCEEKLLLDEVSLTLILAV  524

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW  3186
             CGTLG  +LG  +HC ALK G+ SDV +GN++ISMY+KC +LD+A+K F+ M   D+ SW
Sbjct  525   CGTLGFRELGYQIHCYALKGGYFSDVALGNSLISMYSKCWDLDDAIKVFKTMQDHDVVSW  584

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             NSL++ Y+L R GDEAL  WSRM    I PD  T   ++SA+R+T  N ++ C+  F SM
Sbjct  585   NSLISCYILQRNGDEALALWSRMNDGEIKPDKITLTLVISAFRYTESNKLSSCRDLFLSM  644

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSI  2826
             ++ Y + P ++HY   + VLG+WGLLEEAE+TIN+MPF+P+ SV RALLDSC +H N+S+
Sbjct  645   KTVYDIEPTTEHYTVFIRVLGHWGLLEEAEDTINSMPFQPEVSVLRALLDSCRVHSNTSV  704

Query  2825  GKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQH  2646
              KRV K ILS + + PS +ILKSN+YSASG W  SE++R EM+E+G++K P +SW+I ++
Sbjct  705   AKRVAKLILSTKSESPSDYILKSNIYSASGLWHRSEMIREEMRERGYRKHPAKSWIIHEN  764

Query  2645  KFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAK  2466
             K HSF ARDTSH Q KDIYS L+ILI+EC+KAGY P+T +VL EV+E+ KK FLFHHSAK
Sbjct  765   KVHSFHARDTSHPQEKDIYSGLEILIMECLKAGYEPNTEFVLQEVDEFMKKSFLFHHSAK  824

Query  2465  LALTYGLLMTK-HGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKC  2289
             LA+TYG+L +   GKPV+V+KN++LCGDCH FFK  S+V KREI +RD+SGFH F+NGKC
Sbjct  825   LAVTYGILTSNTRGKPVQVVKNVMLCGDCHEFFKYVSVVVKREIVLRDSSGFHHFVNGKC  884

Query  2288  SCNDRW  2271
             SC DRW
Sbjct  885   SCRDRW  890


 Score = 94.7 bits (234),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 77/321 (24%), Positives = 149/321 (46%), Gaps = 35/321 (11%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             ++V A F ++ V      N +I+ Y++ G    A  +F  +     V Y A+++GF +  
Sbjct  94    RAVHASFLKLRVEKTRLGNALISTYLKLGFPREAFLVFVSMTSPTVVSYTALISGFSRLN  153

Query  3767  EGLKAMAFFYRMIKESI-EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               ++A+  F+RM K  I + +++T  +I  AC  +       QIHG I+KSG   +  + 
Sbjct  154   LEIEALKVFFRMRKSGIVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLNSVFVC  213

Query  3590  AALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE-TQLE  3414
              +L+ +  +    +D  K+F  +P     + +  +++ G  + G  + A  LF+E  ++E
Sbjct  214   NSLMSLYAKGSSCDDVLKVFDEIP--QRDVTSWNTVISGLVKEGMSDRAFDLFYEMNRVE  271

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGE---  3243
             GL V     +  +     +   L  G  LH  A++ G + ++ V NA+I  Y+K G+   
Sbjct  272   GLGVDCFTLSTLLSSCTDSSDDLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDIRK  331

Query  3242  ----------------------------LDNAVKAFELMSSRDLCSWNSLLAGYVLHRRG  3147
                                         LD+AV+  E ++ ++  ++N+L+AG+  H  G
Sbjct  332   VESLYEMMVVQDAVTSTEMITAYMAFGMLDSAVEISEDITKKNTITYNALMAGFCRHGHG  391

Query  3146  DEALDTWSRMERLGIVPDSFT  3084
              +AL  ++ M + G+    F+
Sbjct  392   LKALKLFTEMLQRGVELTDFS  412


 Score = 82.4 bits (202),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 103/467 (22%), Positives = 200/467 (43%), Gaps = 80/467 (17%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             +  LL    +  ++E+   VHA  +KL  ++ T + NAL+  Y K G       +F ++ 
Sbjct  77    YFYLLRLSAQYDDVEVTRAVHASFLKL-RVEKTRLGNALISTYLKLGFPREAFLVFVSMT  135

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQ  4041
                + S+  +ISG  + ++   A ++F  M+++  ++ +  T   +L AC        G 
Sbjct  136   SPTVVSYTALISGFSRLNLEIEALKVFFRMRKSGIVQPNEYTFVAILTACVRVSRFSLGI  195

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESG  3861
             ++H   ++ G+ +++ V N+L+  Y +  S   V+ +F+ +  RD  +WN +I+  ++ G
Sbjct  196   QIHGLIVKSGFLNSVFVCNSLMSLYAKGSSCDDVLKVFDEIPQRDVTSWNTVISGLVKEG  255

Query  3860  LVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIAN  3681
             + D A   FD   E N V             EGL                  FTL+++ +
Sbjct  256   MSDRA---FDLFYEMNRV-------------EGLGVDC--------------FTLSTLLS  285

Query  3680  AC-----GLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP-  3519
             +C      LL  R    ++HG  ++ G      +  AL+   ++ G +   E ++  M  
Sbjct  286   SCTDSSDDLLRGR----ELHGRAIRIGLMQELSVNNALIGFYSKFGDIRKVESLYEMMVV  341

Query  3518  -------------LGHGRL---------------VALTSMLRGYAQNGQPENAISLFFET  3423
                          +  G L               +   +++ G+ ++G    A+ LF E 
Sbjct  342   QDAVTSTEMITAYMAFGMLDSAVEISEDITKKNTITYNALMAGFCRHGHGLKALKLFTEM  401

Query  3422  QLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHG-FLSDVVVGNAVISMYAKCG  3246
                G+ + D   T+  +  CG +   K+ E +H   +K G  L +  +  A++ M  +C 
Sbjct  402   LQRGVELTDFSLTS-AVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCTRCE  460

Query  3245  ELDNAVKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
              + +A + F+     L SS+   +  SLL GY  +   D+A+  + R
Sbjct  461   RMADAEEMFDQWPSNLDSSK---ATTSLLGGYARNGLPDKAVSLFHR  504


 Score = 68.9 bits (167),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKLE-EDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL  E TRL NALIS YLKLG    A  VF S++SP      A+ISGF+++N EI
Sbjct  97    HASFLKLRVEKTRLGNALISTYLKLGFPREAFLVFVSMTSPTVVSYTALISGFSRLNLEI  156

Query  4464  EAVELFYEMR  4435
             EA+++F+ MR
Sbjct  157   EALKVFFRMR  166



>ref|XP_002873115.1| EMB175 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49374.1| EMB175 [Arabidopsis lyrata subsp. lyrata]
Length=896

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/726 (55%), Positives = 538/726 (74%), Gaps = 5/726 (1%)
 Frame = -3

Query  4433  LRGSGI-EPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK--  4263
             +R +GI +PNEY+FVA+LTAC+R     LG Q+H L++K G+L+S +V N+LM LYSK  
Sbjct  171   MRKAGIVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLNSVFVGNSLMSLYSKDS  230

Query  4262  CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
               S D V++LFD +P RD+ASWNT+IS +VKE    +AF LF +M R + L +D  TLST
Sbjct  231   GSSCDDVLKLFDEIPHRDVASWNTVISSLVKEGKSHKAFNLFYEMNRVEGLGVDCFTLST  290

Query  4082  LLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
             LL++C++   + RG+ELH  A+RIG    LSVNNALI FY++ G +K V +L+E M+V+D
Sbjct  291   LLSSCTDSSDLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDMKKVESLYEMMMVQD  350

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
             A T+ EMITAYM  G+VD A E+F+++ EKN + YNA++AGFC+NG GLKA+  F  M++
Sbjct  351   AVTFTEMITAYMAFGMVDSAVEIFENITEKNTITYNALMAGFCRNGHGLKALKLFTEMLQ  410

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMED  3546
               +E +DF+LTS  +ACGL+ E++ S+QIHGF +K GC  N CI+ ALLDMCTRC RM D
Sbjct  411   RGVELTDFSLTSAVDACGLVSEKRVSEQIHGFCIKFGCLLNPCIQTALLDMCTRCERMAD  470

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             AE++F + P    R  A TS+L GYA+NG P+ A+SLF  T  E  + +DEV+   +L V
Sbjct  471   AEEMFEQWPSNLDRSKATTSILGGYARNGLPDKALSLFHRTLCEEELFLDEVSLTLILAV  530

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW  3186
             CGTLG  ++G  +HC ALK G+ SDV +GN++ISMY+KC + D+A+K F  M   D+ SW
Sbjct  531   CGTLGFREMGYQIHCYALKAGYFSDVCLGNSLISMYSKCCDSDDAIKVFNTMQEHDVVSW  590

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             NSL++ Y+L R G+EAL  WSRM    I PD  T   ++SA+R+T  N ++ C+  F SM
Sbjct  591   NSLISCYILQRNGNEALALWSRMNEEEIKPDMITLTLVISAFRYTESNKLSSCRDLFLSM  650

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSI  2826
             ++ Y + P ++HY   V VLG+WGLLEEAE+TIN+MPF+P+ SV RALLDSC +H N+S+
Sbjct  651   KTIYDIEPTTEHYTAFVRVLGHWGLLEEAEDTINSMPFQPEVSVLRALLDSCRVHSNTSV  710

Query  2825  GKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQH  2646
              KRV K +LS +P++PS +ILKSN+YSASG W  SE++R EM+E+G++K P +SW+I + 
Sbjct  711   AKRVAKLVLSTKPENPSEYILKSNIYSASGLWHRSEMIREEMRERGYRKHPSKSWIIHEK  770

Query  2645  KFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAK  2466
             K HSF ARDTSH Q KDIYS L+ILI+EC+K+GY P+T +VL EV+E+ KK FLFHHSAK
Sbjct  771   KVHSFHARDTSHPQEKDIYSGLEILIMECLKSGYEPNTEFVLQEVDEFMKKSFLFHHSAK  830

Query  2465  LALTYGLLMTK-HGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKC  2289
             LA+TYG+L +   GKPVRV+KN++LCGDCH FFK  S+V KREI +RD+SGFH F+NGKC
Sbjct  831   LAVTYGILTSNTRGKPVRVVKNVMLCGDCHEFFKYVSVVVKREIVLRDSSGFHHFVNGKC  890

Query  2288  SCNDRW  2271
             SC D W
Sbjct  891   SCRDLW  896


 Score = 90.5 bits (223),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 154/323 (48%), Gaps = 38/323 (12%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             K+V A F ++        N +I+ Y++ G    A  +F  L     V Y A+++GF +  
Sbjct  100   KAVHASFLKLREEKTRLGNALISTYLKLGFPREAFLVFVSLSSPTVVSYTALISGFSRLN  159

Query  3767  EGLKAMAFFYRMIKESI-EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               ++A+  F+RM K  I + +++T  +I  AC  +       QIHG I+KSG   +  + 
Sbjct  160   LEIEALKVFFRMRKAGIVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLNSVFVG  219

Query  3590  AALLDMCTR--CGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE-TQ  3420
              +L+ + ++      +D  K+F  +P  H  + +  +++    + G+   A +LF+E  +
Sbjct  220   NSLMSLYSKDSGSSCDDVLKLFDEIP--HRDVASWNTVISSLVKEGKSHKAFNLFYEMNR  277

Query  3419  LEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL  3240
             +EGL  VD    +T+L  C     L  G  LH  A++ G + ++ V NA+I  Y+K G++
Sbjct  278   VEGL-GVDCFTLSTLLSSCTDSSDLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDM  336

Query  3239  -------------------------------DNAVKAFELMSSRDLCSWNSLLAGYVLHR  3153
                                            D+AV+ FE ++ ++  ++N+L+AG+  + 
Sbjct  337   KKVESLYEMMMVQDAVTFTEMITAYMAFGMVDSAVEIFENITEKNTITYNALMAGFCRNG  396

Query  3152  RGDEALDTWSRMERLGIVPDSFT  3084
              G +AL  ++ M + G+    F+
Sbjct  397   HGLKALKLFTEMLQRGVELTDFS  419


 Score = 90.5 bits (223),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 100/461 (22%), Positives = 194/461 (42%), Gaps = 68/461 (15%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             F  LL    +  ++E+   VHA  +KL   + T + NAL+  Y K G       +F +L 
Sbjct  83    FFYLLRLSAQYHDVEVTKAVHASFLKLRE-EKTRLGNALISTYLKLGFPREAFLVFVSLS  141

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQ  4041
                + S+  +ISG  + ++   A ++F  M++   ++ +  T   +L AC        G 
Sbjct  142   SPTVVSYTALISGFSRLNLEIEALKVFFRMRKAGIVQPNEYTFVAILTACVRVSRFSLGI  201

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTR--CGSIKSVMALFERMLVRDAFTWNEMITAYME  3867
             ++H   ++ G+ +++ V N+L+  Y++    S   V+ LF+ +  RD  +WN +I++   
Sbjct  202   QIHGLIVKSGFLNSVFVGNSLMSLYSKDSGSSCDDVLKLFDEIPHRDVASWNTVISS---  258

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSDFTLTS  3690
                  L KE                       G+  KA   FY M + E +    FTL++
Sbjct  259   -----LVKE-----------------------GKSHKAFNLFYEMNRVEGLGVDCFTLST  290

Query  3689  IANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRM----  3522
             + ++C    +    +++HG  ++ G      +  AL+   ++ G M+  E ++  M    
Sbjct  291   LLSSCTDSSDLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDMKKVESLYEMMMVQD  350

Query  3521  -------------------------PLGHGRLVALTSMLRGYAQNGQPENAISLFFETQL  3417
                                       +     +   +++ G+ +NG    A+ LF E   
Sbjct  351   AVTFTEMITAYMAFGMVDSAVEIFENITEKNTITYNALMAGFCRNGHGLKALKLFTEMLQ  410

Query  3416  EGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELD  3237
              G+ + D   T+  +  CG +   ++ E +H   +K G L +  +  A++ M  +C  + 
Sbjct  411   RGVELTDFSLTS-AVDACGLVSEKRVSEQIHGFCIKFGCLLNPCIQTALLDMCTRCERMA  469

Query  3236  NAVKAFELMSSR--DLCSWNSLLAGYVLHRRGDEALDTWSR  3120
             +A + FE   S      +  S+L GY  +   D+AL  + R
Sbjct  470   DAEEMFEQWPSNLDRSKATTSILGGYARNGLPDKALSLFHR  510


 Score = 72.4 bits (176),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL EE TRL NALIS YLKLG    A  VF SLSSP      A+ISGF+++N EI
Sbjct  103   HASFLKLREEKTRLGNALISTYLKLGFPREAFLVFVSLSSPTVVSYTALISGFSRLNLEI  162

Query  4464  EAVELFYEMR  4435
             EA+++F+ MR
Sbjct  163   EALKVFFRMR  172



>ref|XP_010490873.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Camelina sativa]
Length=886

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/724 (55%), Positives = 541/724 (75%), Gaps = 5/724 (1%)
 Frame = -3

Query  4433  LRGSGI-EPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +R +GI +PNEY+FVA+LTAC+R     LG Q+H L++K G+L S +V N+LM LY+K  
Sbjct  165   MRKAGIVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLSSVFVCNSLMSLYAKGY  224

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             S D V+++FD +P+RD+ SWNT+IS +VKE M  +AF+LF +M R   L +D  TLSTLL
Sbjct  225   SCDDVLKVFDEIPQRDVTSWNTVISSLVKEGMSDKAFDLFYEMNRVKGLGVDCFTLSTLL  284

Query  4076  NACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             ++ S+ F+R G+ELH  A+RIG    LSVNNALI FY++ G I+ V +L+E M+V+DA T
Sbjct  285   SS-SDDFLR-GRELHGRAIRIGLMQELSVNNALIGFYSKFGDIEKVESLYEMMMVQDAVT  342

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
               EMITAYM  G+VD A E+F+++ EKN + YNA++AGFC+NG GLKA+  F  M++  +
Sbjct  343   STEMITAYMAFGMVDSAVEIFENITEKNTIAYNALMAGFCRNGYGLKALNLFTDMLQRGV  402

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEP-NDCIEAALLDMCTRCGRMEDAE  3540
             E +DF+LTS  +ACGL+ E+K S+QIHGF +K GC   N CI+ ALLDMCTRC RM DAE
Sbjct  403   ELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCTRCERMADAE  462

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             ++F + P       A TS+L GYA+NG  + A+SLF  T  E  +++DEV+   +L VCG
Sbjct  463   EMFDQWPSSLDSSKATTSILGGYARNGLSDKAVSLFHRTLCEEKLLLDEVSLTLILAVCG  522

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG  +LG  +HC ALK G+L++V +GN++ISMY+KC + D+A+K F+ M   D+ SWNS
Sbjct  523   TLGFRELGYQIHCYALKGGYLTNVALGNSLISMYSKCWDSDDAIKVFKTMQDHDVVSWNS  582

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L++ Y+L R GDEAL  WSRM   GI PD  T   ++SA+R+T  N ++ C+  F SM++
Sbjct  583   LISCYILQRNGDEALALWSRMNDGGIKPDKITLTLVISAFRYTESNKLSSCRDLFLSMKT  642

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              Y + P ++HY   V VLG+WGLLEEAE+TIN+MPF+P+ SV RALLD+C +H N+S+ K
Sbjct  643   IYDIEPTTEHYTAFVRVLGHWGLLEEAEDTINSMPFQPEVSVLRALLDTCRVHSNTSVAK  702

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             RV K ILS +P++PS +ILKSN+YSASG W  SE++R EM+E+G++K P +SW+I ++K 
Sbjct  703   RVAKLILSTKPENPSEYILKSNIYSASGLWHRSEMIREEMRERGYRKHPAKSWIIHENKV  762

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSF ARDTSH Q KDIYS L+ILI+EC+KAGY P+T +VL EV+E+ KK FLFHHSAKLA
Sbjct  763   HSFHARDTSHPQEKDIYSGLEILIMECLKAGYEPNTEFVLQEVDEFMKKSFLFHHSAKLA  822

Query  2459  LTYGLLMTK-HGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             +TYG+L +   GKPVRV+KN++LCGDCH FFK  S+V KREI +RD+SGFH F+NGKCSC
Sbjct  823   VTYGILTSNTRGKPVRVVKNVMLCGDCHEFFKYVSVVVKREIVLRDSSGFHHFVNGKCSC  882

Query  2282  NDRW  2271
              DRW
Sbjct  883   RDRW  886


 Score = 85.5 bits (210),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 149/350 (43%), Gaps = 40/350 (11%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLG-YLDSTYVVNALMGLYSKC  4260
             D+   G+E  ++S  + + AC      ++  Q+H   IK G  L +  +  AL+ + ++C
Sbjct  396   DMLQRGVELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCTRC  455

Query  4259  GSLDFVIELFDNLPKRDIASWNT--MISGMVKESMFTRAFELFNDMQRNDCLRIDYITLS  4086
               +    E+FD  P    +S  T  ++ G  +  +  +A  LF+     + L +D ++L+
Sbjct  456   ERMADAEEMFDQWPSSLDSSKATTSILGGYARNGLSDKAVSLFHRTLCEEKLLLDEVSLT  515

Query  4085  TLLNACSECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVR  3909
              +L  C     R  G ++H +AL+ GY +N+++ N+LI  Y++C      + +F+ M   
Sbjct  516   LILAVCGTLGFRELGYQIHCYALKGGYLTNVALGNSLISMYSKCWDSDDAIKVFKTMQDH  575

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMI  3729
             D  +WN +I+ Y+                               +NG+  +A+A + RM 
Sbjct  576   DVVSWNSLISCYI-----------------------------LQRNGD--EALALWSRMN  604

Query  3728  KESIEFSDFTLTSIANACGLLMERKSSKQIHGFI-LKS--GCEPNDCIEAALLDMCTRCG  3558
                I+    TLT + +A       K S     F+ +K+    EP      A + +    G
Sbjct  605   DGGIKPDKITLTLVISAFRYTESNKLSSCRDLFLSMKTIYDIEPTTEHYTAFVRVLGHWG  664

Query  3557  RMEDAEKIFHRMPLGH--GRLVALTSMLRGYAQNGQPENAISLFFETQLE  3414
              +E+AE   + MP       L AL    R ++     +    L   T+ E
Sbjct  665   LLEEAEDTINSMPFQPEVSVLRALLDTCRVHSNTSVAKRVAKLILSTKPE  714


 Score = 38.1 bits (87),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 19/68 (28%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVEL  4450
             + + +D   S  +I+AY+  G+VD A+ +F++++        A+++GF +    ++A+ L
Sbjct  334   MMMVQDAVTSTEMITAYMAFGMVDSAVEIFENITEKNTIAYNALMAGFCRNGYGLKALNL  393

Query  4449  FYEMRLER  4426
             F +M L+R
Sbjct  394   FTDM-LQR  400


 Score = 87.0 bits (214),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 75/328 (23%), Positives = 152/328 (46%), Gaps = 39/328 (12%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             ++V A F ++ V      N +I+ Y++ G    A  +F  +     V Y A+++GF +  
Sbjct  94    RAVHASFLKLKVEKTRLGNALISTYLKLGFPREAFLVFVSMTSPTVVSYTALISGFSRLN  153

Query  3767  EGLKAMAFFYRMIKESI-EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               ++A+  F+RM K  I + +++T  +I  AC  +       QIHG I+KSG   +  + 
Sbjct  154   LEIEALKVFFRMRKAGIVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLSSVFVC  213

Query  3590  AALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE-TQLE  3414
              +L+ +  +    +D  K+F  +P     + +  +++    + G  + A  LF+E  +++
Sbjct  214   NSLMSLYAKGYSCDDVLKVFDEIP--QRDVTSWNTVISSLVKEGMSDKAFDLFYEMNRVK  271

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL--  3240
             GL     V   T+  +  +      G  LH  A++ G + ++ V NA+I  Y+K G++  
Sbjct  272   GL----GVDCFTLSTLLSSSDDFLRGRELHGRAIRIGLMQELSVNNALIGFYSKFGDIEK  327

Query  3239  -----------------------------DNAVKAFELMSSRDLCSWNSLLAGYVLHRRG  3147
                                          D+AV+ FE ++ ++  ++N+L+AG+  +  G
Sbjct  328   VESLYEMMMVQDAVTSTEMITAYMAFGMVDSAVEIFENITEKNTIAYNALMAGFCRNGYG  387

Query  3146  DEALDTWSRMERLGIVPDSFTCLHILSA  3063
              +AL+ ++ M + G+    F+    + A
Sbjct  388   LKALNLFTDMLQRGVELTDFSLTSAVDA  415


 Score = 84.3 bits (207),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 98/462 (21%), Positives = 199/462 (43%), Gaps = 74/462 (16%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             +  LL    +  ++E+   VHA  +KL  ++ T + NAL+  Y K G       +F ++ 
Sbjct  77    YFYLLRLSSQYDDVEVTRAVHASFLKLK-VEKTRLGNALISTYLKLGFPREAFLVFVSMT  135

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQ  4041
                + S+  +ISG  + ++   A ++F  M++   ++ +  T   +L AC        G 
Sbjct  136   SPTVVSYTALISGFSRLNLEIEALKVFFRMRKAGIVQPNEYTFVAILTACVRVSRFSLGI  195

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESG  3861
             ++H   ++ G+ S++ V N+L+  Y +  S   V+ +F+ +  RD  +WN +I++ ++ G
Sbjct  196   QIHGLIVKSGFLSSVFVCNSLMSLYAKGYSCDDVLKVFDEIPQRDVTSWNTVISSLVKEG  255

Query  3860  LVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIAN  3681
             + D A   FD   E N V            G G+                  FTL+++ +
Sbjct  256   MSDKA---FDLFYEMNRV-----------KGLGVDC----------------FTLSTLLS  285

Query  3680  ACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRM-------  3522
             +    +     +++HG  ++ G      +  AL+   ++ G +E  E ++  M       
Sbjct  286   SSDDFLR---GRELHGRAIRIGLMQELSVNNALIGFYSKFGDIEKVESLYEMMMVQDAVT  342

Query  3521  ----------------------PLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
                                    +     +A  +++ G+ +NG    A++LF +    G+
Sbjct  343   STEMITAYMAFGMVDSAVEIFENITEKNTIAYNALMAGFCRNGYGLKALNLFTDMLQRGV  402

Query  3407  VVVDEVATAtvlgvcgtlgllklGENLHCLALKHG-FLSDVVVGNAVISMYAKCGELDNA  3231
              + D   T+  +  CG +   K+ E +H   +K G  L +  +  A++ M  +C  + +A
Sbjct  403   ELTDFSLTS-AVDACGLVSEKKVSEQIHGFCIKFGCLLLNPCIQTALLDMCTRCERMADA  461

Query  3230  VKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
              + F+     L SS+   +  S+L GY  +   D+A+  + R
Sbjct  462   EEMFDQWPSSLDSSK---ATTSILGGYARNGLSDKAVSLFHR  500


 Score = 69.3 bits (168),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKLE-EDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL+ E TRL NALIS YLKLG    A  VF S++SP      A+ISGF+++N EI
Sbjct  97    HASFLKLKVEKTRLGNALISTYLKLGFPREAFLVFVSMTSPTVVSYTALISGFSRLNLEI  156

Query  4464  EAVELFYEMR  4435
             EA+++F+ MR
Sbjct  157   EALKVFFRMR  166



>ref|XP_003520676.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Glycine max]
Length=874

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/719 (55%), Positives = 527/719 (73%), Gaps = 3/719 (0%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRS-QNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLD  4248
             S + PNEY++VA+LTAC     +   G Q+HA  +K  + DS +V NAL+ LY+K  S  
Sbjct  158   SHLPPNEYTYVAVLTACSSLLHHFHFGLQLHAAALKTAHFDSPFVANALVSLYAKHASFH  217

Query  4247  FVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNAC  4068
               ++LF+ +P+RDIASWNT+IS  +++S++  AF LF +MQ  D  R+D  TLS LL A 
Sbjct  218   AALKLFNQIPRRDIASWNTIISAALQDSLYDTAFRLFRNMQATDAFRVDDFTLSILLTAS  277

Query  4067  SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
             +   +  GQ++HAHA+++G E++L+V N LI FY++ G++  V  LFE M VRD  TW E
Sbjct  278   AS--LMEGQQVHAHAVKLGLETDLNVGNGLIGFYSKFGNVDDVEWLFEGMRVRDVITWTE  335

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             M+TAYME GLV+LA ++FD +PEKN+V YN VLAGFC+N +G +AM  F RM++E +E +
Sbjct  336   MVTAYMEFGLVNLALKVFDEMPEKNSVSYNTVLAGFCRNEQGFEAMRLFVRMVEEGLELT  395

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
             DF+LTS+ +ACGLL + K SKQ+HGF +K G   N  +EAALLDM TRCGRM DA K+F 
Sbjct  396   DFSLTSVVDACGLLGDYKVSKQVHGFAVKFGFGSNGYVEAALLDMYTRCGRMVDAGKMFL  455

Query  3527  RMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgl  3348
             R  L     V  T+M+ GYA+NGQPE AI LF   + +G V++DEVA A++LG+CGT+G 
Sbjct  456   RWELEEFSSVVWTAMICGYARNGQPEEAIYLFHVGRSDGKVIMDEVAAASMLGLCGTIGH  515

Query  3347  lklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAG  3168
             L +G+ +HC  +K G   ++ VGNAV+SMY KCG +D+A+K F  M   D+ +WN+L++G
Sbjct  516   LDMGKQIHCHVIKCGLGFNLEVGNAVVSMYFKCGSVDDAMKVFGDMPCTDIVTWNTLISG  575

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGV  2988
              ++HR+GD AL+ W  M   GI P+  T + I+SAYR T  N+V+ C++ F SM++ Y +
Sbjct  576   NLMHRQGDRALEIWVEMLGEGIKPNQVTFVLIISAYRQTNLNLVDDCRNLFNSMRTVYQI  635

Query  2987  LPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIK  2808
              P S HYA  +SVLG+WGLL+EA ETIN MPF+P + VWR LLD C +H N  IGK   +
Sbjct  636   EPTSRHYASFISVLGHWGLLQEALETINNMPFQPSALVWRVLLDGCRLHKNELIGKWAAQ  695

Query  2807  KILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFF  2628
              IL++EP+DPSTFIL SNLYSASGRW  SE+VR +M+EKGF+K P QSW++C+ K +SF+
Sbjct  696   NILALEPKDPSTFILVSNLYSASGRWDRSEMVREDMREKGFRKHPAQSWIVCEKKINSFY  755

Query  2627  ARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYG  2448
              RD SH Q KDI   L+ILILEC+K GY PDTS+VLHEVEE+ KK FLFHHSAKLA TYG
Sbjct  756   PRDRSHPQEKDIQRGLEILILECLKIGYEPDTSFVLHEVEEHHKKIFLFHHSAKLAATYG  815

Query  2447  LLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             +LMTK GKP+R++KNILLCGDCH F K ASIVTKR+I +RD+SGFHCF NG+CSC D W
Sbjct  816   ILMTKPGKPIRIVKNILLCGDCHAFLKYASIVTKRDIFLRDSSGFHCFSNGQCSCKDCW  874


 Score =   129 bits (324),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 118/463 (25%), Positives = 193/463 (42%), Gaps = 73/463 (16%)
 Frame = -3

Query  4418  IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVI  4239
             + P  +S +  L    RS +  L   VHA ++K    D T++ NAL+  Y K       +
Sbjct  60    LPPESHSLLHALHVSSRSGDTHLAKTVHATLLKRDEED-THLSNALISTYLKLNLFPHAL  118

Query  4238  ELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSEC  4059
              LF +LP  ++ S+ T+IS + K      A  LF  M     L  +  T   +L ACS  
Sbjct  119   RLFLSLPSPNVVSYTTLISFLSKHRQH-HALHLFLRMTTRSHLPPNEYTYVAVLTACSSL  177

Query  4058  F--MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                   G +LHA AL+  +  +  V NAL+  Y +  S  + + LF ++  RD  +WN +
Sbjct  178   LHHFHFGLQLHAAALKTAHFDSPFVANALVSLYAKHASFHAALKLFNQIPRRDIASWNTI  237

Query  3884  ITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSD  3705
             I+A ++  L D A  LF ++   +A                                  D
Sbjct  238   ISAALQDSLYDTAFRLFRNMQATDA------------------------------FRVDD  267

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE-----  3540
             FTL+ +  A   LME    +Q+H   +K G E +  +   L+   ++ G ++D E     
Sbjct  268   FTLSILLTASASLME---GQQVHAHAVKLGLETDLNVGNGLIGFYSKFGNVDDVEWLFEG  324

Query  3539  --------------------------KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAIS  3438
                                       K+F  MP  +   V+  ++L G+ +N Q   A+ 
Sbjct  325   MRVRDVITWTEMVTAYMEFGLVNLALKVFDEMPEKNS--VSYNTVLAGFCRNEQGFEAMR  382

Query  3437  LFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMY  3258
             LF     EGL + D   T+ V             + +H  A+K GF S+  V  A++ MY
Sbjct  383   LFVRMVEEGLELTDFSLTSVVDACGLLGDYKVSKQ-VHGFAVKFGFGSNGYVEAALLDMY  441

Query  3257  AKCGELDNAVKAFELMSSRDLCS--WNSLLAGYVLHRRGDEAL  3135
              +CG + +A K F      +  S  W +++ GY  + + +EA+
Sbjct  442   TRCGRMVDAGKMFLRWELEEFSSVVWTAMICGYARNGQPEEAI  484



>ref|XP_007162829.1| hypothetical protein PHAVU_001G184400g [Phaseolus vulgaris]
 gb|ESW34823.1| hypothetical protein PHAVU_001G184400g [Phaseolus vulgaris]
Length=874

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/718 (55%), Positives = 525/718 (73%), Gaps = 2/718 (0%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             S + PN Y++VA+LTAC R  + +LG QVHA  +K  + DST+V NAL+ LY+K      
Sbjct  159   SHLIPNSYTYVAVLTACTRILHFQLGLQVHAAALKTAHFDSTFVANALVSLYAKHAPFHV  218

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
              ++LF+   +RD+ASWNT+IS  V+ESM+  AF+LF+DMQ  D  ++D  TLS LL+AC+
Sbjct  219   ALKLFNQTRQRDLASWNTIISAAVQESMYDTAFQLFHDMQTTDAFQVDDFTLSILLSACA  278

Query  4064  ECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                   GQ++HAHA+++G E++L+V N L  FYT  G+++ V  LFE M VRD  TW +M
Sbjct  279   S--FVEGQQVHAHAVKLGLETSLNVGNGLTGFYTNFGTLEDVEWLFEEMKVRDVITWTQM  336

Query  3884  ITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSD  3705
             +T YME GLVDLA ++FD +PEKN+V YN VL+GFCQN EGL+A+  F +M++E +E +D
Sbjct  337   VTVYMEFGLVDLALKVFDEMPEKNSVSYNTVLSGFCQNEEGLEALKLFVKMVEEGLELTD  396

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHR  3525
             F+LTS  NA GLL + + SKQ+HGF +K G   N CIEAALLDM TRCG M DAEK+F R
Sbjct  397   FSLTSGVNASGLLGDPRVSKQVHGFTVKFGFGSNACIEAALLDMYTRCGSMVDAEKMFLR  456

Query  3524  MPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgll  3345
               +     V+ T+M+ GYA+NG+PE AISLF   +    V++DEV   ++LG+CGT+G  
Sbjct  457   WEVEQFSSVSWTAMICGYARNGRPEEAISLFHVGRSNEKVIMDEVVVTSMLGICGTVGHH  516

Query  3344  klGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGY  3165
              +G+ +H   +K G  S++ VGNA++SMY KCG +D+A+K F  M+  D+ +WN+L++G 
Sbjct  517   DMGKQIHGHVVKCGLGSNLQVGNALLSMYFKCGNVDDAMKLFHDMAYTDIVTWNTLISGN  576

Query  3164  VLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGVL  2985
             ++HR+G+ AL+ W  M+   I PD  T + I+SAYR T  N V+ C+S F SM++ Y V 
Sbjct  577   LIHRQGNRALEVWVEMQEKNIKPDQVTFVLIISAYRQTNSNFVDDCRSLFNSMRTVYQVE  636

Query  2984  PASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKK  2805
             P S HYA  +SVLG+WG L+EA ETIN MPF+P + VWRALLD+C  H N+ IG+   + 
Sbjct  637   PTSLHYASFISVLGHWGFLQEALETINKMPFQPSALVWRALLDACKQHQNNIIGRWAAQN  696

Query  2804  ILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFFA  2625
             ILS EP+DPSTFIL SNLYSASGRW  SE+VR EM++KG +K P QSW+I + K H+F+ 
Sbjct  697   ILSFEPKDPSTFILVSNLYSASGRWDRSEMVRDEMRQKGIRKHPAQSWIISEKKIHTFYP  756

Query  2624  RDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYGL  2445
             RD SH + KDIYS L+ILILEC+K GY PDTS+VLHEVEE+ K+ FLFHHSAKLA TYG+
Sbjct  757   RDRSHPREKDIYSGLEILILECLKVGYEPDTSFVLHEVEEHHKEIFLFHHSAKLAATYGI  816

Query  2444  LMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             LMTK GKPVR++KNILLCGDCHTF K ASIVTK++I +RD+SGFHCF  G+CSC D W
Sbjct  817   LMTKPGKPVRIVKNILLCGDCHTFLKYASIVTKKDIFLRDSSGFHCFSGGQCSCKDCW  874


 Score =   132 bits (332),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 125/481 (26%), Positives = 204/481 (42%), Gaps = 81/481 (17%)
 Frame = -3

Query  4457  WSSSMR*DLRGSG--IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNA  4284
             +S S R +LR     + P+  S V  L    R+ + +L   VHA ++KL   D T + NA
Sbjct  45    FSLSFRRNLRHVTHYLPPDSDSLVHALHVSSRAADTQLVKTVHATLLKLHEHD-TRLFNA  103

Query  4283  LMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTR-AFELFNDMQRNDCLR  4107
             L+  Y K       + LF +LP  +  S+ T+IS + K     R A +LF  M R+  + 
Sbjct  104   LISAYLKLRLFPHALRLFLSLPSPNAVSYTTLISALSKRPHHERHALKLFLRMTRSHLIP  163

Query  4106  IDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMAL  3930
               Y T   +L AC+     + G ++HA AL+  +  +  V NAL+  Y +       + L
Sbjct  164   NSY-TYVAVLTACTRILHFQLGLQVHAAALKTAHFDSTFVANALVSLYAKHAPFHVALKL  222

Query  3929  FERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAM  3750
             F +   RD  +WN +I+A ++  + D A +LF  +   +A                    
Sbjct  223   FNQTRQRDLASWNTIISAAVQESMYDTAFQLFHDMQTTDA--------------------  262

Query  3749  AFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMC  3570
                        +  DFTL+ + +AC   +E    +Q+H   +K G E +  +   L    
Sbjct  263   ----------FQVDDFTLSILLSACASFVE---GQQVHAHAVKLGLETSLNVGNGLTGFY  309

Query  3569  TRCGRMEDAE-------------------------------KIFHRMPLGHGRLVALTSM  3483
             T  G +ED E                               K+F  MP  +   V+  ++
Sbjct  310   TNFGTLEDVEWLFEEMKVRDVITWTQMVTVYMEFGLVDLALKVFDEMPEKNS--VSYNTV  367

Query  3482  LRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHG  3303
             L G+ QN +   A+ LF +   EGL + D   T+ V             + +H   +K G
Sbjct  368   LSGFCQNEEGLEALKLFVKMVEEGLELTDFSLTSGVNASGLLGDPRVSKQ-VHGFTVKFG  426

Query  3302  FLSDVVVGNAVISMYAKCGELDNAVKAF-----ELMSSRDLCSWNSLLAGYVLHRRGDEA  3138
             F S+  +  A++ MY +CG + +A K F     E  SS    SW +++ GY  + R +EA
Sbjct  427   FGSNACIEAALLDMYTRCGSMVDAEKMFLRWEVEQFSS---VSWTAMICGYARNGRPEEA  483

Query  3137  L  3135
             +
Sbjct  484   I  484


 Score = 81.6 bits (200),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/279 (23%), Positives = 121/279 (43%), Gaps = 6/279 (2%)
 Frame = -3

Query  3950  IKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQN  3771
             +K+V A   ++   D   +N +I+AY++  L   A  LF  LP  NAV Y  +++   + 
Sbjct  83    VKTVHATLLKLHEHDTRLFNALISAYLKLRLFPHALRLFLSLPSPNAVSYTTLISALSKR  142

Query  3770  GEGLK-AMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCI  3594
                 + A+  F RM +  +  + +T  ++  AC  ++  +   Q+H   LK+    +  +
Sbjct  143   PHHERHALKLFLRMTRSHLIPNSYTYVAVLTACTRILHFQLGLQVHAAALKTAHFDSTFV  202

Query  3593  EAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLE  3414
               AL+ +  +      A K+F++       L +  +++    Q    + A  LF + Q  
Sbjct  203   ANALVSLYAKHAPFHVALKLFNQTR--QRDLASWNTIISAAVQESMYDTAFQLFHDMQTT  260

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDN  3234
                 VD+   +    +         G+ +H  A+K G  + + VGN +   Y   G L++
Sbjct  261   DAFQVDDFTLS---ILLSACASFVEGQQVHAHAVKLGLETSLNVGNGLTGFYTNFGTLED  317

Query  3233  AVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
                 FE M  RD+ +W  ++  Y+     D AL  +  M
Sbjct  318   VEWLFEEMKVRDVITWTQMVTVYMEFGLVDLALKVFDEM  356



>ref|NP_196000.2| pentatricopeptide repeat protein EMB175 [Arabidopsis thaliana]
 sp|Q9FFN1.1|PP363_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g03800; 
AltName: Full=Protein EMBRYO DEFECTIVE 175 [Arabidopsis 
thaliana]
 dbj|BAB08606.1| selenium-binding protein-like [Arabidopsis thaliana]
 dbj|BAC41880.1| unknown protein [Arabidopsis thaliana]
 gb|AAW62960.1| embryo-defective 175 [Arabidopsis thaliana]
 gb|AAW62961.1| embryo-defective 175 [Arabidopsis thaliana]
 gb|AED90656.1| pentatricopeptide repeat protein EMB175 [Arabidopsis thaliana]
 gb|AHL38647.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=896

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/726 (54%), Positives = 530/726 (73%), Gaps = 5/726 (1%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK--  4263
             +R +G ++PNEY+FVA+LTAC+R     LG Q+H L++K G+L+S +V N+LM LY K  
Sbjct  171   MRKAGLVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLNSVFVSNSLMSLYDKDS  230

Query  4262  CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
               S D V++LFD +P+RD+ASWNT++S +VKE    +AF+LF +M R +   +D  TLST
Sbjct  231   GSSCDDVLKLFDEIPQRDVASWNTVVSSLVKEGKSHKAFDLFYEMNRVEGFGVDSFTLST  290

Query  4082  LLNACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
             LL++C++   + RG+ELH  A+RIG    LSVNNALI FY++   +K V +L+E M+ +D
Sbjct  291   LLSSCTDSSVLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFWDMKKVESLYEMMMAQD  350

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
             A T+ EMITAYM  G+VD A E+F ++ EKN + YNA++AGFC+NG GLKA+  F  M++
Sbjct  351   AVTFTEMITAYMSFGMVDSAVEIFANVTEKNTITYNALMAGFCRNGHGLKALKLFTDMLQ  410

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMED  3546
               +E +DF+LTS  +ACGL+ E+K S+QIHGF +K G   N CI+ ALLDMCTRC RM D
Sbjct  411   RGVELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGTAFNPCIQTALLDMCTRCERMAD  470

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             AE++F + P       A TS++ GYA+NG P+ A+SLF  T  E  + +DEV+   +L V
Sbjct  471   AEEMFDQWPSNLDSSKATTSIIGGYARNGLPDKAVSLFHRTLCEQKLFLDEVSLTLILAV  530

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW  3186
             CGTLG  ++G  +HC ALK G+ SD+ +GN++ISMYAKC + D+A+K F  M   D+ SW
Sbjct  531   CGTLGFREMGYQIHCYALKAGYFSDISLGNSLISMYAKCCDSDDAIKIFNTMREHDVISW  590

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             NSL++ Y+L R GDEAL  WSRM    I PD  T   ++SA+R+T  N ++ C+  F SM
Sbjct  591   NSLISCYILQRNGDEALALWSRMNEKEIKPDIITLTLVISAFRYTESNKLSSCRDLFLSM  650

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSI  2826
             ++ Y + P ++HY   V VLG+WGLLEEAE+TIN+MP +P+ SV RALLDSC +H N+S+
Sbjct  651   KTIYDIEPTTEHYTAFVRVLGHWGLLEEAEDTINSMPVQPEVSVLRALLDSCRIHSNTSV  710

Query  2825  GKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQH  2646
              KRV K ILS +P+ PS +ILKSN+YSASG W  SE++R EM+E+G++K P +SW+I ++
Sbjct  711   AKRVAKLILSTKPETPSEYILKSNIYSASGFWHRSEMIREEMRERGYRKHPAKSWIIHEN  770

Query  2645  KFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAK  2466
             K HSF ARDTSH Q KDIY  L+ILI+EC+K GY P+T YVL EV+E+ KK FLFHHSAK
Sbjct  771   KIHSFHARDTSHPQEKDIYRGLEILIMECLKVGYEPNTEYVLQEVDEFMKKSFLFHHSAK  830

Query  2465  LALTYGLLMTK-HGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKC  2289
             LA+TYG+L +   GKPVRVMKN++LCGDCH FFK  S+V KREI +RD+SGFH F+NGKC
Sbjct  831   LAVTYGILSSNTRGKPVRVMKNVMLCGDCHEFFKYISVVVKREIVLRDSSGFHHFVNGKC  890

Query  2288  SCNDRW  2271
             SC D W
Sbjct  891   SCRDLW  896


 Score = 89.4 bits (220),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/313 (24%), Positives = 137/313 (44%), Gaps = 37/313 (12%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+   G+E  ++S  + + AC      ++  Q+H   IK G   +  +  AL+ + ++C 
Sbjct  407   DMLQRGVELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGTAFNPCIQTALLDMCTRCE  466

Query  4256  SLDFVIELFDNLPKRDIASWNT--MISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
              +    E+FD  P    +S  T  +I G  +  +  +A  LF+       L +D ++L+ 
Sbjct  467   RMADAEEMFDQWPSNLDSSKATTSIIGGYARNGLPDKAVSLFHRTLCEQKLFLDEVSLTL  526

Query  4082  LLNACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
             +L  C    F   G ++H +AL+ GY S++S+ N+LI  Y +C      + +F  M   D
Sbjct  527   ILAVCGTLGFREMGYQIHCYALKAGYFSDISLGNSLISMYAKCCDSDDAIKIFNTMREHD  586

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
               +WN +I+ Y+                               +NG+  +A+A + RM +
Sbjct  587   VISWNSLISCYI-----------------------------LQRNGD--EALALWSRMNE  615

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFI-LKS--GCEPNDCIEAALLDMCTRCGR  3555
             + I+    TLT + +A       K S     F+ +K+    EP      A + +    G 
Sbjct  616   KEIKPDIITLTLVISAFRYTESNKLSSCRDLFLSMKTIYDIEPTTEHYTAFVRVLGHWGL  675

Query  3554  MEDAEKIFHRMPL  3516
             +E+AE   + MP+
Sbjct  676   LEEAEDTINSMPV  688


 Score = 36.6 bits (83),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVEL  4450
             + + +D      +I+AY+  G+VD A+ +F      ++++  A+++GF +    ++A++L
Sbjct  345   MMMAQDAVTFTEMITAYMSFGMVDSAVEIFANVTEKNTITYNALMAGFCRNGHGLKALKL  404

Query  4449  FYEMRLER  4426
             F +M L+R
Sbjct  405   FTDM-LQR  411


 Score = 81.3 bits (199),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 97/464 (21%), Positives = 194/464 (42%), Gaps = 74/464 (16%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             F  LL    +  ++E+   VHA  +KL   + T + NAL+  Y K G     I +F +L 
Sbjct  83    FFYLLRLSAQYHDVEVTKAVHASFLKLRE-EKTRLGNALISTYLKLGFPREAILVFVSLS  141

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQ  4041
                + S+  +ISG  + ++   A ++F  M++   ++ +  T   +L AC        G 
Sbjct  142   SPTVVSYTALISGFSRLNLEIEALKVFFRMRKAGLVQPNEYTFVAILTACVRVSRFSLGI  201

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTR--CGSIKSVMALFERMLVRDAFTWNEMITAYME  3867
             ++H   ++ G+ +++ V+N+L+  Y +    S   V+ LF+ +  RD  +WN ++++   
Sbjct  202   QIHGLIVKSGFLNSVFVSNSLMSLYDKDSGSSCDDVLKLFDEIPQRDVASWNTVVSS---  258

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSDFTLTS  3690
                  L KE                       G+  KA   FY M + E      FTL++
Sbjct  259   -----LVKE-----------------------GKSHKAFDLFYEMNRVEGFGVDSFTLST  290

Query  3689  IANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRM----  3522
             + ++C         +++HG  ++ G      +  AL+   ++   M+  E ++  M    
Sbjct  291   LLSSCTDSSVLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFWDMKKVESLYEMMMAQD  350

Query  3521  -------------------------PLGHGRLVALTSMLRGYAQNGQPENAISLFFETQL  3417
                                       +     +   +++ G+ +NG    A+ LF +   
Sbjct  351   AVTFTEMITAYMSFGMVDSAVEIFANVTEKNTITYNALMAGFCRNGHGLKALKLFTDMLQ  410

Query  3416  EGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELD  3237
              G+ + D   T+  +  CG +   K+ E +H   +K G   +  +  A++ M  +C  + 
Sbjct  411   RGVELTDFSLTS-AVDACGLVSEKKVSEQIHGFCIKFGTAFNPCIQTALLDMCTRCERMA  469

Query  3236  NAVKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
             +A + F+     L SS+   +  S++ GY  +   D+A+  + R
Sbjct  470   DAEEMFDQWPSNLDSSK---ATTSIIGGYARNGLPDKAVSLFHR  510


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL EE TRL NALIS YLKLG    A+ VF SLSSP      A+ISGF+++N EI
Sbjct  103   HASFLKLREEKTRLGNALISTYLKLGFPREAILVFVSLSSPTVVSYTALISGFSRLNLEI  162

Query  4464  EAVELFYEMR  4435
             EA+++F+ MR
Sbjct  163   EALKVFFRMR  172


 Score = 69.3 bits (168),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/232 (26%), Positives = 113/232 (49%), Gaps = 22/232 (9%)
 Frame = -3

Query  3749  AFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMC  3570
              FFY +++ S ++ D  +T   +A  L +  + ++                +  AL+   
Sbjct  82    GFFY-LLRLSAQYHDVEVTKAVHASFLKLREEKTR----------------LGNALISTY  124

Query  3569  TRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEV  3390
              + G   +A  +F  + L    +V+ T+++ G+++      A+ +FF  +  GLV  +E 
Sbjct  125   LKLGFPREAILVF--VSLSSPTVVSYTALISGFSRLNLEIEALKVFFRMRKAGLVQPNEY  182

Query  3389  ATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAK--CGELDNAVKAFE  3216
                 +L  C  +    LG  +H L +K GFL+ V V N+++S+Y K      D+ +K F+
Sbjct  183   TFVAILTACVRVSRFSLGIQIHGLIVKSGFLNSVFVSNSLMSLYDKDSGSSCDDVLKLFD  242

Query  3215  LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERL-GIVPDSFTCLHILSA  3063
              +  RD+ SWN++++  V   +  +A D +  M R+ G   DSFT   +LS+
Sbjct  243   EIPQRDVASWNTVVSSLVKEGKSHKAFDLFYEMNRVEGFGVDSFTLSTLLSS  294



>ref|XP_006398839.1| hypothetical protein EUTSA_v10012634mg [Eutrema salsugineum]
 gb|ESQ40292.1| hypothetical protein EUTSA_v10012634mg [Eutrema salsugineum]
Length=896

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/726 (54%), Positives = 528/726 (73%), Gaps = 5/726 (1%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK--  4263
             +R  G I PNEY+FVA+LTAC+R     LG Q+H L++K G+L+S YV N++M LY+K  
Sbjct  171   MRSEGKIHPNEYTFVAILTACVRICRFSLGIQIHGLIVKSGFLNSVYVGNSVMSLYAKHP  230

Query  4262  CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
               S D V++LFD +P RD+ASWNT+IS +VKE M  +AF LF +M R + + +D  TLST
Sbjct  231   GSSSDDVLQLFDEIPHRDVASWNTVISSLVKEGMSDKAFGLFYEMNRVEGVGVDSFTLST  290

Query  4082  LLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
             LL++C++   + RG+ELH+ A+R+G +  LSVNNALI FY +CG IK V  L+E M VRD
Sbjct  291   LLSSCTDSSDLMRGRELHSRAIRVGLKQELSVNNALIGFYAKCGDIKKVENLYEMMSVRD  350

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
              FT  EMITAYM  G+VD A E+F+ +PEK+ + YNA++AG C+NG GLKA+  F  M++
Sbjct  351   GFTLTEMITAYMTVGMVDSAVEMFEKIPEKDVITYNALMAGLCRNGHGLKALRLFTEMLQ  410

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMED  3546
               +  +DF+LTS  +ACGL+ E++ S+QIHG  +K GC  N CI+ ALLDMCTRCGRM D
Sbjct  411   RGVVLTDFSLTSAVDACGLISEKEVSEQIHGSCIKFGCASNSCIQTALLDMCTRCGRMAD  470

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             AE+IF + P       A TS++ GYA+NG PE A+SLF  T  E  +V+DEV+   +L V
Sbjct  471   AEEIFEQWPSNLDSSKATTSIIGGYARNGLPEKALSLFLRTLCEEKLVLDEVSLTLILAV  530

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW  3186
             CGTLG  ++G  +H  ALK G+ SDV +GN++I MY+KC   D+A+K F  M   D+ S 
Sbjct  531   CGTLGFREMGYQIHGYALKGGYFSDVGLGNSLIGMYSKCCCSDDAIKVFNTMRKHDVVSC  590

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             NSL++ Y+L R GDEAL  W RM + GI PD+ T   ++SA+R++  + ++ C+  F SM
Sbjct  591   NSLISNYILQRNGDEALALWLRMNKEGIKPDTITLALVISAFRYSESDKLSSCRDLFLSM  650

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSI  2826
             ++ Y + P ++HY   V VLG WGLLEEAE+T+N+MPF+P+ SV R+LLDSC +H N+SI
Sbjct  651   KTIYDIEPTTEHYTAFVGVLGQWGLLEEAEDTVNSMPFQPEVSVLRSLLDSCRVHSNTSI  710

Query  2825  GKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQH  2646
              KRV K IL  +P +PS +ILKSN+YSASG W  SE++R EM+E+G +K P +SW+I ++
Sbjct  711   AKRVAKLILGTKPDNPSDYILKSNIYSASGLWHRSEMIREEMRERGHRKHPSRSWIIHEN  770

Query  2645  KFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAK  2466
             + HSF ARDTSH Q KDIYS L+ILI+EC++AGY PDT +VL EV+E+ KK FLFHHSAK
Sbjct  771   QVHSFHARDTSHPQEKDIYSGLEILIMECLRAGYEPDTEFVLQEVDEFMKKSFLFHHSAK  830

Query  2465  LALTYGLLMTKH-GKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKC  2289
             LA+TYG+L + + GKPVRV+KN+ LCGDCH FFK  S V KREI +RD+SGFH F+NGKC
Sbjct  831   LAVTYGILTSNNRGKPVRVVKNVRLCGDCHEFFKYVSAVVKREIVLRDSSGFHRFMNGKC  890

Query  2288  SCNDRW  2271
             SC D W
Sbjct  891   SCKDLW  896


 Score =   100 bits (250),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 100/464 (22%), Positives = 198/464 (43%), Gaps = 74/464 (16%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             F  LL    +  + E+   VHA  +KL   ++  + NAL+  Y K G       +F +L 
Sbjct  83    FFYLLRLSTQYHDAEVTKAVHASFLKLRE-ENINLGNALISTYLKLGFPRDAFLVFVSLS  141

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE-CFMRRGQ  4041
                + S+  +ISG  + ++  +A +LF  M+    +  +  T   +L AC   C    G 
Sbjct  142   SPTVVSYTALISGFARLNLEIKALKLFFRMRSEGKIHPNEYTFVAILTACVRICRFSLGI  201

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTR--CGSIKSVMALFERMLVRDAFTWNEMITAYME  3867
             ++H   ++ G+ +++ V N+++  Y +    S   V+ LF+ +  RD  +WN +I++ ++
Sbjct  202   QIHGLIVKSGFLNSVYVGNSVMSLYAKHPGSSSDDVLQLFDEIPHRDVASWNTVISSLVK  261

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSDFTLTS  3690
              G+ D                               KA   FY M + E +    FTL++
Sbjct  262   EGMSD-------------------------------KAFGLFYEMNRVEGVGVDSFTLST  290

Query  3689  IANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGH  3510
             + ++C    +    +++H   ++ G +    +  AL+    +CG ++  E ++  M +  
Sbjct  291   LLSSCTDSSDLMRGRELHSRAIRVGLKQELSVNNALIGFYAKCGDIKKVENLYEMMSVRD  350

Query  3509  G-----------------------------RLVALTSMLRGYAQNGQPENAISLFFETQL  3417
             G                              ++   +++ G  +NG    A+ LF E   
Sbjct  351   GFTLTEMITAYMTVGMVDSAVEMFEKIPEKDVITYNALMAGLCRNGHGLKALRLFTEMLQ  410

Query  3416  EGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELD  3237
              G+V+ D   T+  +  CG +   ++ E +H   +K G  S+  +  A++ M  +CG + 
Sbjct  411   RGVVLTDFSLTS-AVDACGLISEKEVSEQIHGSCIKFGCASNSCIQTALLDMCTRCGRMA  469

Query  3236  NAVKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
             +A + FE     L SS+   +  S++ GY  +   ++AL  + R
Sbjct  470   DAEEIFEQWPSNLDSSK---ATTSIIGGYARNGLPEKALSLFLR  510


 Score = 98.6 bits (244),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 152/323 (47%), Gaps = 38/323 (12%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             K+V A F ++   +    N +I+ Y++ G    A  +F  L     V Y A+++GF +  
Sbjct  100   KAVHASFLKLREENINLGNALISTYLKLGFPRDAFLVFVSLSSPTVVSYTALISGFARLN  159

Query  3767  EGLKAMAFFYRMIKES-IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               +KA+  F+RM  E  I  +++T  +I  AC  +       QIHG I+KSG   +  + 
Sbjct  160   LEIKALKLFFRMRSEGKIHPNEYTFVAILTACVRICRFSLGIQIHGLIVKSGFLNSVYVG  219

Query  3590  AALLDMCTR--CGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE-TQ  3420
              +++ +  +      +D  ++F  +P  H  + +  +++    + G  + A  LF+E  +
Sbjct  220   NSVMSLYAKHPGSSSDDVLQLFDEIP--HRDVASWNTVISSLVKEGMSDKAFGLFYEMNR  277

Query  3419  LEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL  3240
             +EG V VD    +T+L  C     L  G  LH  A++ G   ++ V NA+I  YAKCG++
Sbjct  278   VEG-VGVDSFTLSTLLSSCTDSSDLMRGRELHSRAIRVGLKQELSVNNALIGFYAKCGDI  336

Query  3239  -------------------------------DNAVKAFELMSSRDLCSWNSLLAGYVLHR  3153
                                            D+AV+ FE +  +D+ ++N+L+AG   + 
Sbjct  337   KKVENLYEMMSVRDGFTLTEMITAYMTVGMVDSAVEMFEKIPEKDVITYNALMAGLCRNG  396

Query  3152  RGDEALDTWSRMERLGIVPDSFT  3084
              G +AL  ++ M + G+V   F+
Sbjct  397   HGLKALRLFTEMLQRGVVLTDFS  419


 Score = 68.9 bits (167),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 7/72 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL EE+  L NALIS YLKLG    A  VF SLSSP      A+ISGFA++N EI
Sbjct  103   HASFLKLREENINLGNALISTYLKLGFPRDAFLVFVSLSSPTVVSYTALISGFARLNLEI  162

Query  4464  EAVELFYEMRLE  4429
             +A++LF+ MR E
Sbjct  163   KALKLFFRMRSE  174



>ref|XP_008805381.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Phoenix dactylifera]
Length=892

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/723 (54%), Positives = 524/723 (72%), Gaps = 3/723 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGI+PNE+SFVA+LT CIR  N +LG QVHAL IK  +    +V NAL+G+Y KCG 
Sbjct  171   MRQSGIDPNEFSFVAILTDCIRQGNSQLGAQVHALAIKTHHCFCGHVSNALVGMYVKCGR  230

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             +D  ++LF ++P+RD++SWN +I GMV++  +  AFELF+DMQ +     D+ TLSTLL+
Sbjct  231   VDAAVQLFGDMPERDVSSWNAVILGMVEDCRYHEAFELFHDMQISG-YHGDHFTLSTLLS  289

Query  4073  ACSECFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             A +E F    G+ +HA+AL+ G E  LS+ NALI FY++ G ++ V+ +F+RM VRD  +
Sbjct  290   AAAESFAHAEGEAIHAYALKTGLELELSICNALIGFYSKFGRVEDVVDVFQRMPVRDVIS  349

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W  M+T +ME GLVD A E+FD +PE+N++ YNA+LAGFC+N EG + +  F +++++ +
Sbjct  350   WTGMLTGFMEFGLVDSAVEVFDQMPERNSISYNALLAGFCKNSEGYRGLKLFQQILEDGM  409

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +D  LT   NAC ++ +RK S+QIH F++K GCE N  I+ AL+DMC++CGRMEDA+K
Sbjct  410   EMADIMLTGAINACAIVSDRKPSEQIHAFVIKIGCESNHWIKTALIDMCSKCGRMEDAQK  469

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVVVDEVATAtvlgvcg  3360
             +F          +A TS++  +A+NGQPE AI+LF E  + +G + +DE  +ATVLGVCG
Sbjct  470   MFGTSVHHRSFPMAWTSLICAHAKNGQPEEAIALFHEMLKRDGTIKMDEFMSATVLGVCG  529

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG   LG+ +HC   K G  SD+ V NA+ SMYAKCG+L +A+  F+ M   D+ SWN+
Sbjct  530   TLGFGVLGKQIHCSVAKSGISSDLAVENAIFSMYAKCGDLADAITFFDQMPRHDIVSWNA  589

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L+  ++LHR+GD ALD W+ M  LG+ PDS T   I SA ++T+ N V+ CQ  F SM  
Sbjct  590   LITAHLLHRQGDRALDVWANMVDLGVKPDSITFNLIFSACKYTSTNSVSTCQRLFHSMGR  649

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
             AY V PAS+HYA +V VLG+WG  +EAE  IN+MPF+  +S+WRALLD+C +  N S+GK
Sbjct  650   AYDVEPASEHYAAMVDVLGFWGSFDEAERLINSMPFKADASIWRALLDNCRLRSNLSLGK  709

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             +V +++L++EPQDPST+IL SNLYSA GRW CSE VR EM+ KGF+K P +SW I Q+  
Sbjct  710   QVAQRLLALEPQDPSTYILVSNLYSAFGRWHCSEKVRNEMRGKGFRKHPARSWTIHQNAV  769

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSFFARD SH Q+KDIY  LDILILECMKAGY PDTS+VLHEVEEYQKK FLF+HSAKLA
Sbjct  770   HSFFARDRSHPQTKDIYGGLDILILECMKAGYEPDTSFVLHEVEEYQKKHFLFYHSAKLA  829

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
               YG+LMT  G+PVR++KNI LCGDCH F    S VT REI VRD +GFH F  GKCSC 
Sbjct  830   AMYGILMTGRGRPVRIVKNIRLCGDCHAFMNYVSTVTGREISVRDATGFHNFKGGKCSCG  889

Query  2279  DRW  2271
             D W
Sbjct  890   DSW  892


 Score =   115 bits (288),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 107/450 (24%), Positives = 194/450 (43%), Gaps = 67/450 (15%)
 Frame = -3

Query  4316  GYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELF  4137
             G  D T + NAL+ +Y K G L    + F+ LP  D+AS+  ++SG  K      A +LF
Sbjct  109   GADDDTRLANALIFMYLKLGRLADARKAFECLPCPDVASFTALVSGYAKCGCEAEAIDLF  168

Query  4136  NDMQRNDCLRIDYITLSTLLNACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRC  3957
               M+++     ++  ++ L +   +   + G ++HA A++  +     V+NAL+  Y +C
Sbjct  169   CRMRQSGIDPNEFSFVAILTDCIRQGNSQLGAQVHALAIKTHHCFCGHVSNALVGMYVKC  228

Query  3956  GSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFC  3777
             G + + + LF  M  RD  +W                               NAV+ G  
Sbjct  229   GRVDAAVQLFGDMPERDVSSW-------------------------------NAVILGMV  257

Query  3776  QNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDC  3597
             ++    +A   F+ M         FTL+++ +A          + IH + LK+G E    
Sbjct  258   EDCRYHEAFELFHDMQISGYHGDHFTLSTLLSAAAESFAHAEGEAIHAYALKTGLELELS  317

Query  3596  IEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLF-----  3432
             I  AL+   ++ GR+ED   +F RMP+    +++ T ML G+ + G  ++A+ +F     
Sbjct  318   ICNALIGFYSKFGRVEDVVDVFQRMPVRD--VISWTGMLTGFMEFGLVDSAVEVFDQMPE  375

Query  3431  -------------------------FETQLEGLVVVDEVATAtvlgvcgtlgllklGENL  3327
                                      F+  LE  + + ++     +  C  +   K  E +
Sbjct  376   RNSISYNALLAGFCKNSEGYRGLKLFQQILEDGMEMADIMLTGAINACAIVSDRKPSEQI  435

Query  3326  HCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFEL-MSSRDL-CSWNSLLAGYVLHR  3153
             H   +K G  S+  +  A+I M +KCG +++A K F   +  R    +W SL+  +  + 
Sbjct  436   HAFVIKIGCESNHWIKTALIDMCSKCGRMEDAQKMFGTSVHHRSFPMAWTSLICAHAKNG  495

Query  3152  RGDEALDTWSRM-ERLGIVP-DSFTCLHIL  3069
             + +EA+  +  M +R G +  D F    +L
Sbjct  496   QPEEAIALFHEMLKRDGTIKMDEFMSATVL  525


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = -2

Query  4602  EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVELFYE  4441
             ++DTRL+NALI  YLKLG +  A   F+ L  P      A++SG+AK   E EA++LF  
Sbjct  111   DDDTRLANALIFMYLKLGRLADARKAFECLPCPDVASFTALVSGYAKCGCEAEAIDLFCR  170

Query  4440  MR  4435
             MR
Sbjct  171   MR  172


 Score = 55.1 bits (131),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -3

Query  3305  GFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTW  3126
             G   D  + NA+I MY K G L +A KAFE +   D+ S+ +L++GY       EA+D +
Sbjct  109   GADDDTRLANALIFMYLKLGRLADARKAFECLPCPDVASFTALVSGYAKCGCEAEAIDLF  168

Query  3125  SRMERLGIVPDSFTCLHILS  3066
              RM + GI P+ F+ + IL+
Sbjct  169   CRMRQSGIDPNEFSFVAILT  188



>gb|KFK24838.1| hypothetical protein AALP_AA8G031300 [Arabis alpina]
Length=881

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/729 (54%), Positives = 533/729 (73%), Gaps = 9/729 (1%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK--  4263
             +R  G I+PNE++FVA+LT+C+R     LG Q+H L++K G+L   YV N++M LY+K  
Sbjct  154   MRNEGLIQPNEHTFVAVLTSCVRICRFSLGVQIHGLIVKSGFLSYVYVGNSVMSLYAKKV  213

Query  4262  --CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITL  4089
               C S D V++LFD +P+RD+ SWNT+IS +VKE ++ +AFELF++M R + + +D  T+
Sbjct  214   HGCSSGD-VVKLFDEMPQRDLVSWNTVISCLVKEGLYEKAFELFHEMNRVEGVGVDCFTV  272

Query  4088  STLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLV  3912
             STLL++C++     RG+ELHA  +RIG    LSV+NALI FY + G +K V  L+E M V
Sbjct  273   STLLSSCTDSNDSMRGKELHARVVRIGLMRELSVSNALIGFYGKFGDVKKVEYLYEMMNV  332

Query  3911  RDAFTWNEMITAYMESGLVDLAKELFDH-LPEKNAVLYNAVLAGFCQNGEGLKAMAFFYR  3735
             RD FT  EMITAYM  G+VDLA E+F+  +PEKN + YNA++AGFC+NG GLKA+  F  
Sbjct  333   RDGFTLTEMITAYMGFGMVDLAVEMFEKKIPEKNIITYNALMAGFCRNGYGLKALELFSE  392

Query  3734  MIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGR  3555
             M++  +  +DF+LTS  +ACGL+ E+K S+Q+HGF +K GC  N CI+ ALLDMCTRC R
Sbjct  393   MLQRGVALTDFSLTSAVDACGLVSEKKVSEQLHGFCIKFGCASNPCIQTALLDMCTRCDR  452

Query  3554  MEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtv  3375
             M DAE++F + P       A TS+L GYA+NG P+ A+SLF  +  E  +V+DEV+   +
Sbjct  453   MVDAEEMFDQWPSNLDSSKATTSILGGYARNGLPDKALSLFHRSICEEKLVLDEVSLTLI  512

Query  3374  lgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDL  3195
             L VCGTLG  ++G+ ++  ALK G+LSDV +GN++ISMY+KC   D+A+K F  M   D+
Sbjct  513   LSVCGTLGFREMGDQIYGYALKGGYLSDVGLGNSLISMYSKCCHFDDAIKVFNAMQKHDV  572

Query  3194  CSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFF  3015
              SWNSL++ Y+L R GDEAL  WSRM +  I PD+ T   ++SAYR+T  N ++ C++ F
Sbjct  573   VSWNSLISCYILQRNGDEALALWSRMNKERIKPDTITLALVISAYRYTESNKLSSCRNLF  632

Query  3014  FSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLN  2835
              S+++ YG+ P ++HY   V VLG+WGLLEEAEE +N+MPF+P+ SV RALLD C +H N
Sbjct  633   LSVKTIYGIEPTTEHYTAFVGVLGHWGLLEEAEEIVNSMPFQPEVSVLRALLDRCRVHSN  692

Query  2834  SSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVI  2655
             +SI KRV K ILS +P +PS +ILKSN+YSASG W  SE++R +M+E+G +K P +SW+I
Sbjct  693   TSIAKRVSKLILSTKPDNPSEYILKSNIYSASGLWHRSEMIREQMRERGHRKHPSRSWII  752

Query  2654  CQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHH  2475
              ++  HSF ARD SH Q KDIY  L+ILI+EC+KAGY P+T +VL EV+E+ KK FLFHH
Sbjct  753   HENNVHSFHARDASHPQEKDIYGGLEILIMECLKAGYEPNTEFVLQEVDEFIKKSFLFHH  812

Query  2474  SAKLALTYGLLMTK-HGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLN  2298
             SAKLA+TYG+L +   GKPVRVMKN++LCGDCH F K  S+V KREI +RDTSGFHCF+N
Sbjct  813   SAKLAVTYGILSSNSRGKPVRVMKNVMLCGDCHEFLKFVSVVVKREIVLRDTSGFHCFVN  872

Query  2297  GKCSCNDRW  2271
             GKCSC D W
Sbjct  873   GKCSCKDLW  881


 Score = 79.0 bits (193),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 143/326 (44%), Gaps = 42/326 (13%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             K+V A + ++        N  I  Y++ G    A  +F  L   N V Y ++++GF +  
Sbjct  83    KAVHASYLKLREEKTNLGNAFIDTYLKLGYPREASRVFASLSSPNVVSYTSLISGFKRLN  142

Query  3767  EGLKAMAFFYRMIKES-IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               +KA+  F+ M  E  I+ ++ T  ++  +C  +       QIHG I+KSG      + 
Sbjct  143   LEIKALKVFFMMRNEGLIQPNEHTFVAVLTSCVRICRFSLGVQIHGLIVKSGFLSYVYVG  202

Query  3590  AALLDMCTR----CGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE-  3426
              +++ +  +    C    D  K+F  MP     LV+  +++    + G  E A  LF E 
Sbjct  203   NSVMSLYAKKVHGCSS-GDVVKLFDEMP--QRDLVSWNTVISCLVKEGLYEKAFELFHEM  259

Query  3425  TQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG  3246
              ++EG V VD    +T+L  C        G+ LH   ++ G + ++ V NA+I  Y K G
Sbjct  260   NRVEG-VGVDCFTVSTLLSSCTDSNDSMRGKELHARVVRIGLMRELSVSNALIGFYGKFG  318

Query  3245  ELDNAVKAFELMSSRD--------------------------------LCSWNSLLAGYV  3162
             ++      +E+M+ RD                                + ++N+L+AG+ 
Sbjct  319   DVKKVEYLYEMMNVRDGFTLTEMITAYMGFGMVDLAVEMFEKKIPEKNIITYNALMAGFC  378

Query  3161  LHRRGDEALDTWSRMERLGIVPDSFT  3084
              +  G +AL+ +S M + G+    F+
Sbjct  379   RNGYGLKALELFSEMLQRGVALTDFS  404


 Score = 60.1 bits (144),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 7/72 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A +LKL EE T L NA I  YLKLG    A  VF SLSSP      ++ISGF ++N EI
Sbjct  86    HASYLKLREEKTNLGNAFIDTYLKLGYPREASRVFASLSSPNVVSYTSLISGFKRLNLEI  145

Query  4464  EAVELFYEMRLE  4429
             +A+++F+ MR E
Sbjct  146   KALKVFFMMRNE  157



>ref|XP_006287028.1| hypothetical protein CARUB_v10000176mg [Capsella rubella]
 gb|EOA19926.1| hypothetical protein CARUB_v10000176mg [Capsella rubella]
Length=895

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/726 (54%), Positives = 531/726 (73%), Gaps = 5/726 (1%)
 Frame = -3

Query  4433  LRGSGI-EPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK--  4263
             +R +GI +PNEY+FVA+LTAC R     LG Q+H L++K G+L+S +V N+LM LY+K  
Sbjct  170   MRKAGIVQPNEYTFVAILTACARVSRFSLGIQIHGLIVKSGFLNSVFVGNSLMSLYAKDS  229

Query  4262  CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
               S + V++LFD +P RD+ SWNT+IS +VKE M  +AF LF +M R   L +D  TLS 
Sbjct  230   GSSCNDVLKLFDEIPHRDVTSWNTVISSLVKEGMSDKAFGLFYEMNRVQGLGVDCFTLSA  289

Query  4082  LLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
             LL++C++   + RG+ELH  A+RIG    LSV+NALI FY++ G IK V +L++ M+V+D
Sbjct  290   LLSSCTDSDDLLRGRELHGRAIRIGLMQELSVSNALIGFYSKFGDIKKVESLYDMMMVQD  349

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
             A T  EMITAYM  G+VD A E+F+++ EKN + YNA++AGFC+NG GLKA+  F  M++
Sbjct  350   AVTSTEMITAYMAFGMVDSAVEIFENITEKNTITYNALMAGFCRNGHGLKALRLFTEMLQ  409

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMED  3546
               +E +DF+LTS  +ACGL+ E+K S+QIH F +K GC  N CI+ ALLDMCTRC RM D
Sbjct  410   RGVELTDFSLTSAVDACGLVSEKKLSEQIHAFCIKFGCLLNPCIQTALLDMCTRCERMSD  469

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             AE++F + P       A TS+L GYA++G P+ A+SLF  T  E  + +DE++   +L V
Sbjct  470   AEEMFDQWPSNLDSSKATTSILGGYARDGLPDKAVSLFHRTLCEEKLFLDEISLTLILAV  529

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW  3186
             CGTLG  ++G  +HC ALK G+ SDV +GN++ISMY+KC + D+A+K F  M   D+ SW
Sbjct  530   CGTLGFREMGYQIHCHALKGGYFSDVGLGNSLISMYSKCCDSDDAIKVFNTMQEHDVVSW  589

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             NSL++ Y+L R G++ L  W +M    I PD  T   +++A+R+T  N ++ C+  F SM
Sbjct  590   NSLISCYILQRNGEKVLALWLKMNEEEIKPDMITLTLVITAFRYTESNKLSSCRDLFLSM  649

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSI  2826
             +S Y + P ++HY   V VLG+WGLLEEAE+TINTMPF+P+ SV RALLDSC +H N+S+
Sbjct  650   KSIYDIEPMTEHYTAFVRVLGHWGLLEEAEDTINTMPFQPEVSVLRALLDSCRVHSNTSV  709

Query  2825  GKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQH  2646
              KRV K ILS +P+ PS +ILKSN+YSA+G W  SE++R EM+E+G++K P +SW+I ++
Sbjct  710   AKRVAKLILSTKPETPSEYILKSNIYSAAGLWHRSEMIREEMRERGYRKHPSRSWIIHEN  769

Query  2645  KFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAK  2466
             K HSF ARDTSH + KDIYS L+ILI+EC+KAGY P+T +VL EV+E+ KK FLFHHSAK
Sbjct  770   KVHSFHARDTSHPREKDIYSGLEILIMECLKAGYEPNTEFVLQEVDEFMKKSFLFHHSAK  829

Query  2465  LALTYGLLMTK-HGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKC  2289
             LA+TYG+L +   GKPVRV+KN++LCGDCH FFK  SIV KREI +RD+SGFH F+NGKC
Sbjct  830   LAVTYGILTSDTRGKPVRVVKNVMLCGDCHEFFKYISIVVKREIVLRDSSGFHHFVNGKC  889

Query  2288  SCNDRW  2271
             SC DRW
Sbjct  890   SCRDRW  895


 Score = 89.0 bits (219),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 151/323 (47%), Gaps = 38/323 (12%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             ++V A F ++ V      N +I+ Y++ G    A  +F  +     V Y A+++GF +  
Sbjct  99    RAVHASFLKLRVEKPRLGNALISTYLKLGFPREAFLVFMSMTSPTVVSYTALISGFSKLN  158

Query  3767  EGLKAMAFFYRMIKESI-EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               ++A+  F+RM K  I + +++T  +I  AC  +       QIHG I+KSG   +  + 
Sbjct  159   LEIEALKVFFRMRKAGIVQPNEYTFVAILTACARVSRFSLGIQIHGLIVKSGFLNSVFVG  218

Query  3590  AALLDMCTR--CGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE-TQ  3420
              +L+ +  +       D  K+F  +P  H  + +  +++    + G  + A  LF+E  +
Sbjct  219   NSLMSLYAKDSGSSCNDVLKLFDEIP--HRDVTSWNTVISSLVKEGMSDKAFGLFYEMNR  276

Query  3419  LEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL  3240
             ++GL  VD    + +L  C     L  G  LH  A++ G + ++ V NA+I  Y+K G++
Sbjct  277   VQGL-GVDCFTLSALLSSCTDSDDLLRGRELHGRAIRIGLMQELSVSNALIGFYSKFGDI  335

Query  3239  -------------------------------DNAVKAFELMSSRDLCSWNSLLAGYVLHR  3153
                                            D+AV+ FE ++ ++  ++N+L+AG+  + 
Sbjct  336   KKVESLYDMMMVQDAVTSTEMITAYMAFGMVDSAVEIFENITEKNTITYNALMAGFCRNG  395

Query  3152  RGDEALDTWSRMERLGIVPDSFT  3084
              G +AL  ++ M + G+    F+
Sbjct  396   HGLKALRLFTEMLQRGVELTDFS  418


 Score = 88.6 bits (218),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 97/464 (21%), Positives = 196/464 (42%), Gaps = 74/464 (16%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             F  LL    +  ++E+   VHA  +KL  ++   + NAL+  Y K G       +F ++ 
Sbjct  82    FFYLLRLSAQYHDVEVTRAVHASFLKL-RVEKPRLGNALISTYLKLGFPREAFLVFMSMT  140

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQ  4041
                + S+  +ISG  K ++   A ++F  M++   ++ +  T   +L AC+       G 
Sbjct  141   SPTVVSYTALISGFSKLNLEIEALKVFFRMRKAGIVQPNEYTFVAILTACARVSRFSLGI  200

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTR--CGSIKSVMALFERMLVRDAFTWNEMITAYME  3867
             ++H   ++ G+ +++ V N+L+  Y +    S   V+ LF+ +  RD  +WN +I++ ++
Sbjct  201   QIHGLIVKSGFLNSVFVGNSLMSLYAKDSGSSCNDVLKLFDEIPHRDVTSWNTVISSLVK  260

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSDFTLTS  3690
              G+ D                               KA   FY M + + +    FTL++
Sbjct  261   EGMSD-------------------------------KAFGLFYEMNRVQGLGVDCFTLSA  289

Query  3689  IANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRM----  3522
             + ++C    +    +++HG  ++ G      +  AL+   ++ G ++  E ++  M    
Sbjct  290   LLSSCTDSDDLLRGRELHGRAIRIGLMQELSVSNALIGFYSKFGDIKKVESLYDMMMVQD  349

Query  3521  -------------------------PLGHGRLVALTSMLRGYAQNGQPENAISLFFETQL  3417
                                       +     +   +++ G+ +NG    A+ LF E   
Sbjct  350   AVTSTEMITAYMAFGMVDSAVEIFENITEKNTITYNALMAGFCRNGHGLKALRLFTEMLQ  409

Query  3416  EGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELD  3237
              G+ + D   T+  +  CG +   KL E +H   +K G L +  +  A++ M  +C  + 
Sbjct  410   RGVELTDFSLTS-AVDACGLVSEKKLSEQIHAFCIKFGCLLNPCIQTALLDMCTRCERMS  468

Query  3236  NAVKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
             +A + F+     L SS+   +  S+L GY      D+A+  + R
Sbjct  469   DAEEMFDQWPSNLDSSK---ATTSILGGYARDGLPDKAVSLFHR  509


 Score = 67.0 bits (162),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKLE-EDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL  E  RL NALIS YLKLG    A  VF S++SP      A+ISGF+K+N EI
Sbjct  102   HASFLKLRVEKPRLGNALISTYLKLGFPREAFLVFMSMTSPTVVSYTALISGFSKLNLEI  161

Query  4464  EAVELFYEMR  4435
             EA+++F+ MR
Sbjct  162   EALKVFFRMR  171



>ref|XP_010908658.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Elaeis guineensis]
Length=899

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/723 (54%), Positives = 523/723 (72%), Gaps = 3/723 (0%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGI+PN++SFVA+LT CIR  N +LG QVHAL +K  +    +V NAL+G+Y KCG 
Sbjct  178   MRLSGIDPNQFSFVAILTDCIRQANSQLGAQVHALAVKTYHCSCVHVSNALVGMYVKCGR  237

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             +D  ++LF ++P+RD++SWNT+I GM+++  +  AFELF+DMQ N     D+ TLSTLL+
Sbjct  238   VDAAVQLFGDMPERDVSSWNTVILGMIEDCRYHEAFELFHDMQING-YHGDHFTLSTLLS  296

Query  4073  ACSECFM-RRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             A +E F    G+ +HA+AL+ G E  LSV NALI  Y++ G ++ V+ +F+ M VRD  +
Sbjct  297   ASAESFAYAEGEAIHAYALKTGLELELSVGNALIGLYSKFGGVEDVVDVFQGMPVRDVIS  356

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W  M++ +ME GLV+ A E+FD +PE+N + Y+A+LAGFC+NGEG + +  F +++++ +
Sbjct  357   WTGMLSGFMEFGLVESAVEVFDQMPERNCISYSALLAGFCKNGEGYQGLKLFQQILEDRM  416

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E SD TLTS  NAC ++ +RK S+QIH F++K GCE ND IEAAL+DMC++CGRMEDA+K
Sbjct  417   EISDITLTSAINACAMVSDRKQSEQIHAFMVKVGCESNDWIEAALIDMCSKCGRMEDAQK  476

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLF-FETQLEGLVVVDEVATAtvlgvcg  3360
             +F          ++ TS++  +A+NGQP+ AISLF    + +G+V +DE   ATVLGVCG
Sbjct  477   MFGTSVHNRTFSMSWTSLICAHAKNGQPDEAISLFHVMLKRDGMVHMDEFMLATVLGVCG  536

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
             TLG   LG+ +H    K G  SD+ V NA+ SMYAKCG L +A+  F+ M   D+ SWN+
Sbjct  537   TLGFGVLGKQIHGFVAKSGMSSDLAVENAIFSMYAKCGNLVDAITFFDQMPRHDVVSWNA  596

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             L+  ++LHR+GD ALD W+ M  LG+ PDS T   I SA ++T+ N V+ CQ  F SM S
Sbjct  597   LITAHLLHRQGDSALDVWANMADLGVKPDSITFYLIFSACKYTSSNSVSTCQRLFCSMGS  656

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
             AY + P S+HYA +V VLG+WG   EA+  I +MPF+  +S+WRALLD+C +  N S+G+
Sbjct  657   AYDIEPTSEHYAAMVDVLGFWGSFNEAKRLIKSMPFKADASIWRALLDNCRLRSNLSLGR  716

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
             + ++ +L++EPQDPST+IL SNLYSASGRW CS+ VR EM+ KGF K P +SW I Q+  
Sbjct  717   QAVQHLLALEPQDPSTYILVSNLYSASGRWHCSDKVRDEMRGKGFCKHPARSWTIHQNAV  776

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             HSFFARD SH Q+KDIYS LDILILECMKAGY PDTS+VLHEVEEYQKK FLF+HSAKLA
Sbjct  777   HSFFARDRSHPQNKDIYSGLDILILECMKAGYQPDTSFVLHEVEEYQKKHFLFYHSAKLA  836

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             + YG+LMT  G+PVR++KNI LCGDCH F    S VT REI VRD +GFH F  GKCSC 
Sbjct  837   VMYGILMTGPGQPVRIVKNIRLCGDCHAFMNYVSTVTGREISVRDATGFHNFKRGKCSCG  896

Query  2279  DRW  2271
             D W
Sbjct  897   DYW  899


 Score =   135 bits (340),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/370 (25%), Positives = 169/370 (46%), Gaps = 68/370 (18%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D++ +G   + ++   LL+A   S     G  +HA  +K G      V NAL+GLYSK G
Sbjct  278   DMQINGYHGDHFTLSTLLSASAESFAYAEGEAIHAYALKTGLELELSVGNALIGLYSKFG  337

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDC------------  4113
              ++ V+++F  +P RD+ SW  M+SG ++  +   A E+F+ M   +C            
Sbjct  338   GVEDVVDVFQGMPVRDVISWTGMLSGFMEFGLVESAVEVFDQMPERNCISYSALLAGFCK  397

Query  4112  ------------------LRIDYITLSTLLNACSECFMRR-GQELHAHALRIGYESNLSV  3990
                               + I  ITL++ +NAC+    R+  +++HA  +++G ESN  +
Sbjct  398   NGEGYQGLKLFQQILEDRMEISDITLTSAINACAMVSDRKQSEQIHAFMVKVGCESNDWI  457

Query  3989  NNALIKFYTRCGSIKSVMALFERMLVRDAF--TWNEMITAYMESGLVDLAKELFDHLPEK  3816
               ALI   ++CG ++    +F   +    F  +W  +I A+                   
Sbjct  458   EAALIDMCSKCGRMEDAQKMFGTSVHNRTFSMSWTSLICAH-------------------  498

Query  3815  NAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES--IEFSDFTLTSIANACGLLMERKSSKQ  3642
                          +NG+  +A++ F+ M+K    +   +F L ++   CG L      KQ
Sbjct  499   ------------AKNGQPDEAISLFHVMLKRDGMVHMDEFMLATVLGVCGTLGFGVLGKQ  546

Query  3641  IHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQN  3462
             IHGF+ KSG   +  +E A+  M  +CG + DA   F +MP     +V+  +++  +  +
Sbjct  547   IHGFVAKSGMSSDLAVENAIFSMYAKCGNLVDAITFFDQMP--RHDVVSWNALITAHLLH  604

Query  3461  GQPENAISLF  3432
              Q ++A+ ++
Sbjct  605   RQGDSALDVW  614


 Score = 39.3 bits (90),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (54%), Gaps = 6/63 (10%)
 Frame = -2

Query  4590  RLSNALISAYLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEMRLE  4429
              +SNAL+  Y+K G VD A+ +F  +      S   +I G  +  R  EA ELF++M++ 
Sbjct  223   HVSNALVGMYVKCGRVDAAVQLFGDMPERDVSSWNTVILGMIEDCRYHEAFELFHDMQIN  282

Query  4428  RFR  4420
              + 
Sbjct  283   GYH  285


 Score =   119 bits (298),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 106/436 (24%), Positives = 191/436 (44%), Gaps = 66/436 (15%)
 Frame = -3

Query  4307  DSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDM  4128
             D T + NAL+ +Y K G L    + F+ LP  D+AS+  ++SG  K      A +LF  M
Sbjct  119   DDTPLANALISMYLKLGRLADARKAFECLPCPDVASFTALVSGYAKCGCEAEAVDLFCRM  178

Query  4127  QRNDCLRIDYITLSTLLNACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSI  3948
             + +      +  ++ L +   +   + G ++HA A++  + S + V+NAL+  Y +CG +
Sbjct  179   RLSGIDPNQFSFVAILTDCIRQANSQLGAQVHALAVKTYHCSCVHVSNALVGMYVKCGRV  238

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
              + + LF  M  RD  +WN +I   +E                             C+  
Sbjct  239   DAAVQLFGDMPERDVSSWNTVILGMIED----------------------------CRYH  270

Query  3767  EGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEA  3588
             E   A   F+ M         FTL+++ +A          + IH + LK+G E    +  
Sbjct  271   E---AFELFHDMQINGYHGDHFTLSTLLSASAESFAYAEGEAIHAYALKTGLELELSVGN  327

Query  3587  ALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLF--------  3432
             AL+ + ++ G +ED   +F  MP+    +++ T ML G+ + G  E+A+ +F        
Sbjct  328   ALIGLYSKFGGVEDVVDVFQGMPVRD--VISWTGMLSGFMEFGLVESAVEVFDQMPERNC  385

Query  3431  ----------------------FETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCL  3318
                                   F+  LE  + + ++   + +  C  +   K  E +H  
Sbjct  386   ISYSALLAGFCKNGEGYQGLKLFQQILEDRMEISDITLTSAINACAMVSDRKQSEQIHAF  445

Query  3317  ALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFEL-MSSRDLC-SWNSLLAGYVLHRRGD  3144
              +K G  S+  +  A+I M +KCG +++A K F   + +R    SW SL+  +  + + D
Sbjct  446   MVKVGCESNDWIEAALIDMCSKCGRMEDAQKMFGTSVHNRTFSMSWTSLICAHAKNGQPD  505

Query  3143  EALDTWSRM-ERLGIV  3099
             EA+  +  M +R G+V
Sbjct  506   EAISLFHVMLKRDGMV  521


 Score = 57.8 bits (138),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 6/65 (9%)
 Frame = -2

Query  4608  KLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVELF  4447
             + ++DT L+NALIS YLKLG +  A   F+ L  P      A++SG+AK   E EAV+LF
Sbjct  116   RADDDTPLANALISMYLKLGRLADARKAFECLPCPDVASFTALVSGYAKCGCEAEAVDLF  175

Query  4446  YEMRL  4432
               MRL
Sbjct  176   CRMRL  180



>emb|CDY14176.1| BnaC02g02930D [Brassica napus]
Length=877

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/723 (53%), Positives = 519/723 (72%), Gaps = 11/723 (2%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +R  G IEPNEY+FVA+L AC+RS+   LG Q+H L++K G+L+S +V N++M LYS   
Sbjct  164   MRSEGVIEPNEYTFVAVLNACVRSRRFSLGVQIHGLIVKSGFLNSVFVRNSVMSLYSSGD  223

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             +     ++FD +P RD+ASWNT+IS +VKE +F  AF LF +M R +    D  T+STLL
Sbjct  224   AR----KVFDEMPVRDVASWNTVISCLVKEGLFGEAFGLFCEMNRVE--EADSFTVSTLL  277

Query  4076  NACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             +A       RG+ELH   +R+G    LSV+NALI FY + G ++ V  L+E M VRD FT
Sbjct  278   SASDSM---RGRELHGRVIRVGLRQELSVSNALIGFYAKYGDVRKVETLYEMMSVRDGFT  334

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
               EMITAYM  G+VD A E+F+ +PEKNA+ YNA++AGFC+NG G KA+  F+ M++  +
Sbjct  335   LTEMITAYMAFGMVDSAVEMFEKIPEKNAISYNALMAGFCRNGYGSKALKLFFEMLQRGV  394

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +DF+LTS  +ACGL+ E+K S+Q+HGF +K GC  N CI+ ALLDMCTRC RM DAE+
Sbjct  395   ELTDFSLTSAVDACGLVAEKKVSEQVHGFCVKFGCATNPCIQTALLDMCTRCERMTDAEE  454

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F + P       A TSML GY +NG PE A+SLF  T  E  +V+DEV+    L VCGT
Sbjct  455   MFEQWPCNLDSSKATTSMLGGYFRNGLPEKALSLFHRTLKEEKLVLDEVSLTLALAVCGT  514

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG  ++G+ +H  ALK G+ SDV +GN++ISMY+KC   ++A+K F  M   D+ SWNSL
Sbjct  515   LGSGEMGDQIHGYALKGGYSSDVGLGNSLISMYSKCYHFNDAIKVFNTMREHDVVSWNSL  574

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             ++ Y+L R GDEAL  W RM + GI PD+ T   ++S+Y++T  + ++ C+  F SM++ 
Sbjct  575   ISCYILQRNGDEALTLWLRMNKEGIKPDTITLALVISSYKYTESDKISTCRDLFLSMETT  634

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             +G+ P ++HY   V VLG+WGLLEEAEET+N+MPF P+ SV RALLDSC +H N+S+ KR
Sbjct  635   HGISPTTEHYTAFVRVLGHWGLLEEAEETVNSMPFHPEVSVLRALLDSCRVHSNASMAKR  694

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V K ILS +P +PS +ILKSN+YSASG W  SE +R EM+E+G++K P +SW++  +  H
Sbjct  695   VAKLILSAKPDNPSEYILKSNIYSASGLWHRSETIREEMRERGYRKHPSRSWIVHGNAIH  754

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
             SF ARDTSH + KD+YS L+ILI+EC+KAGY P+T +VL EV+E  KK FLFHHSAKLAL
Sbjct  755   SFHARDTSHPEEKDVYSGLEILIMECLKAGYEPNTEFVLQEVDELTKKSFLFHHSAKLAL  814

Query  2456  TYGLLMTKHGK-PVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             TYG+L  K+ + PVRV+KN+++CGDCH F+K  S+V KREI +RD+SGFH F+NG CSC 
Sbjct  815   TYGILTAKNQREPVRVVKNVMVCGDCHEFYKYVSVVVKREIVLRDSSGFHRFVNGNCSCK  874

Query  2279  DRW  2271
             D W
Sbjct  875   DLW  877


 Score = 94.0 bits (232),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 101/442 (23%), Positives = 208/442 (47%), Gaps = 42/442 (10%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             F  LL    + +++E+   VHA  +KL   + T + NAL+  Y K G     + +F +L 
Sbjct  76    FFYLLRLSSQHRDVEVARAVHASFLKLRE-EKTKLGNALISTYLKLGLPREALLVFASLS  134

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECFMRR---  4047
                + S+  +ISG  + ++  +A ++F  M+    +  +  T   +LNAC     RR   
Sbjct  135   SPSVVSYTALISGFARLNLEIKALKVFFKMRSEGVIEPNEYTFVAVLNACVRS--RRFSL  192

Query  4046  GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYME  3867
             G ++H   ++ G+ +++ V N+++  Y+   + K    +F+ M VRD  +WN +I+  ++
Sbjct  193   GVQIHGLIVKSGFLNSVFVRNSVMSLYSSGDARK----VFDEMPVRDVASWNTVISCLVK  248

Query  3866  SGLVDLAKELF---DHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTL  3696
              GL   A  LF   + + E ++   + +L+      + ++      R+I+  +       
Sbjct  249   EGLFGEAFGLFCEMNRVEEADSFTVSTLLSA----SDSMRGRELHGRVIRVGLRQE----  300

Query  3695  TSIANA-CGLLMERKSSKQIHGFI----LKSGCEPNDCIEAALLDMCTRCGRMEDAEKIF  3531
              S++NA  G   +    +++        ++ G    + I A +       G ++ A ++F
Sbjct  301   LSVSNALIGFYAKYGDVRKVETLYEMMSVRDGFTLTEMITAYMA-----FGMVDSAVEMF  355

Query  3530  HRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlg  3351
              ++P  +   ++  +++ G+ +NG    A+ LFFE    G+ + D   T+  +  CG + 
Sbjct  356   EKIPEKNA--ISYNALMAGFCRNGYGSKALKLFFEMLQRGVELTDFSLTS-AVDACGLVA  412

Query  3350  llklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFE-----LMSSRDLCSW  3186
               K+ E +H   +K G  ++  +  A++ M  +C  + +A + FE     L SS+   + 
Sbjct  413   EKKVSEQVHGFCVKFGCATNPCIQTALLDMCTRCERMTDAEEMFEQWPCNLDSSK---AT  469

Query  3185  NSLLAGYVLHRRGDEALDTWSR  3120
              S+L GY  +   ++AL  + R
Sbjct  470   TSMLGGYFRNGLPEKALSLFHR  491


 Score = 74.7 bits (182),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 7/72 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL EE T+L NALIS YLKLGL   AL VF SLSSP      A+ISGFA++N EI
Sbjct  96    HASFLKLREEKTKLGNALISTYLKLGLPREALLVFASLSSPSVVSYTALISGFARLNLEI  155

Query  4464  EAVELFYEMRLE  4429
             +A+++F++MR E
Sbjct  156   KALKVFFKMRSE  167



>emb|CDY04897.1| BnaAnng00790D [Brassica napus]
Length=878

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/723 (54%), Positives = 519/723 (72%), Gaps = 11/723 (2%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +R  G IEPNEY+FVA+L AC+RS    LG Q+H L++K G+LDS +V N++M LYS   
Sbjct  165   MRSEGLIEPNEYTFVAVLNACVRSGRFSLGVQIHGLIVKSGFLDSVFVCNSVMSLYSSGD  224

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             +     ++FD +P+RD+ASWNT+IS +VKE +F  AF LF +M R +    D  T+STLL
Sbjct  225   AR----KVFDEMPERDVASWNTLISSLVKEGLFGEAFGLFCEMNRVE--EADSFTVSTLL  278

Query  4076  NACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             +A     + RG+ELH   +R+G    LSV+NALI FY + G ++ V  L+E M VRD FT
Sbjct  279   SASD---LMRGRELHGRVIRVGLRQELSVSNALIGFYAKYGDVRKVETLYEMMSVRDGFT  335

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
               EMITAYM  G+VDLA E+F+ +PEKN + YNA++AGFC+NG G KA+  F  M+   +
Sbjct  336   LTEMITAYMAFGMVDLAVEMFEKIPEKNTISYNALMAGFCRNGYGSKALKLFIEMLLRGV  395

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +DF+LTS  +ACGL+ E+K S+Q+HGF +K GC  N CI+ ALLDMCTRC RM DAE+
Sbjct  396   ELTDFSLTSAVDACGLVAEKKVSEQVHGFCVKFGCATNPCIQTALLDMCTRCERMTDAEE  455

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F + P       A TSML GY +NG PE A+SLF+ T  E  +V+DEV+    L VCGT
Sbjct  456   MFEQWPCNLNSSKATTSMLGGYFRNGLPEKALSLFYRTLKEEKLVLDEVSLTLALAVCGT  515

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG +++G+ +H  ALK GF +D+ +GN++ISMY+KC    +AVK F  M   DL SWNSL
Sbjct  516   LGFVEMGDQIHGYALKDGFFNDIGLGNSLISMYSKCFRFSDAVKVFNTMREHDLVSWNSL  575

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             L+ Y+L R GDEAL  W RM + GI PD+ T   ++S+YR+T  + ++ C+  F SM++ 
Sbjct  576   LSCYILQRNGDEALAIWLRMNKEGIKPDTITLALVISSYRYTESDKISTCRDLFRSMETV  635

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             Y + P ++HY   V VLG+WGLLEEAEET+N+MPF P+ SV RALLDSC +H N+S+ KR
Sbjct  636   YNISPTTEHYTAFVRVLGHWGLLEEAEETVNSMPFHPEVSVLRALLDSCRVHSNASMAKR  695

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V K ILS +P +PS +ILKSN+YSASG W  SE +R EM+E+G++K P +SW++  +  H
Sbjct  696   VAKLILSAKPDNPSEYILKSNIYSASGLWHRSETIREEMRERGYRKHPSRSWIVHGNAIH  755

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
             SF ARDTSH + KD+YS L+ILI+EC+KAGY P+T +VL EV+E  KK FLFHHSAKLAL
Sbjct  756   SFHARDTSHPEEKDVYSGLEILIMECLKAGYEPNTEFVLQEVDELTKKSFLFHHSAKLAL  815

Query  2456  TYGLLMTKHGK-PVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             TYG+L  K+ + PVRV+KN+++CGDCH F+K  S+V KRE+ +RD+SGFH F+NGKCSC 
Sbjct  816   TYGILTAKNQREPVRVVKNVMVCGDCHEFYKYVSVVVKREVVLRDSSGFHRFVNGKCSCK  875

Query  2279  DRW  2271
             D W
Sbjct  876   DLW  878


 Score = 89.4 bits (220),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 99/468 (21%), Positives = 196/468 (42%), Gaps = 80/468 (17%)
 Frame = -3

Query  4418  IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVI  4239
             IE     F  LL    +  ++E+   VHA  +KL   + T + NAL+  Y K G     +
Sbjct  70    IESAVDGFFYLLRLSSQHHDVEVTRAVHASFLKLSE-EKTKLGNALISTYLKLGLPRDAL  128

Query  4238  ELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSEC  4059
              +F +L    + S+  +ISG  + ++  +A ++F  M+    +  +  T   +LNAC   
Sbjct  129   LVFASLSSPSVVSYTALISGFSRLNLEIKALKVFFKMRSEGLIEPNEYTFVAVLNACVRS  188

Query  4058  -FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMI  3882
                  G ++H   ++ G+  ++ V N+++  Y+   + K    +F+ M  RD  +WN +I
Sbjct  189   GRFSLGVQIHGLIVKSGFLDSVFVCNSVMSLYSSGDARK----VFDEMPERDVASWNTLI  244

Query  3881  TAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDF  3702
             ++ ++ G                  L+      FC+              +    E   F
Sbjct  245   SSLVKEG------------------LFGEAFGLFCE--------------MNRVEEADSF  272

Query  3701  TLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRM  3522
             T++++ +A  L+  R    ++HG +++ G      +  AL+    + G +   E ++  M
Sbjct  273   TVSTLLSASDLMRGR----ELHGRVIRVGLRQELSVSNALIGFYAKYGDVRKVETLYEMM  328

Query  3521  PLGHG-----------------------------RLVALTSMLRGYAQNGQPENAISLFF  3429
              +  G                               ++  +++ G+ +NG    A+ LF 
Sbjct  329   SVRDGFTLTEMITAYMAFGMVDLAVEMFEKIPEKNTISYNALMAGFCRNGYGSKALKLFI  388

Query  3428  ETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKC  3249
             E  L G+ + D   T+  +  CG +   K+ E +H   +K G  ++  +  A++ M  +C
Sbjct  389   EMLLRGVELTDFSLTS-AVDACGLVAEKKVSEQVHGFCVKFGCATNPCIQTALLDMCTRC  447

Query  3248  GELDNAVKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
               + +A + FE     L SS+   +  S+L GY  +   ++AL  + R
Sbjct  448   ERMTDAEEMFEQWPCNLNSSK---ATTSMLGGYFRNGLPEKALSLFYR  492


 Score = 79.7 bits (195),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 127/284 (45%), Gaps = 25/284 (9%)
 Frame = -3

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
             ++V A F ++        N +I+ Y++ GL   A  +F  L   + V Y A+++GF +  
Sbjct  94    RAVHASFLKLSEEKTKLGNALISTYLKLGLPRDALLVFASLSSPSVVSYTALISGFSRLN  153

Query  3767  EGLKAMAFFYRMIKES-IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
               +KA+  F++M  E  IE +++T  ++ NAC          QIHG I+KSG        
Sbjct  154   LEIKALKVFFKMRSEGLIEPNEYTFVAVLNACVRSGRFSLGVQIHGLIVKSG--------  205

Query  3590  AALLDMCTRCGRM------EDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFF  3429
                LD    C  +       DA K+F  MP     + +  +++    + G    A  LF 
Sbjct  206   --FLDSVFVCNSVMSLYSSGDARKVFDEMP--ERDVASWNTLISSLVKEGLFGEAFGLFC  261

Query  3428  ETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKC  3249
             E        V+E A +  +    +   L  G  LH   ++ G   ++ V NA+I  YAK 
Sbjct  262   EMNR-----VEE-ADSFTVSTLLSASDLMRGRELHGRVIRVGLRQELSVSNALIGFYAKY  315

Query  3248  GELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
             G++      +E+MS RD  +   ++  Y+     D A++ + ++
Sbjct  316   GDVRKVETLYEMMSVRDGFTLTEMITAYMAFGMVDLAVEMFEKI  359


 Score = 72.8 bits (177),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 7/72 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL EE T+L NALIS YLKLGL   AL VF SLSSP      A+ISGF+++N EI
Sbjct  97    HASFLKLSEEKTKLGNALISTYLKLGLPRDALLVFASLSSPSVVSYTALISGFSRLNLEI  156

Query  4464  EAVELFYEMRLE  4429
             +A+++F++MR E
Sbjct  157   KALKVFFKMRSE  168


 Score = 68.6 bits (166),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 97/196 (49%), Gaps = 8/196 (4%)
 Frame = -3

Query  3650  SKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGY  3471
             ++ +H   LK   E    +  AL+    + G   DA  +F    L    +V+ T+++ G+
Sbjct  93    TRAVHASFLKLSEEKTK-LGNALISTYLKLGLPRDALLVF--ASLSSPSVVSYTALISGF  149

Query  3470  AQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSD  3291
             ++      A+ +FF+ + EGL+  +E     VL  C   G   LG  +H L +K GFL  
Sbjct  150   SRLNLEIKALKVFFKMRSEGLIEPNEYTFVAVLNACVRSGRFSLGVQIHGLIVKSGFLDS  209

Query  3290  VVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMER  3111
             V V N+V+S+Y+      +A K F+ M  RD+ SWN+L++  V      EA   +  M R
Sbjct  210   VFVCNSVMSLYSS----GDARKVFDEMPERDVASWNTLISSLVKEGLFGEAFGLFCEMNR  265

Query  3110  LGIVPDSFTCLHILSA  3063
             +    DSFT   +LSA
Sbjct  266   VE-EADSFTVSTLLSA  280



>ref|XP_009125519.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Brassica rapa]
Length=877

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/723 (54%), Positives = 515/723 (71%), Gaps = 11/723 (2%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             +R  G IEPNEY+FVA+L AC RS    LG Q+H L++K G+LDS +V N++M LYS   
Sbjct  164   MRSEGLIEPNEYTFVAVLNACARSGRFSLGVQIHGLIVKSGFLDSVFVCNSVMSLYSSGD  223

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             +     ++FD +PKRD+ASWNT+IS +VKE +F  AF LF +M R +    D  T+STLL
Sbjct  224   AR----KVFDEMPKRDVASWNTLISCLVKEGLFGEAFGLFCEMNRVE--EADSFTVSTLL  277

Query  4076  NACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             +        RG+ELH   +R+G    LSV+NALI FY + G +K V  L+E M VRD FT
Sbjct  278   SGSDSM---RGRELHGRVIRVGLRQELSVSNALIGFYAKYGDVKKVETLYEMMSVRDGFT  334

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
               EMITAYM  G+VD A E+F+ +PEKN + YNA++AGFC+NG GLKA+  F  M+   +
Sbjct  335   LTEMITAYMAFGMVDSAVEMFEKIPEKNTISYNALMAGFCRNGFGLKALKLFIEMLLRGV  394

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E +DF+LTS  +ACGL+ E+K S+QIHGF +K GC  N CI+ ALLDMCTRC RM DAE+
Sbjct  395   ELTDFSLTSAVDACGLVSEKKLSEQIHGFCVKFGCASNPCIQTALLDMCTRCERMTDAEE  454

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgt  3357
             +F + P       A TSML GY +NG PE A+SLF+ T  E  +V+DEV+    L VCGT
Sbjct  455   MFEQWPCNLNSSKATTSMLGGYFRNGLPEKALSLFYRTLKEEKLVLDEVSLTLALAVCGT  514

Query  3356  lgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSL  3177
             LG +++G+ +H  ALK GF +D+ +GN++ISMY+KC    +AVK F  M   DL SWNSL
Sbjct  515   LGFVEMGDQIHGYALKDGFFNDIGLGNSLISMYSKCFRFSDAVKVFNTMREHDLVSWNSL  574

Query  3176  LAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSA  2997
             L+ Y+L R GDEAL  W RM + GI PD+ T   ++S+YR+T  + ++ C+  F SM++ 
Sbjct  575   LSCYILQRNGDEALAIWLRMNKEGIKPDTITLALVISSYRYTESDKISTCRDLFRSMETV  634

Query  2996  YGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKR  2817
             Y + P ++HY   V VLG+WGLLEEAEET+N+MPF P+ SV RALLDSC +H N+S+ KR
Sbjct  635   YNISPTTEHYTAFVRVLGHWGLLEEAEETVNSMPFHPEVSVLRALLDSCRVHSNASMAKR  694

Query  2816  VIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFH  2637
             V K ILS +P +PS +ILKSN+YSASG W  SE +R EM+E+ ++K P +SW++  +  H
Sbjct  695   VAKLILSAKPDNPSEYILKSNIYSASGLWHRSETIREEMRERRYRKHPSRSWIVHGNAIH  754

Query  2636  SFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLAL  2457
             SF ARDTSH + KD+YS L+ILI+EC+KAGY P+T +VL EV+E  KK FLFHHSAKLAL
Sbjct  755   SFHARDTSHPEEKDVYSGLEILIMECLKAGYEPNTEFVLQEVDELTKKSFLFHHSAKLAL  814

Query  2456  TYGLLMTKHGK-PVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             TYG+L  K+ + PVRV+KN+++CGDCH F+K  S+V KRE+ +RD+SGFH F+NGKCSC 
Sbjct  815   TYGILTAKNQREPVRVVKNVMVCGDCHEFYKYVSVVVKREVVLRDSSGFHRFVNGKCSCK  874

Query  2279  DRW  2271
             D W
Sbjct  875   DLW  877


 Score = 92.4 bits (228),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 104/447 (23%), Positives = 206/447 (46%), Gaps = 38/447 (9%)
 Frame = -3

Query  4418  IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVI  4239
             IE     F  LL    +  ++E+   VHA  +KL   + T + NAL+  Y K G     +
Sbjct  69    IESAVDGFFYLLRLSSQHHDVEVTRAVHASFLKLRE-EKTKLGNALISTYLKLGLPRDAL  127

Query  4238  ELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSEC  4059
              +F +L    + S+  +ISG  + ++  +A ++F  M+    +  +  T   +LNAC+  
Sbjct  128   LVFASLSSPSVVSYTALISGFARLNLEIKALKVFFKMRSEGLIEPNEYTFVAVLNACARS  187

Query  4058  -FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMI  3882
                  G ++H   ++ G+  ++ V N+++  Y+   + K    +F+ M  RD  +WN +I
Sbjct  188   GRFSLGVQIHGLIVKSGFLDSVFVCNSVMSLYSSGDARK----VFDEMPKRDVASWNTLI  243

Query  3881  TAYMESGLVDLAKELF---DHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEF  3711
             +  ++ GL   A  LF   + + E ++   + +L+G     + ++      R+I+  +  
Sbjct  244   SCLVKEGLFGEAFGLFCEMNRVEEADSFTVSTLLSG----SDSMRGRELHGRVIRVGLRQ  299

Query  3710  SDFTLTSIANA-CGLLMERKSSKQIHGFI----LKSGCEPNDCIEAALLDMCTRCGRMED  3546
                   S++NA  G   +    K++        ++ G    + I A +       G ++ 
Sbjct  300   E----LSVSNALIGFYAKYGDVKKVETLYEMMSVRDGFTLTEMITAYM-----AFGMVDS  350

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             A ++F ++P      ++  +++ G+ +NG    A+ LF E  L G+ + D   T+  +  
Sbjct  351   AVEMFEKIP--EKNTISYNALMAGFCRNGFGLKALKLFIEMLLRGVELTDFSLTS-AVDA  407

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFE-----LMSSR  3201
             CG +   KL E +H   +K G  S+  +  A++ M  +C  + +A + FE     L SS+
Sbjct  408   CGLVSEKKLSEQIHGFCVKFGCASNPCIQTALLDMCTRCERMTDAEEMFEQWPCNLNSSK  467

Query  3200  DLCSWNSLLAGYVLHRRGDEALDTWSR  3120
                +  S+L GY  +   ++AL  + R
Sbjct  468   ---ATTSMLGGYFRNGLPEKALSLFYR  491


 Score = 73.9 bits (180),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 7/72 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL EE T+L NALIS YLKLGL   AL VF SLSSP      A+ISGFA++N EI
Sbjct  96    HASFLKLREEKTKLGNALISTYLKLGLPRDALLVFASLSSPSVVSYTALISGFARLNLEI  155

Query  4464  EAVELFYEMRLE  4429
             +A+++F++MR E
Sbjct  156   KALKVFFKMRSE  167



>ref|XP_009398362.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Musa acuminata subsp. malaccensis]
Length=871

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/724 (53%), Positives = 511/724 (71%), Gaps = 5/724 (1%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R  G+EPNE+SFVA+LT+CIR  +  LG QVHA  +K  +    +V NAL+G+Y KCG 
Sbjct  150   MRFLGVEPNEFSFVAILTSCIRQLDGRLGSQVHAFAVKTDHCSCVHVNNALLGVYVKCGC  209

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
                  +LF  + +RD++SWN ++ G+V+E  +  AF LFN MQ  +    D  +LSTLL 
Sbjct  210   ASAADQLFGEMVERDVSSWNAVMLGVVEECRYDEAFRLFNLMQM-EGYHGDGFSLSTLLT  268

Query  4073  ACSECFMRRGQE-LHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             A +  F   G E +HA+AL+IG E +LSV NAL+ FYT+ GS++ V  +F RM ++D  +
Sbjct  269   AAAHGFGGAGGEAVHAYALKIGLELDLSVGNALVGFYTQFGSVEDVADVFWRMPIKDVTS  328

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W  M+T YME G+V+ A ++FD +PE+N V YNA+LAGF  NGEG + +  F  +++  +
Sbjct  329   WTGMLTGYMEFGMVESAVDIFDQMPERNCVTYNALLAGFYHNGEGDRGLDLFQHILENDL  388

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             E SDFTLTS  NACG++ + K S+Q+H F++KSGC+ +  +EAALLDMC +CGR+EDA+K
Sbjct  389   EISDFTLTSAINACGMVSDLKMSEQVHAFVIKSGCKSSSWVEAALLDMCAKCGRIEDAQK  448

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQL--EGLVVVDEVATAtvlgvc  3363
             +F          VA TS++  +++ G    A+ LF +T L  +  VV+D  A A +LG+C
Sbjct  449   MFTSWAHEESFPVAWTSLICAHSRCGLHFEALHLF-QTGLSRDDPVVMDAFALAMILGLC  507

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
             GTLG  +LG+ LHC+  K G LSDV VGNA+ SMYAKCG L++A+  F  M   D  SWN
Sbjct  508   GTLGFFELGQQLHCVVTKSGLLSDVEVGNALFSMYAKCGRLEDAISLFSQMPQHDTVSWN  567

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQ  3003
             +L+  Y++HR+GD+ALD W  M  +G+ PD  T L ++SA R+T+ N V+ C   F SM+
Sbjct  568   ALITAYLIHRQGDKALDVWDSMNMVGVKPDFITFLLVISACRYTSSNSVDVCHGLFHSME  627

Query  3002  SAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIG  2823
             S+Y ++PAS+HY+ +V VLGYWG  +EAE+ I  MP +P +SVWRALLDSC +  N ++G
Sbjct  628   SSYNIIPASEHYSAMVDVLGYWGSFDEAEQLIKNMPSKPNASVWRALLDSCRLRSNMTLG  687

Query  2822  KRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHK  2643
             ++  + +L +EPQDPST++L SNLYSASGRW CSE VR +M+EKG QK P +SW+   + 
Sbjct  688   RQAAQSLLELEPQDPSTYVLVSNLYSASGRWHCSEKVRQDMREKGLQKHPVRSWITHHNT  747

Query  2642  FHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKL  2463
              HSF+ARD SH QSKDIYSALDILILECMKAGY PDT +VLHEVEEYQKK+FLF+HSAKL
Sbjct  748   MHSFYARDRSHPQSKDIYSALDILILECMKAGYEPDTCFVLHEVEEYQKKNFLFYHSAKL  807

Query  2462  ALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             A+ YGLL++   +PVRV+KNILLCGDCH F K  S VT REI VRD SGFH F  G CSC
Sbjct  808   AVVYGLLISGPDRPVRVVKNILLCGDCHAFMKYVSSVTGREISVRDASGFHNFRGGVCSC  867

Query  2282  NDRW  2271
              D W
Sbjct  868   GDYW  871


 Score =   114 bits (286),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 113/448 (25%), Positives = 197/448 (44%), Gaps = 65/448 (15%)
 Frame = -3

Query  4412  PNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIEL  4233
             P+ ++   LL   +   +L+LG   HA  +K    + T + NAL+ +Y K G L    + 
Sbjct  56    PSPFAPRRLLRLAVDRLDLDLGRAAHAAAVKALDNEDTGLGNALISMYLKLGRLSDARKA  115

Query  4232  FDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECFM  4053
             FD LP  D+AS++++IS   K      A  LF  M+       ++  ++ L +   +   
Sbjct  116   FDALPSPDVASFSSLISAYAKCGRPVEAAGLFCRMRFLGVEPNEFSFVAILTSCIRQLDG  175

Query  4052  RRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAY  3873
             R G ++HA A++  + S + VNNAL+  Y +CG   +   LF  M+ RD  +WN ++   
Sbjct  176   RLGSQVHAFAVKTDHCSCVHVNNALLGVYVKCGCASAADQLFGEMVERDVSSWNAVMLGV  235

Query  3872  MESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLT  3693
             +E    D A  LF+ +           + G+  +G+G                   F+L+
Sbjct  236   VEECRYDEAFRLFNLMQ----------MEGY--HGDG-------------------FSLS  264

Query  3692  SIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLG  3513
             ++  A          + +H + LK G E +  +  AL+   T+ G +ED   +F RMP+ 
Sbjct  265   TLLTAAAHGFGGAGGEAVHAYALKIGLELDLSVGNALVGFYTQFGSVEDVADVFWRMPIK  324

Query  3512  HGRLVALTSMLRGYAQNGQPENAISLF------------------------------FET  3423
                + + T ML GY + G  E+A+ +F                              F+ 
Sbjct  325   D--VTSWTGMLTGYMEFGMVESAVDIFDQMPERNCVTYNALLAGFYHNGEGDRGLDLFQH  382

Query  3422  QLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGE  3243
              LE  + + +    + +  CG +  LK+ E +H   +K G  S   V  A++ M AKCG 
Sbjct  383   ILENDLEISDFTLTSAINACGMVSDLKMSEQVHAFVIKSGCKSSSWVEAALLDMCAKCGR  442

Query  3242  LDNAVKAFELMSSRD--LCSWNSLLAGY  3165
             +++A K F   +  +    +W SL+  +
Sbjct  443   IEDAQKMFTSWAHEESFPVAWTSLICAH  470


 Score = 73.9 bits (180),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 88/174 (51%), Gaps = 3/174 (2%)
 Frame = -3

Query  3587  ALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
             AL+ M  + GR+ DA K F  +P     + + +S++  YA+ G+P  A  LF   +  G 
Sbjct  98    ALISMYLKLGRLSDARKAFDALP--SPDVASFSSLISAYAKCGRPVEAAGLFCRMRFLG-  154

Query  3407  VVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAV  3228
             V  +E +   +L  C      +LG  +H  A+K    S V V NA++ +Y KCG    A 
Sbjct  155   VEPNEFSFVAILTSCIRQLDGRLGSQVHAFAVKTDHCSCVHVNNALLGVYVKCGCASAAD  214

Query  3227  KAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILS  3066
             + F  M  RD+ SWN+++ G V   R DEA   ++ M+  G   D F+   +L+
Sbjct  215   QLFGEMVERDVSSWNAVMLGVVEECRYDEAFRLFNLMQMEGYHGDGFSLSTLLT  268


 Score = 60.8 bits (146),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (51%), Gaps = 16/151 (11%)
 Frame = -3

Query  3293  DVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRME  3114
             D  +GNA+ISMY K G L +A KAF+ + S D+ S++SL++ Y    R  EA   + RM 
Sbjct  92    DTGLGNALISMYLKLGRLSDARKAFDALPSPDVASFSSLISAYAKCGRPVEAAGLFCRMR  151

Query  3113  RLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACL---VSVLG  2943
              LG+ P+ F+ + IL++        + +      S   A+ V   +DH +C+    ++LG
Sbjct  152   FLGVEPNEFSFVAILTS-------CIRQLDGRLGSQVHAFAV--KTDHCSCVHVNNALLG  202

Query  2942  YW---GLLEEAEETINTMPFEPKSSVWRALL  2859
              +   G    A++    M  E   S W A++
Sbjct  203   VYVKCGCASAADQLFGEM-VERDVSSWNAVM  232


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 6/62 (10%)
 Frame = -2

Query  4599  EDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVELFYEM  4438
             EDT L NALIS YLKLG +  A   FD+L SP      ++IS +AK  R +EA  LF  M
Sbjct  91    EDTGLGNALISMYLKLGRLSDARKAFDALPSPDVASFSSLISAYAKCGRPVEAAGLFCRM  150

Query  4437  RL  4432
             R 
Sbjct  151   RF  152



>gb|EPS58257.1| hypothetical protein M569_16559 [Genlisea aurea]
Length=846

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/727 (51%), Positives = 506/727 (70%), Gaps = 12/727 (2%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++R +G+ PN ++ VA+LTAC    +LELG Q+HA+ +K G+LDST+V N LM LY++  
Sbjct  127   EMRDAGVGPNGFTLVAMLTACSGLGDLELGTQIHAMSVKTGHLDSTHVSNTLMRLYAEWD  186

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              LD   +LFD +P RDI+SWNT+IS MVK   +  AFE F D+   + LR D  TLSTL+
Sbjct  187   CLDSAFKLFDEMPNRDISSWNTLISSMVKAEFYDEAFECFIDLLTWEDLRADQFTLSTLI  246

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              A   CF +++G  LH ++ ++  ES+LS+ N+LI+FY  CG ++ V ALF  M +RDAF
Sbjct  247   YASGRCFDLKKGSSLHGYSHKLRCESHLSLRNSLIQFYAECGCVEDVEALFNSMPLRDAF  306

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             TW +MI AY   GL+D A E+FD  P+K+++ +N +L+G  QNG+G +A+ FF RM+++ 
Sbjct  307   TWTQMIKAYSGFGLLDSAIEIFDRAPDKSSIAFNTLLSGLHQNGDGFRALRFFRRMLEDG  366

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +  +D TLT++  +CG   +   S+QIHGF+LK     ND I+AALLDMCT+CGRMEDA+
Sbjct  367   VAVTDSTLTTVLCSCGCAGDAGFSEQIHGFVLKFNVGGNDRIQAALLDMCTKCGRMEDAD  426

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             KIF RMP      V LT+M+ GYA+N + E A SL  +         DE A+A++L VCG
Sbjct  427   KIFDRMPQRRSP-VTLTTMVSGYARNLELEKAASLIGQ-----YTFFDEFASASILAVCG  480

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAV---KAFELMSSRDLCS  3189
              LG   LGE LHC  LK G L +  VGN++ISMY+K G         K FE M  RD  S
Sbjct  481   DLGFRDLGEQLHCRVLKDGSLRNAGVGNSLISMYSKSGGGGGTEIFDKIFESMPYRDAVS  540

Query  3188  WNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFS  3009
             WN LL+GYV  R GD+AL+ +  M++ G  PDS TC  I++AY++T  N+  +C  F  S
Sbjct  541   WNCLLSGYVSRRLGDDALNKFDEMQKSGGKPDSITCSLIITAYKYTNSNMAQQCHEFVLS  600

Query  3008  MQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSS  2829
             M+SA+G+ P S+HYA L+ VLG WG+LE AE+  NT PF+P  ++ + LL+SCI H + +
Sbjct  601   MKSAHGIDPDSNHYASLIGVLGRWGMLERAEKVANTAPFDPGPALLKPLLESCIRHKDPT  660

Query  2828  IGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVIC-  2652
             +GKR  ++IL+M+P +PSTF+LKSNLYSASGRW CSELVR EM+ +GF+K P +SW+   
Sbjct  661   VGKRTARRILTMDPDEPSTFVLKSNLYSASGRWHCSELVRDEMRARGFRKRPARSWITDR  720

Query  2651  QHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHS  2472
             ++  HSFFARD SH +++DIY+AL++L  E  KAGY PDTS+VL EVEE+QK DFL HHS
Sbjct  721   KNGVHSFFARDKSHPETRDIYAALEVLFKEAKKAGYEPDTSFVLQEVEEFQKVDFLMHHS  780

Query  2471  AKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGK  2292
             AK+A  +GLL  K    VRVMKN+ LCGDCH+F +SAS+V  REIH+RD SGFH F +G+
Sbjct  781   AKIAAAFGLL-KKGTAVVRVMKNVRLCGDCHSFLRSASVVCGREIHLRDPSGFHLFRDGQ  839

Query  2291  CSCNDRW  2271
             CSC DRW
Sbjct  840   CSCKDRW  846


 Score =   122 bits (306),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 115/448 (26%), Positives = 190/448 (42%), Gaps = 64/448 (14%)
 Frame = -3

Query  4412  PNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIEL  4233
             P+      LL   I   ++     VHA +++ G  D   + N+L+  Y + G ++    +
Sbjct  35    PSNGDLSRLLKLSIEYGDVNFCKAVHASILR-GEEDDIRLQNSLVTAYLRLGRVNDAESV  93

Query  4232  FDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-  4056
             FD++P  D+ S   MIS   K      A  LF +M R+  +  +  TL  +L ACS    
Sbjct  94    FDSIPCPDVVSHTAMISAFAKSHREDGAVRLFFEM-RDAGVGPNGFTLVAMLTACSGLGD  152

Query  4055  MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITA  3876
             +  G ++HA +++ G+  +  V+N L++ Y     + S   LF+ M  RD  +WN +I++
Sbjct  153   LELGTQIHAMSVKTGHLDSTHVSNTLMRLYAEWDCLDSAFKLFDEMPNRDISSWNTLISS  212

Query  3875  YMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTL  3696
              +++   D A E F  L                              +  E +    FTL
Sbjct  213   MVKAEFYDEAFECFIDL------------------------------LTWEDLRADQFTL  242

Query  3695  TSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPL  3516
             +++  A G   + K    +HG+  K  CE +  +  +L+     CG +ED E +F+ MPL
Sbjct  243   STLIYASGRCFDLKKGSSLHGYSHKLRCESHLSLRNSLIQFYAECGCVEDVEALFNSMPL  302

Query  3515  --------------GHGRL---------------VALTSMLRGYAQNGQPENAISLFFET  3423
                           G G L               +A  ++L G  QNG    A+  FF  
Sbjct  303   RDAFTWTQMIKAYSGFGLLDSAIEIFDRAPDKSSIAFNTLLSGLHQNGDGFRALR-FFRR  361

Query  3422  QLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGE  3243
              LE  V V +    TVL  CG  G     E +H   LK     +  +  A++ M  KCG 
Sbjct  362   MLEDGVAVTDSTLTTVLCSCGCAGDAGFSEQIHGFVLKFNVGGNDRIQAALLDMCTKCGR  421

Query  3242  LDNAVKAFELMSS-RDLCSWNSLLAGYV  3162
             +++A K F+ M   R   +  ++++GY 
Sbjct  422   MEDADKIFDRMPQRRSPVTLTTMVSGYA  449


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 132/290 (46%), Gaps = 5/290 (2%)
 Frame = -3

Query  3980  LIKFYTRCGSI---KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNA  3810
             L+K     G +   K+V A   R    D    N ++TAY+  G V+ A+ +FD +P  + 
Sbjct  43    LLKLSIEYGDVNFCKAVHASILRGEEDDIRLQNSLVTAYLRLGRVNDAESVFDSIPCPDV  102

Query  3809  VLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGF  3630
             V + A+++ F ++     A+  F+ M    +  + FTL ++  AC  L + +   QIH  
Sbjct  103   VSHTAMISAFAKSHREDGAVRLFFEMRDAGVGPNGFTLVAMLTACSGLGDLELGTQIHAM  162

Query  3629  ILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPE  3450
              +K+G   +  +   L+ +      ++ A K+F  MP  +  + +  +++    +    +
Sbjct  163   SVKTGHLDSTHVSNTLMRLYAEWDCLDSAFKLFDEMP--NRDISSWNTLISSMVKAEFYD  220

Query  3449  NAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAV  3270
              A   F +      +  D+   +T++   G    LK G +LH  + K    S + + N++
Sbjct  221   EAFECFIDLLTWEDLRADQFTLSTLIYASGRCFDLKKGSSLHGYSHKLRCESHLSLRNSL  280

Query  3269  ISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
             I  YA+CG +++    F  M  RD  +W  ++  Y      D A++ + R
Sbjct  281   IQFYAECGCVEDVEALFNSMPLRDAFTWTQMIKAYSGFGLLDSAIEIFDR  330


 Score = 64.3 bits (155),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKLEEDT-RLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A  L+ EED  RL N+L++AYL+LG V+ A +VFDS+  P      A+IS FAK +RE 
Sbjct  60    HASILRGEEDDIRLQNSLVTAYLRLGRVNDAESVFDSIPCPDVVSHTAMISAFAKSHRED  119

Query  4464  EAVELFYEMR  4435
              AV LF+EMR
Sbjct  120   GAVRLFFEMR  129



>emb|CAB85500.1| putative protein [Arabidopsis thaliana]
Length=837

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/667 (53%), Positives = 483/667 (72%), Gaps = 4/667 (1%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK--  4263
             +R +G ++PNEY+FVA+LTAC+R     LG Q+H L++K G+L+S +V N+LM LY K  
Sbjct  171   MRKAGLVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLNSVFVSNSLMSLYDKDS  230

Query  4262  CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
               S D V++LFD +P+RD+ASWNT++S +VKE    +AF+LF +M R +   +D  TLST
Sbjct  231   GSSCDDVLKLFDEIPQRDVASWNTVVSSLVKEGKSHKAFDLFYEMNRVEGFGVDSFTLST  290

Query  4082  LLNACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
             LL++C++   + RG+ELH  A+RIG    LSVNNALI FY++   +K V +L+E M+ +D
Sbjct  291   LLSSCTDSSVLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFWDMKKVESLYEMMMAQD  350

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
             A T+ EMITAYM  G+VD A E+F ++ EKN + YNA++AGFC+NG GLKA+  F  M++
Sbjct  351   AVTFTEMITAYMSFGMVDSAVEIFANVTEKNTITYNALMAGFCRNGHGLKALKLFTDMLQ  410

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMED  3546
               +E +DF+LTS  +ACGL+ E+K S+QIHGF +K G   N CI+ ALLDMCTRC RM D
Sbjct  411   RGVELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGTAFNPCIQTALLDMCTRCERMAD  470

Query  3545  AEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgv  3366
             AE++F + P       A TS++ GYA+NG P+ A+SLF  T  E  + +DEV+   +L V
Sbjct  471   AEEMFDQWPSNLDSSKATTSIIGGYARNGLPDKAVSLFHRTLCEQKLFLDEVSLTLILAV  530

Query  3365  cgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSW  3186
             CGTLG  ++G  +HC ALK G+ SD+ +GN++ISMYAKC + D+A+K F  M   D+ SW
Sbjct  531   CGTLGFREMGYQIHCYALKAGYFSDISLGNSLISMYAKCCDSDDAIKIFNTMREHDVISW  590

Query  3185  NSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSM  3006
             NSL++ Y+L R GDEAL  WSRM    I PD  T   ++SA+R+T  N ++ C+  F SM
Sbjct  591   NSLISCYILQRNGDEALALWSRMNEKEIKPDIITLTLVISAFRYTESNKLSSCRDLFLSM  650

Query  3005  QSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSI  2826
             ++ Y + P ++HY   V VLG+WGLLEEAE+TIN+MP +P+ SV RALLDSC +H N+S+
Sbjct  651   KTIYDIEPTTEHYTAFVRVLGHWGLLEEAEDTINSMPVQPEVSVLRALLDSCRIHSNTSV  710

Query  2825  GKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQH  2646
              KRV K ILS +P+ PS +ILKSN+YSASG W  SE++R EM+E+G++K P +SW+I ++
Sbjct  711   AKRVAKLILSTKPETPSEYILKSNIYSASGFWHRSEMIREEMRERGYRKHPAKSWIIHEN  770

Query  2645  KFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAK  2466
             K HSF ARDTSH Q KDIY  L+ILI+EC+K GY P+T YVL EV+E+ KK FLFHHSAK
Sbjct  771   KIHSFHARDTSHPQEKDIYRGLEILIMECLKVGYEPNTEYVLQEVDEFMKKSFLFHHSAK  830

Query  2465  LALTYGL  2445
             LA+TYG+
Sbjct  831   LAVTYGI  837


 Score = 89.7 bits (221),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/313 (24%), Positives = 137/313 (44%), Gaps = 37/313 (12%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+   G+E  ++S  + + AC      ++  Q+H   IK G   +  +  AL+ + ++C 
Sbjct  407   DMLQRGVELTDFSLTSAVDACGLVSEKKVSEQIHGFCIKFGTAFNPCIQTALLDMCTRCE  466

Query  4256  SLDFVIELFDNLPKRDIASWNT--MISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
              +    E+FD  P    +S  T  +I G  +  +  +A  LF+       L +D ++L+ 
Sbjct  467   RMADAEEMFDQWPSNLDSSKATTSIIGGYARNGLPDKAVSLFHRTLCEQKLFLDEVSLTL  526

Query  4082  LLNACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRD  3906
             +L  C    F   G ++H +AL+ GY S++S+ N+LI  Y +C      + +F  M   D
Sbjct  527   ILAVCGTLGFREMGYQIHCYALKAGYFSDISLGNSLISMYAKCCDSDDAIKIFNTMREHD  586

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK  3726
               +WN +I+ Y+                               +NG+  +A+A + RM +
Sbjct  587   VISWNSLISCYI-----------------------------LQRNGD--EALALWSRMNE  615

Query  3725  ESIEFSDFTLTSIANACGLLMERKSSKQIHGFI-LKS--GCEPNDCIEAALLDMCTRCGR  3555
             + I+    TLT + +A       K S     F+ +K+    EP      A + +    G 
Sbjct  616   KEIKPDIITLTLVISAFRYTESNKLSSCRDLFLSMKTIYDIEPTTEHYTAFVRVLGHWGL  675

Query  3554  MEDAEKIFHRMPL  3516
             +E+AE   + MP+
Sbjct  676   LEEAEDTINSMPV  688


 Score = 36.6 bits (83),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVEL  4450
             + + +D      +I+AY+  G+VD A+ +F      ++++  A+++GF +    ++A++L
Sbjct  345   MMMAQDAVTFTEMITAYMSFGMVDSAVEIFANVTEKNTITYNALMAGFCRNGHGLKALKL  404

Query  4449  FYEMRLER  4426
             F +M L+R
Sbjct  405   FTDM-LQR  411


 Score = 81.3 bits (199),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 97/464 (21%), Positives = 194/464 (42%), Gaps = 74/464 (16%)
 Frame = -3

Query  4397  FVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLP  4218
             F  LL    +  ++E+   VHA  +KL   + T + NAL+  Y K G     I +F +L 
Sbjct  83    FFYLLRLSAQYHDVEVTKAVHASFLKLRE-EKTRLGNALISTYLKLGFPREAILVFVSLS  141

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQ  4041
                + S+  +ISG  + ++   A ++F  M++   ++ +  T   +L AC        G 
Sbjct  142   SPTVVSYTALISGFSRLNLEIEALKVFFRMRKAGLVQPNEYTFVAILTACVRVSRFSLGI  201

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTR--CGSIKSVMALFERMLVRDAFTWNEMITAYME  3867
             ++H   ++ G+ +++ V+N+L+  Y +    S   V+ LF+ +  RD  +WN ++++   
Sbjct  202   QIHGLIVKSGFLNSVFVSNSLMSLYDKDSGSSCDDVLKLFDEIPQRDVASWNTVVSS---  258

Query  3866  SGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIK-ESIEFSDFTLTS  3690
                  L KE                       G+  KA   FY M + E      FTL++
Sbjct  259   -----LVKE-----------------------GKSHKAFDLFYEMNRVEGFGVDSFTLST  290

Query  3689  IANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRM----  3522
             + ++C         +++HG  ++ G      +  AL+   ++   M+  E ++  M    
Sbjct  291   LLSSCTDSSVLLRGRELHGRAIRIGLMQELSVNNALIGFYSKFWDMKKVESLYEMMMAQD  350

Query  3521  -------------------------PLGHGRLVALTSMLRGYAQNGQPENAISLFFETQL  3417
                                       +     +   +++ G+ +NG    A+ LF +   
Sbjct  351   AVTFTEMITAYMSFGMVDSAVEIFANVTEKNTITYNALMAGFCRNGHGLKALKLFTDMLQ  410

Query  3416  EGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELD  3237
              G+ + D   T+  +  CG +   K+ E +H   +K G   +  +  A++ M  +C  + 
Sbjct  411   RGVELTDFSLTS-AVDACGLVSEKKVSEQIHGFCIKFGTAFNPCIQTALLDMCTRCERMA  469

Query  3236  NAVKAFE-----LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSR  3120
             +A + F+     L SS+   +  S++ GY  +   D+A+  + R
Sbjct  470   DAEEMFDQWPSNLDSSK---ATTSIIGGYARNGLPDKAVSLFHR  510


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 7/70 (10%)
 Frame = -2

Query  4623  YADFLKL-EEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL EE TRL NALIS YLKLG    A+ VF SLSSP      A+ISGF+++N EI
Sbjct  103   HASFLKLREEKTRLGNALISTYLKLGFPREAILVFVSLSSPTVVSYTALISGFSRLNLEI  162

Query  4464  EAVELFYEMR  4435
             EA+++F+ MR
Sbjct  163   EALKVFFRMR  172


 Score = 69.3 bits (168),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 101/199 (51%), Gaps = 6/199 (3%)
 Frame = -3

Query  3650  SKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGY  3471
             +K +H   LK   E    +  AL+    + G   +A  +F  + L    +V+ T+++ G+
Sbjct  99    TKAVHASFLKLR-EEKTRLGNALISTYLKLGFPREAILVF--VSLSSPTVVSYTALISGF  155

Query  3470  AQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSD  3291
             ++      A+ +FF  +  GLV  +E     +L  C  +    LG  +H L +K GFL+ 
Sbjct  156   SRLNLEIEALKVFFRMRKAGLVQPNEYTFVAILTACVRVSRFSLGIQIHGLIVKSGFLNS  215

Query  3290  VVVGNAVISMYAK--CGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
             V V N+++S+Y K      D+ +K F+ +  RD+ SWN++++  V   +  +A D +  M
Sbjct  216   VFVSNSLMSLYDKDSGSSCDDVLKLFDEIPQRDVASWNTVVSSLVKEGKSHKAFDLFYEM  275

Query  3116  ERL-GIVPDSFTCLHILSA  3063
              R+ G   DSFT   +LS+
Sbjct  276   NRVEGFGVDSFTLSTLLSS  294



>ref|XP_004955587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Setaria italica]
Length=867

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/732 (49%), Positives = 490/732 (67%), Gaps = 19/732 (3%)
 Frame = -3

Query  4418  IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLD-----STYVVNALMGLYSKCGS  4254
             ++P EY+FV LLTAC R  N  LG QVHAL  K G+       S  V NAL+G+Y KCG 
Sbjct  137   LDPTEYTFVGLLTACARRGNPRLGAQVHALAAKSGHCSCSGPGSLLVDNALLGMYVKCGR  196

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             L   +  FD + +RD++SWN +++G+V+      AF LF +M R   +R D  +LS LL 
Sbjct  197   LGDALRAFDGMERRDVSSWNAVLAGLVELGRHEEAFGLFGEM-RASGVRADSFSLSALLA  255

Query  4073  ACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGS-IKSVMALFERMLVRDAF  3900
             A  E F +  G+ +HA +L+ G E++LSV NALI FY   GS ++ V+++F+ M V+D  
Sbjct  256   AAGEGFGLPEGEAVHALSLKSGLETDLSVGNALIGFYAEHGSSVEDVVSVFQGMPVKDVI  315

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG----------LKAM  3750
             +W  ++  YME GLVD+A ++FD +PE+N V YNAVL GFCQN EG          L+ +
Sbjct  316   SWTGLLNGYMEFGLVDMALDVFDRMPERNFVTYNAVLTGFCQNKEGVRVTFAKKAGLRGL  375

Query  3749  AFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMC  3570
               F +M+++ +E SD T+TS  NAC +  +RK S+Q+H F++K GC     I+AAL+DMC
Sbjct  376   GLFRQMVEDGLEVSDVTVTSALNACAIAADRKVSEQVHAFVIKCGCGSTPWIDAALIDMC  435

Query  3569  TRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVVVDE  3393
              +CGR  DA  +F +        +A  S+L    ++G+ E A+S F +  +  G+  +DE
Sbjct  436   IKCGRSGDAHLLFEQWRHQESFHIAWNSLLLASVRDGEYEKALSTFLQMFRSSGVGFIDE  495

Query  3392  VATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFEL  3213
                   LGVCG LG  +LG+ +H  A K G L    VGNA+ISMY KCGELD+AV  FE 
Sbjct  496   FMLTAALGVCGALGFAELGKQMHSFAAKSGLLYACGVGNAIISMYGKCGELDDAVNFFER  555

Query  3212  MSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVN  3033
             M+ RDL SWN+++  ++LHR+G+E LD W++MERLGI PDS T L ++SA  HT+ +  +
Sbjct  556   MTCRDLVSWNAMITAHLLHRQGEEILDIWAQMERLGIRPDSITFLLVMSACSHTSSDSTD  615

Query  3032  RCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDS  2853
             +C+  F SM S+YG+ PA +HYA  V+VLG WG  +EAE+ I +MPF+P + VWR+LLDS
Sbjct  616   QCRELFLSMSSSYGIEPAMEHYAAFVNVLGCWGHFDEAEQLIGSMPFKPGALVWRSLLDS  675

Query  2852  CIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIP  2673
             C    N ++ +R +K +L++EPQDPST++L SNL+S S RW  SE  R EM+EKG +KIP
Sbjct  676   CSKRSNMTVRRRAMKHLLALEPQDPSTYVLTSNLFSESARWHSSETTRLEMREKGMRKIP  735

Query  2672  GQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKK  2493
              +SW    +  HSFFARD SH QSKDIY+ LD+LILEC+KAGY PDT++VLH+VEEYQK+
Sbjct  736   ARSWTFNDNTVHSFFARDRSHPQSKDIYAGLDVLILECIKAGYEPDTTFVLHDVEEYQKR  795

Query  2492  DFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGF  2313
              FL +HSAKLA  YG+L    G+ VRV+KNI +CGDCH+F + AS  T + I VRD+SGF
Sbjct  796   HFLMYHSAKLAAMYGILTAGTGRAVRVVKNIRMCGDCHSFLEHASAATGKVISVRDSSGF  855

Query  2312  HCFLNGKCSCND  2277
             H F  GKC+C +
Sbjct  856   HIFRGGKCTCRE  867


 Score =   114 bits (285),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/387 (25%), Positives = 172/387 (44%), Gaps = 75/387 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++R SG+  + +S  ALL A      L  G  VHAL +K G      V NAL+G Y++ G
Sbjct  237   EMRASGVRADSFSLSALLAAAGEGFGLPEGEAVHALSLKSGLETDLSVGNALIGFYAEHG  296

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDM-QRN------------  4119
              S++ V+ +F  +P +D+ SW  +++G ++  +   A ++F+ M +RN            
Sbjct  297   SSVEDVVSVFQGMPVKDVISWTGLLNGYMEFGLVDMALDVFDRMPERNFVTYNAVLTGFC  356

Query  4118  ---------------------------DCLRIDYITLSTLLNACSECFMRR-GQELHAHA  4023
                                        D L +  +T+++ LNAC+    R+  +++HA  
Sbjct  357   QNKEGVRVTFAKKAGLRGLGLFRQMVEDGLEVSDVTVTSALNACAIAADRKVSEQVHAFV  416

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S   ++ ALI    +CG       LFE+   +++F                   
Sbjct  417   IKCGCGSTPWIDAALIDMCIKCGRSGDAHLLFEQWRHQESFH------------------  458

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                        + +N++L    ++GE  KA++ F +M + S + F D F LT+    CG 
Sbjct  459   -----------IAWNSLLLASVRDGEYEKALSTFLQMFRSSGVGFIDEFMLTAALGVCGA  507

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H F  KSG      +  A++ M  +CG ++DA   F RM      LV+  
Sbjct  508   LGFAELGKQMHSFAAKSGLLYACGVGNAIISMYGKCGELDDAVNFFERMTCRD--LVSWN  565

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGL  3408
             +M+  +  + Q E  + ++ + +  G+
Sbjct  566   AMITAHLLHRQGEEILDIWAQMERLGI  592


 Score = 40.0 bits (92),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (52%), Gaps = 6/62 (10%)
 Frame = -2

Query  4587  LSNALISAYLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEMRLER  4426
             + NAL+  Y+K G +  AL  FD +      S  A+++G  ++ R  EA  LF EMR   
Sbjct  183   VDNALLGMYVKCGRLGDALRAFDGMERRDVSSWNAVLAGLVELGRHEEAFGLFGEMRASG  242

Query  4425  FR  4420
              R
Sbjct  243   VR  244


 Score =   109 bits (273),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 83/278 (30%), Positives = 138/278 (50%), Gaps = 11/278 (4%)
 Frame = -3

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGE--GLKAMAFFYR  3735
             DA   N ++ AY+ +G +  A+ +FD +P ++A  Y+A+++G  + G      A      
Sbjct  72    DARAANAVMCAYLRAGRLADARGVFDRMPARDAASYSALISGHARLGSPASAAAALLARM  131

Query  3734  MIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSG----CEPND-CIEAALLDMC  3570
              + ++++ +++T   +  AC      +   Q+H    KSG      P    ++ ALL M 
Sbjct  132   RLADALDPTEYTFVGLLTACARRGNPRLGAQVHALAAKSGHCSCSGPGSLLVDNALLGMY  191

Query  3569  TRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEV  3390
              +CGR+ DA + F  M      + +  ++L G  + G+ E A  LF E +  G V  D  
Sbjct  192   VKCGRLGDALRAFDGME--RRDVSSWNAVLAGLVELGRHEEAFGLFGEMRASG-VRADSF  248

Query  3389  ATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG-ELDNAVKAFEL  3213
             + + +L   G    L  GE +H L+LK G  +D+ VGNA+I  YA+ G  +++ V  F+ 
Sbjct  249   SLSALLAAAGEGFGLPEGEAVHALSLKSGLETDLSVGNALIGFYAEHGSSVEDVVSVFQG  308

Query  3212  MSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIV  3099
             M  +D+ SW  LL GY+     D ALD + RM     V
Sbjct  309   MPVKDVISWTGLLNGYMEFGLVDMALDVFDRMPERNFV  346


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 150/612 (25%), Positives = 239/612 (39%), Gaps = 116/612 (19%)
 Frame = -3

Query  4340  VHALMIKLGYLDSTY-----VVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGM  4176
              HA+ +K G L ++        NA+M  Y + G L     +FD +P RD AS++ +ISG 
Sbjct  55    AHAVAVKSGALGTSTSPDARAANAVMCAYLRAGRLADARGVFDRMPARDAASYSALISGH  114

Query  4175  VK-ESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS-ECFMRRGQELHAHALRIGY--  4008
              +  S  + A  L   M+  D L     T   LL AC+     R G ++HA A + G+  
Sbjct  115   ARLGSPASAAAALLARMRLADALDPTEYTFVGLLTACARRGNPRLGAQVHALAAKSGHCS  174

Query  4007  ---ESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKEL  3837
                  +L V+NAL+  Y +CG +   +  F+ M  RD  +W                   
Sbjct  175   CSGPGSLLVDNALLGMYVKCGRLGDALRAFDGMERRDVSSW-------------------  215

Query  3836  FDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMER  3657
                         NAVLAG  + G   +A   F  M    +    F+L+++  A G     
Sbjct  216   ------------NAVLAGLVELGRHEEAFGLFGEMRASGVRADSFSLSALLAAAGEGFGL  263

Query  3656  KSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG-RMEDAEKIFHRMPLGHGRLVALTSML  3480
                + +H   LKSG E +  +  AL+      G  +ED   +F  MP+    +++ T +L
Sbjct  264   PEGEAVHALSLKSGLETDLSVGNALIGFYAEHGSSVEDVVSVFQGMPVKD--VISWTGLL  321

Query  3479  RGYAQNGQPENAISLF----------------------------------------FETQ  3420
              GY + G  + A+ +F                                        F   
Sbjct  322   NGYMEFGLVDMALDVFDRMPERNFVTYNAVLTGFCQNKEGVRVTFAKKAGLRGLGLFRQM  381

Query  3419  LEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL  3240
             +E  + V +V   + L  C      K+ E +H   +K G  S   +  A+I M  KCG  
Sbjct  382   VEDGLEVSDVTVTSALNACAIAADRKVSEQVHAFVIKCGCGSTPWIDAALIDMCIKCGRS  441

Query  3239  DNAVKAFELMSSRDL--CSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILS  3066
              +A   FE    ++    +WNSLL   V     ++AL T+ +M R   V   F    +L+
Sbjct  442   GDAHLLFEQWRHQESFHIAWNSLLLASVRDGEYEKALSTFLQMFRSSGV--GFIDEFMLT  499

Query  3065  AYRHTTKNVVNRCQSFFF--------SMQSAYGVLPASDHYACLVSVLGYWGLLEEAEET  2910
             A        +  C +  F        S  +  G+L A      ++S+ G  G L++A   
Sbjct  500   A-------ALGVCGALGFAELGKQMHSFAAKSGLLYACGVGNAIISMYGKCGELDDAVNF  552

Query  2909  INTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSME----PQDPSTFIL---KSNL  2751
                M      S W A++ + ++H     G+ ++     ME      D  TF+L     + 
Sbjct  553   FERMTCRDLVS-WNAMITAHLLHRQ---GEEILDIWAQMERLGIRPDSITFLLVMSACSH  608

Query  2750  YSASGRWQCSEL  2715
              S+    QC EL
Sbjct  609   TSSDSTDQCREL  620


 Score = 93.6 bits (231),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/315 (25%), Positives = 136/315 (43%), Gaps = 38/315 (12%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G+E ++ +  + L AC  + + ++  QVHA +IK G   + ++  AL+ +  KCG     
Sbjct  385   GLEVSDVTVTSALNACAIAADRKVSEQVHAFVIKCGCGSTPWIDAALIDMCIKCGRSGDA  444

Query  4241  IELFDNLPKRDI--ASWNTMISGMVKESMFTRAFELFNDMQRNDCLR-IDYITLSTLLNA  4071
               LF+    ++    +WN+++   V++  + +A   F  M R+  +  ID   L+  L  
Sbjct  445   HLLFEQWRHQESFHIAWNSLLLASVRDGEYEKALSTFLQMFRSSGVGFIDEFMLTAALGV  504

Query  4070  CSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTW  3894
             C    F   G+++H+ A + G      V NA+I  Y +CG +   +  FERM  RD  +W
Sbjct  505   CGALGFAELGKQMHSFAAKSGLLYACGVGNAIISMYGKCGELDDAVNFFERMTCRDLVSW  564

Query  3893  NEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIE  3714
             N MITA++   L    +E+ D                             + +M +  I 
Sbjct  565   NAMITAHL---LHRQGEEILD----------------------------IWAQMERLGIR  593

Query  3713  FSDFTLTSIANACGLLMERKSSKQIHGFILKS---GCEPNDCIEAALLDMCTRCGRMEDA  3543
                 T   + +AC       + +    F+  S   G EP     AA +++    G  ++A
Sbjct  594   PDSITFLLVMSACSHTSSDSTDQCRELFLSMSSSYGIEPAMEHYAAFVNVLGCWGHFDEA  653

Query  3542  EKIFHRMPLGHGRLV  3498
             E++   MP   G LV
Sbjct  654   EQLIGSMPFKPGALV  668


 Score = 32.7 bits (73),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 13/92 (14%)
 Frame = -2

Query  4710  SLSIQEPLLSSDPLINSSISTYPEQHAVDYADFLKL-----EEDTRLSNALISAYLKLGL  4546
             +LS++  L +   + N+ I  Y E H     D + +      +D      L++ Y++ GL
Sbjct  271   ALSLKSGLETDLSVGNALIGFYAE-HGSSVEDVVSVFQGMPVKDVISWTGLLNGYMEFGL  329

Query  4545  VDYALAVFDSL------SSPAIISGFAKINRE  4468
             VD AL VFD +      +  A+++GF + N+E
Sbjct  330   VDMALDVFDRMPERNFVTYNAVLTGFCQ-NKE  360



>ref|XP_002461524.1| hypothetical protein SORBIDRAFT_02g004050 [Sorghum bicolor]
 gb|EER98045.1| hypothetical protein SORBIDRAFT_02g004050 [Sorghum bicolor]
Length=867

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/727 (48%), Positives = 483/727 (66%), Gaps = 13/727 (2%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G+ P EY+FV LLTAC R  N  LG QVHAL+ K G+  S  V NAL+G+Y KCG     
Sbjct  140   GLLPTEYTFVGLLTACARRGNPRLGTQVHALVAKSGHASSLLVANALLGMYVKCGRFGDA  199

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
             +  FD + +RD++SWN +++G+V+      AFELF +M+ +  +R D  TLS LL A  E
Sbjct  200   LRAFDGMDRRDVSSWNAVLAGLVELGRHEEAFELFGEMRASGNVRADRFTLSALLAAAGE  259

Query  4061  CFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNE  3888
              F + +G+ +HA +L+ G E++LSV NALI FY   G S+  V+++F+RM V+D  +W  
Sbjct  260   GFGQPQGEAVHALSLKSGLETDLSVGNALIGFYAEHGASVDDVVSVFQRMPVKDVISWTG  319

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLK----------AMAFFY  3738
             ++  YME GLVD+A ++F+ +P++N V YNAVL GFCQN EG++           +  F 
Sbjct  320   LLNGYMEFGLVDMALDVFERMPQRNFVTYNAVLTGFCQNKEGVRVTFAKKAGFRGLGLFR  379

Query  3737  RMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG  3558
             +M++  +E SD T+T + NAC +  +RK+S+Q+H F++K GC  +  I+AAL+DMC +CG
Sbjct  380   QMVEAGLEISDVTVTGVLNACAIAADRKASEQVHAFVIKCGCVSSPWIDAALIDMCIKCG  439

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVVVDEVATA  3381
             R  DA  +F +        +A  S+L    ++G+ E A+S F +  +  G+  +DE    
Sbjct  440   RSGDAHLLFEQWQHDESFHIAWNSLLLASVRDGEYEKALSTFLQMFRSSGVEFIDEFMLT  499

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
              VLGVCG+LG  +LG+ +H    K G L    VGNA+ISMY KCGEL +A   FE M+ R
Sbjct  500   AVLGVCGSLGFAELGKQMHSFTAKSGLLCARGVGNAIISMYGKCGELKDAGSFFEGMTCR  559

Query  3200  DLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQS  3021
             DL SWN+++  ++LH +GDE L  WS MERL + PDS T L ++SA  HT+ +   +C+ 
Sbjct  560   DLVSWNAMITAHLLHHQGDEILKIWSEMERLMVRPDSITFLLVISACSHTSSDSTQKCRD  619

Query  3020  FFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMH  2841
              F +M S YG+ PA +HYA  V VLG WG  ++AE+ I  MP +P + VWR+LLDSC  H
Sbjct  620   LFLTMPSTYGIEPAMEHYAAFVYVLGCWGHFDDAEQLIGGMPLKPGALVWRSLLDSCSKH  679

Query  2840  LNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSW  2661
              N ++ +R +K +L++EPQDPST++L SNL S S RW  SE  R EM+EKG +KIP +SW
Sbjct  680   SNMAVRRRAMKHLLALEPQDPSTYVLTSNLLSESARWHSSENRRLEMREKGMRKIPARSW  739

Query  2660  VICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLF  2481
                 +  HSFFARD +H QS+DIY+ LD+LILEC+KAGY PDT++VLH+VEEYQK+ FL 
Sbjct  740   TFHGNMVHSFFARDRTHPQSRDIYAGLDVLILECIKAGYEPDTTFVLHDVEEYQKRHFLM  799

Query  2480  HHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFL  2301
             +HS KLA  YGLLM   G+ VRV+KNI +CGDCH+F + AS  T + I VRD+SGFH F 
Sbjct  800   YHSVKLASMYGLLMAGPGQTVRVVKNIRMCGDCHSFLEHASAATGKVISVRDSSGFHIFR  859

Query  2300  NGKCSCN  2280
              GKCSC 
Sbjct  860   EGKCSCR  866


 Score =   114 bits (285),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 135/275 (49%), Gaps = 7/275 (3%)
 Frame = -3

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLA---GFCQNGEGLKAMAFFY  3738
             DA   N ++ AY+ +G +  A+++FD +P ++A  Y+A+++        G    A     
Sbjct  74    DARASNAVMCAYLRAGRLADARDVFDRMPARDAASYSALISGHARLGGGGAAAAAAELLG  133

Query  3737  RM-IKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
             RM + + +  +++T   +  AC      +   Q+H  + KSG   +  +  ALL M  +C
Sbjct  134   RMRLADGLLPTEYTFVGLLTACARRGNPRLGTQVHALVAKSGHASSLLVANALLGMYVKC  193

Query  3560  GRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATA  3381
             GR  DA + F  M      + +  ++L G  + G+ E A  LF E +  G V  D    +
Sbjct  194   GRFGDALRAFDGMD--RRDVSSWNAVLAGLVELGRHEEAFELFGEMRASGNVRADRFTLS  251

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG-ELDNAVKAFELMSS  3204
              +L   G       GE +H L+LK G  +D+ VGNA+I  YA+ G  +D+ V  F+ M  
Sbjct  252   ALLAAAGEGFGQPQGEAVHALSLKSGLETDLSVGNALIGFYAEHGASVDDVVSVFQRMPV  311

Query  3203  RDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIV  3099
             +D+ SW  LL GY+     D ALD + RM +   V
Sbjct  312   KDVISWTGLLNGYMEFGLVDMALDVFERMPQRNFV  346


 Score =   107 bits (266),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 141/578 (24%), Positives = 224/578 (39%), Gaps = 104/578 (18%)
 Frame = -3

Query  4319  LGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFEL  4140
             LG        NA+M  Y + G L    ++FD +P RD AS++ +ISG  +      A   
Sbjct  69    LGASPDARASNAVMCAYLRAGRLADARDVFDRMPARDAASYSALISGHARLGGGGAAAAA  128

Query  4139  FNDMQR---NDCLRIDYITLSTLLNACS-ECFMRRGQELHAHALRIGYESNLSVNNALIK  3972
                + R    D L     T   LL AC+     R G ++HA   + G+ S+L V NAL+ 
Sbjct  129   AELLGRMRLADGLLPTEYTFVGLLTACARRGNPRLGTQVHALVAKSGHASSLLVANALLG  188

Query  3971  FYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAV  3792
              Y +CG     +  F+ M  RD  +WN ++   +E G  + A ELF  +           
Sbjct  189   MYVKCGRFGDALRAFDGMDRRDVSSWNAVLAGLVELGRHEEAFELFGEMRASG-------  241

Query  3791  LAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGC  3612
                                    ++    FTL+++  A G    +   + +H   LKSG 
Sbjct  242   -----------------------NVRADRFTLSALLAAAGEGFGQPQGEAVHALSLKSGL  278

Query  3611  EPNDCIEAALLDMCTRCG-RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISL  3435
             E +  +  AL+      G  ++D   +F RMP+    +++ T +L GY + G  + A+ +
Sbjct  279   ETDLSVGNALIGFYAEHGASVDDVVSVFQRMPVKD--VISWTGLLNGYMEFGLVDMALDV  336

Query  3434  F----------------------------------------FETQLEGLVVVDEVATAtv  3375
             F                                        F   +E  + + +V    V
Sbjct  337   FERMPQRNFVTYNAVLTGFCQNKEGVRVTFAKKAGFRGLGLFRQMVEAGLEISDVTVTGV  396

Query  3374  lgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDL  3195
             L  C      K  E +H   +K G +S   +  A+I M  KCG   +A   FE     + 
Sbjct  397   LNACAIAADRKASEQVHAFVIKCGCVSSPWIDAALIDMCIKCGRSGDAHLLFEQWQHDES  456

Query  3194  --CSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQS  3021
                +WNSLL   V     ++AL T+ +M R   V   F    +L+A       V+  C S
Sbjct  457   FHIAWNSLLLASVRDGEYEKALSTFLQMFRSSGV--EFIDEFMLTA-------VLGVCGS  507

Query  3020  FFF--------SMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRA  2865
               F        S  +  G+L A      ++S+ G  G L++A      M      S W A
Sbjct  508   LGFAELGKQMHSFTAKSGLLCARGVGNAIISMYGKCGELKDAGSFFEGMTCRDLVS-WNA  566

Query  2864  LLDSCIMHLNSSIGKRVIKKILSME----PQDPSTFIL  2763
             ++ + ++H     G  ++K    ME      D  TF+L
Sbjct  567   MITAHLLHHQ---GDEILKIWSEMERLMVRPDSITFLL  601


 Score = 94.7 bits (234),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 136/316 (43%), Gaps = 38/316 (12%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             +G+E ++ +   +L AC  + + +   QVHA +IK G + S ++  AL+ +  KCG    
Sbjct  384   AGLEISDVTVTGVLNACAIAADRKASEQVHAFVIKCGCVSSPWIDAALIDMCIKCGRSGD  443

Query  4244  VIELFDNLPKRDI--ASWNTMISGMVKESMFTRAFELFNDMQRNDCLR-IDYITLSTLLN  4074
                LF+     +    +WN+++   V++  + +A   F  M R+  +  ID   L+ +L 
Sbjct  444   AHLLFEQWQHDESFHIAWNSLLLASVRDGEYEKALSTFLQMFRSSGVEFIDEFMLTAVLG  503

Query  4073  AC-SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
              C S  F   G+++H+   + G      V NA+I  Y +CG +K   + FE M  RD  +
Sbjct  504   VCGSLGFAELGKQMHSFTAKSGLLCARGVGNAIISMYGKCGELKDAGSFFEGMTCRDLVS  563

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             WN MITA+           L  H                 Q  E LK  +   R++   +
Sbjct  564   WNAMITAH-----------LLHH-----------------QGDEILKIWSEMERLM---V  592

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKS---GCEPNDCIEAALLDMCTRCGRMED  3546
                  T   + +AC       + K    F+      G EP     AA + +    G  +D
Sbjct  593   RPDSITFLLVISACSHTSSDSTQKCRDLFLTMPSTYGIEPAMEHYAAFVYVLGCWGHFDD  652

Query  3545  AEKIFHRMPLGHGRLV  3498
             AE++   MPL  G LV
Sbjct  653   AEQLIGGMPLKPGALV  668


 Score = 31.6 bits (70),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 13/92 (14%)
 Frame = -2

Query  4710  SLSIQEPLLSSDPLINSSISTYPEQHAVDYADFLKLEE-----DTRLSNALISAYLKLGL  4546
             +LS++  L +   + N+ I  Y E H     D + + +     D      L++ Y++ GL
Sbjct  271   ALSLKSGLETDLSVGNALIGFYAE-HGASVDDVVSVFQRMPVKDVISWTGLLNGYMEFGL  329

Query  4545  VDYALAVFDSL------SSPAIISGFAKINRE  4468
             VD AL VF+ +      +  A+++GF + N+E
Sbjct  330   VDMALDVFERMPQRNFVTYNAVLTGFCQ-NKE  360



>dbj|BAK00347.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=861

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/733 (49%), Positives = 488/733 (67%), Gaps = 15/733 (2%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLD-STYVVNALMGLYSKCG  4257
             +R +G+ P +Y+FV LLTACIR  N  LG QVHAL  K  Y+  S  V NAL+G+Y KCG
Sbjct  130   MRLAGLAPTKYTFVGLLTACIRRGNPRLGTQVHALAAKGRYIGGSLLVANALLGMYVKCG  189

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+  + +F  + +RD++SWNT++SG+V+   +  AFELF DM+ +D + +D  +LS LL
Sbjct  190   RLEDALRMFHGMEERDVSSWNTVLSGLVELGRYEEAFELFGDMRTSD-VAVDRFSLSALL  248

Query  4076  NACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDA  3903
              A +E F +  G  +HA +L+ G E +LSV NALI FY   G S++ ++ +F+RM V+D 
Sbjct  249   AAATEGFCLPHGAAVHALSLKSGLEVDLSVGNALIGFYAEHGDSVEDMVGVFQRMPVKDV  308

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGE----------GLKA  3753
              +W  ++  YME GLVD A  +F  +PE+N V YNAVL GFC+N E          GL+ 
Sbjct  309   ISWTGLLNGYMEFGLVDNALGVFYRMPERNFVTYNAVLTGFCRNKESARVTFARKAGLQG  368

Query  3752  MAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDM  3573
             +  F +M++  +E SD T+T + NAC +  +RK S+Q+H F++K GC  +  I+AAL+DM
Sbjct  369   LGLFRQMLENGLEMSDVTVTGVLNACAIAADRKISEQVHTFVIKCGCGSSPWIDAALIDM  428

Query  3572  CTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVVVD  3396
             C +CGR  DA  +F          +A +S+L    ++G+ E A S F +  +   +  +D
Sbjct  429   CIKCGRSGDARLLFEHWRHQESFHIAWSSLLLSSFRDGEYEKAFSTFLQMFRNSDIQFID  488

Query  3395  EVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFE  3216
             E     VLGVCG LG ++LG+ +H LA K G L    VGNA++SMY KCG+L+NAV  F+
Sbjct  489   EFLLTNVLGVCGALGFMELGKQMHLLAAKSGLLRACGVGNAIVSMYGKCGQLENAVTFFQ  548

Query  3215  LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVV  3036
              M  RDL SWN+L+  ++LHR+GDE  DTWS MERL I PDS T L I+SA   T  +  
Sbjct  549   RMPHRDLVSWNALITAHLLHRQGDEIWDTWSEMERLVIKPDSVTFLLIISACSCTNSDSA  608

Query  3035  NRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLD  2856
             + C   F SM S Y   PA +H+A +V+VLG WG  +EAE+ I +MPF+P + VWR+LL+
Sbjct  609   DACMELFHSMSSKYNTEPAMEHFAAVVNVLGRWGHFDEAEQFIASMPFKPSAIVWRSLLE  668

Query  2855  SCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKI  2676
             +C    N ++ +R +  +L++EPQDPST++L SNLYS S +W CSE  R EM+EKG  KI
Sbjct  669   TCSKQSNMTLRRRAMNHLLALEPQDPSTYVLASNLYSESAKWHCSENTRLEMREKGIHKI  728

Query  2675  PGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQK  2496
             P +SW    +  HSFFARD SH QSKDIY+ LD+L LECMKAGY PDT++VLH+VEEYQK
Sbjct  729   PARSWTFDDNAIHSFFARDRSHPQSKDIYAGLDVLTLECMKAGYEPDTTFVLHDVEEYQK  788

Query  2495  KDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSG  2316
             + FL +HSAKLA TYGLLM   GK +RV+KNI +CGDCH+F + AS  T +EI VRD++G
Sbjct  789   RYFLMYHSAKLAATYGLLMAGSGKIIRVVKNIRMCGDCHSFLEHASAATGKEISVRDSNG  848

Query  2315  FHCFLNGKCSCND  2277
             FH F  G CSC +
Sbjct  849   FHIFRAGICSCRE  861


 Score =   100 bits (250),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 95/395 (24%), Positives = 174/395 (44%), Gaps = 77/395 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R S +  + +S  ALL A      L  G  VHAL +K G      V NAL+G Y++ G
Sbjct  231   DMRTSDVAVDRFSLSALLAAATEGFCLPHGAAVHALSLKSGLEVDLSVGNALIGFYAEHG  290

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDM-QRN------------  4119
              S++ ++ +F  +P +D+ SW  +++G ++  +   A  +F  M +RN            
Sbjct  291   DSVEDMVGVFQRMPVKDVISWTGLLNGYMEFGLVDNALGVFYRMPERNFVTYNAVLTGFC  350

Query  4118  ---------------------------DCLRIDYITLSTLLNACSECFMRR-GQELHAHA  4023
                                        + L +  +T++ +LNAC+    R+  +++H   
Sbjct  351   RNKESARVTFARKAGLQGLGLFRQMLENGLEMSDVTVTGVLNACAIAADRKISEQVHTFV  410

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S+  ++ ALI    +CG       LFE    +++F                   
Sbjct  411   IKCGCGSSPWIDAALIDMCIKCGRSGDARLLFEHWRHQESFH------------------  452

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                        + ++++L    ++GE  KA + F +M + S I+F D F LT++   CG 
Sbjct  453   -----------IAWSSLLLSSFRDGEYEKAFSTFLQMFRNSDIQFIDEFLLTNVLGVCGA  501

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H    KSG      +  A++ M  +CG++E+A   F RMP  H  LV+  
Sbjct  502   LGFMELGKQMHLLAAKSGLLRACGVGNAIVSMYGKCGQLENAVTFFQRMP--HRDLVSWN  559

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             +++  +  + Q +     +  +++E LV+  +  T
Sbjct  560   ALITAHLLHRQGDEIWDTW--SEMERLVIKPDSVT  592


 Score = 38.5 bits (88),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (58%), Gaps = 6/57 (11%)
 Frame = -2

Query  4587  LSNALISAYLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEMR  4435
             ++NAL+  Y+K G ++ AL +F  +      S   ++SG  ++ R  EA ELF +MR
Sbjct  177   VANALLGMYVKCGRLEDALRMFHGMEERDVSSWNTVLSGLVELGRYEEAFELFGDMR  233


 Score =   104 bits (259),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 142/537 (26%), Positives = 228/537 (42%), Gaps = 62/537 (12%)
 Frame = -3

Query  4340  VHALMIKLG---YLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVK  4170
              HA+  K G    LD+  + NA+M  Y + G L   +E+FD +  RD AS++ +ISG  +
Sbjct  57    AHAVATKSGTAAQLDAR-LANAVMCGYIRAGRLTDALEVFDRMTARDAASYSALISGHAR  115

Query  4169  -ESMFTRAFELFNDMQRNDCLRIDYITLSTLLNAC-SECFMRRGQELHAHALRIGY-ESN  3999
               S  + A  LF  M+        Y T   LL AC      R G ++HA A +  Y   +
Sbjct  116   LGSPVSAAEALFRSMRLAGLAPTKY-TFVGLLTACIRRGNPRLGTQVHALAAKGRYIGGS  174

Query  3998  LSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPE  3819
             L V NAL+  Y +CG ++  + +F  M  RD  +WN +++  +E G  + A ELF  +  
Sbjct  175   LLVANALLGMYVKCGRLEDALRMFHGMEERDVSSWNTVLSGLVELGRYEEAFELFGDMRT  234

Query  3818  KN--------AVLYNAVLAGFC-QNGEGLKAMAFFYRMIKESIEFSDFTLTSIANA-CGL  3669
              +        + L  A   GFC  +G  + A++     +K  +E       S+ NA  G 
Sbjct  235   SDVAVDRFSLSALLAAATEGFCLPHGAAVHALS-----LKSGLEVD----LSVGNALIGF  285

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
               E   S +    + +     +      LL+     G +++A  +F+RMP      V   
Sbjct  286   YAEHGDSVEDMVGVFQRMPVKDVISWTGLLNGYMEFGLVDNALGVFYRMP--ERNFVTYN  343

Query  3488  SMLRGYAQNGQPENAISLF-----------FETQLEGLVVVDEVATAtvlgvcgtlgllk  3342
             ++L G+ +N   E+A   F           F   LE  + + +V    VL  C      K
Sbjct  344   AVLTGFCRN--KESARVTFARKAGLQGLGLFRQMLENGLEMSDVTVTGVLNACAIAADRK  401

Query  3341  lGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDL--CSWNSLLAG  3168
             + E +H   +K G  S   +  A+I M  KCG   +A   FE    ++    +W+SLL  
Sbjct  402   ISEQVHTFVIKCGCGSSPWIDAALIDMCIKCGRSGDARLLFEHWRHQESFHIAWSSLLLS  461

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFS-------  3009
                    ++A  T+ +M R   +   F    +L+       NV+  C +  F        
Sbjct  462   SFRDGEYEKAFSTFLQMFRNSDI--QFIDEFLLT-------NVLGVCGALGFMELGKQMH  512

Query  3008  -MQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMH  2841
              + +  G+L A      +VS+ G  G LE A      MP     S W AL+ + ++H
Sbjct  513   LLAAKSGLLRACGVGNAIVSMYGKCGQLENAVTFFQRMPHRDLVS-WNALITAHLLH  568



>ref|XP_006402229.1| hypothetical protein EUTSA_v10015790mg [Eutrema salsugineum]
 gb|ESQ43682.1| hypothetical protein EUTSA_v10015790mg [Eutrema salsugineum]
Length=831

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/725 (49%), Positives = 479/725 (66%), Gaps = 68/725 (9%)
 Frame = -3

Query  4433  LRGSG-IEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSK--  4263
             +R  G I+PNE++FVA+LTAC                   G+L+S +V N++M LY+K  
Sbjct  171   MRSEGQIQPNEFTFVAILTACSNQ----------------GFLNSVFVGNSVMNLYAKHP  214

Query  4262  CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
               S+D V++LFD +P RD+AS  T                                    
Sbjct  215   GSSIDDVLQLFDEIPHRDVASDLT------------------------------------  238

Query  4082  LLNACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDA  3903
                        RG ELHA A+R+G +  LSVNNALI FY +CG IK V  L+E M VRD 
Sbjct  239   -----------RGGELHARAIRVGLKQELSVNNALIGFYAKCGDIKKVENLYEMMNVRDG  287

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE  3723
             FT  EMI AYM  G+VD A E+F+ +PEK+ + YNA++AG C+NG GLKA+  F  M++ 
Sbjct  288   FTLTEMIIAYMTFGMVDSAVEMFEKIPEKDVITYNALMAGLCRNGHGLKALKLFTEMLQR  347

Query  3722  SIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDA  3543
              +  +DF+LTS  +AC L+ E++ S+QIHG  +K GC  N CI+ ALLDMCTRC RM D 
Sbjct  348   GV-LTDFSLTSAVDACSLVSEKEVSEQIHGSCIKFGCASNPCIQTALLDMCTRCARMSDV  406

Query  3542  EKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvc  3363
             E+IF + P       A TS++ GYA+NG PE A+SLF  T  E  +V+DEV+   +L VC
Sbjct  407   EEIFEQWPSNLDSSKATTSIIGGYARNGLPEKALSLFHRTLCEEKLVLDEVSLTLILAVC  466

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
             GTLG  ++G  +H  ALK G+ SDV +GN +ISMY+KC   D+A+K F  M   D+ SWN
Sbjct  467   GTLGFREMGYQIHGYALKGGYFSDVALGNTLISMYSKCCCSDDAIKVFNTMREHDVVSWN  526

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQ  3003
             SL++ Y+L R GDEAL  W RM + GI PD+ T   ++SA+R++  + ++ C+  F SM+
Sbjct  527   SLISSYILQRNGDEALALWLRMNKEGIKPDTITLALVISAFRYSESDKLSSCRDLFLSMK  586

Query  3002  SAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIG  2823
             + + + P ++HY   V VLG+ GLLEEAE+T+N+MPF+P+ SV R+LLDSC +H N+SI 
Sbjct  587   TIHDIEPTTEHYTAFVGVLGHRGLLEEAEDTVNSMPFQPEVSVLRSLLDSCRVHSNTSIA  646

Query  2822  KRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHK  2643
             KRV K +L  +P +PS +ILKSN+YSASG W  SE++R EM+E+G++K P +SW+I +++
Sbjct  647   KRVAKLVLGTKPDNPSDYILKSNIYSASGLWHRSEMIREEMRERGYRKHPSRSWIIHENQ  706

Query  2642  FHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKL  2463
              HSF ARDTSH Q KDIYS L+ILI+EC++AGY PDT +VL EV+E+ KK FLF HSAKL
Sbjct  707   VHSFHARDTSHPQEKDIYSGLEILIMECLRAGYEPDTEFVLQEVDEFMKKSFLFPHSAKL  766

Query  2462  ALTYGLLMTKH-GKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCS  2286
             A+TY +L + + GKPVRV+KN+ LCGDCH  FK  S V KREI +RD+SGFH F+NGKCS
Sbjct  767   AVTYCILTSNNRGKPVRVVKNVRLCGDCHELFKYVSAVVKREIVLRDSSGFHRFMNGKCS  826

Query  2285  CNDRW  2271
             C D W
Sbjct  827   CKDLW  831


 Score = 69.3 bits (168),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 7/72 (10%)
 Frame = -2

Query  4623  YADFLKLEEDT-RLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREI  4465
             +A FLKL E+T  L N+LISAYLKLG    A  VF SLSSP      A+ISGFA++N EI
Sbjct  103   HASFLKLREETIDLGNSLISAYLKLGFPRDAFLVFVSLSSPTVVSYTALISGFARLNLEI  162

Query  4464  EAVELFYEMRLE  4429
             +A++LF+ MR E
Sbjct  163   KALKLFFRMRSE  174



>ref|XP_010228310.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g03800 [Brachypodium distachyon]
Length=866

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/735 (49%), Positives = 483/735 (66%), Gaps = 17/735 (2%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYL---DSTYVVNALMGLYSK  4263
             +R +G+ P EY+FV LLTACIR  N  LG QVHAL  K        S  V NAL+G+Y K
Sbjct  133   MRLAGLAPTEYTFVGLLTACIRRGNPRLGTQVHALAAKYPCCCCGGSLLVANALLGMYVK  192

Query  4262  CGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLST  4083
             CG  +  + +FD +  RD++SWNT++SG+V+   +  AFELF DM R   +  D  +LS 
Sbjct  193   CGRFEDAMRVFDGMEGRDVSSWNTVLSGLVELGRYEEAFELFEDM-RAGGIAADRFSLSA  251

Query  4082  LLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVR  3909
             LL A +E F +  G  +HA +L+ G E +LSV NALI FY   G S++ V+ +F+RMLV+
Sbjct  252   LLTAAAEGFGLPEGAAVHALSLKSGLEVDLSVGNALIGFYAEHGDSVEDVVGVFQRMLVK  311

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG----------L  3759
             D  +W  ++  YME GLVD A  +FD +PE+N V YNAVL GFC N EG          L
Sbjct  312   DVISWTGLLNGYMEFGLVDTALAVFDRMPERNFVTYNAVLTGFCLNKEGVRVTFAKKAGL  371

Query  3758  KAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALL  3579
             + +  F +M++  +E SD T+T + NAC ++ +RK S+Q+H F++K GC  +  I+A L+
Sbjct  372   RGLGLFRQMLENGLEMSDVTVTGVLNACAIVADRKMSEQVHTFVIKCGCGSSPWIDAGLI  431

Query  3578  DMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVV  3402
             DMC +CGR  DA  +F          +A  S+L    ++G+ E A S+F +  +   +  
Sbjct  432   DMCIKCGRSGDARLLFEHWRHPESFHIAWNSLLLASFRDGEYEKAFSIFLQKFRSSDVQF  491

Query  3401  VDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKA  3222
             +DE   +TVLGVCG LG  +LG+ +H  A K G L    VGNA+ISMY KCG+L+NAV  
Sbjct  492   IDEFMLSTVLGVCGALGFAELGKEMHSFAAKSGHLHACGVGNAIISMYGKCGQLENAVNF  551

Query  3221  FELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKN  3042
             F+ M  RDL SWN+L+  ++LHR+GDE LD WS+MERL I PDS T L I+SA  +T+ +
Sbjct  552   FQQMPHRDLVSWNALITAHLLHRQGDEILDIWSQMERLVIKPDSITFLLIVSACSYTSSD  611

Query  3041  VVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRAL  2862
              V++C   F  M S Y + PA +H+A  V VLG W   +EAE+ I +MPF+P + VWR+L
Sbjct  612   SVDKCMKLFHYMSSKYNIEPAMEHFAAFVYVLGCWDRFDEAEQFIGSMPFKPGALVWRSL  671

Query  2861  LDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQ  2682
             L+SC    N ++ +R +  +L++EPQDPST++L SNL S S RW CSE  R EM+EKG  
Sbjct  672   LESCSKRSNMTMRRRAMNHLLALEPQDPSTYVLASNLLSESARWHCSENTRQEMREKGIH  731

Query  2681  KIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEY  2502
             KIP +SW    +  HSFFARD  H QSKDIY+ LD+L LECMKAGY PDT++VLH+VEE+
Sbjct  732   KIPARSWTFHNNTVHSFFARDRLHPQSKDIYAGLDVLTLECMKAGYEPDTTFVLHDVEEH  791

Query  2501  QKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDT  2322
             QK+ FL +HSAKLA TYGLLM+  G+ V V+KNI +CGDCH+F K AS  T +EI VRD+
Sbjct  792   QKRHFLMYHSAKLAATYGLLMSGPGQSVNVVKNIRMCGDCHSFMKHASAATGKEISVRDS  851

Query  2321  SGFHCFLNGKCSCND  2277
             SGFH F  G CSC +
Sbjct  852   SGFHIFRGGVCSCRE  866


 Score =   111 bits (278),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 97/374 (26%), Positives = 183/374 (49%), Gaps = 35/374 (9%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R  GI  + +S  ALLTA      L  G  VHAL +K G      V NAL+G Y++ G
Sbjct  236   DMRAGGIAADRFSLSALLTAAAEGFGLPEGAAVHALSLKSGLEVDLSVGNALIGFYAEHG  295

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDM-QRNDCLRIDYITLST  4083
              S++ V+ +F  +  +D+ SW  +++G ++  +   A  +F+ M +RN      ++T + 
Sbjct  296   DSVEDVVGVFQRMLVKDVISWTGLLNGYMEFGLVDTALAVFDRMPERN------FVTYNA  349

Query  4082  LLNACSECFMRRGQEL---HAHALR-IGYESNLSVNNALIKFYTRCGSIKSVMALFERML  3915
             +L     C  + G  +       LR +G    +  N   +   T  G + +   + +R +
Sbjct  350   VLTGF--CLNKEGVRVTFAKKAGLRGLGLFRQMLENGLEMSDVTVTGVLNACAIVADRKM  407

Query  3914  VRDAFTW----NEMITAYMESGLVDL---------AKELFDHL--PEKNAVLYNAVLAGF  3780
                  T+        + ++++GL+D+         A+ LF+H   PE   + +N++L   
Sbjct  408   SEQVHTFVIKCGCGSSPWIDAGLIDMCIKCGRSGDARLLFEHWRHPESFHIAWNSLLLAS  467

Query  3779  CQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGLLMERKSSKQIHGFILKSGCEP  3606
              ++GE  KA + F +  + S ++F D F L+++   CG L   +  K++H F  KSG   
Sbjct  468   FRDGEYEKAFSIFLQKFRSSDVQFIDEFMLSTVLGVCGALGFAELGKEMHSFAAKSGHLH  527

Query  3605  NDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE  3426
                +  A++ M  +CG++E+A   F +MP  H  LV+  +++  +  + Q +  + ++  
Sbjct  528   ACGVGNAIISMYGKCGQLENAVNFFQQMP--HRDLVSWNALITAHLLHRQGDEILDIW--  583

Query  3425  TQLEGLVVVDEVAT  3384
             +Q+E LV+  +  T
Sbjct  584   SQMERLVIKPDSIT  597


 Score = 41.2 bits (95),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 6/57 (11%)
 Frame = -2

Query  4587  LSNALISAYLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEMR  4435
             ++NAL+  Y+K G  + A+ VFD +      S   ++SG  ++ R  EA ELF +MR
Sbjct  182   VANALLGMYVKCGRFEDAMRVFDGMEGRDVSSWNTVLSGLVELGRYEEAFELFEDMR  238


 Score =   114 bits (285),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 85/276 (31%), Positives = 135/276 (49%), Gaps = 10/276 (4%)
 Frame = -3

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGE-GLKAMAFFYRM  3732
             DA   N ++  Y+ +G +D A+ +FD +P ++A  Y+A+++G  + G     A A F RM
Sbjct  74    DARLANAVMCGYLRAGRLDDARGVFDRMPARDAASYSALISGHARLGSPASAAXALFRRM  133

Query  3731  IKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSG---CEPNDCIEAALLDMCTRC  3561
                 +  +++T   +  AC      +   Q+H    K     C  +  +  ALL M  +C
Sbjct  134   RLAGLAPTEYTFVGLLTACIRRGNPRLGTQVHALAAKYPCCCCGGSLLVANALLGMYVKC  193

Query  3560  GRMEDAEKIFHRMPLGHGRLV-ALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             GR EDA ++F  M    GR V +  ++L G  + G+ E A  L FE    G +  D  + 
Sbjct  194   GRFEDAMRVFDGM---EGRDVSSWNTVLSGLVELGRYEEAFEL-FEDMRAGGIAADRFSL  249

Query  3383  AtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGE-LDNAVKAFELMS  3207
             + +L        L  G  +H L+LK G   D+ VGNA+I  YA+ G+ +++ V  F+ M 
Sbjct  250   SALLTAAAEGFGLPEGAAVHALSLKSGLEVDLSVGNALIGFYAEHGDSVEDVVGVFQRML  309

Query  3206  SRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIV  3099
              +D+ SW  LL GY+     D AL  + RM     V
Sbjct  310   VKDVISWTGLLNGYMEFGLVDTALAVFDRMPERNFV  345


 Score =   101 bits (251),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 146/592 (25%), Positives = 224/592 (38%), Gaps = 117/592 (20%)
 Frame = -3

Query  4340  VHALMIKLGY--LDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVK-  4170
              HA+ +K G   L    + NA+M  Y + G LD    +FD +P RD AS++ +ISG  + 
Sbjct  60    AHAVAVKSGAAALPDARLANAVMCGYLRAGRLDDARGVFDRMPARDAASYSALISGHARL  119

Query  4169  ESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECFMRRGQE---LHAHALRIGYE--  4005
              S  + A  LF  M+       +Y T   LL AC    +RRG        HAL   Y   
Sbjct  120   GSPASAAXALFRRMRLAGLAPTEY-TFVGLLTAC----IRRGNPRLGTQVHALAAKYPCC  174

Query  4004  ---SNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELF  3834
                 +L V NAL+  Y +CG  +  M +F+ M  RD  +WN +++  +E G  + A ELF
Sbjct  175   CCGGSLLVANALLGMYVKCGRFEDAMRVFDGMEGRDVSSWNTVLSGLVELGRYEEAFELF  234

Query  3833  DHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERK  3654
             +                                M    I    F+L+++  A        
Sbjct  235   ED-------------------------------MRAGGIAADRFSLSALLTAAAEGFGLP  263

Query  3653  SSKQIHGFILKSGCEPNDCIEAALLDMCTRCG-RMEDAEKIFHRMPLGHGRLVALTSMLR  3477
                 +H   LKSG E +  +  AL+      G  +ED   +F RM +    +++ T +L 
Sbjct  264   EGAAVHALSLKSGLEVDLSVGNALIGFYAEHGDSVEDVVGVFQRMLVKD--VISWTGLLN  321

Query  3476  GYAQNGQPENAISLF----------------------------------------FETQL  3417
             GY + G  + A+++F                                        F   L
Sbjct  322   GYMEFGLVDTALAVFDRMPERNFVTYNAVLTGFCLNKEGVRVTFAKKAGLRGLGLFRQML  381

Query  3416  EGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELD  3237
             E  + + +V    VL  C  +   K+ E +H   +K G  S   +   +I M  KCG   
Sbjct  382   ENGLEMSDVTVTGVLNACAIVADRKMSEQVHTFVIKCGCGSSPWIDAGLIDMCIKCGRSG  441

Query  3236  NAVKAFELMSSRDL--CSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
             +A   FE     +    +WNSLL         ++A   + +  R   V   F    +LS 
Sbjct  442   DARLLFEHWRHPESFHIAWNSLLLASFRDGEYEKAFSIFLQKFRSSDV--QFIDEFMLS-  498

Query  3062  YRHTTKNVVNRCQSFFF--------SMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETI  2907
                    V+  C +  F        S  +  G L A      ++S+ G  G LE A    
Sbjct  499   ------TVLGVCGALGFAELGKEMHSFAAKSGHLHACGVGNAIISMYGKCGQLENAVNFF  552

Query  2906  NTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSME----PQDPSTFIL  2763
               MP     S W AL+ + ++H     G  ++     ME      D  TF+L
Sbjct  553   QQMPHRDLVS-WNALITAHLLHRQ---GDEILDIWSQMERLVIKPDSITFLL  600



>ref|XP_008670964.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 
[Zea mays]
 tpg|DAA42571.1| TPA: hypothetical protein ZEAMMB73_154468 [Zea mays]
Length=872

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/727 (47%), Positives = 481/727 (66%), Gaps = 13/727 (2%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G+ P EY+FV L TAC R  N  LG QVHAL  K G+     V NA++G+Y KCG     
Sbjct  145   GLLPTEYTFVGLFTACARRGNPRLGTQVHALAAKSGHSSLLLVANAILGMYVKCGRFGDA  204

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
             +  FD + +RD++SWN +++G+V+      AFE+F +M+ +  +R D  +LS LL A  E
Sbjct  205   MRAFDGMDRRDVSSWNAVLAGLVELGRHDEAFEMFGEMRASGNVRADRFSLSALLTAAGE  264

Query  4061  CFMR-RGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNE  3888
                + +G+ +HA + + G E++LSV NALI FY   G S++ V+++F+RM V+D  +W  
Sbjct  265   GVGQLQGEAVHALSFKSGLETDLSVGNALIGFYAEHGASVEDVVSVFQRMPVKDVISWTG  324

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKA----------MAFFY  3738
             ++  YME GLVD+A ++F+ +P++N V YNAVL GFC+N EG++A          +  F 
Sbjct  325   LLNGYMEFGLVDMALDVFERMPQRNFVTYNAVLTGFCRNKEGVRATFAKKAGLRGLGLFR  384

Query  3737  RMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCG  3558
             +M+++ +E SD T+T + NAC +  +RK S+Q+H F++K GC  +   +AAL+DMC +CG
Sbjct  385   QMVEDGLEISDVTVTGVLNACAIAADRKVSEQVHAFVIKCGCVSSPWSDAALIDMCIKCG  444

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVVVDEVATA  3381
             R  DA  +F +        +A  S+L    + G+ E A+S F +  +  G   +DE    
Sbjct  445   RSGDAHLLFEQWQHEESFHIAWNSLLLASVRGGEYEKALSTFLQMFRSSGAEFIDEFMLT  504

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
             +VLGVCG+LG  +LG+ +H  A K G LS   VGNA+ISMY KCGEL +A+  FE MS R
Sbjct  505   SVLGVCGSLGFAELGKQMHTFAAKSGLLSARGVGNAIISMYGKCGELKDAISLFERMSCR  564

Query  3200  DLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQS  3021
             DL SWN+++  ++L  +GD+ L  WS MER  + PDS T L ++SA  HT+ +  ++C+ 
Sbjct  565   DLVSWNAMITAHLLLHQGDDILKIWSEMERSMVRPDSITFLLVISACSHTSSDSTDKCRK  624

Query  3020  FFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMH  2841
              F SM S YG+ PA +HYA  V VLG WG  +EAE+ I  MP +P + VWR+LLDSC  H
Sbjct  625   LFLSMPSTYGIEPAMEHYAAFVYVLGCWGRFDEAEQLIGGMPLQPGALVWRSLLDSCSKH  684

Query  2840  LNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSW  2661
              N ++ +R +K +L++EPQDPST++L SNL S S RW+ SE  R EM EKG +KIP +SW
Sbjct  685   SNMAVRRRAMKHLLALEPQDPSTYVLTSNLLSESARWRSSENTRLEMYEKGMRKIPARSW  744

Query  2660  VICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLF  2481
                 +  HSFFARD SH QS+DIY+ LD+LILEC+KAGY PDT++VLH+VEEYQK+ FL 
Sbjct  745   TFHGNMVHSFFARDKSHPQSRDIYAGLDVLILECIKAGYEPDTTFVLHDVEEYQKRHFLM  804

Query  2480  HHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFL  2301
             +HS KLA  YGLLM   G+ +RV+KNI +CGDCH+F + AS  T + I VRD+SGFH F 
Sbjct  805   YHSMKLASMYGLLMAGPGQTIRVVKNIRMCGDCHSFLEHASAATGKVISVRDSSGFHIFR  864

Query  2300  NGKCSCN  2280
              GKCSC+
Sbjct  865   GGKCSCS  871


 Score =   115 bits (287),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/279 (29%), Positives = 138/279 (49%), Gaps = 11/279 (4%)
 Frame = -3

Query  3908  DAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQ--NGEG-----LKAM  3750
             DA T N ++ AY+  G +  A+++FD +P ++A  Y+A+++G+ +   G G     + + 
Sbjct  75    DARTANAVMCAYLRVGRLGDARDVFDWMPARDAASYSALISGYARLAGGSGSVTATVASA  134

Query  3749  AFFYRM-IKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDM  3573
                 RM + + +  +++T   +  AC      +   Q+H    KSG      +  A+L M
Sbjct  135   ELLGRMRLADGLLPTEYTFVGLFTACARRGNPRLGTQVHALAAKSGHSSLLLVANAILGM  194

Query  3572  CTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDE  3393
               +CGR  DA + F  M      + +  ++L G  + G+ + A  +F E +  G V  D 
Sbjct  195   YVKCGRFGDAMRAFDGMD--RRDVSSWNAVLAGLVELGRHDEAFEMFGEMRASGNVRADR  252

Query  3392  VATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG-ELDNAVKAFE  3216
              + + +L   G       GE +H L+ K G  +D+ VGNA+I  YA+ G  +++ V  F+
Sbjct  253   FSLSALLTAAGEGVGQLQGEAVHALSFKSGLETDLSVGNALIGFYAEHGASVEDVVSVFQ  312

Query  3215  LMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIV  3099
              M  +D+ SW  LL GY+     D ALD + RM +   V
Sbjct  313   RMPVKDVISWTGLLNGYMEFGLVDMALDVFERMPQRNFV  351


 Score =   109 bits (272),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 138/573 (24%), Positives = 223/573 (39%), Gaps = 90/573 (16%)
 Frame = -3

Query  4319  LGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVK-------ESM  4161
             LG        NA+M  Y + G L    ++FD +P RD AS++ +ISG  +        + 
Sbjct  70    LGPSSDARTANAVMCAYLRVGRLGDARDVFDWMPARDAASYSALISGYARLAGGSGSVTA  129

Query  4160  FTRAFELFNDMQRNDCLRIDYITLSTLLNACS-ECFMRRGQELHAHALRIGYESNLSVNN  3984
                + EL   M+  D L     T   L  AC+     R G ++HA A + G+ S L V N
Sbjct  130   TVASAELLGRMRLADGLLPTEYTFVGLFTACARRGNPRLGTQVHALAAKSGHSSLLLVAN  189

Query  3983  ALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVL  3804
             A++  Y +CG     M  F+ M  RD  +WN ++   +E G  D A E+F  +       
Sbjct  190   AILGMYVKCGRFGDAMRAFDGMDRRDVSSWNAVLAGLVELGRHDEAFEMFGEMRASG---  246

Query  3803  YNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFIL  3624
                                        ++    F+L+++  A G  + +   + +H    
Sbjct  247   ---------------------------NVRADRFSLSALLTAAGEGVGQLQGEAVHALSF  279

Query  3623  KSGCEPNDCIEAALLDMCTRCG-RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPEN  3447
             KSG E +  +  AL+      G  +ED   +F RMP+    +++ T +L GY + G  + 
Sbjct  280   KSGLETDLSVGNALIGFYAEHGASVEDVVSVFQRMPVKD--VISWTGLLNGYMEFGLVDM  337

Query  3446  AISLF----------------------------------------FETQLEGLVVVDEVA  3387
             A+ +F                                        F   +E  + + +V 
Sbjct  338   ALDVFERMPQRNFVTYNAVLTGFCRNKEGVRATFAKKAGLRGLGLFRQMVEDGLEISDVT  397

Query  3386  TAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMS  3207
                VL  C      K+ E +H   +K G +S      A+I M  KCG   +A   FE   
Sbjct  398   VTGVLNACAIAADRKVSEQVHAFVIKCGCVSSPWSDAALIDMCIKCGRSGDAHLLFEQWQ  457

Query  3206  SRDL--CSWNSLLAGYVLHRRGDEALDTWSRMERLGIVP--DSFTCLHILSAYRHTTKNV  3039
               +    +WNSLL   V     ++AL T+ +M R       D F    +L          
Sbjct  458   HEESFHIAWNSLLLASVRGGEYEKALSTFLQMFRSSGAEFIDEFMLTSVLGVCGSLGFAE  517

Query  3038  VNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALL  2859
             + + Q   F+ +S  G+L A      ++S+ G  G L++A      M      S W A++
Sbjct  518   LGK-QMHTFAAKS--GLLSARGVGNAIISMYGKCGELKDAISLFERMSCRDLVS-WNAMI  573

Query  2858  DS-CIMHLNSSIGKRVIKKILSMEPQDPSTFIL  2763
              +  ++H    I K   +   SM   D  TF+L
Sbjct  574   TAHLLLHQGDDILKIWSEMERSMVRPDSITFLL  606



>gb|EAZ38850.1| hypothetical protein OsJ_23267 [Oryza sativa Japonica Group]
Length=872

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/735 (49%), Positives = 485/735 (66%), Gaps = 19/735 (3%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIK-----LGYLDSTYVVNALMGLY  4269
             +R +G+ P EY+FV LLTAC R  N  LG QVHAL +K      G   S  V NAL+G+Y
Sbjct  137   MRLAGMAPTEYTFVGLLTACARRGNPRLGSQVHALAVKGNSPCGGGGGSLLVDNALLGMY  196

Query  4268  SKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITL  4089
              K G  D  +++FD + +RD++SWNT++SG+V+   +  AFELF DM R+  +  D  +L
Sbjct  197   VKGGRFDDALKVFDGMERRDVSSWNTVLSGLVELGRYDEAFELFGDM-RDSGVGADRFSL  255

Query  4088  STLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERML  3915
             S LL A +E F +  G  +HA +L+ G E +LSV NAL+ FY   G SI+ V+ +FERM 
Sbjct  256   SALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHGHSIEDVVDVFERMP  315

Query  3914  VRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG---------  3762
              +D  +W  ++  YME GLVD+A ++FD +P +N V YNAVL GF  N EG         
Sbjct  316   AKDVISWTGLLNGYMEFGLVDMAMDVFDRMPVRNFVTYNAVLTGFNHNKEGVRVTFARKS  375

Query  3761  -LKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAA  3585
              L+ +  F +M+++ +E SD T+T + NAC +  ERK S+Q+  F +K GC     I+AA
Sbjct  376   GLRGLGLFKQMLEDGLEISDVTVTGVLNACAITAERKMSEQVQAFAIKCGCGSTPWIDAA  435

Query  3584  LLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGL  3408
             L+DMC +CGR  DA  +F +        +A  S+L    ++G+ E A+S F +  +   +
Sbjct  436   LIDMCIKCGRSGDAHLLFEKWRHEESFHIAWNSLLAASFRDGEYEKALSTFLKMFRSNDV  495

Query  3407  VVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAV  3228
               +DE    TVLG CG LG  + G+ +HC A K G LS   VGNA+ISMY KCG L+ AV
Sbjct  496   QFIDEFILTTVLGACGALGFAEFGKQMHCFAAKSGLLSAQGVGNAIISMYGKCGALETAV  555

Query  3227  KAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTT  3048
               F+ M  RDL SWN+L+  ++LHR+GDE LD WS+MERL I PDS T L ++S+  +T+
Sbjct  556   NVFKRMPCRDLVSWNALITSHLLHRQGDEILDLWSQMERLPIKPDSVTFLLVISSCSYTS  615

Query  3047  KNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWR  2868
              N  ++C+  F SM S YG+ PA +HYA  V VLG WG  EEAE+ I  MPF+P + VWR
Sbjct  616   SNSADKCRELFLSMSSIYGIEPAVEHYAAFVHVLGCWGHFEEAEQLIGKMPFKPSALVWR  675

Query  2867  ALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKG  2688
             + LDSC    N ++ +  ++ +L++EPQDPST++L SNLYS S RWQCSE  R +M+EKG
Sbjct  676   SCLDSCNRQPNMTMRRLAMRHLLALEPQDPSTYVLASNLYSESARWQCSESTRLKMREKG  735

Query  2687  FQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVE  2508
              +KIP +SW    +  HSFFARD SH QSKDIY+ LD+LILECMKAGY PDT++VLH+VE
Sbjct  736   MRKIPARSWTFHGNSIHSFFARDRSHPQSKDIYAGLDVLILECMKAGYEPDTTFVLHDVE  795

Query  2507  EYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVR  2328
             EYQK+ FL +HS KLA  YGLLM+ HG+ +RV+KN+ +CGDCH+F +  S  T +EI VR
Sbjct  796   EYQKRHFLMYHSVKLAAMYGLLMSGHGETIRVVKNVRMCGDCHSFLEYTSAATGKEILVR  855

Query  2327  DTSGFHCFLNGKCSC  2283
             D++GFH F  GKCSC
Sbjct  856   DSAGFHIFCGGKCSC  870


 Score =   114 bits (285),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 102/395 (26%), Positives = 181/395 (46%), Gaps = 77/395 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R SG+  + +S  ALL A      L  G  VHAL +K G      V NAL+G Y++ G
Sbjct  242   DMRDSGVGADRFSLSALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHG  301

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQ-RN------------  4119
              S++ V+++F+ +P +D+ SW  +++G ++  +   A ++F+ M  RN            
Sbjct  302   HSIEDVVDVFERMPAKDVISWTGLLNGYMEFGLVDMAMDVFDRMPVRNFVTYNAVLTGFN  361

Query  4118  ---------------------------DCLRIDYITLSTLLNACSECFMRR-GQELHAHA  4023
                                        D L I  +T++ +LNAC+    R+  +++ A A
Sbjct  362   HNKEGVRVTFARKSGLRGLGLFKQMLEDGLEISDVTVTGVLNACAITAERKMSEQVQAFA  421

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S   ++ ALI    +CG       LFE+    ++F                   
Sbjct  422   IKCGCGSTPWIDAALIDMCIKCGRSGDAHLLFEKWRHEESFH------------------  463

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                        + +N++LA   ++GE  KA++ F +M + + ++F D F LT++  ACG 
Sbjct  464   -----------IAWNSLLAASFRDGEYEKALSTFLKMFRSNDVQFIDEFILTTVLGACGA  512

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H F  KSG      +  A++ M  +CG +E A  +F RMP     LV+  
Sbjct  513   LGFAEFGKQMHCFAAKSGLLSAQGVGNAIISMYGKCGALETAVNVFKRMPCRD--LVSWN  570

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             +++  +  + Q +  + L+  +Q+E L +  +  T
Sbjct  571   ALITSHLLHRQGDEILDLW--SQMERLPIKPDSVT  603


 Score = 42.0 bits (97),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 6/57 (11%)
 Frame = -2

Query  4587  LSNALISAYLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEMR  4435
             + NAL+  Y+K G  D AL VFD +      S   ++SG  ++ R  EA ELF +MR
Sbjct  188   VDNALLGMYVKGGRFDDALKVFDGMERRDVSSWNTVLSGLVELGRYDEAFELFGDMR  244


 Score =   105 bits (262),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 144/297 (48%), Gaps = 16/297 (5%)
 Frame = -3

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKA-MAFFYRMI  3729
             A  WN ++  Y+ +G +  A+ +F+ +P ++A  Y+A+++G  + G    A +    RM 
Sbjct  79    ARAWNAVMCGYLRAGALADARGVFERMPARDAASYSALISGHARLGSPAAAGVELLGRMR  138

Query  3728  KESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEP------NDCIEAALLDMCT  3567
                +  +++T   +  AC      +   Q+H   +K G  P      +  ++ ALL M  
Sbjct  139   LAGMAPTEYTFVGLLTACARRGNPRLGSQVHALAVK-GNSPCGGGGGSLLVDNALLGMYV  197

Query  3566  RCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVA  3387
             + GR +DA K+F  M      + +  ++L G  + G+ + A  LF + +  G V  D  +
Sbjct  198   KGGRFDDALKVFDGME--RRDVSSWNTVLSGLVELGRYDEAFELFGDMRDSG-VGADRFS  254

Query  3386  TAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG-ELDNAVKAFELM  3210
              + +L        L  G  +H L+LK G   D+ VGNA++  YA+ G  +++ V  FE M
Sbjct  255   LSALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHGHSIEDVVDVFERM  314

Query  3209  SSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNV  3039
              ++D+ SW  LL GY+     D A+D + RM     V +  T   +L+ + H  + V
Sbjct  315   PAKDVISWTGLLNGYMEFGLVDMAMDVFDRMP----VRNFVTYNAVLTGFNHNKEGV  367



>ref|NP_001058999.1| Os07g0172600 [Oryza sativa Japonica Group]
 dbj|BAC83621.1| selenium-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF20913.1| Os07g0172600 [Oryza sativa Japonica Group]
Length=872

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/735 (49%), Positives = 485/735 (66%), Gaps = 19/735 (3%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIK-----LGYLDSTYVVNALMGLY  4269
             +R +G+ P EY+FV LLTAC R  N  LG QVHAL +K      G   S  V NAL+G+Y
Sbjct  137   MRLAGMAPTEYTFVGLLTACARRGNPRLGSQVHALAVKGNSPCGGGGGSLLVDNALLGMY  196

Query  4268  SKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITL  4089
              K G  D  +++FD + +RD++SWNT++SG+V+   +  AFELF DM R+  +  D  +L
Sbjct  197   VKGGRFDDALKVFDGMERRDVSSWNTVLSGLVELGRYDEAFELFGDM-RDSGVGADRFSL  255

Query  4088  STLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERML  3915
             S LL A +E F +  G  +HA +L+ G E +LSV NAL+ FY   G SI+ V+ +FERM 
Sbjct  256   SALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHGHSIEDVVDVFERMP  315

Query  3914  VRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG---------  3762
              +D  +W  ++  YME GLVD+A ++FD +P +N V YNAVL GF  N EG         
Sbjct  316   AKDVISWTGLLNGYMEFGLVDMAMDVFDRMPVRNFVTYNAVLTGFNHNKEGVRVTFARKS  375

Query  3761  -LKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAA  3585
              L+ +  F +M+++ +E SD T+T + NAC +  ERK S+Q+  F +K GC     I+AA
Sbjct  376   GLRGLGLFKQMLEDGLEISDVTVTGVLNACAITAERKMSEQVQAFAIKCGCGSTPWIDAA  435

Query  3584  LLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGL  3408
             L+DMC +CGR  DA  +F +        +A  S+L    ++G+ E A+S F +  +   +
Sbjct  436   LIDMCIKCGRSGDAHLLFEKWRHEESFHIAWNSLLAASFRDGEYEKALSTFLKMFRSNDV  495

Query  3407  VVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAV  3228
               +DE    TVLG CG LG  + G+ +HC A K G LS   VGNA+ISMY KCG L+ AV
Sbjct  496   QFIDEFILTTVLGACGALGFAEFGKQMHCFAAKSGLLSAQGVGNAIISMYGKCGALETAV  555

Query  3227  KAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTT  3048
               F+ M  RDL SWN+L+  ++LHR+GDE LD WS+MERL I PDS T L ++S+  +T+
Sbjct  556   NVFKRMPCRDLVSWNALITSHLLHRQGDEILDLWSQMERLPIKPDSVTFLLVISSCSYTS  615

Query  3047  KNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWR  2868
              N  ++C+  F SM S YG+ PA +HYA  V VLG WG  EEAE+ I  MPF+P + VWR
Sbjct  616   SNSADKCRELFLSMSSIYGIEPAVEHYAAFVHVLGCWGHFEEAEQLIGKMPFKPSALVWR  675

Query  2867  ALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKG  2688
             + LDSC    N ++ +  ++ +L++EPQDPST++L SNLYS S RWQCSE  R +M+EKG
Sbjct  676   SCLDSCNRQPNMTMRRLAMRHLLALEPQDPSTYVLASNLYSESARWQCSESTRLKMREKG  735

Query  2687  FQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVE  2508
              +KIP +SW    +  HSFFARD SH QSKDIY+ LD+LILECMKAGY PDT++VLH+VE
Sbjct  736   MRKIPARSWTFHGNSIHSFFARDRSHPQSKDIYAGLDVLILECMKAGYEPDTTFVLHDVE  795

Query  2507  EYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVR  2328
             EYQK+ FL +HS KLA  YGLLM+ HG+ +RV+KN+ +CGDCH+F +  S  T +EI VR
Sbjct  796   EYQKRHFLMYHSVKLAAMYGLLMSGHGETIRVVKNVRMCGDCHSFLEYTSAATGKEILVR  855

Query  2327  DTSGFHCFLNGKCSC  2283
             D++GFH F  GKCSC
Sbjct  856   DSAGFHIFCGGKCSC  870


 Score =   114 bits (285),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 102/395 (26%), Positives = 181/395 (46%), Gaps = 77/395 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R SG+  + +S  ALL A      L  G  VHAL +K G      V NAL+G Y++ G
Sbjct  242   DMRDSGVGADRFSLSALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHG  301

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQ-RN------------  4119
              S++ V+++F+ +P +D+ SW  +++G ++  +   A ++F+ M  RN            
Sbjct  302   HSIEDVVDVFERMPAKDVISWTGLLNGYMEFGLVDMAMDVFDRMPVRNFVTYNAVLTGFN  361

Query  4118  ---------------------------DCLRIDYITLSTLLNACSECFMRR-GQELHAHA  4023
                                        D L I  +T++ +LNAC+    R+  +++ A A
Sbjct  362   HNKEGVRVTFARKSGLRGLGLFKQMLEDGLEISDVTVTGVLNACAITAERKMSEQVQAFA  421

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S   ++ ALI    +CG       LFE+    ++F                   
Sbjct  422   IKCGCGSTPWIDAALIDMCIKCGRSGDAHLLFEKWRHEESFH------------------  463

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                        + +N++LA   ++GE  KA++ F +M + + ++F D F LT++  ACG 
Sbjct  464   -----------IAWNSLLAASFRDGEYEKALSTFLKMFRSNDVQFIDEFILTTVLGACGA  512

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H F  KSG      +  A++ M  +CG +E A  +F RMP     LV+  
Sbjct  513   LGFAEFGKQMHCFAAKSGLLSAQGVGNAIISMYGKCGALETAVNVFKRMPCRD--LVSWN  570

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             +++  +  + Q +  + L+  +Q+E L +  +  T
Sbjct  571   ALITSHLLHRQGDEILDLW--SQMERLPIKPDSVT  603


 Score = 42.0 bits (97),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 6/57 (11%)
 Frame = -2

Query  4587  LSNALISAYLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEMR  4435
             + NAL+  Y+K G  D AL VFD +      S   ++SG  ++ R  EA ELF +MR
Sbjct  188   VDNALLGMYVKGGRFDDALKVFDGMERRDVSSWNTVLSGLVELGRYDEAFELFGDMR  244


 Score =   105 bits (262),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 144/297 (48%), Gaps = 16/297 (5%)
 Frame = -3

Query  3905  AFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKA-MAFFYRMI  3729
             A  WN ++  Y+ +G +  A+ +F+ +P ++A  Y+A+++G  + G    A +    RM 
Sbjct  79    ARAWNAVMCGYLRAGALADARGVFERMPARDAASYSALISGHARLGSPAAAGVELLGRMR  138

Query  3728  KESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEP------NDCIEAALLDMCT  3567
                +  +++T   +  AC      +   Q+H   +K G  P      +  ++ ALL M  
Sbjct  139   LAGMAPTEYTFVGLLTACARRGNPRLGSQVHALAVK-GNSPCGGGGGSLLVDNALLGMYV  197

Query  3566  RCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVA  3387
             + GR +DA K+F  M      + +  ++L G  + G+ + A  LF + +  G V  D  +
Sbjct  198   KGGRFDDALKVFDGME--RRDVSSWNTVLSGLVELGRYDEAFELFGDMRDSG-VGADRFS  254

Query  3386  TAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG-ELDNAVKAFELM  3210
              + +L        L  G  +H L+LK G   D+ VGNA++  YA+ G  +++ V  FE M
Sbjct  255   LSALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHGHSIEDVVDVFERM  314

Query  3209  SSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNV  3039
              ++D+ SW  LL GY+     D A+D + RM     V +  T   +L+ + H  + V
Sbjct  315   PAKDVISWTGLLNGYMEFGLVDMAMDVFDRMP----VRNFVTYNAVLTGFNHNKEGV  367



>gb|EYU41564.1| hypothetical protein MIMGU_mgv1a001413mg [Erythranthe guttata]
Length=824

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/577 (57%), Positives = 401/577 (69%), Gaps = 52/577 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYIAT+YDY+AP+DEYGN+NQPKWGHLK+LH+LL S+E +L YG  T
Sbjct  291   YHGGTNFGRTAGGPYIATSYDYDAPIDEYGNLNQPKWGHLKKLHSLLMSMEKILTYGQYT  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTDYGRMMSSTVY   G +VCFL NAN+KDDI+I FEG+ YT PAWSV+ILPDC TEVYN
Sbjct  351   NTDYGRMMSSTVYSLNGTRVCFLGNANNKDDITINFEGRKYTVPAWSVSILPDCVTEVYN  410

Query  362   TARVNAQTTVMVKKLSEGA-------LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             TARVN QT+VMVK+L   A        +W +R E   HLK    N+SS L     A QL 
Sbjct  411   TARVNTQTSVMVKELPAEAEEKRHYDFEWQWRAEHFEHLKTS-LNKSSPLKGVTYANQLL  469

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQK+VTNDT+DYLWYMTS  +NE +PI G+E+TL VN   HVLHAFFN KHIG++W + +
Sbjct  470   DQKIVTNDTSDYLWYMTSVDVNEDDPIWGEEVTLRVNCDCHVLHAFFNGKHIGTKWVK-N  528

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGMDLS  880
             G++ F+F+ S KL++  N+ISLLS TVGL NYG Y +KV  G++GPVKLV PN    DLS
Sbjct  529   GQYSFVFEESAKLKRGTNSISLLSVTVGLQNYGAYIDKVKNGILGPVKLVAPNSIEKDLS  588

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
              N W Y VGL+GI +GL  +D   K  WH SN   +RMF+WYK                 
Sbjct  589   TNEWAYKVGLNGIERGLQNIDTKYKREWH-SNIPFNRMFVWYK-----------------  630

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                              T F+TP G+D+VVLDL G+GKG AWVNGHNIGRYWPS+LA  +
Sbjct  631   -----------------TSFRTPKGKDAVVLDLWGLGKGSAWVNGHNIGRYWPSYLADEN  673

Query  1241  GCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC+  CDYRG+Y GSKC+T CG  SQRWYHVPRSFL +  +N LVLFEE GG P  + V+
Sbjct  674   GCVSSCDYRGDYTGSKCLTNCGNSSQRWYHVPRSFLNEEEDNTLVLFEEFGGNPTHISVR  733

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQ  1597
             TVTVG   A+  EGN +ELSC G R ISKI F SFG P  S GS     C + + + V++
Sbjct  734   TVTVGKAVAHAYEGNRLELSCDGSRVISKINFASFGNPT-SKGS-----CHSPNSLSVVE  787

Query  1598  SACVGKEKCTLHVSDALFPTTTC-KSKIRRLAVEATC  1705
              AC+GKE C++ VS+  F  + C KS+++RLAVE  C
Sbjct  788   KACIGKESCSIEVSEKTFGASGCGKSQMKRLAVEVEC  824



>gb|EMT05832.1| hypothetical protein F775_12454 [Aegilops tauschii]
Length=781

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/725 (48%), Positives = 469/725 (65%), Gaps = 18/725 (2%)
 Frame = -3

Query  4400  SFVALLTACIR---SQNLELGFQVHALMIKLGYLD-STYVVNALMGLYSKCGSLDFVIEL  4233
             S+ AL++   R     N  LG QVHAL  K  Y   S  V NAL+G+Y KCG L+  + +
Sbjct  58    SYSALISGHARLVPPGNPRLGTQVHALAAKGRYCGGSLLVANALLGMYVKCGHLEDALRM  117

Query  4232  FDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-  4056
             F  + +RD++SWNT++SG+V    +  A ELF DM+  D + +D  +LS LL A +E F 
Sbjct  118   FYGMEERDVSSWNTVLSGLVVLGTYEEASELFGDMRTGD-VAVDRFSLSALLTAATEGFS  176

Query  4055  MRRGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNEMIT  3879
             + +G  +HA +L+ G E +LSV NALI FY   G S++ V+ +F+RM V+D  +W  ++ 
Sbjct  177   LPQGAAVHALSLKSGLEVDLSVGNALIGFYAEHGDSVEDVVGVFQRMPVKDVSSWTGLLN  236

Query  3878  AYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG----------LKAMAFFYRMI  3729
              YME GLVD A  +FD +PE+N V YNAVL GFCQN EG          L+ +  F +M+
Sbjct  237   GYMEFGLVDNALGVFDQMPERNFVTYNAVLTGFCQNKEGVRVTFAWKAGLQGLGLFRQML  296

Query  3728  KESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRME  3549
             +  +E S  T+TS+ NAC +  +RK S+Q+H F++K GC  +  I+A L+DMC +CGR  
Sbjct  297   ENGLEMSRVTMTSVLNACAIAADRKMSEQVHTFVIKCGCGSSPWIDATLIDMCIKCGRSA  356

Query  3548  DAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEG-LVVVDEVATAtvl  3372
             DA  +F          +A +S+L    ++G+ E A S F      G +  +DE    TVL
Sbjct  357   DARLLFEHWRHQESFHIAWSSLLLSSVRDGEYERASSTFLLMFRSGDIQFIDEFLLTTVL  416

Query  3371  gvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLC  3192
             GVCG LG  +LG+ +H LA K G L    VGNA++SMY KCG L+NAV  F+ M  RDL 
Sbjct  417   GVCGALGFTELGKQMHLLAAKSGLLHACGVGNAIVSMYGKCGPLENAVTFFQRMPHRDLV  476

Query  3191  SWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFF  3012
             SWN+L+  ++LHR+GDE  D WS+MERL I PDS T L I+SA  +T  +  + C   F 
Sbjct  477   SWNALITAHLLHRQGDEIWDIWSQMERLVIKPDSVTFLLIISACSYTDSDSADACMELFR  536

Query  3011  SMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNS  2832
              M S Y   PA +H+A +V VLG WG  +EAE+ I +MPF+P + VWR+LL+SC    N 
Sbjct  537   CMSSKYNTEPAMEHFAAVVYVLGCWGHFDEAEQFIASMPFKPGALVWRSLLESCSKQSNM  596

Query  2831  SIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVIC  2652
             ++ +R +  +L++EPQDPST++L SNLYS S +W CSE  R EM+EKG  KIP +SW   
Sbjct  597   TLRRRAMNHLLALEPQDPSTYVLTSNLYSESAKWHCSENTRLEMREKGIHKIPARSWTFD  656

Query  2651  QHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHS  2472
              +  HSFFARD SH QSKDIY+ LD+L LECMK GY PDT++V H+VEEYQK+ FL +HS
Sbjct  657   DNAIHSFFARDRSHPQSKDIYAGLDVLTLECMKDGYEPDTTFVRHDVEEYQKRHFLMYHS  716

Query  2471  AKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGK  2292
             AKLA TYGLLM   GK +RV+KNI +CGDCH+F + AS  T +EI VRD++GFH F  G 
Sbjct  717   AKLAATYGLLMAGSGKIIRVVKNICMCGDCHSFLEHASAATGKEISVRDSNGFHIFRAGI  776

Query  2291  CSCND  2277
             CSC +
Sbjct  777   CSCRE  781


 Score =   107 bits (268),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 93/395 (24%), Positives = 175/395 (44%), Gaps = 77/395 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R   +  + +S  ALLTA     +L  G  VHAL +K G      V NAL+G Y++ G
Sbjct  151   DMRTGDVAVDRFSLSALLTAATEGFSLPQGAAVHALSLKSGLEVDLSVGNALIGFYAEHG  210

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDM----------------  4128
              S++ V+ +F  +P +D++SW  +++G ++  +   A  +F+ M                
Sbjct  211   DSVEDVVGVFQRMPVKDVSSWTGLLNGYMEFGLVDNALGVFDQMPERNFVTYNAVLTGFC  270

Query  4127  QRNDCLRIDY------------------------ITLSTLLNACSECFMRR-GQELHAHA  4023
             Q  + +R+ +                        +T++++LNAC+    R+  +++H   
Sbjct  271   QNKEGVRVTFAWKAGLQGLGLFRQMLENGLEMSRVTMTSVLNACAIAADRKMSEQVHTFV  330

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S+  ++  LI    +CG       LFE    +++F                   
Sbjct  331   IKCGCGSSPWIDATLIDMCIKCGRSADARLLFEHWRHQESFH------------------  372

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                        + ++++L    ++GE  +A + F  M +   I+F D F LT++   CG 
Sbjct  373   -----------IAWSSLLLSSVRDGEYERASSTFLLMFRSGDIQFIDEFLLTTVLGVCGA  421

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H    KSG      +  A++ M  +CG +E+A   F RMP  H  LV+  
Sbjct  422   LGFTELGKQMHLLAAKSGLLHACGVGNAIVSMYGKCGPLENAVTFFQRMP--HRDLVSWN  479

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             +++  +  + Q +    ++  +Q+E LV+  +  T
Sbjct  480   ALITAHLLHRQGDEIWDIW--SQMERLVIKPDSVT  512


 Score = 32.7 bits (73),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 6/57 (11%)
 Frame = -2

Query  4587  LSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVELFYEMR  4435
             ++NAL+  Y+K G ++ AL +F      D  S   ++SG   +    EA ELF +MR
Sbjct  97    VANALLGMYVKCGHLEDALRMFYGMEERDVSSWNTVLSGLVVLGTYEEASELFGDMR  153


 Score = 89.4 bits (220),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/313 (25%), Positives = 144/313 (46%), Gaps = 32/313 (10%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             +G+E +  +  ++L AC  + + ++  QVH  +IK G   S ++   L+ +  KCG    
Sbjct  298   NGLEMSRVTMTSVLNACAIAADRKMSEQVHTFVIKCGCGSSPWIDATLIDMCIKCGRSAD  357

Query  4244  VIELFDNLPKRDI--ASWNTMISGMVKESMFTRAFELFNDMQRN-DCLRIDYITLSTLLN  4074
                LF++   ++    +W++++   V++  + RA   F  M R+ D   ID   L+T+L 
Sbjct  358   ARLLFEHWRHQESFHIAWSSLLLSSVRDGEYERASSTFLLMFRSGDIQFIDEFLLTTVLG  417

Query  4073  ACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
              C    F   G+++H  A + G      V NA++  Y +CG +++ +  F+RM  RD  +
Sbjct  418   VCGALGFTELGKQMHLLAAKSGLLHACGVGNAIVSMYGKCGPLENAVTFFQRMPHRDLVS  477

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             WN +ITA++   L     E++D   +   ++              +K  +  + +I  + 
Sbjct  478   WNALITAHL---LHRQGDEIWDIWSQMERLV--------------IKPDSVTFLLIISAC  520

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
              ++D   +  A+AC  L    SSK           EP     AA++ +    G  ++AE+
Sbjct  521   SYTD---SDSADACMELFRCMSSKY--------NTEPAMEHFAAVVYVLGCWGHFDEAEQ  569

Query  3536  IFHRMPLGHGRLV  3498
                 MP   G LV
Sbjct  570   FIASMPFKPGALV  582


 Score = 34.7 bits (78),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (54%), Gaps = 7/63 (11%)
 Frame = -2

Query  4599  EDTRLSNALISAYLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEM  4438
             +D      L++ Y++ GLVD AL VFD +      +  A+++GF + N+E   V   ++ 
Sbjct  226   KDVSSWTGLLNGYMEFGLVDNALGVFDQMPERNFVTYNAVLTGFCQ-NKEGVRVTFAWKA  284

Query  4437  RLE  4429
              L+
Sbjct  285   GLQ  287



>emb|CAN82063.1| hypothetical protein VITISV_016431 [Vitis vinifera]
Length=755

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/724 (48%), Positives = 449/724 (62%), Gaps = 135/724 (19%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R SGIE NE+SFVA+LT CIR  +LELG Q+HA++IK+G+L+ T+V NALMGLY KCG 
Sbjct  164   MRSSGIELNEFSFVAILTVCIRLLDLELGCQLHAIVIKMGFLNYTFVSNALMGLYGKCGY  223

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             LD V++LFD +  RDIASWNT+IS +VKE M+ RAFELF DM+R D  RID+ TLST+L 
Sbjct  224   LDXVLQLFDEMXHRDIASWNTVISSVVKEMMYERAFELFRDMRRIDGFRIDHFTLSTILV  283

Query  4073  ACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTW  3894
             A  E                                         + +F++M  R++ ++
Sbjct  284   AAME--------------------------------------DLALEVFDKMPARNSISY  305

Query  3893  NEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIE  3714
             N                               A+L+GFCQNGEG KA+AFF RM++E +E
Sbjct  306   N-------------------------------AILSGFCQNGEGSKALAFFCRMVEEGVE  334

Query  3713  FSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKI  3534
              +DFT T + NACGLLME K SKQIHGFILK G   N CIEAALLDMCTRCGRM DA+K+
Sbjct  335   LTDFTXTGVLNACGLLMEAKISKQIHGFILKFGFGSNACIEAALLDMCTRCGRMADAQKM  394

Query  3533  FHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtl  3354
             F +        +  TSM+ GYA+N QPE AISLF ++QLEG +VVD VA+  VLGVCGTL
Sbjct  395   FSQGXFXQSGSIIWTSMICGYARNAQPEEAISLFCQSQLEGAMVVDXVASTAVLGVCGTL  454

Query  3353  gllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLL  3174
                ++G+ +HC ALK GFLSD+ VGN++I+MY+KC  + +A+K F +M + D+ SWN L+
Sbjct  455   AFHEMGKQIHCHALKSGFLSDLGVGNSIITMYSKCSNMXDAIKVFNVMPAHDIVSWNGLI  514

Query  3173  AGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAY  2994
             AG++LHR+GDEAL  WS+ME+ GI PD+ T + I+SAYRHT  N+V+ C+  F SM++ Y
Sbjct  515   AGHLLHRQGDEALSVWSKMEKAGIKPDTVTFVLIISAYRHTNSNLVDNCRRLFLSMKTIY  574

Query  2993  GVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSC---IMHLNSSIG  2823
              + P   HY  LV VLGYWGLLEEAEE IN MP EP++SVWRALLD+C   I+H N    
Sbjct  575   HIDPTVXHYTSLVGVLGYWGLLEEAEEMINKMPIEPEASVWRALLDACRSWIIHENK---  631

Query  2822  KRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHK  2643
                +    + +   P    + S L          EL+  E  + G+  +P          
Sbjct  632   ---VHSFYARDKSHPQAKDIHSGL----------ELLIMECLKAGY--VP----------  666

Query  2642  FHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKL  2463
                    DTS                            +VLHEVEE+QKKDFLF+HSAK+
Sbjct  667   -------DTS----------------------------FVLHEVEEHQKKDFLFYHSAKI  691

Query  2462  ALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             A TYGLLMT+ G+ +R++KNILLCGDCHTF K  SIVT REI +RD SG HCFLNG+CSC
Sbjct  692   AATYGLLMTRPGRXIRIVKNILLCGDCHTFLKYVSIVTGREIFLRDASGHHCFLNGQCSC  751

Query  2282  NDRW  2271
              D W
Sbjct  752   KDYW  755


 Score = 85.5 bits (210),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/296 (24%), Positives = 131/296 (44%), Gaps = 42/296 (14%)
 Frame = -3

Query  3950  IKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQN  3771
             IK+V A   + L  D    N +I AY++ G+V  A ++F  L   N V Y A+++GF ++
Sbjct  93    IKAVHASIFK-LAEDIHLANALIVAYLKLGMVXNAXKVFVGLSCPNVVSYTAMISGFAKS  151

Query  3770  GEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
                 +AM  F+RM    IE ++F+  +I   C  L++ +   Q+H  ++K G      + 
Sbjct  152   NRERQAMEIFFRMRSSGIELNEFSFVAILTVCIRLLDLELGCQLHAIVIKMGFLNYTFVS  211

Query  3590  AALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEG  3411
              AL+ +  +CG ++   ++F  M   H  + +  +++    +    E A  LF + +   
Sbjct  212   NALMGLYGKCGYLDXVLQLFDEMX--HRDIASWNTVISSVVKEMMYERAFELFRDMR---  266

Query  3410  LVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNA  3231
                                        +    + H  LS ++V              D A
Sbjct  267   --------------------------RIDGFRIDHFTLSTILVA----------AMEDLA  290

Query  3230  VKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
             ++ F+ M +R+  S+N++L+G+  +  G +AL  + RM   G+    FT   +L+A
Sbjct  291   LEVFDKMPARNSISYNAILSGFCQNGEGSKALAFFCRMVEEGVELTDFTXTGVLNA  346


 Score = 71.2 bits (173),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A   KL ED  L+NALI AYLKLG+V  A  VF  LS P      A+ISGFAK NRE +
Sbjct  97    HASIFKLAEDIHLANALIVAYLKLGMVXNAXKVFVGLSCPNVVSYTAMISGFAKSNRERQ  156

Query  4461  AVELFYEMR  4435
             A+E+F+ MR
Sbjct  157   AMEIFFRMR  165



>gb|EAZ02927.1| hypothetical protein OsI_25067 [Oryza sativa Indica Group]
Length=678

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/677 (48%), Positives = 450/677 (66%), Gaps = 14/677 (2%)
 Frame = -3

Query  4274  LYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYI  4095
             +Y K G  D  +++FD + +RD++SWNT++SG+V+   +  AFELF DM R+  +  D  
Sbjct  1     MYVKGGRFDDALKVFDGMERRDVSSWNTVLSGLVELGRYDEAFELFGDM-RDSGVGADRF  59

Query  4094  TLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFER  3921
             +LS LL A +E F +  G  +HA +L+ G E +LSV NAL+ FY   G SI+ V+ +FER
Sbjct  60    SLSALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHGHSIEDVVDVFER  119

Query  3920  MLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG-------  3762
             M  +D  +W  ++  YME GLVD+A ++FD +P +N V YNAVL GF  N EG       
Sbjct  120   MPAKDVISWTGLLNGYMEFGLVDMAMDVFDRMPVRNFVTYNAVLTGFNHNKEGVRVTFAR  179

Query  3761  ---LKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIE  3591
                L+ +  F +M+++ +E SD T+T + NAC +  ERK S+Q+  F +K GC     I+
Sbjct  180   KSGLRGLGLFKQMLEDGLEISDVTVTGVLNACAITAERKMSEQVQAFAIKCGCGSTPWID  239

Query  3590  AALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLE  3414
             AAL+DMC +CGR  DA  +F +        +A  S+L    ++G+ E A+S F +  +  
Sbjct  240   AALIDMCIKCGRSGDAHLLFEKWRHEESFHIAWNSLLAASFRDGEYEKALSTFLKMFRSN  299

Query  3413  GLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDN  3234
              +  +DE    TVLG CG LG  + G+ +HC A K G LS   VGNA+ISMY KCG L+ 
Sbjct  300   DVQFIDEFILTTVLGACGALGFAEFGKQMHCFAAKSGLLSAQGVGNAIISMYGKCGALET  359

Query  3233  AVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRH  3054
             AV  F+ M  RDL SWN+L+  ++LHR+GDE LD WS+MERL I PDS T L ++S+  +
Sbjct  360   AVNVFKRMPCRDLVSWNALITSHLLHRQGDEILDLWSQMERLPIKPDSVTFLLVISSCSY  419

Query  3053  TTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSV  2874
             T+ N  ++C+  F SM S YG+ PA +HYA  V VLG WG  EEAE+ I  MPF+P + V
Sbjct  420   TSSNSADKCRELFLSMSSIYGIEPAVEHYAAFVHVLGCWGHFEEAEQLIGKMPFKPSALV  479

Query  2873  WRALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKE  2694
             WR+ LDSC    N ++ +  ++ +L++EPQDPST++L SNLYS S RWQCSE  R +M+E
Sbjct  480   WRSCLDSCNRQPNMTMRRLAMRHLLALEPQDPSTYVLASNLYSESARWQCSESTRLKMRE  539

Query  2693  KGFQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHE  2514
             KG +KIP +SW    +  HSFFARD SH QSKDIY+ LD+LILECMKAGY PDT++VLH+
Sbjct  540   KGMRKIPARSWTFHGNSIHSFFARDRSHPQSKDIYAGLDVLILECMKAGYEPDTTFVLHD  599

Query  2513  VEEYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIH  2334
             VEEYQK+ FL +HS KLA  YGLLM+ HG+ +RV+KN+ +CGDCH+F +  S  T +EI 
Sbjct  600   VEEYQKRHFLMYHSVKLAAMYGLLMSGHGETIRVVKNVRMCGDCHSFLEYTSAATGKEIL  659

Query  2333  VRDTSGFHCFLNGKCSC  2283
             VRD++GFH F  GKCSC
Sbjct  660   VRDSAGFHIFCGGKCSC  676


 Score =   114 bits (286),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 102/395 (26%), Positives = 181/395 (46%), Gaps = 77/395 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R SG+  + +S  ALL A      L  G  VHAL +K G      V NAL+G Y++ G
Sbjct  48    DMRDSGVGADRFSLSALLAAAAEGFGLHEGAAVHALSLKSGLEMDLSVGNALVGFYAEHG  107

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQ-RN------------  4119
              S++ V+++F+ +P +D+ SW  +++G ++  +   A ++F+ M  RN            
Sbjct  108   HSIEDVVDVFERMPAKDVISWTGLLNGYMEFGLVDMAMDVFDRMPVRNFVTYNAVLTGFN  167

Query  4118  ---------------------------DCLRIDYITLSTLLNACSECFMRR-GQELHAHA  4023
                                        D L I  +T++ +LNAC+    R+  +++ A A
Sbjct  168   HNKEGVRVTFARKSGLRGLGLFKQMLEDGLEISDVTVTGVLNACAITAERKMSEQVQAFA  227

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S   ++ ALI    +CG       LFE+    ++F                   
Sbjct  228   IKCGCGSTPWIDAALIDMCIKCGRSGDAHLLFEKWRHEESFH------------------  269

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                        + +N++LA   ++GE  KA++ F +M + + ++F D F LT++  ACG 
Sbjct  270   -----------IAWNSLLAASFRDGEYEKALSTFLKMFRSNDVQFIDEFILTTVLGACGA  318

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H F  KSG      +  A++ M  +CG +E A  +F RMP     LV+  
Sbjct  319   LGFAEFGKQMHCFAAKSGLLSAQGVGNAIISMYGKCGALETAVNVFKRMPCRD--LVSWN  376

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             +++  +  + Q +  + L+  +Q+E L +  +  T
Sbjct  377   ALITSHLLHRQGDEILDLW--SQMERLPIKPDSVT  409


 Score = 36.2 bits (82),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 27/49 (55%), Gaps = 6/49 (12%)
 Frame = -2

Query  4563  YLKLGLVDYALAVFDSL------SSPAIISGFAKINREIEAVELFYEMR  4435
             Y+K G  D AL VFD +      S   ++SG  ++ R  EA ELF +MR
Sbjct  2     YVKGGRFDDALKVFDGMERRDVSSWNTVLSGLVELGRYDEAFELFGDMR  50



>ref|XP_006658315.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like 
[Oryza brachyantha]
Length=661

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/662 (49%), Positives = 445/662 (67%), Gaps = 14/662 (2%)
 Frame = -3

Query  4223  LPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRR  4047
             + +RD++SWNT++SG+V+   +  AFELF DM R+  +  D  +LS LL A +E F ++ 
Sbjct  1     MERRDVSSWNTVLSGLVELGRYDEAFELFGDM-RDSGVAADRFSLSPLLAAAAEGFGLQE  59

Query  4046  GQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNEMITAYM  3870
             G  +HA +L+ G E +LSV NALI FY   G S++  + +F+RM V+D  +W  ++  YM
Sbjct  60    GAAVHALSLKSGLEMDLSVGNALIGFYAEHGDSVEDAVDVFQRMPVKDVVSWTGLLHGYM  119

Query  3869  ESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG----------LKAMAFFYRMIKES  3720
             E GLVD+A ++FD +PE+N V YNAVL GFCQN EG          L+ +  F +M+++ 
Sbjct  120   EFGLVDMALDVFDRMPERNFVTYNAVLTGFCQNKEGVRVTFARKSGLRGLGLFRQMVEDG  179

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +E SD T+T + NAC +  +RK S+Q+H F++K GC     I+AAL+DMC +CGR  DA 
Sbjct  180   LEISDVTVTGVLNACAIAADRKMSEQVHTFVIKCGCSSTPWIDAALIDMCIKCGRSGDAH  239

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVVVDEVATAtvlgvc  3363
              +F +        +A  S+L    ++G+ E AIS F +  +   +  +DE    TVLGVC
Sbjct  240   LLFEQWRHEESLHIAWNSLLVASFKDGEYEKAISTFLKMFRSNDVQFIDEFILTTVLGVC  299

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
             G LG  +LG+ +H  A K GFLS   VGNA+ISMY KCG L+ AV  F+ M  RDL SWN
Sbjct  300   GALGFAELGKQMHSFAAKSGFLSAQGVGNAIISMYGKCGALETAVDVFKRMPCRDLVSWN  359

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQ  3003
             +L+  ++LHR+GDE L+ WS++ERL I PDS T L ++S+  +T+ N  ++C+  F SM 
Sbjct  360   ALITSHLLHRQGDEILELWSQIERLPIKPDSITFLLVISSCSYTSSNSTDKCRELFLSMS  419

Query  3002  SAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIG  2823
             S +G+ P+ +HYA  V VLG WG  EEAE+ I  MP +P   VWR+LLDSC    N ++ 
Sbjct  420   STHGIKPSVEHYAAFVYVLGCWGHFEEAEQLIGKMPLKPSVLVWRSLLDSCNRRPNMTMR  479

Query  2822  KRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHK  2643
             +  +K +L++EPQDPST++L SNLYS S RWQ SE  R +M+E G +KIP +SW    + 
Sbjct  480   RLAMKHLLALEPQDPSTYVLTSNLYSESARWQSSESTRLKMREMGMRKIPAKSWTFHGNS  539

Query  2642  FHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKL  2463
              HSFFARD SH QSKDIY+ LD+LIL+CMKAGY PDT++VLH+VEEYQK+ FL +HS KL
Sbjct  540   IHSFFARDRSHPQSKDIYAGLDVLILDCMKAGYEPDTTFVLHDVEEYQKRHFLMYHSVKL  599

Query  2462  ALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             A  YGLLMT HG+ +RV+KNI +CGDCH+F +  S  T +EI VRD+ GFH F  GKCSC
Sbjct  600   AAMYGLLMTGHGETIRVVKNIRMCGDCHSFMEYTSAATGKEILVRDSGGFHIFRGGKCSC  659

Query  2282  ND  2277
              +
Sbjct  660   RE  661


 Score =   117 bits (294),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 98/395 (25%), Positives = 175/395 (44%), Gaps = 77/395 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R SG+  + +S   LL A      L+ G  VHAL +K G      V NAL+G Y++ G
Sbjct  31    DMRDSGVAADRFSLSPLLAAAAEGFGLQEGAAVHALSLKSGLEMDLSVGNALIGFYAEHG  90

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDM-QRN------------  4119
              S++  +++F  +P +D+ SW  ++ G ++  +   A ++F+ M +RN            
Sbjct  91    DSVEDAVDVFQRMPVKDVVSWTGLLHGYMEFGLVDMALDVFDRMPERNFVTYNAVLTGFC  150

Query  4118  ---------------------------DCLRIDYITLSTLLNACSECFMRR-GQELHAHA  4023
                                        D L I  +T++ +LNAC+    R+  +++H   
Sbjct  151   QNKEGVRVTFARKSGLRGLGLFRQMVEDGLEISDVTVTGVLNACAIAADRKMSEQVHTFV  210

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S   ++ ALI    +CG       LFE+        W                 
Sbjct  211   IKCGCSSTPWIDAALIDMCIKCGRSGDAHLLFEQ--------WRH---------------  247

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                    E   + +N++L    ++GE  KA++ F +M + + ++F D F LT++   CG 
Sbjct  248   ------EESLHIAWNSLLVASFKDGEYEKAISTFLKMFRSNDVQFIDEFILTTVLGVCGA  301

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H F  KSG      +  A++ M  +CG +E A  +F RMP     LV+  
Sbjct  302   LGFAELGKQMHSFAAKSGFLSAQGVGNAIISMYGKCGALETAVDVFKRMPCRD--LVSWN  359

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             +++  +  + Q +  + L+  +Q+E L +  +  T
Sbjct  360   ALITSHLLHRQGDEILELW--SQIERLPIKPDSIT  392


 Score = 25.8 bits (55),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = -2

Query  4521  DSLSSPAIISGFAKINREIEAVELFYEMR  4435
             D  S   ++SG  ++ R  EA ELF +MR
Sbjct  5     DVSSWNTVLSGLVELGRYDEAFELFGDMR  33



>gb|EMT14333.1| hypothetical protein F775_08151 [Aegilops tauschii]
Length=661

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/662 (48%), Positives = 438/662 (66%), Gaps = 14/662 (2%)
 Frame = -3

Query  4223  LPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRR  4047
             + +RD++SWNT++SG+V+   +  AFELF DM+  D + +D  +LS LL A +E F +  
Sbjct  1     MEERDVSSWNTVLSGLVELGRYEEAFELFGDMRTAD-VAVDRFSLSALLTAATEGFSLPL  59

Query  4046  GQELHAHALRIGYESNLSVNNALIKFYTRCG-SIKSVMALFERMLVRDAFTWNEMITAYM  3870
             G  +HA +L+ G E +LSV NALI FY   G S++ V+ +F+RM V+D  +W  ++  YM
Sbjct  60    GAAVHALSLKSGLEVDLSVGNALIGFYAEHGDSVEDVVGVFQRMPVKDVISWTGLLNGYM  119

Query  3869  ESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG----------LKAMAFFYRMIKES  3720
             E GLVD A  +FD +PE+N V YNAVL GFCQN EG          L+ +  F +M++  
Sbjct  120   EFGLVDKALGVFDRMPERNFVTYNAVLTGFCQNKEGVRVSFARKAGLQGLGLFRQMLENG  179

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
             +E SD T+T + NAC +  +RK S+Q+H F++K GC  +  I+AAL+DMC +CGR  DA 
Sbjct  180   LEMSDVTMTGVLNACAIAADRKMSEQVHTFVIKCGCGSSPWIDAALIDMCVKCGRSGDAR  239

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET-QLEGLVVVDEVATAtvlgvc  3363
              +F          +A +S+L    ++G+ E A+S F +  +   +  +D     T LGVC
Sbjct  240   MLFQHWRHQESFHIAWSSLLLSSVRDGEYEKALSTFLQMFRSSDIQFIDAFLLTTALGVC  299

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
             G LG  +LG+ +H LA K G L    VGNA++SMY KCG+L+NAV  F+ M  RDL SWN
Sbjct  300   GALGFTELGKQMHVLAAKSGLLRACGVGNAIVSMYGKCGQLENAVTFFQRMPHRDLVSWN  359

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQ  3003
             +L+  ++LHR+GDE  D WS+MERL I PDS T L I+SA   T  +  +     F  M 
Sbjct  360   ALITAHLLHRQGDEIWDIWSQMERLAIKPDSVTFLLIISACSCTDSDSADASMELFRCMS  419

Query  3002  SAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIG  2823
             S Y   PA +H+A +V VLG WG  +EAE+ I +MPF+P + VWR+LL+SC    N ++ 
Sbjct  420   SKYNTEPAMEHFAAVVYVLGCWGHFDEAEQFIASMPFKPGALVWRSLLESCSKQSNMTLR  479

Query  2822  KRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHK  2643
             +R +  +L++EPQDPST++L SNLYS S +W CSE  R EM+EKG  KIP +SW    + 
Sbjct  480   RRAMSHLLALEPQDPSTYVLASNLYSESAKWHCSENTRLEMREKGIHKIPARSWTFYDNA  539

Query  2642  FHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKL  2463
              HSFFARD SH QSKDIY+ LD+L LEC+KAGY PDT++VLH+VEEYQK+ FL +HSAKL
Sbjct  540   IHSFFARDRSHPQSKDIYAGLDVLTLECIKAGYEPDTTFVLHDVEEYQKRHFLMYHSAKL  599

Query  2462  ALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSC  2283
             A TYGLLM   GK +RV+KNI +CGDCH+F + AS  T +EI VRD++GFH F  G CSC
Sbjct  600   AATYGLLMAGSGKIIRVVKNIRMCGDCHSFLEHASAATGKEISVRDSNGFHVFRAGICSC  659

Query  2282  ND  2277
              +
Sbjct  660   RE  661


 Score =   113 bits (283),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 95/395 (24%), Positives = 179/395 (45%), Gaps = 77/395 (19%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R + +  + +S  ALLTA     +L LG  VHAL +K G      V NAL+G Y++ G
Sbjct  31    DMRTADVAVDRFSLSALLTAATEGFSLPLGAAVHALSLKSGLEVDLSVGNALIGFYAEHG  90

Query  4256  -SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDM----------------  4128
              S++ V+ +F  +P +D+ SW  +++G ++  +  +A  +F+ M                
Sbjct  91    DSVEDVVGVFQRMPVKDVISWTGLLNGYMEFGLVDKALGVFDRMPERNFVTYNAVLTGFC  150

Query  4127  QRNDCLRIDY------------------------ITLSTLLNACSECFMRR-GQELHAHA  4023
             Q  + +R+ +                        +T++ +LNAC+    R+  +++H   
Sbjct  151   QNKEGVRVSFARKAGLQGLGLFRQMLENGLEMSDVTMTGVLNACAIAADRKMSEQVHTFV  210

Query  4022  LRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAK  3843
             ++ G  S+  ++ ALI    +CG       LF+    +++F                   
Sbjct  211   IKCGCGSSPWIDAALIDMCVKCGRSGDARMLFQHWRHQESFH------------------  252

Query  3842  ELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES-IEFSD-FTLTSIANACGL  3669
                        + ++++L    ++GE  KA++ F +M + S I+F D F LT+    CG 
Sbjct  253   -----------IAWSSLLLSSVRDGEYEKALSTFLQMFRSSDIQFIDAFLLTTALGVCGA  301

Query  3668  LMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALT  3489
             L   +  KQ+H    KSG      +  A++ M  +CG++E+A   F RMP  H  LV+  
Sbjct  302   LGFTELGKQMHVLAAKSGLLRACGVGNAIVSMYGKCGQLENAVTFFQRMP--HRDLVSWN  359

Query  3488  SMLRGYAQNGQPENAISLFFETQLEGLVVVDEVAT  3384
             +++  +  + Q +    ++  +Q+E L +  +  T
Sbjct  360   ALITAHLLHRQGDEIWDIW--SQMERLAIKPDSVT  392


 Score = 25.8 bits (55),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = -2

Query  4521  DSLSSPAIISGFAKINREIEAVELFYEMR  4435
             D  S   ++SG  ++ R  EA ELF +MR
Sbjct  5     DVSSWNTVLSGLVELGRYEEAFELFGDMR  33


 Score = 67.8 bits (164),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -3

Query  4355  ELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGM  4176
             ELG Q+H L  K G L +  V NA++ +Y KCG L+  +  F  +P RD+ SWN +I+  
Sbjct  306   ELGKQMHVLAAKSGLLRACGVGNAIVSMYGKCGQLENAVTFFQRMPHRDLVSWNALITAH  365

Query  4175  VKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
             +        +++++ M+R   ++ D +T   +++ACS
Sbjct  366   LLHRQGDEIWDIWSQMERL-AIKPDSVTFLLIISACS  401



>ref|XP_011094447.1| PREDICTED: beta-galactosidase 15-like [Sesamum indicum]
Length=831

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/576 (54%), Positives = 389/576 (68%), Gaps = 49/576 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH+L+ S+E +L YG AT
Sbjct  297   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKKLHSLIMSMEKILTYGKAT  356

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DYG MMSSTV+EY G +VCFL NAN++D  +I FEGK+YTTPAWSV+ILPDC   VYN
Sbjct  357   NKDYGGMMSSTVFEYNGTRVCFLGNANNRDAKTINFEGKSYTTPAWSVSILPDCVNVVYN  416

Query  362   TARVNAQTTVMVKKLSEGA-------LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             TA VN Q +VMVKKL   A       L+W +R E I HLK   +N S  L     A QL 
Sbjct  417   TAEVNTQKSVMVKKLPLEAAPKRHYDLEWLWRSEHIEHLKTSVEN-SGPLKGVTYANQLL  475

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQK+  NDT+DYLWYMTS  INE +PI G+E+T+ V     +LH FFN KHIGS+W   +
Sbjct  476   DQKLAANDTSDYLWYMTSVDINEDDPIWGEEVTVSVQCDCQILHVFFNGKHIGSKWVT-N  534

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGMDLS  880
             G++ FLF+R+ KL+   N++SLLS TVGL NYG +F+K   G++GPVKLV PN    DL+
Sbjct  535   GQYNFLFERNAKLKLGTNSLSLLSVTVGLQNYGAHFDKANNGILGPVKLVAPNSLEKDLT  594

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
              N W Y VGL+G+ + L ++D  +K  WH  N   DRMF+WYK T               
Sbjct  595   SNKWAYKVGLNGLERRLQEVDIKHKRKWH-PNVPFDRMFVWYKTT---------------  638

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                FKTP GED VVLDL G+GKG AWVNGH+IGRYWPSF+A  +
Sbjct  639   -------------------FKTPKGEDPVVLDLWGLGKGTAWVNGHDIGRYWPSFVADDN  679

Query  1241  GCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC+  CDYRG Y GSKC+T CGK SQRWYHVPRSFL    +N LVLFEE GG P  + VQ
Sbjct  680   GCVSFCDYRGAYTGSKCLTNCGKSSQRWYHVPRSFLNDE-DNTLVLFEEFGGNPTFISVQ  738

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQ  1597
             TVT+ +  A+  EGN++ELSC+ GR ISK+ F SFG   G+ GS     C + + + V++
Sbjct  739   TVTMKSASAHAYEGNSLELSCQ-GRVISKVNFASFGN--GTYGSLHKGSCHSPNSLSVVK  795

Query  1598  SACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              AC+GKE C++  S+  F  ++C + ++ LAVE  C
Sbjct  796   QACIGKESCSIDASEQTFGPSSCDAPMKSLAVEVQC  831



>ref|XP_010683945.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g03800-like [Beta vulgaris subsp. vulgaris]
Length=488

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/488 (60%), Positives = 371/488 (76%), Gaps = 0/488 (0%)
 Frame = -3

Query  3734  MIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGR  3555
             M+   +E ++ TLTS+ +AC LL E+  S+QIHGF++K G   N CIEAALLDMCTRCGR
Sbjct  1     MVNHGVELTEHTLTSVISACSLLAEKDFSEQIHGFVVKFGFRSNACIEAALLDMCTRCGR  60

Query  3554  MEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtv  3375
             M DAEK+FH+        V  TS++ GYA+N QPE A++LF   Q + ++VVDEV   T+
Sbjct  61    MTDAEKMFHQSKRDQSLSVKWTSLISGYARNAQPEEAMNLFKWGQSQEILVVDEVVATTI  120

Query  3374  lgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDL  3195
             LG+CG LG  ++GE +HC ALK G L DVV+GNA+ISMY+KCG ++ A + F  +  RD+
Sbjct  121   LGICGALGFQEMGEQMHCHALKCGHLYDVVLGNAIISMYSKCGYMEGAXEFFNSLPIRDV  180

Query  3194  CSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFF  3015
              SWN L+AGY+L R+GDE L  W RM+R  I PDS T + I+S++RHT  N+++ C+  F
Sbjct  181   VSWNCLIAGYLLLRQGDEVLAVWLRMKRSHIRPDSITLILIISSFRHTRSNMLHDCRKLF  240

Query  3014  FSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLN  2835
              SM   Y V P SDHYA  VSVLG WG LEEAE+ I  MPFEPK+SVW+ALL +C +H +
Sbjct  241   SSMTREYDVEPTSDHYAAFVSVLGDWGFLEEAEDIILKMPFEPKTSVWQALLRTCDIHSD  300

Query  2834  SSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVI  2655
             S I KR++K+IL+++P+DPSTFIL SNL+SASGRW CSE VR EM++KG +K P +SW++
Sbjct  301   SVIRKRIVKRILAIQPKDPSTFILVSNLFSASGRWHCSENVREEMRKKGIRKHPARSWIV  360

Query  2654  CQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHH  2475
              Q K HSF+ RD +H QSKDIYS L+ILILEC+KAGYVPDTS+VLHEVEE+QKKDFLF+H
Sbjct  361   RQDKVHSFYTRDKNHSQSKDIYSGLEILILECLKAGYVPDTSFVLHEVEEHQKKDFLFYH  420

Query  2474  SAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNG  2295
             SAKLA+TYGLL T  GKP+RV KN+LLCGDCH F K  S VTKREI VRDTSGFHCF +G
Sbjct  421   SAKLAVTYGLLTTMPGKPIRVSKNVLLCGDCHNFCKYMSRVTKREISVRDTSGFHCFSDG  480

Query  2294  KCSCNDRW  2271
             KCSC D W
Sbjct  481   KCSCRDHW  488


 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 134/309 (43%), Gaps = 39/309 (13%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G+E  E++  ++++AC      +   Q+H  ++K G+  +  +  AL+ + ++CG +   
Sbjct  5     GVELTEHTLTSVISACSLLAEKDFSEQIHGFVVKFGFRSNACIEAALLDMCTRCGRMTDA  64

Query  4241  IELFDNLPKRDIA---SWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNA  4071
              ++F    KRD +    W ++ISG  + +    A  LF   Q  + L +D +  +T+L  
Sbjct  65    EKMFHQ-SKRDQSLSVKWTSLISGYARNAQPEEAMNLFKWGQSQEILVVDEVVATTILGI  123

Query  4070  CSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTW  3894
             C    F   G+++H HAL+ G+  ++ + NA+I  Y++CG ++     F  + +RD  +W
Sbjct  124   CGALGFQEMGEQMHCHALKCGHLYDVVLGNAIISMYSKCGYMEGAXEFFNSLPIRDVVSW  183

Query  3893  NEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIE  3714
             N +I                               AG+    +G + +A + RM +  I 
Sbjct  184   NCLI-------------------------------AGYLLLRQGDEVLAVWLRMKRSHIR  212

Query  3713  FSDFTLTSIANACGLL---MERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDA  3543
                 TL  I ++       M     K       +   EP     AA + +    G +E+A
Sbjct  213   PDSITLILIISSFRHTRSNMLHDCRKLFSSMTREYDVEPTSDHYAAFVSVLGDWGFLEEA  272

Query  3542  EKIFHRMPL  3516
             E I  +MP 
Sbjct  273   EDIILKMPF  281



>ref|XP_010245925.1| PREDICTED: beta-galactosidase 15-like [Nelumbo nucifera]
Length=829

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/578 (53%), Positives = 378/578 (65%), Gaps = 53/578 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYIATTYDY+APLDEYGN+NQPKWGHLKELH +L S+E VL +G+ +
Sbjct  295   YHGGTNFGRTAGGPYIATTYDYDAPLDEYGNLNQPKWGHLKELHLVLKSMEKVLTHGDVS  354

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +TD+G  + +T+Y       CFL+NAN   D +ITF+GK YT PAWSV+ILPDCK EVYN
Sbjct  355   HTDFGNFVGATIYATNETSSCFLSNANTTTDATITFQGKQYTIPAWSVSILPDCKKEVYN  414

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+++AQT+VMVKK++       +LKW +RPE I       K         + A  L +Q
Sbjct  415   TAKISAQTSVMVKKVNVAEDQPMSLKWLWRPEQITETALQGKG-------PMVASHLMEQ  467

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K VTND +DYLWYMTS  ++E +PI G +LTL VNT  HVLHA+ N  HIGS+WA+  G 
Sbjct  468   KFVTNDASDYLWYMTSVNMDEKDPIWGTDLTLLVNTTGHVLHAYVNGNHIGSQWAEHGG-  526

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLV-EPNGEGM--DL  877
             F F F++++KL+   N ISLLS TVGL NYG  ++    G++GPV L+ +  GE +  DL
Sbjct  527   FVFAFEKAIKLKPGRNQISLLSATVGLKNYGAMYDLTPTGILGPVALIGKKTGEEIVKDL  586

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S N WT+ VGL+G  K L+  D  +   W   N  T+RM  WYK T              
Sbjct  587   SSNKWTFKVGLNGEEKQLYNEDLSHDSEWKSENXPTNRMMTWYKTT--------------  632

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AWVNG +IGRYWP+FL++ 
Sbjct  633   --------------------FKPPLGTDPVVVDLQGLGKGHAWVNGKSIGRYWPTFLSQQ  672

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC   CDYRG Y  SKCVT CG PSQRWYHVPRSFLR    N L LFEEMGG P  V  
Sbjct  673   DGCSNTCDYRGPYSDSKCVTNCGHPSQRWYHVPRSFLRDD-ENTLTLFEEMGGSPYLVNF  731

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QTVTVG+ CA V+EG T+ELSC+ G+ IS+I+F SFG+P G+CGSF    CDA DI+  +
Sbjct  732   QTVTVGSACATVQEGKTLELSCQSGQTISEIRFASFGDPQGTCGSFVKGSCDAKDILSTV  791

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKI-RRLAVEATC  1705
             Q+ACVGKE C + VS        C   I +RLAVEA C
Sbjct  792   QNACVGKESCCIEVSKNALGAPNCGGNITKRLAVEAVC  829



>ref|XP_010245924.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15-like [Nelumbo 
nucifera]
Length=820

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/578 (53%), Positives = 378/578 (65%), Gaps = 53/578 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYIATTYDY+APLDEYGN+NQPKWGHLKELH +L S+E VL +G+ +
Sbjct  286   YHGGTNFGRTAGGPYIATTYDYDAPLDEYGNLNQPKWGHLKELHLVLKSMEKVLTHGDVS  345

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +TD+G  + +T+Y       CFL+NAN   D +ITF+GK YT PAWSV+ILPDCK EVYN
Sbjct  346   HTDFGNFVGATIYATNETSSCFLSNANTTTDATITFQGKQYTIPAWSVSILPDCKKEVYN  405

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+++AQT+VMVKK++       +LKW +RPE I       K         + A  L +Q
Sbjct  406   TAKISAQTSVMVKKVNAAEDQPMSLKWLWRPEQITETALQGKG-------PMVASHLMEQ  458

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K VTND +DYLWYMTS  ++E +PI G +LTL VNT  HVLHA+ N  HIGS+ A+  G 
Sbjct  459   KFVTNDASDYLWYMTSVNMDEKDPIWGTDLTLLVNTTGHVLHAYVNGNHIGSQRAEHGG-  517

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLV-EPNGEGM--DL  877
             F F F++++KL+   N ISLLS TVGL NYG  ++    G++GPV L+ +  GE +  DL
Sbjct  518   FVFAFEKAIKLKPGRNQISLLSATVGLKNYGAMYDLTPTGILGPVALIGKKTGEEIVKDL  577

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S N WT+ VGL+G  K L+  D  +   W   N  T+RM  WYK T              
Sbjct  578   SSNKWTFKVGLNGEEKQLYNEDLSHDSEWKSENPPTNRMMTWYKTT--------------  623

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AWVNG +IGRYWP+FL++ 
Sbjct  624   --------------------FKPPLGTDPVVVDLQGLGKGHAWVNGKSIGRYWPTFLSQQ  663

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC   CDYRG Y  SKCVT CG PSQRWYHVPRSFLR    N L LFEEMGG P  V  
Sbjct  664   DGCSNTCDYRGPYSDSKCVTNCGHPSQRWYHVPRSFLRDD-ENTLTLFEEMGGSPYLVNF  722

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QTVTVG++CA V+EG T+ELSC+ G+ IS+I+F SFG+P G+CGSF    CDA DI+  +
Sbjct  723   QTVTVGSVCATVQEGKTLELSCQSGQTISEIRFASFGDPQGTCGSFVKGSCDAKDILSTV  782

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKI-RRLAVEATC  1705
             Q+ACVGKE C + VS        C   I +RLAVEA C
Sbjct  783   QNACVGKESCCIEVSKNALGAPNCGGNITKRLAVEAVC  820



>ref|XP_010050189.1| PREDICTED: beta-galactosidase 15-like [Eucalyptus grandis]
Length=832

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/582 (51%), Positives = 378/582 (65%), Gaps = 55/582 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPKWGHLK LH L+ S+E++L +G   
Sbjct  289   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKRLHELIMSMEEILTHGVKR  348

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + DYG MMS TVY YKGK+ CFL NAN   D ++   G +YT PAWSV+ILPDC TEVYN
Sbjct  349   DVDYGNMMSGTVYMYKGKQSCFLGNANQNQDFTVNLMGSSYTVPAWSVSILPDCYTEVYN  408

Query  362   TARVNAQTTVMVKKLSEG-------ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             TA++N+Q TVMVK  +E         L+W +RPE    L +G    S        A +L 
Sbjct  409   TAKINSQQTVMVKLPNEADDQTEPYELQWDWRPEHPESLHHGVAKGS-----VTTANELL  463

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQK VTNDT+DYLWY+TS  +++ + + G+ +TL V+T  H++HAF N KH+GS+W   D
Sbjct  464   DQKTVTNDTSDYLWYLTSLDLSKDDSLAGKAITLHVHTNGHIVHAFVNGKHVGSQWGTSD  523

Query  701   GKFKFLFQRSVKLRK-DINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---  868
                +F+ ++ +KL+    N+ISLLS TVGL NYG  F+ V  G+ GPVKL+   G+    
Sbjct  524   -HLEFIMEKDIKLKHGKTNSISLLSVTVGLQNYGANFDTVNVGIHGPVKLIGNKGQSDEV  582

Query  869   -MDLSKNTWTYMVGLHGISKGLFKLDD-HNKLTWHESNFQTDRMFIWYKVTQSiplitll  1042
              +DLS N WTY VGL+G+ +   +LD+  ++  W   N  ++R+F+WYK T         
Sbjct  583   TVDLSTNLWTYKVGLNGMEEKGLQLDNARHQHGWKSYNLPSNRLFVWYKTT---------  633

Query  1043  dlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPS  1222
                                      FK P G D VV+DL G+GKG AWVNGHNIGR+WPS
Sbjct  634   -------------------------FKAPLGSDPVVVDLQGLGKGTAWVNGHNIGRFWPS  668

Query  1223  FLAKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
             F+A  DGC   CDYRG Y  +KC+T CG PSQRWYH+PRSFL+  G N+LVLFEE GG P
Sbjct  669   FVASEDGCTATCDYRGAYNSNKCLTNCGDPSQRWYHIPRSFLQDDG-NKLVLFEEFGGTP  727

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATD  1579
               VR QT+T GTICA   E   +EL C+GGR +S+IKF SFGEP G CGS+    C+A +
Sbjct  728   LHVRFQTITAGTICATTDEKKQLELLCQGGRIMSEIKFASFGEPTGVCGSYARGSCEAPN  787

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              + VIQ  C+G+E CTL VS+  F  T C   + RLAVEATC
Sbjct  788   TLSVIQKQCLGQESCTLDVSENTFGPTGCHQNVYRLAVEATC  829



>gb|KCW89294.1| hypothetical protein EUGRSUZ_A01583 [Eucalyptus grandis]
Length=837

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/582 (51%), Positives = 378/582 (65%), Gaps = 55/582 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPKWGHLK LH L+ S+E++L +G   
Sbjct  294   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKRLHELIMSMEEILTHGVKR  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + DYG MMS TVY YKGK+ CFL NAN   D ++   G +YT PAWSV+ILPDC TEVYN
Sbjct  354   DVDYGNMMSGTVYMYKGKQSCFLGNANQNQDFTVNLMGSSYTVPAWSVSILPDCYTEVYN  413

Query  362   TARVNAQTTVMVKKLSEG-------ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             TA++N+Q TVMVK  +E         L+W +RPE    L +G    S        A +L 
Sbjct  414   TAKINSQQTVMVKLPNEADDQTEPYELQWDWRPEHPESLHHGVAKGS-----VTTANELL  468

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQK VTNDT+DYLWY+TS  +++ + + G+ +TL V+T  H++HAF N KH+GS+W   D
Sbjct  469   DQKTVTNDTSDYLWYLTSLDLSKDDSLAGKAITLHVHTNGHIVHAFVNGKHVGSQWGTSD  528

Query  701   GKFKFLFQRSVKLRK-DINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---  868
                +F+ ++ +KL+    N+ISLLS TVGL NYG  F+ V  G+ GPVKL+   G+    
Sbjct  529   -HLEFIMEKDIKLKHGKTNSISLLSVTVGLQNYGANFDTVNVGIHGPVKLIGNKGQSDEV  587

Query  869   -MDLSKNTWTYMVGLHGISKGLFKLDD-HNKLTWHESNFQTDRMFIWYKVTQSiplitll  1042
              +DLS N WTY VGL+G+ +   +LD+  ++  W   N  ++R+F+WYK T         
Sbjct  588   TVDLSTNLWTYKVGLNGMEEKGLQLDNARHQHGWKSYNLPSNRLFVWYKTT---------  638

Query  1043  dlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPS  1222
                                      FK P G D VV+DL G+GKG AWVNGHNIGR+WPS
Sbjct  639   -------------------------FKAPLGSDPVVVDLQGLGKGTAWVNGHNIGRFWPS  673

Query  1223  FLAKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
             F+A  DGC   CDYRG Y  +KC+T CG PSQRWYH+PRSFL+  G N+LVLFEE GG P
Sbjct  674   FVASEDGCTATCDYRGAYNSNKCLTNCGDPSQRWYHIPRSFLQDDG-NKLVLFEEFGGTP  732

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATD  1579
               VR QT+T GTICA   E   +EL C+GGR +S+IKF SFGEP G CGS+    C+A +
Sbjct  733   LHVRFQTITAGTICATTDEKKQLELLCQGGRIMSEIKFASFGEPTGVCGSYARGSCEAPN  792

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              + VIQ  C+G+E CTL VS+  F  T C   + RLAVEATC
Sbjct  793   TLSVIQKQCLGQESCTLDVSENTFGPTGCHQNVYRLAVEATC  834



>ref|XP_006583477.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=846

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/582 (50%), Positives = 389/582 (67%), Gaps = 54/582 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPY+ T+YDY+APLDEYGN+NQPKWGHL++LHNLL S E++L  G++ 
Sbjct  294   YHGGTNFKRTAGGPYVTTSYDYDAPLDEYGNLNQPKWGHLRQLHNLLKSKENILTQGSSQ  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTDYG M+++TVY Y GK  CF+ NA+   D +I F    YT PAWSV+ILP+C +E YN
Sbjct  354   NTDYGNMVTATVYTYDGKSTCFIGNAHQSKDATINFRNNEYTIPAWSVSILPNCSSEAYN  413

Query  362   TARVNAQTTVMVKKLSEG---ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKV  532
             TA+VN QTT+MVKK +E    AL+W +R E  + +K G   Q + +ID L A +L DQKV
Sbjct  414   TAKVNTQTTIMVKKDNEDLEYALRWQWRQEPFVQMKDG---QITGIID-LTAPKLLDQKV  469

Query  533   VTNDTTDYLWYMTSFKIN-ESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKF  709
             VTND +DYLWY+TS  I  + +P   +E  L V+T  HVLH F N KH+G++ A+ +G+F
Sbjct  470   VTNDFSDYLWYITSIDIKGDDDPSWTKEFRLRVHTSGHVLHVFVNGKHVGTQHAK-NGQF  528

Query  710   KFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGE--------  865
             KF+ +  +KL    N ISLLS TVGLPNYG +F+ +  GV+GPV+LV   G+        
Sbjct  529   KFVHESKIKLTTGKNEISLLSTTVGLPNYGPFFDNIEVGVLGPVQLVAAVGDYDYDDDEI  588

Query  866   GMDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
               DLSKN W+Y VGLHG  +  +  ++  K TW+     TDR+ +WYK T          
Sbjct  589   VKDLSKNQWSYKVGLHGEHEMHYSYENSLK-TWYTDAVPTDRILVWYKTT----------  637

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     FK+P G+D VV+DL+G+GKG AWVNG++IGRYW S+
Sbjct  638   ------------------------FKSPIGDDPVVVDLSGLGKGHAWVNGNSIGRYWSSY  673

Query  1226  LAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             LA  +GC  +CDYRG Y  +KC++ C +PSQRWYHVPRSFLR    N LVLFEE+GG+P 
Sbjct  674   LADENGCSPKCDYRGPYTSNKCLSMCAQPSQRWYHVPRSFLRDNDQNTLVLFEELGGQPY  733

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDI  1582
              V   TVTVG +CAN  EGNT+EL+C   + IS+IKF SFG P G CGSF+  +C++++ 
Sbjct  734   YVNFLTVTVGKVCANAYEGNTLELACNKNQVISEIKFASFGLPKGECGSFQKGNCESSEA  793

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCK-SKIRRLAVEATC  1705
             +  I++ C+GK+KC++ VS+     T C+ ++ RRLAVEA C
Sbjct  794   LSAIKAQCIGKDKCSIQVSERTLGPTRCRVAEDRRLAVEAVC  835



>ref|XP_003530083.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=846

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/582 (50%), Positives = 390/582 (67%), Gaps = 54/582 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPY+ T+YDY+APLDEYGN+NQPKWGHL++LHNLL S E++L  G++ 
Sbjct  294   YHGGTNFKRTAGGPYVTTSYDYDAPLDEYGNLNQPKWGHLRQLHNLLKSKENILTQGSSQ  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +TDYG M+++TVY Y GK  CF+ NA+   D +I F    YT PAWSV+ILP+C +E YN
Sbjct  354   HTDYGNMVTATVYTYDGKSTCFIGNAHQSKDATINFRNNEYTIPAWSVSILPNCSSEAYN  413

Query  362   TARVNAQTTVMVKKLSEG---ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKV  532
             TA+VN QTT+MVKK +E    AL+W +R E  + +K G   Q + +ID L A +L DQKV
Sbjct  414   TAKVNTQTTIMVKKDNEDLEYALRWQWRQEPFVQMKDG---QITGIID-LTAPKLLDQKV  469

Query  533   VTNDTTDYLWYMTSFKIN-ESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKF  709
             VTND +DYLWY+TS  I  + +P   +E  L V+T  HVLH F N KH+G++ A+ +G+F
Sbjct  470   VTNDFSDYLWYITSIDIKGDDDPSWTKEFRLRVHTSGHVLHVFVNGKHVGTQHAK-NGQF  528

Query  710   KFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGE--------  865
             KF+ +  +KL    N ISLLS TVGLPNYG +F+ +  GV+GPV+LV   G+        
Sbjct  529   KFVHESKIKLTTGKNEISLLSTTVGLPNYGPFFDNIEVGVLGPVQLVAAVGDYDYDDDEI  588

Query  866   GMDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
               DLSKN W+Y VGLHG  +  +  ++  K TW+     TDR+ +WYK T          
Sbjct  589   VKDLSKNQWSYKVGLHGEHEMHYSYENSLK-TWYTDAVPTDRILVWYKTT----------  637

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     FK+P G+D VV+DL+G+GKG AWVNG++IGRYW S+
Sbjct  638   ------------------------FKSPIGDDPVVVDLSGLGKGHAWVNGNSIGRYWSSY  673

Query  1226  LAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             LA  +GC  +CDYRG Y  +KC++ C +PSQRWYHVPRSFLR    N LVLFEE+GG+P 
Sbjct  674   LADENGCSPKCDYRGPYTSNKCLSMCAQPSQRWYHVPRSFLRDDDQNTLVLFEELGGQPY  733

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDI  1582
              V   TVTVG +CAN  EGNT+EL+C   + IS+IKF SFG P G CGSF+  +C++++ 
Sbjct  734   YVNFLTVTVGKVCANAYEGNTLELACNKNQVISEIKFASFGLPKGECGSFQKGNCESSEA  793

Query  1583  IPVIQSACVGKEKCTLHVSD-ALFPTTTCKSKIRRLAVEATC  1705
             +  I++ C+GK+KC++ VS+ AL PT    ++ RRLAVEA C
Sbjct  794   LSAIKAQCIGKDKCSIQVSERALGPTRCRVAEDRRLAVEAVC  835



>ref|XP_010518958.1| PREDICTED: beta-galactosidase 15-like [Tarenaya hassleriana]
Length=821

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/579 (50%), Positives = 372/579 (64%), Gaps = 56/579 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI TTYDYNAPLDE+G +NQPK+GHLK+LH++L+S+E  L +GN T
Sbjct  288   YHGGTNFGRTSGGPYITTTYDYNAPLDEFGQLNQPKYGHLKQLHDVLHSMEKTLTHGNIT  347

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+   +++T+Y  +    CFL NAN   D +I F+G  YT PAWSVT+LPDCKTE YN
Sbjct  348   TVDFDNSVTATIYATEEGSSCFLGNANSSSDATINFQGTEYTVPAWSVTVLPDCKTEAYN  407

Query  362   TARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVK+ +       +L+WS+RPE +       K  S++        QLFDQ
Sbjct  408   TAKVNTQTSVMVKRPNGAEEEPSSLEWSWRPEIMDGAVLRGKGDSAM-------NQLFDQ  460

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K V ND +DYLWYMT   + ES+P+  + +T+ +N+ +HVLH F N +HIGS+WA+ DGK
Sbjct  461   KNVANDESDYLWYMTKVHLKESDPVWSKNMTIRINSTAHVLHVFVNGEHIGSQWAK-DGK  519

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++F+++VK +  +N ISLLS TVG  NYG +FE    G+ GPV++V  NG+     +L
Sbjct  520   YTYMFEQNVKYKPGVNQISLLSTTVGFANYGAFFETGAAGITGPVEIVGWNGDETVVKNL  579

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF  +  +K  W E +   +RM  WYK T              
Sbjct  580   SGHKWSYKTGLDGFQDQLFSSETSSK--WSEESVPFNRMMTWYKTT--------------  623

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G + VV+DL G+GKG AW+NG+NIGRYWPSFLA  
Sbjct  624   --------------------FKAPLGTEPVVVDLLGLGKGTAWINGNNIGRYWPSFLAGE  663

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC   CDYRG+YG  KC T CG+P+QRWYHVPRSFL   G+N LVLFEE+GG P  V  
Sbjct  664   DGCSAVCDYRGSYGSEKCQTNCGQPTQRWYHVPRSFLNSEGDNTLVLFEEIGGNPSLVNF  723

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QTVTVG+ICAN  E NT+ELSC  G+ IS IKF SFG P G CGSFE   C+ + D   +
Sbjct  724   QTVTVGSICANAYEKNTLELSCN-GKPISAIKFASFGNPGGVCGSFEKGTCEGSNDAEAI  782

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKI-RRLAVEATC  1705
             +   CVGKEKC++ VS  +F    C     R+LAVEA C
Sbjct  783   LAKECVGKEKCSIDVSADIFGAADCDGGFARKLAVEAVC  821



>ref|XP_010540711.1| PREDICTED: beta-galactosidase 15 [Tarenaya hassleriana]
Length=822

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/577 (49%), Positives = 368/577 (64%), Gaps = 53/577 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             +HGGTNFGRT+GGPYI TTYDYNAPLDEYGN+NQPK+GHLK+LH++L+S+E  L  G  +
Sbjct  288   FHGGTNFGRTTGGPYITTTYDYNAPLDEYGNLNQPKYGHLKQLHDVLHSMETTLTQGEVS  347

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D+G  +S+T Y  K    CF +NAN   D +I  +G+NYT PAWSVT+LPDCKTE YN
Sbjct  348   NVDFGNSVSATTYATKEASSCFFSNANTSSDATINVQGRNYTIPAWSVTVLPDCKTETYN  407

Query  362   TARVNAQTTVM--VKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVV  535
             TA+VNAQT+VM    K     ++WS+R E +  +    +  ++         +L DQK +
Sbjct  408   TAKVNAQTSVMEKKGKDKAKKMRWSWRLEDVEEMVMKGRGDATF-------SKLVDQKEM  460

Query  536   TNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKF  715
              +D +DYLWYMT   +++++P+LG   +L +N  +HVLH + N +H+GS+WA+ DGKF +
Sbjct  461   ADDQSDYLWYMTKVNLDQNDPVLGNNSSLRINCTAHVLHVYVNGEHVGSQWAK-DGKFNY  519

Query  716   LFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM-----DLS  880
             +F+ +VK    +N ISLLS TVG  NYG +F+    G+ G V++V  NG G      DLS
Sbjct  520   VFEPTVKFIPGVNIISLLSVTVGFQNYGSFFDLAPAGITGSVQIVGRNGAGAETAVKDLS  579

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
                WTY  GL+G     F+  D +   W +SN  T+RM  WYK                 
Sbjct  580   TQAWTYKTGLNGFKNQFFR-SDRSSSGWSKSNVPTNRMMTWYK-----------------  621

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                              T FK P G + VV+DL G+GKG AW+NG+NIGRYWPSFLA  D
Sbjct  622   -----------------TSFKAPYGTEPVVVDLQGLGKGTAWINGNNIGRYWPSFLAGQD  664

Query  1241  GCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC + CDYRG+YG  KC + CG+P+QRWYHVPRSF    G N LVLFEEMGG P  VR Q
Sbjct  665   GCSEVCDYRGSYGSEKCRSNCGQPTQRWYHVPRSFFNPKGKNTLVLFEEMGGNPSLVRFQ  724

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPVI  1594
             TV V T+CANV E N +ELSC  G++IS+IKF SFG P G CGSF    CDA+ D + V+
Sbjct  725   TVAVTTVCANVYENNVLELSCN-GKRISEIKFASFGNPRGECGSFNKDTCDASNDAVAVL  783

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                CVGKE+C+++VS+  F  + C     RLAVEA C
Sbjct  784   TKECVGKERCSVNVSEVKFGASNCGGAANRLAVEAVC  820



>emb|CDY65885.1| BnaCnng48970D [Brassica napus]
Length=821

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/578 (49%), Positives = 372/578 (64%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDE+GN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  289   YHGGTNFGRTAGGPYITTSYDYDAPLDEFGNLNQPKYGHLKQLHDILHSMEKTLTYGNVS  348

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G  +S+T+Y+ +G   CF  N N+  D +I F+G+ Y  P WSV+ILPDCKTEVYN
Sbjct  349   TIDFGNFVSATIYKTEGGSSCFFGNVNESSDATINFQGETYVVPTWSVSILPDCKTEVYN  408

Query  362   TARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++N QT+VMVKK +E       LKWS+RPE I +     + +S++       +QLFDQ
Sbjct  409   TAKINTQTSVMVKKPNEAEDKPINLKWSWRPENIDNFLLKGRGESTM-------RQLFDQ  461

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K+V+ND +DYLWYMT+  + E +P+ G+ + L +N+ +HVLHAF N +H+G+  A+ +GK
Sbjct  462   KIVSNDQSDYLWYMTTLNLKEEDPVWGKNMYLHINSTAHVLHAFVNGQHVGNYHAE-NGK  520

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++  K     N ISLLS TVGLPNYG +FE V  G+ GPV ++  N +     DL
Sbjct  521   FHYVFEQEAKFNPGDNVISLLSITVGLPNYGAFFENVPAGITGPVFIIGKNDDETIVKDL  580

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF  +  +K  W   +   +R   WYK T              
Sbjct  581   SAHKWSYKTGLSGFENQLFSSESQSK--WSGDSVPFNRTMTWYKTT--------------  624

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G + VV+DL G+GKG AW+NG+NIGRYWP FL+  
Sbjct  625   --------------------FKAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPEFLSTE  664

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC  +C+YRG Y   KC T CG+P+QRWYHVPRSFL   G+N LVLFEE+GG P  V  
Sbjct  665   DGCSTECNYRGAYYAEKCQTNCGEPTQRWYHVPRSFLNPKGDNTLVLFEEIGGNPSFVNF  724

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT+ VG +CANV E N +ELSC  GR IS IKF SFG P G CGSFE   C+A  D++ +
Sbjct  725   QTIGVGGVCANVYEKNVLELSCH-GRPISAIKFASFGNPRGKCGSFEKGTCEANKDVVNI  783

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + + CVGKEKC+++VS   F    C    R LAVEA C
Sbjct  784   LSAECVGKEKCSVNVSAEKFGVPECDGATRSLAVEALC  821



>emb|CDY36652.1| BnaA07g04050D [Brassica napus]
Length=621

 Score =   565 bits (1457),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 277/578 (48%), Positives = 372/578 (64%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN++QPK+GHLK+LH++L+++E  L YGN +
Sbjct  89    YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLSQPKYGHLKQLHDVLHTIEKTLTYGNIS  148

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y+ +    CF  N N+  D +I+F+G++Y  PAWSVTILPDCK E YN
Sbjct  149   TIDFGNSASATIYKTEEGSSCFFGNGNENSDATISFQGESYVVPAWSVTILPDCKNEAYN  208

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  209   TAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENMDNFLLKGKGEST-------QTQLFDQ  261

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +P LG+ ++L VN+ +HVLHAF N KHIG++ A++D K
Sbjct  262   KVVTNDQSDYLWYMTTVKFKKRDPFLGKNMSLRVNSTAHVLHAFVNGKHIGNQHAEND-K  320

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   NG+     DL
Sbjct  321   FNYVFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPIFITGRNGDETIVKDL  380

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF+ +  +K  W   +   +R   WYK T              
Sbjct  381   SAHKWSYKTGLIGFESQLFRTESMSK--WSVESVPFNRTMTWYKTT--------------  424

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK+P G D VV+DL G+GKG AWVNG+NIGRYWP+F++  
Sbjct  425   --------------------FKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFISSK  464

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +GC   C+YRG Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEE+GG P  V  
Sbjct  465   NGCDANCNYRGAYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEIGGNPSLVSF  524

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT  VG++CANV E + +ELSC   + IS IKF SFG P G+CGSF    C+++ + + +
Sbjct  525   QTTRVGSLCANVYEKSIIELSCD-RKPISAIKFASFGNPDGNCGSFVKGTCESSNNTVDI  583

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F T  C   +RRLAVEA C
Sbjct  584   LTQECVGKEKCSIDVSTKRFGTPDCSGAVRRLAVEAIC  621



>emb|CDX79397.1| BnaC06g19060D [Brassica napus]
Length=607

 Score =   564 bits (1453),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 278/578 (48%), Positives = 370/578 (64%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF R +GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  75    YHGGTNFDRAAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKTLTYGNIS  134

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               ++G   S+T+Y+ +    CF  N N+K D +I+F+G++Y  PAWSVTILPDCK E YN
Sbjct  135   TIEFGNSASATIYKTEEGSSCFFGNGNEKSDATISFQGESYVVPAWSVTILPDCKNEAYN  194

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  195   TAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENMDNFLLKGKGEST-------QTQLFDQ  247

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +P  G+ ++L VN+ +HVLHAF N KHIG++ A+ +GK
Sbjct  248   KVVTNDQSDYLWYMTTVKFKKRDPFSGKNMSLRVNSTAHVLHAFVNGKHIGNQHAE-NGK  306

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   NG+     DL
Sbjct  307   FNYVFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPIFITGRNGDETIVKDL  366

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF+ +  +K  W   +   +R   WYK T              
Sbjct  367   SAHKWSYKTGLIGFESQLFRTESMSK--WSVESVPFNRTMTWYKTT--------------  410

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK+P G D VV+DL G+GKG AWVNG+NIGRYWP+F++  
Sbjct  411   --------------------FKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFISSE  450

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +GC  +C+YRG Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  
Sbjct  451   NGCDAKCNYRGAYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLVSF  510

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT  VG++CANV E N +ELSC   ++IS IKF SFG P G CGSF    C+++ + + +
Sbjct  511   QTTRVGSVCANVYEKNIIELSCD-RKQISAIKFASFGNPDGDCGSFVKGTCESSNNTVDI  569

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F    C    RRLAVEA C
Sbjct  570   LTQECVGKEKCSIDVSKEKFGAPDCSGAARRLAVEAIC  607



>emb|CDX67790.1| BnaA07g18300D [Brassica napus]
Length=815

 Score =   571 bits (1472),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 373/578 (65%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E +L YGN +
Sbjct  283   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKILTYGNIS  342

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y  K    CF  N N+  D +I+F+G++Y  PAWSVTILPDCK E YN
Sbjct  343   TIDFGNSASATIYRTKEGSSCFFGNGNENSDATISFQGESYVVPAWSVTILPDCKNEAYN  402

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  403   TAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENMDNFLLKGKGEST-------QTQLFDQ  455

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +P LG+ ++L VN+ +HVL AF N KHIG+++A+ +GK
Sbjct  456   KVVTNDQSDYLWYMTTVKFKKRDPFLGKNMSLRVNSTAHVLRAFVNGKHIGNQYAE-NGK  514

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   N +     DL
Sbjct  515   FNYVFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPISITGRNVDETIVKDL  574

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL+G    LF+ +  +K  W   +   +R   WYK T              
Sbjct  575   SAHKWSYKTGLNGFENQLFRTESMSK--WSVESVPFNRTMTWYKAT--------------  618

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AWVNG+NIGRYWP+F++  
Sbjct  619   --------------------FKAPLGNDPVVVDLLGLGKGTAWVNGNNIGRYWPAFISSE  658

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +GC  +C+YRG Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  
Sbjct  659   NGCAAKCNYRGPYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLVSF  718

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT+ VG++CANV E N++ELSC   + IS IKF SFG P G+CGSFE   C+++ + I +
Sbjct  719   QTIRVGSVCANVYEKNSIELSCD-RKPISAIKFASFGNPDGNCGSFEKGTCESSNNTINI  777

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F    C    RRLAVEA C
Sbjct  778   LTQECVGKEKCSIDVSTEKFGAPDCTGSARRLAVEAIC  815



>ref|XP_009119501.1| PREDICTED: beta-galactosidase 15-like [Brassica rapa]
Length=700

 Score =   565 bits (1457),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 280/578 (48%), Positives = 373/578 (65%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN++QPK+GHLK+LH++L+S+E  L YGN +
Sbjct  168   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLSQPKYGHLKQLHDVLHSIEKTLTYGNIS  227

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y+ +    CF  N N+K D +I+F+G++Y  PAWSVTILPDCK E YN
Sbjct  228   TIDFGNSASATIYKTEEGSSCFFGNGNEKSDATISFQGESYVVPAWSVTILPDCKKEAYN  287

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  288   TAKITTQTSMMVKKPNEAENTPSTLKWSWRPENMDNFLLKGKGEST-------QTQLFDQ  340

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +P LG+ ++L VN+ +HVLHAF N KHIGS+ A+ +GK
Sbjct  341   KVVTNDQSDYLWYMTTVKFKKRDPFLGKNMSLRVNSTAHVLHAFVNGKHIGSQHAE-NGK  399

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   NG+     DL
Sbjct  400   FNYVFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPIFITGRNGDETIVKDL  459

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF+ +  +K  W   +   +R  IWYK T              
Sbjct  460   SAHKWSYKTGLIGFESQLFRTESMSK--WSVESVPFNRTMIWYKTT--------------  503

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK+P G D VV+DL G+GKG AWVNG+NIGRYWP+F++  
Sbjct  504   --------------------FKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFISSE  543

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +GC  +C+YRG Y   KC+T CG+P+QRWYHVPR FL   G+N LVLFEE+GG P  V  
Sbjct  544   NGCDAKCNYRGAYHAEKCLTNCGEPTQRWYHVPRFFLNAEGDNTLVLFEEIGGNPSLVSF  603

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT  VG++CANV E + +ELSC   + IS IKF SFG P G+CGSFE   C+++ +   +
Sbjct  604   QTTRVGSLCANVYEKSIIELSCD-RKPISAIKFASFGNPDGNCGSFEKGTCESSKNTADI  662

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F T  C   +R LAVEA C
Sbjct  663   LTQECVGKEKCSIDVSTKRFGTPDCSGAVRSLAVEAIC  700



>emb|CDX79398.1| BnaC06g19050D [Brassica napus]
Length=730

 Score =   565 bits (1455),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 280/578 (48%), Positives = 370/578 (64%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  198   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERTLTYGNIS  257

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               ++G   S+T+YE +    CF  N N+K D +I+F+G++Y  PAWSVTILPDCK E YN
Sbjct  258   TIEFGNSASATIYETEEGSSCFFGNGNEKSDATISFQGESYVVPAWSVTILPDCKNEAYN  317

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  318   TAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENMDNFLLKGKGEST-------QTQLFDQ  370

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +P  G+ ++L VN+ +HVLHAF N KHIG + A+ +GK
Sbjct  371   KVVTNDQSDYLWYMTTVKFKKRDPFSGKNMSLRVNSTAHVLHAFVNGKHIGCQHAE-NGK  429

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   NG+     DL
Sbjct  430   FNYVFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPIFITGRNGDETIVKDL  489

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF+ +  +K  W   +   +R   WYK T              
Sbjct  490   SAHKWSYKTGLIGFESQLFRTESMSK--WSVESVPFNRTMTWYKTT--------------  533

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK+P G D VV+DL G+GKG AWVNG+NIGRYWP+F++  
Sbjct  534   --------------------FKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFISSE  573

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +GC  +C+YRG Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  
Sbjct  574   NGCDAKCNYRGVYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLVSF  633

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT  VG++CANV E N +ELSC   ++IS IKF SFG P G CGSF    C+++ + + +
Sbjct  634   QTTRVGSVCANVYEKNIIELSCD-RKQISAIKFASFGNPDGDCGSFVKGTCESSNNTVDI  692

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F    C    RRLAVEA C
Sbjct  693   LTQECVGKEKCSIDVSTKKFGVPDCSGATRRLAVEAIC  730



>gb|KFK44946.1| hypothetical protein AALP_AA1G323300 [Arabis alpina]
Length=820

 Score =   568 bits (1464),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 368/578 (64%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RTSGGPYI TTYDY+APLDE+GN+NQPK+GHLK+LH++L+S+E  L +GN +
Sbjct  288   YHGGTNFDRTSGGPYITTTYDYDAPLDEFGNLNQPKYGHLKQLHDVLHSMEKTLTHGNIS  347

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D+G + S+T+Y       CF  N N+  D  I F G +Y  PAWSV+ILPDC+TE YN
Sbjct  348   NVDFGNLASATIYTTNEGSSCFFGNVNETSDAIINFNGTSYDVPAWSVSILPDCRTETYN  407

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++N QT+VMVKK +E       LKWS+RPE + ++    K +S++       K+LFDQ
Sbjct  408   TAKINTQTSVMVKKPNEAENEPSTLKWSWRPENVDNVLLKGKGESTM-------KRLFDQ  460

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVV ND +DYLWYMT+  + E +P+ G+ +++ +N+ +HVLHAF N +HIG+ +  D GK
Sbjct  461   KVVGNDESDYLWYMTTVNLKEQDPVWGKNMSIRINSTAHVLHAFVNGEHIGN-YRADSGK  519

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F +++++  K     N I+LLS TVGLPNYG +FE +  G+ GPV ++  NG+     DL
Sbjct  520   FHYVYEQDAKFIPGTNVITLLSTTVGLPNYGAFFESIPTGITGPVFIIGRNGDETVIKDL  579

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G +  LF  +  +K  W   +   +R   WYK T              
Sbjct  580   STHKWSYKTGLSGFTNELFSSESPSK--WSGESVPFNRTMTWYKTT--------------  623

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G + VV+DL G+GKG AW+NG+NIGRYWP+FLA  
Sbjct  624   --------------------FKPPLGNEPVVVDLLGLGKGTAWINGNNIGRYWPAFLAGD  663

Query  1238  DGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +GC  +CDYRG Y   KC T CG+P+QRWYHVPRSFL   G+N LVLFEE+GG P  V  
Sbjct  664   NGCSDECDYRGAYYAEKCQTNCGEPTQRWYHVPRSFLNSEGDNTLVLFEEVGGNPSLVNF  723

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QTV VG++CAN  E N +ELSC  G+ IS IKF SFG P G CGSFE   C+A+ D   +
Sbjct  724   QTVRVGSVCANAYEKNVLELSCH-GKPISDIKFASFGYPGGKCGSFEKGTCEASNDAASI  782

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F    C    RRLAVEA C
Sbjct  783   LTDECVGKEKCSIDVSSEKFGAPECGGAARRLAVEAIC  820



>emb|CDY69031.1| BnaCnng61490D [Brassica napus]
Length=621

 Score =   560 bits (1443),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 277/578 (48%), Positives = 367/578 (63%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  89    YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKTLTYGNIS  148

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y+ +    CF  N N+  D +I+F G++Y  PAWS+TILPDCK E YN
Sbjct  149   TIDFGNSASATIYKTEEGSSCFFGNGNENSDATISFRGESYVVPAWSITILPDCKNEAYN  208

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  209   TAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENMDNFLLKGKGEST-------QTQLFDQ  261

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +P LG+ ++L VN  +HVLHAF N K+IG++ A+ +GK
Sbjct  262   KVVTNDQSDYLWYMTTVKFKKRDPFLGKNMSLRVNCTAHVLHAFVNGKYIGNQHAE-NGK  320

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   N +     DL
Sbjct  321   FNYIFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPISITGRNVDETIVKDL  380

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL+G    LF+ +  +K  W   +   +R   WYK T              
Sbjct  381   SAHKWSYKTGLNGFENQLFRTESMSK--WSVESVPFNRTMTWYKAT--------------  424

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 F  P G D VV+DL G+GKG AWVNG+NIGRYWP+F++  
Sbjct  425   --------------------FNAPLGNDPVVVDLLGLGKGTAWVNGNNIGRYWPAFISSE  464

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +GC  +C+YRG Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  
Sbjct  465   NGCAAKCNYRGPYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLVNF  524

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT  VG++CANV E NT+ELSC   + IS IKF SFG P G+CGSFE   C+++ + + +
Sbjct  525   QTTRVGSVCANVYEKNTIELSCD-RKPISAIKFASFGNPDGNCGSFEKGTCESSNNTVDI  583

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC + VS   F    C    RRL VEA C
Sbjct  584   LTQECVGKEKCFIDVSTEKFGAPDCTGSARRLVVEAIC  621



>ref|XP_006306017.1| hypothetical protein CARUB_v10011312mg, partial [Capsella rubella]
 gb|EOA38915.1| hypothetical protein CARUB_v10011312mg, partial [Capsella rubella]
Length=805

 Score =   565 bits (1455),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 277/578 (48%), Positives = 370/578 (64%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RTSGGPYI T+YDY+APLDEYGN+ QPK+GHLK+LH++L+S+E  L +GN T
Sbjct  273   YHGGTNFDRTSGGPYITTSYDYDAPLDEYGNLAQPKYGHLKQLHDVLHSMEKTLTHGNIT  332

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D+G  +S+T+Y+ +    CF+ N N+  D  I F+G +Y  P WSV+ILPDCKT  YN
Sbjct  333   NIDFGNQVSATIYKTEEGSSCFIGNVNETSDARINFQGTSYDVPPWSVSILPDCKTVTYN  392

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++N QT+VMVKK +E       LKWS+RPE + ++    K +S++       +QLFDQ
Sbjct  393   TAKINTQTSVMVKKPNEAEDEPSTLKWSWRPENVDNVLLKGKGESTM-------RQLFDQ  445

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVV+ND +DYLWYMT+  + E +P+  + +++ VN+ +HVLHAF N +HIG+ +  +DGK
Sbjct  446   KVVSNDQSDYLWYMTTVNLKEQDPVWSKNMSIRVNSTAHVLHAFVNGQHIGN-YRVEDGK  504

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++  K     N I+ LS TVGLPNYG +FE +  G+ GPV ++  NG+     DL
Sbjct  505   FHYVFEQDAKFNPGANVITFLSITVGLPNYGAFFENIPAGITGPVFIIGRNGDETIVKDL  564

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF  +  +  TW   +   +R   WYK T              
Sbjct  565   SAHKWSYKTGLSGFENQLFSAESPS--TWSGESVPINRTMTWYKTT--------------  608

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G + VV+DL G+GKG AW+NG+NIGRYWPSFL+  
Sbjct  609   --------------------FKAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPSFLSGI  648

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC  +C+Y+G Y   KC T CG+P+QRWYH+PRSFL   G+N LVLFEE+GG P  V  
Sbjct  649   DGCPAECNYKGAYYAEKCQTNCGEPTQRWYHIPRSFLNSDGDNTLVLFEEIGGNPSLVNF  708

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT+ VG++CANV E N +ELSC  G+ IS IKF SFG P G+CGSFE   C+A+ +   +
Sbjct  709   QTIGVGSVCANVYEKNVLELSCN-GKPISAIKFASFGNPGGNCGSFEKGTCEASNNAAAI  767

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F    C    RRLAVEA C
Sbjct  768   LTQECVGKEKCSIDVSQEKFGAPECGGDARRLAVEAIC  805



>ref|XP_010999621.1| PREDICTED: beta-galactosidase 15-like [Populus euphratica]
Length=823

 Score =   565 bits (1455),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 373/582 (64%), Gaps = 63/582 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+NQPKWGHLKELH++L+S+ED L  GN +
Sbjct  291   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKELHDVLHSMEDTLTRGNIS  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + D+G  +S T+Y  +    CFL N + ++D +I F+G +Y  PAWSV+ILPDC+  VYN
Sbjct  351   SVDFGNSVSGTIYSTEKGSSCFLTNTDSRNDTTINFQGIDYEVPAWSVSILPDCQDVVYN  410

Query  362   TARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLI--DALDAKQLF  520
             TA+V+AQT+VMVKK +       AL WS+RPET         N  S+L     +   Q+ 
Sbjct  411   TAKVSAQTSVMVKKKNVAEDEPAALSWSWRPET---------NDKSILFGKGEVSVNQIL  461

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQK   ND +DYL+YMTS  + E +PI G  +TL +     VLH F N + IGS+WA+  
Sbjct  462   DQKDAGNDQSDYLFYMTSVSLKEDDPIWGDNMTLRITGSGQVLHVFVNGEFIGSQWAK-Y  520

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---  871
             G F ++F++ +KL K  NTI+LLS TVG  NYG  F+    GV GPV+LV  + + +   
Sbjct  521   GVFDYVFEQKIKLNKGKNTITLLSATVGFANYGANFDLTQAGVRGPVELVGYHDDEIIIK  580

Query  872   DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             DLS + W+Y VGL G+ + L+  D      W + N+ T++MF WYK T            
Sbjct  581   DLSSHKWSYKVGLEGLHQNLYSSDSSK---WQQDNYPTNKMFTWYKAT------------  625

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   FK P G D VV+DL G+GKG+AWVNG++IGRYWPSF+A
Sbjct  626   ----------------------FKAPLGTDPVVVDLLGLGKGLAWVNGNSIGRYWPSFIA  663

Query  1232  KSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             + DGC    CDYRG+Y  +KCVT CGKP+QRWYHVPRSFL   G+N LVLFEE GG P  
Sbjct  664   E-DGCSLDPCDYRGSYDNNKCVTNCGKPTQRWYHVPRSFLNNEGDNTLVLFEEFGGDPSS  722

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DI  1582
             V  QT+ +G+ C    E   +ELSC+ GR+IS IKF SFG P+G+CGSF    C+A+ D 
Sbjct  723   VNFQTIAIGSACVGAEENKKIELSCQ-GRQISAIKFASFGNPLGTCGSFSKGTCEASNDA  781

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCKSK-IRRLAVEATC  1705
               +IQ ACVG+E CT+ VS+  F +TTC    I+ LAVEA C
Sbjct  782   FSIIQKACVGQESCTIDVSEDTFGSTTCGDDVIKTLAVEAIC  823



>emb|CAJ09953.1| beta-galactosidase [Mangifera indica]
Length=827

 Score =   563 bits (1452),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 291/581 (50%), Positives = 364/581 (63%), Gaps = 58/581 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPY+ T+YDY+APLDE+GN+NQPKWGHLKELH +L ++E  L +GN +
Sbjct  292   YHGGTNFGRTSGGPYLTTSYDYDAPLDEFGNLNQPKWGHLKELHTVLKAMEKTLTHGNVS  351

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD+G  +++TVY  +    CF  NAN   D +ITF+G +Y  PAWSV+ILPDCKTE YN
Sbjct  352   TTDFGNSVTATVYATEEGSSCFFGNANTTGDATITFQGSDYVVPAWSVSILPDCKTEAYN  411

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+V+VKK ++      +LKW +RPE I       K        +  A  L DQ
Sbjct  412   TAKVNTQTSVIVKKPNQAENEPSSLKWVWRPEAIDEPVVQGKG-------SFSASFLIDQ  464

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KV+ ND +DYLWYMTS  +   + I    +TL VNT   VLHAF N +H+GS+W +  G 
Sbjct  465   KVI-NDASDYLWYMTSVDLKPDDIIWSDNMTLRVNTTGIVLHAFVNGEHVGSQWTK-YGV  522

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             FK +FQ+ VKL    N ISLLS TVGL NYG  F+ V  G+ GPV+L+   G+     DL
Sbjct  523   FKDVFQQQVKLNPGKNQISLLSVTVGLQNYGPMFDMVQAGITGPVELIGQKGDETVIKDL  582

Query  878   SKNTWTYMVGLHGISKGLF--KLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             S + WTY VGL G+    F  K   +    W   N  ++    WYK T            
Sbjct  583   SCHKWTYEVGLTGLEDNKFYSKASTNETCGWSAENVPSNSKMTWYKTT------------  630

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   FK P G D VVLDL GMGKG AWVNG+N+GRYWPS+LA
Sbjct  631   ----------------------FKAPLGNDPVVLDLQGMGKGFAWVNGYNLGRYWPSYLA  668

Query  1232  KSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             ++DGC    CDYRG Y  +KCVT CG+PSQRWYHVPRSFL+  G N LVLFEE GG P +
Sbjct  669   EADGCSSDPCDYRGQYDNNKCVTNCGQPSQRWYHVPRSFLQD-GENTLVLFEEFGGNPWQ  727

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDI  1582
             V  QT+ VG++C N  E  T+ELSC  GR IS IKF SFG+P G+CGSF+   C    DI
Sbjct  728   VNFQTLVVGSVCGNAHEKKTLELSCN-GRPISAIKFASFGDPQGTCGSFQAGTCQTEQDI  786

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +PV+Q  CVGKE C++ +S+     T C S +++LAVEA C
Sbjct  787   LPVLQQECVGKETCSIDISEDKLGKTNCGSVVKKLAVEAVC  827



>ref|XP_011000544.1| PREDICTED: beta-galactosidase 15-like [Populus euphratica]
Length=823

 Score =   563 bits (1452),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 372/582 (64%), Gaps = 63/582 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+NQPKWGHLKELH++L+S+ED L  GN +
Sbjct  291   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKELHDVLHSMEDTLTRGNIS  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + D+G  +S T+Y  +    CFL N + ++D +I F+G +Y  PAWSV+ILPDC+  VYN
Sbjct  351   SVDFGNSVSGTIYSTEKGSSCFLTNTDSRNDTTINFQGIDYEVPAWSVSILPDCQDVVYN  410

Query  362   TARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLI--DALDAKQLF  520
             TA+V+AQT+VMVKK +       AL WS+RPET         N  S+L     +   Q+ 
Sbjct  411   TAKVSAQTSVMVKKKNVAEDEPAALSWSWRPET---------NDKSILFGKGEVSVNQIL  461

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQK   ND +DYL+YMTS  + E +PI G  +TL +     VLH F N + IGS+WA+  
Sbjct  462   DQKDAGNDQSDYLFYMTSVSLKEDDPIWGDNMTLRITGSGQVLHVFVNGEFIGSQWAK-Y  520

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---  871
             G F ++F++ +KL K  NTI+LLS TVG  NYG  F+    GV GPV+LV  + + +   
Sbjct  521   GVFDYVFEQKIKLNKGKNTITLLSATVGFANYGANFDLTQAGVRGPVELVGYHDDEIIIK  580

Query  872   DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             DLS + W+Y VGL G+ + L+  D      W + N+ T++MF WYK T            
Sbjct  581   DLSSHKWSYKVGLEGLHQNLYSSDSSK---WQQDNYPTNKMFTWYKAT------------  625

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   FK P G D VV+DL G+GKG+AWVNG++IGRYWPSF+A
Sbjct  626   ----------------------FKAPLGTDPVVVDLLGLGKGLAWVNGNSIGRYWPSFIA  663

Query  1232  KSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             + DGC    CDYRG+Y  +KCVT CGKP+QRWYHVPRSFL   G+N LVLFEE GG P  
Sbjct  664   E-DGCGLDPCDYRGSYDNNKCVTNCGKPTQRWYHVPRSFLNNEGDNTLVLFEEFGGDPSS  722

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DI  1582
             V  QT+ +G+ C    E   +ELSC+ GR IS IKF SFG P+G+CGSF    C+A+ D 
Sbjct  723   VNFQTIAIGSACVGAEENKKIELSCQ-GRPISAIKFASFGNPLGTCGSFSKGTCEASNDA  781

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCKSK-IRRLAVEATC  1705
               +IQ ACVG+E CT+ VS+  F +TTC    I+ LAVEA C
Sbjct  782   FSIIQKACVGQESCTIDVSEDTFGSTTCGDDVIKTLAVEAIC  823



>ref|XP_009359758.1| PREDICTED: beta-galactosidase 15 [Pyrus x bretschneideri]
Length=854

 Score =   563 bits (1452),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 286/578 (49%), Positives = 363/578 (63%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+   YI TTYDY+APLDEYG +NQPKWGHLKELH +L S+E  L +GN T
Sbjct  322   YHGGTNFGRTAAA-YITTTYDYDAPLDEYGKLNQPKWGHLKELHQILKSMEYTLTHGNVT  380

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              T++   +S+TVY       CFL NAN   D +ITFEG  YT PAWSV+ILPDCKTE YN
Sbjct  381   TTNFDNSVSATVYATNESSSCFLGNANSTTDATITFEGNTYTIPAWSVSILPDCKTEGYN  440

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QTTV VK +++      +L WS+RPETI   +   K +       + A QL DQ
Sbjct  441   TAKVNTQTTVKVKVVNKAEDEPESLAWSWRPETIDDTRVLAKGE-------ITANQLLDQ  493

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KV  +D +DYLWYMTS  + + +PI  + +TL VN    +LHA+ N K++GS+WAQ +  
Sbjct  494   KVAGDDASDYLWYMTSVHLKKDDPIWSKNMTLRVNGTGFILHAYVNGKYVGSQWAQYN-V  552

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++F++SVKL    N ISLLS TVG PNYG  FE++  G+ GPV LV  NG+ +   DL
Sbjct  553   YNYVFEKSVKLLPGKNIISLLSATVGFPNYGGGFEEIKTGISGPVVLVGQNGDEIVIKDL  612

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGLHG+   LF  D      W   N   +RM  WYK T              
Sbjct  613   SAHKWSYKVGLHGLKNKLFSTDSRYATKWSTENLPVNRMLTWYKAT--------------  658

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AW+NGH+IGRYWPS+L+  
Sbjct  659   --------------------FKAPLGTDPVVVDLQGLGKGHAWINGHSIGRYWPSYLSYD  698

Query  1238  DGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
               C    CDYRG+Y  +KC   CG P+QRWYHVPRSF+ + G N +VLFEE GG P  V 
Sbjct  699   TDCSLDACDYRGSYDNNKCSFNCGNPTQRWYHVPRSFM-EDGENTIVLFEEFGGNPSLVN  757

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
              QT+ VGT+CA+  E +T+EL+C  GR IS IKF SFG P G+CGSFE   CD+   + +
Sbjct  758   FQTIQVGTVCAHAYEKHTVELACE-GRPISAIKFASFGNPRGTCGSFEKGSCDSGSALSI  816

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++  CVGKEKC ++VS + F  T C   ++RLAVEA C
Sbjct  817   LKKECVGKEKCLINVSQSKFGLTNCGDAVKRLAVEAVC  854



>emb|CDX93659.1| BnaA06g03890D [Brassica napus]
Length=818

 Score =   562 bits (1448),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 280/578 (48%), Positives = 368/578 (64%), Gaps = 56/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  287   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKKLHDVLHSMEKTLTYGNIS  346

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G+  S+T+Y       CF  N N+  D  I+F+GK+Y  PAWSVTILPDCKTE YN
Sbjct  347   TIDFGKSASATIYTTGEGSSCFFGNGNENSDAKISFQGKSYVVPAWSVTILPDCKTEAYN  406

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  Q ++MVKK +E       LKWS+RPE +       K +S+         QL DQ
Sbjct  407   TAKITTQISMMVKKPNEAEDDPSTLKWSWRPENMDDFLLKGKGEST-------KTQLVDQ  459

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVV+ND +DYLWYMT+ K  + + +LG+ +TL +N+ +HVLHAF N KHIG++ A+ +GK
Sbjct  460   KVVSNDQSDYLWYMTTVKFRKRDLVLGKNMTLRINSTAHVLHAFVNGKHIGNQHAE-NGK  518

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++  K +   N ISLLS TVGL NYG +FE V  G+ GP+ ++  N +     DL
Sbjct  519   FHYVFEKDAKFKSGRNVISLLSITVGLQNYGSFFESVPTGITGPISIIGRNSDETIVKDL  578

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL+G    LF+ +  +K  W   +   +R   WYK T              
Sbjct  579   SAHKWSYKTGLNGFENQLFRTESPSK--WSAESVPLNRSMTWYKAT--------------  622

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AWVNG+NIGRYWP+F++  
Sbjct  623   --------------------FKAPFGNDPVVVDLLGLGKGTAWVNGNNIGRYWPAFISSG  662

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC ++C+YRG Y   KC+TGCG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  
Sbjct  663   DGCSVKCNYRGAYHAEKCLTGCGEPTQRWYHVPRSFL-NAGDNTLVLFEEMGGNPSLVNF  721

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPV  1591
             QT  VG++CANV E N +ELSC   + IS IKF SFG P G+CGSFE   C+   + + +
Sbjct  722   QTTRVGSVCANVYEKNVIELSCD-RKPISAIKFASFGNPNGNCGSFEKGTCEEINNAVDI  780

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS   F    C    RRLA+EA C
Sbjct  781   LTQECVGKEKCSIDVSTEKFGAPDCGGAARRLAIEAIC  818



>ref|XP_003533125.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=832

 Score =   562 bits (1448),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 371/582 (64%), Gaps = 58/582 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APLDEYGN NQPKWGHLK+LH LL S+EDVL  G   
Sbjct  288   YHGGTNFGRTSGGPYITTSYDYDAPLDEYGNKNQPKWGHLKQLHELLKSMEDVLTQGTTN  347

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +TDYG ++++TVY Y GK  CFL NAN  +D +I F+   Y  PAWSV+ILP+C  EVYN
Sbjct  348   HTDYGNLLTATVYNYSGKSACFLGNANSSNDATIMFQSTQYIVPAWSVSILPNCVNEVYN  407

Query  362   TARVNAQTTVMVKKLSE--------GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
             TA++NAQT++MV K ++          L W +  E  + +K G    S     +  A QL
Sbjct  408   TAKINAQTSIMVMKDNKSDNEEEPHSTLNWQWMHEPHVQMKDGQVLGSV----SRKAAQL  463

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQKVVTNDT+DYLWY+TS  I+E++PI  +   + V+T  HVLH F N    G ++ Q 
Sbjct  464   LDQKVVTNDTSDYLWYITSVDISENDPIWSK---IRVSTNGHVLHVFVNGAQAGYQYGQ-  519

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLV--EPNGEGM  871
             +GK+ F ++  +KL+K  N ISLLS TVGLPNYG +F  V  GV GPV+LV  + N E +
Sbjct  520   NGKYSFTYEAKIKLKKGTNEISLLSGTVGLPNYGAHFSNVSVGVCGPVQLVALQNNTEVV  579

Query  872   -DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              D++ NTW Y VGLHG    L+   ++NK  W+ +   T+R+F+WYK             
Sbjct  580   KDITNNTWNYKVGLHGEIVKLY-CPENNK-GWNTNGLPTNRVFVWYK-------------  624

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                  T FK+P G D VV+DL G+ KG AWVNG+NIGRYW  +L
Sbjct  625   ---------------------TLFKSPKGTDPVVVDLKGLKKGQAWVNGNNIGRYWTRYL  663

Query  1229  AKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             A  +GC   C+YRG Y   KC+T CG+P+QRWYHVPRSFLR+   N LVLFEE GG P E
Sbjct  664   ADDNGCTATCNYRGPYSSDKCITKCGRPTQRWYHVPRSFLRQDNQNTLVLFEEFGGHPNE  723

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDII  1585
             V+  TV V  ICAN  EGN +ELSCR  + ISKIKF SFG P G CGSF+ S C++ + +
Sbjct  724   VKFATVMVEKICANSYEGNVLELSCREEQVISKIKFASFGVPEGECGSFKKSQCESPNAL  783

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCK--SKIRRLAVEATC  1705
              ++  +C+GK+ C++ VS  +   T C+      +LA+EA C
Sbjct  784   SILSKSCLGKQSCSVQVSQRMLGPTGCRMPQNQNKLAIEAVC  825



>gb|KHN07882.1| Beta-galactosidase 7 [Glycine soja]
Length=747

 Score =   559 bits (1440),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 292/583 (50%), Positives = 363/583 (62%), Gaps = 62/583 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+ QPKWGHLKELHN+L S+E+ L  GN +
Sbjct  212   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNIAQPKWGHLKELHNVLKSMEETLTSGNVS  271

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD+G  + +T+Y   G   CFL++ N   D ++TF GKNYT PAWSV+ILPDC+ E YN
Sbjct  272   ETDFGNSVKATIYATNGSSSCFLSSTNTTTDATLTFRGKNYTVPAWSVSILPDCEHEEYN  331

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVK+ S+      ALKW +R E I +  +G  N S        A +L DQ
Sbjct  332   TAKVNVQTSVMVKENSKAEEEATALKWVWRSENIDNALHGKSNVS--------ANRLLDQ  383

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMT   +   +P+ G+ +TL +N   HV+HAF N +HIGS WA   G 
Sbjct  384   KDAANDASDYLWYMTKLHVKHDDPVWGENMTLRINGSGHVIHAFVNGEHIGSHWAT-YGI  442

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
                 F+  +KL+   NTISLLS TVGL NYG +F+    G++ P++LV   G+     +L
Sbjct  443   HNDKFEPKIKLKHGTNTISLLSVTVGLQNYGAFFDTWHAGLVEPIELVSVKGDETIIKNL  502

Query  878   SKNTWTYMVGLHGISKGLFKLDD----HNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
             S N W+Y VGLHG    LF  D      NK  W      TDRM  WYK T          
Sbjct  503   SSNKWSYKVGLHGWDHKLFSDDSPFAAPNK--WESEKLPTDRMLTWYKTT----------  550

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     F  P G D VV+DL GMGKG AWVNG NIGR WPS+
Sbjct  551   ------------------------FNAPLGTDPVVVDLQGMGKGYAWVNGQNIGRIWPSY  586

Query  1226  LAKSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
              A+ DGC    CDYRG Y  SKCVT CGKP+QRWYHVPRS+L K G N LVLF E+GG P
Sbjct  587   NAEEDGCSDEPCDYRGEYTDSKCVTNCGKPTQRWYHVPRSYL-KDGANNLVLFAELGGNP  645

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-T  1576
              +V  QTV VGT+CAN  E  T+ELSC+ GRKIS IKF SFG+P G CG+F    C++ +
Sbjct  646   SQVNFQTVVVGTVCANAYENKTLELSCQ-GRKISAIKFASFGDPEGVCGAFTNGSCESKS  704

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + + ++Q ACVGK+ C+  VS+  F  T C +  +RLAVEA C
Sbjct  705   NALSIVQKACVGKQACSFDVSEKTFGPTACGNVAKRLAVEAVC  747



>ref|XP_009620959.1| PREDICTED: beta-galactosidase 15-like [Nicotiana tomentosiformis]
Length=825

 Score =   560 bits (1444),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 284/580 (49%), Positives = 373/580 (64%), Gaps = 57/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI TTYDYNAPLDE+GN+ QPK+GHLKELH++L+S+E  L  GN T
Sbjct  291   YHGGTNFGRTSGGPYITTTYDYNAPLDEFGNLAQPKYGHLKELHDVLHSMEKTLTSGNIT  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N+D G  ++ T+Y   G+  CF +NAN+  D +IT++G  Y  PAWSV+ILPDCKTEVYN
Sbjct  351   NSDLGNSVAVTIYALDGQSSCFFSNANETTDATITYQGVQYNVPAWSVSILPDCKTEVYN  410

Query  362   TARVNAQTTVMVKKLSE-----GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVKK ++      +L+WS+RPE +       + QSS       A +L DQ
Sbjct  411   TAKVNTQTSVMVKKSNDAENEPASLQWSWRPEKVDEAVVLGRGQSS-------AHELVDQ  463

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KV  ND +DY+WYMT+  I +++PI    +TL VN   H+LHA+ N +++GS+WA   G 
Sbjct  464   KVA-NDVSDYMWYMTNVYIGKNDPIWSDNMTLRVNGSGHILHAYVNGQYLGSQWAT-YGI  521

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VKL    N ISLLS T+GL NYG +F+ V  G+ GPV+++  NG+     DL
Sbjct  522   FNYVFEKQVKLNPGRNHISLLSATIGLQNYGAHFDTVQSGIPGPVEIIGKNGDESVIKDL  581

Query  878   SKNTWTYMVGLHGISKGLFKLDDH-NKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             S + W+Y V L+GI+  LF  +       W   +   +RM  WYK T             
Sbjct  582   SSHKWSYKVDLNGINNKLFSGNPKFENGQWFSQDVPINRMMTWYKTT-------------  628

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  FK P G D VV+DL G+GKG AW+NG +IGRYWPS+LA+
Sbjct  629   ---------------------FKAPLGNDPVVVDLQGLGKGHAWINGESIGRYWPSYLAE  667

Query  1235  SDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEV  1408
              +GC    CDYRG YG  KC +GCG+P+QRWYHVPRSFL K+  N LVLFEE GG P  V
Sbjct  668   EEGCSTDLCDYRGKYGPDKCASGCGEPTQRWYHVPRSFL-KSDENTLVLFEEFGGNPSLV  726

Query  1409  RVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDII  1585
               QTV VGT C +  E  TMELSC  GR I+ I+F +FGE  G CGSF+   C +  D++
Sbjct  727   NFQTVQVGTACGSAYENKTMELSCN-GRPITAIRFANFGETEGICGSFDKGSCSSENDVV  785

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              +I+ ACVGKEKC++  S+++F +T C +  +RL VEA C
Sbjct  786   SIIEKACVGKEKCSVPASESVFGSTNCGNNAKRLIVEAVC  825



>ref|XP_010499714.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15-like [Camelina 
sativa]
Length=820

 Score =   560 bits (1442),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 277/578 (48%), Positives = 370/578 (64%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RTSGGPYI TTYDY+APLDEYG+++QPK+GHLK+LH++L+++E  L +GN T
Sbjct  288   YHGGTNFDRTSGGPYITTTYDYDAPLDEYGHLSQPKYGHLKQLHDVLHAMEKTLTHGNVT  347

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G ++++T+Y+ +    CF+ N N+  D  I F+G +Y  P WSV+ILPDCKT  YN
Sbjct  348   TIDFGNLVTATIYKTEEGSSCFIGNVNETSDARINFQGTSYDVPPWSVSILPDCKTVTYN  407

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++N QT+VMVKK +E       LKWS+RPE I ++    K +S++        +LFDQ
Sbjct  408   TAKINTQTSVMVKKPNEAEDEPSTLKWSWRPENIDNVLLKGKGESTM-------SKLFDQ  460

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVV+ND +DYLWYMT+  + E +P+  + ++L +N+ +HVLHAF N +HIG+ +  +DGK
Sbjct  461   KVVSNDESDYLWYMTTVNLKEQDPVWCKNMSLRINSTAHVLHAFVNGQHIGN-YRVEDGK  519

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++  K     N I+LLS TVGLPNYG +FE V  G+ GPV ++  NG+     DL
Sbjct  520   FHYVFEQDAKFNPGANVITLLSITVGLPNYGAFFENVPAGITGPVFIIGRNGDETIVKDL  579

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL G    LF  +  +  TW   +   +R   WYK                
Sbjct  580   SAHKWSYKTGLSGFENQLFSTESPS--TWSGESVPFNRTMTWYK----------------  621

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FK P G + VV+DL G+GKG AW+NG+NIGRYWPSFLA  
Sbjct  622   ------------------TAFKAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPSFLADI  663

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC  +C+Y G Y   KC T CG+P+QRWYHVPRSFL   G+N LVLFEE+GG P  V  
Sbjct  664   DGCSAECNYIGTYYAEKCQTNCGEPTQRWYHVPRSFLNSEGDNMLVLFEEIGGNPSLVNF  723

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT+ VG +CANV E N +ELSC  G+ IS IKF SFG P G+CG FE   C+A+ D   +
Sbjct  724   QTIGVGXVCANVYEKNVLELSCD-GKPISAIKFASFGNPGGNCGYFEKGTCEASNDAAAI  782

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   CVGKEKC++ VS+  F    C   ++RLAVEA C
Sbjct  783   LTKECVGKEKCSIDVSEEKFGAPKCGGAVKRLAVEAVC  820



>gb|KHN27597.1| Beta-galactosidase [Glycine soja]
Length=832

 Score =   560 bits (1443),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 286/582 (49%), Positives = 371/582 (64%), Gaps = 58/582 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APLDEYGN NQPKWGHLK+LH LL S+EDVL  G   
Sbjct  288   YHGGTNFGRTSGGPYITTSYDYDAPLDEYGNKNQPKWGHLKQLHELLKSMEDVLTQGTTN  347

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +TDYG ++++TVY Y GK  CFL NAN  +D +I F+   Y  PAWSV+ILP+C  EVYN
Sbjct  348   HTDYGNLLTATVYNYSGKSACFLGNANSSNDATIMFQSTQYIVPAWSVSILPNCVNEVYN  407

Query  362   TARVNAQTTVMVKKLSE--------GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
             TA++NAQT++MV K ++          L W +  E  + +K G    S     +  A QL
Sbjct  408   TAKINAQTSIMVMKDNKSDNEEEPHSTLNWQWMHEPHVQMKDGQVLGSV----SRKAAQL  463

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQKVVTNDT+DYLWY+TS  I+E++PI  +   + V+T  HVLH F N    G ++ Q 
Sbjct  464   LDQKVVTNDTSDYLWYITSVDISENDPIWSK---IRVSTNGHVLHVFVNGAQAGYQYGQ-  519

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLV--EPNGEGM  871
             +GK+ F ++  +KL+K  N ISLLS TVGLPNYG +F  V  GV GPV+LV  + N E +
Sbjct  520   NGKYSFTYEAKIKLKKGTNEISLLSGTVGLPNYGAHFSNVSVGVCGPVQLVTLQNNTEVV  579

Query  872   -DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              D++ NTW Y VGLHG    L+   ++NK  W+ +   T+R+F+WYK             
Sbjct  580   KDITNNTWNYKVGLHGEIVKLY-CPENNK-GWNTNGLPTNRVFVWYK-------------  624

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                  T FK+P G D VV+DL G+ KG AWVNG+NIGRYW  +L
Sbjct  625   ---------------------TLFKSPKGTDPVVVDLRGLKKGQAWVNGNNIGRYWTRYL  663

Query  1229  AKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             A  +GC   C+YRG Y   KC+T CG+P+QRWYHVPRSFLR+   N LVLFEE GG P E
Sbjct  664   ADDNGCTATCNYRGPYSSDKCITKCGRPTQRWYHVPRSFLRQDNQNTLVLFEEFGGHPNE  723

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDII  1585
             V+  TV V  ICAN  EGN +ELSCR  + IS+IKF SFG P G CGSF+ S C++ + +
Sbjct  724   VKFATVMVEKICANSYEGNVLELSCREEQVISEIKFSSFGVPEGECGSFKKSQCESPNAL  783

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCK--SKIRRLAVEATC  1705
              ++  +C+GK+ C++ VS  +   T C+      +LA+EA C
Sbjct  784   SILSKSCLGKQSCSVQVSQRMLGPTGCRMPQNQNKLAIEAVC  825



>ref|XP_003541315.2| PREDICTED: beta-galactosidase-like [Glycine max]
Length=827

 Score =   559 bits (1441),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 290/581 (50%), Positives = 362/581 (62%), Gaps = 58/581 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+ QPKWGHLKELHN+L S+E+ L  GN +
Sbjct  292   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNIAQPKWGHLKELHNVLKSMEETLTSGNVS  351

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD+G  + +T+Y   G   CFL++ N   D ++TF GKNYT PAWSV+ILPDC+ E YN
Sbjct  352   ETDFGNSVKATIYATNGSSSCFLSSTNTTTDATLTFRGKNYTVPAWSVSILPDCEHEEYN  411

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVK+ S+      ALKW +R E I +  +G  N S        A +L DQ
Sbjct  412   TAKVNVQTSVMVKENSKAEEEATALKWVWRSENIDNALHGKSNVS--------ANRLLDQ  463

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMT   +   +P+ G+ +TL +N+  HV+HAF N +HIGS WA   G 
Sbjct  464   KDAANDASDYLWYMTKLHVKHDDPVWGENMTLRINSSGHVIHAFVNGEHIGSHWAT-YGI  522

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
                 F+  +KL+   NTISLLS TVGL NYG +F+    G++ P++LV   G+     +L
Sbjct  523   HNDKFEPKIKLKHGTNTISLLSVTVGLQNYGAFFDTWHAGLVEPIELVSVKGDETIIKNL  582

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLT--WHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             S N W+Y VGLHG    LF  D        W      TDRM  WYK T            
Sbjct  583   SSNKWSYKVGLHGWDHKLFSDDSPFAAPNKWESEKLPTDRMLTWYKTT------------  630

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   F  P G D VV+DL GMGKG AWVNG NIGR WPS+ A
Sbjct  631   ----------------------FNAPLGTDPVVVDLQGMGKGYAWVNGQNIGRIWPSYNA  668

Query  1232  KSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             + DGC    CDYRG Y  SKCVT CGKP+QRWYHVPRS+L K G N LVLF E+GG P +
Sbjct  669   EEDGCSDEPCDYRGEYTDSKCVTNCGKPTQRWYHVPRSYL-KDGANNLVLFAELGGNPSQ  727

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDI  1582
             V  QTV VGT+CAN  E  T+ELSC+ GRKIS IKF SFG+P G CG+F    C++ ++ 
Sbjct  728   VNFQTVVVGTVCANAYENKTLELSCQ-GRKISAIKFASFGDPEGVCGAFTNGSCESKSNA  786

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + ++Q ACVGK+ C+  VS+  F  T C +  +RLAVEA C
Sbjct  787   LSIVQKACVGKQACSFDVSEKTFGPTACGNVAKRLAVEAVC  827



>ref|XP_009616320.1| PREDICTED: beta-galactosidase 15-like [Nicotiana tomentosiformis]
Length=824

 Score =   558 bits (1439),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 277/582 (48%), Positives = 369/582 (63%), Gaps = 61/582 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI TTYDY+APLDE+GN+NQPK+GHLKELH++L+S+E  L  GN +
Sbjct  290   YHGGTNFGRTAGGPYITTTYDYDAPLDEFGNLNQPKYGHLKELHDVLHSMEKTLTSGNIS  349

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D G  +S T+Y   GK  CF +NAN   D +IT+EG  Y  PAWSV+ILPDCKTEVYN
Sbjct  350   NNDLGNSVSVTIYALDGKSSCFFSNANTTTDATITYEGVKYNVPAWSVSILPDCKTEVYN  409

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETI---MHLKYGHKNQSSVLIDALDAKQL  517
             TA+VN QT++MVKK +EG     +L+WS+RPE +   + L  GH          + A QL
Sbjct  410   TAKVNTQTSIMVKKSNEGESETASLQWSWRPEKLDETVLLGKGH----------ISANQL  459

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQKV  +D +DY+WYMTSF + + +PI    +TL VN   H+LH + N +++GS+WA  
Sbjct  460   LDQKVA-DDVSDYMWYMTSFNLGKDDPIWSDNMTLRVNGTGHILHVYVNGQYLGSKWAT-  517

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM--  871
              G F ++F+  +KL+   N I+LLS T+GL NYG  F+ +  GV GPV++V  NG+    
Sbjct  518   YGIFNYVFENKIKLKPGKNQIALLSATIGLQNYGARFDLIQTGVPGPVEIVGRNGDERVV  577

Query  872   -DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              DLS + W+Y V LHG+   L+  +   +  W   +   +RM  WYK T           
Sbjct  578   KDLSAHKWSYKVDLHGLENKLYAGNSRFESQWQSHDVPINRMMTWYKAT-----------  626

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK P G D VV+DL G+GKG+AWVNG +IGRYWPS+L
Sbjct  627   -----------------------FKAPLGNDPVVVDLQGLGKGLAWVNGESIGRYWPSYL  663

Query  1229  AKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             A+ DGC    CDYRG Y   KC + CG+P+QRWYHVPRSF+   G+N++VL EE GG P 
Sbjct  664   AEGDGCSTDPCDYRGPYSDKKCNSNCGQPTQRWYHVPRSFMSNDGDNEIVLLEEFGGNPS  723

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TD  1579
              +  QTV VG+ C N  E   M +SC+ GR IS IKF +FG+  G+CGSFE   C++ +D
Sbjct  724   LINFQTVRVGSACGNAYEDKLMNISCQ-GRPISAIKFANFGDTQGTCGSFEKGSCESNSD  782

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++ +IQ  CVGKE C++  S ++  +T C +  +RL VEA C
Sbjct  783   VLSIIQKECVGKENCSVVASQSVLGSTNCDNIAKRLVVEAIC  824



>ref|XP_007204034.1| hypothetical protein PRUPE_ppa020752mg [Prunus persica]
 gb|EMJ05233.1| hypothetical protein PRUPE_ppa020752mg [Prunus persica]
Length=817

 Score =   558 bits (1437),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 286/578 (49%), Positives = 362/578 (63%), Gaps = 62/578 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+   YI TTYDY+APLDEYGN+NQPKWGHLK+LH +L S+E  L +GN T
Sbjct  292   YHGGTNFGRTAAA-YITTTYDYDAPLDEYGNLNQPKWGHLKQLHEILKSMEYTLTHGNIT  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G  +S+T+Y       CF  NAN   D +ITF+G  YT PAWSV+ILPDCKTE YN
Sbjct  351   TIDFGNSVSATMYATNDSASCFFGNANSSTDHTITFQGNKYTIPAWSVSILPDCKTEGYN  410

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+  VK +++      +L W +RPE I   +   K +       + A +L DQ
Sbjct  411   TAKVNTQTSFKVKMMNKAEDEPESLGWLWRPENIDDTRLQGKGE-------VTANKLMDQ  463

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K V  D +DYLWYMTS  +N+ +PI    +TL++N    +LHA+ N +++GSEWA+ +  
Sbjct  464   KEVAADASDYLWYMTSVYLNKDDPIWSGNMTLKINATGFILHAYVNGEYLGSEWAKYN-D  522

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++F+++VKL    N ISLLS TVG PNYG  FE +  GV GPV LV  NG+ M   DL
Sbjct  523   YNYVFEKNVKLNPGKNVISLLSATVGFPNYGGGFEVINTGVPGPVVLVGQNGDEMVIKDL  582

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGLHG+   LF  D      W   N   +RM  WYK T              
Sbjct  583   SAHKWSYEVGLHGLKNQLFSTDSRYAAKWSAENLPINRMMTWYKTT--------------  628

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AWVNG+++GRYWPS+LAK 
Sbjct  629   --------------------FKAPLGTDPVVVDLQGLGKGHAWVNGNSLGRYWPSYLAKE  668

Query  1238  DGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG+Y  +KCV  CGKP+QRWYHVPRSF++  G N LVLFEE GG P  V 
Sbjct  669   DGCSLEACDYRGSYDNNKCVFNCGKPTQRWYHVPRSFMQD-GENTLVLFEEFGGNPSLVN  727

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
              QTVT GT+CAN  E +T+EL+C+ GR IS IKF SFG P G CGSFE   CDA +    
Sbjct  728   FQTVTTGTVCANAYEKHTLELACQ-GRPISSIKFASFGNPQGRCGSFEKGSCDANN----  782

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                 CVGKEKC++ VS++   +  C + ++RLAVEA C
Sbjct  783   ---ECVGKEKCSIDVSESKLGSANCGASVKRLAVEAVC  817



>gb|KHN00663.1| Beta-galactosidase [Glycine soja]
Length=836

 Score =   558 bits (1437),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 278/573 (49%), Positives = 369/573 (64%), Gaps = 46/573 (8%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APL+EYG++NQPKWGHLK LH +L S+E  L  G++ 
Sbjct  294   YHGGTNFGRTSGGPYITTSYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSR  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DYG  M++T++ Y G+ VCFL NA+   D +I F+   YT PAWSV+ILPDC TEVYN
Sbjct  354   NIDYGNQMTATIFSYAGQSVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYN  413

Query  362   TARVNAQTTVM-VKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             TA+VNAQT++M +   +  AL W + PET +      K   SV   A+ A +L DQKV  
Sbjct  414   TAKVNAQTSIMTINNENSYALDWQWMPETHLEQMKDGKVLGSV---AITAPRLLDQKVA-  469

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             NDT+DYLWY+TS  + + +PIL  +L + VNTK HVLH F N  HIGS++A   GK+ F 
Sbjct  470   NDTSDYLWYITSVDVKQGDPILSHDLKIRVNTKGHVLHVFVNGAHIGSQYAT-YGKYTFT  528

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDLSKNT  889
             F+  +KL+   N ISL+S TVGLPNYG YF+ +  GV G V+LV  N       D+S N 
Sbjct  529   FEADIKLKLGKNEISLVSGTVGLPNYGAYFDNIHVGVTG-VQLVSQNDGSEVTKDISTNV  587

Query  890   WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNTS  1069
             W Y VG+HG +  L+      +  W  +  Q  ++F+WYK T                  
Sbjct  588   WHYKVGMHGENVKLYSPSRSTE-EWFTNGLQAHKIFMWYKTT------------------  628

Query  1070  FV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCL  1249
                             F+TP G DSVVLDL G+GKG AWVNG+NIGRYW S+LA  DGC 
Sbjct  629   ----------------FRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAGEDGCS  672

Query  1250  Q-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVT  1426
               CDYRG Y  +KC T CG P+QRWYHVP SFLR   +N LV+FEE GG P +V++ TVT
Sbjct  673   STCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVKIATVT  732

Query  1427  VGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQSAC  1606
             +   CA   EG+ +EL+C+  + IS+I+F SFG P G CGSF+  HC+++D + +++  C
Sbjct  733   IAKACAKAYEGHELELACKENQVISEIRFASFGVPEGECGSFKKGHCESSDTLSIVKRLC  792

Query  1607  VGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +GK++C++HV++ +   T C+    RLA++A C
Sbjct  793   LGKQQCSIHVNEKMLGPTGCRVPENRLAIDALC  825



>emb|CDP03052.1| unnamed protein product [Coffea canephora]
Length=828

 Score =   557 bits (1436),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 289/584 (49%), Positives = 371/584 (64%), Gaps = 68/584 (12%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTN+GR +GGPYI+TTYDYNAPLDEYGN+NQPK+GHLK+LH+ L+SLE +L YGN T
Sbjct  297   YHGGTNYGREAGGPYISTTYDYNAPLDEYGNLNQPKYGHLKQLHDTLHSLEKILTYGNVT  356

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTD+G  + STV+   G   CF  N+N   D +IT++G  Y  PAWSV+ILPDCK EVYN
Sbjct  357   NTDFGNSVKSTVFTLNGTSACFFENSNTTTDATITYQGSQYNVPAWSVSILPDCKKEVYN  416

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETI----MHLKYGHKNQSSVLIDALDAKQ  514
             TA+VN QT V VK+ +E      +L W++RPE I    +H K GH          + A +
Sbjct  417   TAKVNTQTWVKVKRSNEAENEPVSLSWTWRPEAIDDAVVHGK-GH----------VSANR  465

Query  515   LFDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQ  694
             L DQKV+ ND +DYLWYMT   + +++PI    L+L VN   H+LHA+ N +++GSEWA 
Sbjct  466   LLDQKVI-NDASDYLWYMTRVNLEKNDPIWSGNLSLRVNATGHILHAYVNGQYVGSEWAP  524

Query  695   DDGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM-  871
               G F ++F++ ++L +  N I+LLS TVGL NYG  F+++  G+ GPV++V  NG+   
Sbjct  525   -YGVFNYVFKKDIQLNRGSNQIALLSATVGLTNYGARFDEIPAGISGPVEIVGRNGDETI  583

Query  872   --DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
               DLS + W+Y VGLHG+SK +FK  D +   W   +   +R   WYK T          
Sbjct  584   IKDLSHHKWSYKVGLHGLSKKIFKSSDPS--LWQSQDLPVNRRMTWYKTT----------  631

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     FK P GED V ++L G+GKG AWVNG+N+GRYW S 
Sbjct  632   ------------------------FKAPLGEDPVAVNLQGLGKGWAWVNGNNLGRYWASL  667

Query  1226  LAKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
             LA  D C    CDYRG Y  SKCVTGCG+P+Q WYHVPRSFL   G+N LVLFEE GG P
Sbjct  668   LA-DDQCSTDPCDYRGPYTNSKCVTGCGEPTQTWYHVPRSFLND-GDNDLVLFEEFGGNP  725

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-T  1576
              +V  QTVTVGT C N  E   +E+SC+ GR IS IKF SFG P G+CGSF+   CDA  
Sbjct  726   SQVTFQTVTVGTTCGNAYENTVLEISCQ-GRPISDIKFASFGNPEGTCGSFQKGTCDANN  784

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKI-RRLAVEATC  1705
             D + V++ ACVGKE C+   S+ L   T C + + +RL VEA C
Sbjct  785   DPLLVVREACVGKESCSFAASETLLGPTNCDASVTKRLVVEAVC  828



>ref|XP_003519945.2| PREDICTED: beta-galactosidase-like [Glycine max]
Length=836

 Score =   557 bits (1436),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 278/573 (49%), Positives = 370/573 (65%), Gaps = 46/573 (8%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APL+EYG++NQPKWGHLK LH +L S+E  L  G++ 
Sbjct  294   YHGGTNFGRTSGGPYITTSYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSR  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DYG  M++T++ Y G+ VCFL NA+   D +I F+   YT PAWSV+ILPDC TEVYN
Sbjct  354   NIDYGNQMTATIFSYAGQSVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYN  413

Query  362   TARVNAQTTVM-VKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             TA+VNAQT++M +   +  AL W + PET +      K   SV   A+ A +L DQKV  
Sbjct  414   TAKVNAQTSIMTINNENSYALDWQWMPETHLEQMKDGKVLGSV---AITAPRLLDQKVA-  469

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             NDT+DYLWY+TS  + + +PIL  +L + VNTK HVLH F N  HIGS++A   GK+ F 
Sbjct  470   NDTSDYLWYITSVDVKQGDPILSHDLKIRVNTKGHVLHVFVNGAHIGSQYAT-YGKYPFT  528

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDLSKNT  889
             F+  +KL+   N ISL+S TVGLPNYG YF+ +  GV G V+LV  N       D+S N 
Sbjct  529   FEADIKLKLGKNEISLVSGTVGLPNYGAYFDNIHVGVTG-VQLVSQNDGSEVTKDISTNV  587

Query  890   WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNTS  1069
             W Y VG+HG +  L+     ++  W  +  Q  ++F+WYK T                  
Sbjct  588   WHYKVGMHGENVKLYSPSRSSE-EWFTNGLQAHKIFMWYKTT------------------  628

Query  1070  FV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCL  1249
                             F+TP G DSVVLDL G+GKG AWVNG+NIGRYW S+LA  DGC 
Sbjct  629   ----------------FRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAGEDGCS  672

Query  1250  Q-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVT  1426
               CDYRG Y  +KC T CG P+QRWYHVP SFLR   +N LV+FEE GG P +V++ TVT
Sbjct  673   STCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVKIATVT  732

Query  1427  VGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQSAC  1606
             +   CA   EG+ +EL+C+  + IS+I+F SFG P G CGSF+  HC+++D + +++  C
Sbjct  733   IAKACAKAYEGHELELACKENQVISEIRFASFGVPEGECGSFKKGHCESSDTLSIVKRLC  792

Query  1607  VGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +GK++C++HV++ +   T C+    RLA++A C
Sbjct  793   LGKQQCSIHVNEKMLGPTGCRVPENRLAIDALC  825



>ref|XP_008337885.1| PREDICTED: beta-galactosidase 15-like [Malus domestica]
Length=827

 Score =   557 bits (1436),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 283/578 (49%), Positives = 361/578 (62%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+   Y+ TTYDY+APLDEYGN+NQPKWGHLKELH +L S+E  L +GN T
Sbjct  295   YHGGTNFGRTAAA-YVTTTYDYDAPLDEYGNLNQPKWGHLKELHQILKSMEYTLTHGNVT  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              T++   +S+TVY       CFL NAN   D +ITF+G  YT PAWSV+ILPDCKTE YN
Sbjct  354   TTNFDNSVSATVYATNESSSCFLGNANSTTDATITFQGNTYTIPAWSVSILPDCKTEGYN  413

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QTTV VK  ++      +L WS+RPETI   +   K +       + A QL DQ
Sbjct  414   TAKVNTQTTVKVKVGNKAEDEPESLAWSWRPETIDDTRVLAKGE-------ITANQLLDQ  466

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KV  +D +DYLWYMTS  + + +PI  + +TL VN    +LHA+ N +++GS+WAQ +  
Sbjct  467   KVAGDDASDYLWYMTSVHLKKDDPIWSKNMTLRVNGTGFILHAYVNGEYVGSQWAQYN-V  525

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++F++SVKL    N ISLLS TVG PNYG  FE++  G+ GPV LV  NG+ +   DL
Sbjct  526   YNYVFEKSVKLHPGKNIISLLSATVGFPNYGGGFEEIKTGISGPVVLVGQNGDEIVIKDL  585

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGLHG+   LF  D      W   N   +RM  WYK T              
Sbjct  586   SAHKWSYKVGLHGLKNKLFSTDSRYATKWSTENLPINRMLTWYKAT--------------  631

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AW+NGH+IGRYWPS+L+  
Sbjct  632   --------------------FKAPLGTDPVVVDLQGLGKGHAWINGHSIGRYWPSYLSYD  671

Query  1238  DGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
               C    CDYRG Y  +KC   CG P+QRWYHVPRSF+   G N +VLFEE GG P  V 
Sbjct  672   TDCSLDACDYRGTYDNNKCSFNCGNPTQRWYHVPRSFMED-GENAIVLFEEFGGNPSLVN  730

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
              QT+ VGT+CA+  E +T+EL+C  GR IS IKF SFG   G+CGSFE   CD+   + +
Sbjct  731   FQTIQVGTVCAHAYEKHTVELACE-GRPISAIKFASFGNSQGTCGSFEKGSCDSGRALSI  789

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++  CVGKEKC ++VS++ F  T C   ++RLAVEA C
Sbjct  790   LKKECVGKEKCLINVSESKFGLTNCGDAVKRLAVEAVC  827



>ref|XP_002284027.2| PREDICTED: beta-galactosidase 15-like [Vitis vinifera]
Length=829

 Score =   556 bits (1433),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 293/586 (50%), Positives = 369/586 (63%), Gaps = 66/586 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APL+EYGN NQPKWGHL++LH LL S+E  L YG+  
Sbjct  292   YHGGTNFGRTAGGPYITTSYDYDAPLNEYGNKNQPKWGHLRDLHLLLLSMEKALTYGDVK  351

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DY  + S+T+Y Y+GK  CF  N+N   D++I + G NYT PAWSV+ILPDC  EVYN
Sbjct  352   NVDYETLTSATIYSYQGKSSCFFGNSNADRDVTINYGGVNYTIPAWSVSILPDCSNEVYN  411

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN+Q +  VKK SE      +L+W++R ETI ++  G             A +L DQ
Sbjct  412   TAKVNSQYSTFVKKGSEAENEPNSLQWTWRGETIQYITPGR----------FTASELLDQ  461

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K V  DT+DYL+YMT+  I+  +PI G++LTL VNT  H+LHAF N +HIG ++A   G+
Sbjct  462   KTVAEDTSDYLYYMTTVDISNDDPIWGKDLTLSVNTSGHILHAFVNGEHIGYQYAL-LGQ  520

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDL  877
             F+F F+RSV L+   N I+LLS TVGL NYG  F+ V QG+ GPV+++  NG      DL
Sbjct  521   FEFQFRRSVTLQLGKNEITLLSATVGLTNYGPDFDMVNQGIHGPVQIIASNGSADIIKDL  580

Query  878   SKNT-WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             S N  W Y  GL+G  K +F L       W   N   +R F+WYK T             
Sbjct  581   SNNNQWAYKAGLNGEDKKIF-LGRARYNQWKSDNLPVNRSFVWYKAT-------------  626

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  F  P GED VV+DL G+GKG AWVNGH++GRYWPS++A+
Sbjct  627   ---------------------FDAPPGEDPVVVDLMGLGKGEAWVNGHSLGRYWPSYIAR  665

Query  1235  SDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
              +GC  +CDYRG Y   KC T CG PSQRWYHVPRSFL  T +N+LVLFEE GG P  V 
Sbjct  666   GEGCSPECDYRGPYKAEKCNTNCGNPSQRWYHVPRSFLAST-DNRLVLFEEFGGNPSSVT  724

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGS--------FETSHC  1567
              QTVTVG  CAN REG T+ELSC+ GR IS IKF SFG+P G+CG         FE   C
Sbjct  725   FQTVTVGNACANAREGYTLELSCQ-GRAISGIKFASFGDPQGTCGKPFATGSQVFEKGTC  783

Query  1568  DATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +A D + +IQ  CVGK  C++ VS+ +     C +  +RLAVEA C
Sbjct  784   EAADSLSIIQKLCVGKYSCSIDVSEQILGPAGCTADTKRLAVEAIC  829



>ref|XP_004288998.1| PREDICTED: beta-galactosidase-like [Fragaria vesca subsp. vesca]
Length=823

 Score =   556 bits (1432),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 366/578 (63%), Gaps = 59/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+   YI T+YDY+APLDEYG++NQPKWGHLKELH +L S+E  L YGN T
Sbjct  295   YHGGTNFGRTAAS-YITTSYDYDAPLDEYGHLNQPKWGHLKELHEVLKSMEHTLTYGNIT  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              T+ G  +S+TV+       C   NAN+  D +ITF+GK +  PAWSV+ILPDCK E YN
Sbjct  354   TTELGNSVSTTVFATNESSSCIFGNANNSADATITFQGKTHIVPAWSVSILPDCKEEAYN  413

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QTT+ VK +++      +L+WS+RPE I     G           + A  L +Q
Sbjct  414   TAKVNTQTTLKVKSVNKAEDEPQSLQWSWRPERIDTELLGKGE--------VVANLLMEQ  465

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMTS +I++ +P+L   +TL +N   ++LHA+ N +H+GS+WA+ +  
Sbjct  466   KEAANDASDYLWYMTSVQISKDDPVLIGNMTLRINETGYILHAYVNGEHVGSQWAKYN-V  524

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ +KL   +NTISLLS TVG PNYG  FE +  G+IGPV+LV  NG+     +L
Sbjct  525   FNYVFEKPIKLVPGVNTISLLSATVGFPNYGGGFEDIKTGIIGPVELVGQNGDETVIKNL  584

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S+  W+Y VGLHG++  LF         W       +R   WYK T              
Sbjct  585   SERKWSYKVGLHGMNDQLFSSASRK---WSVEGVPENRTMTWYKTT--------------  627

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G + VV+DL G+GKG AWVNGH+IGRYWPS+LA  
Sbjct  628   --------------------FKAPLGTEPVVVDLQGLGKGHAWVNGHSIGRYWPSYLAPE  667

Query  1238  DGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG Y  +KCV  CGKP+QRWYHVPRSFL+    N LVLFEE GG P  V 
Sbjct  668   DGCSVEACDYRGTYDNNKCVFNCGKPTQRWYHVPRSFLQDD-ENTLVLFEEFGGNPSYVN  726

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
              QT+ VGTICAN  E +T+EL+C+ GR IS IKF SFG P G+CGSF+   CD+   + +
Sbjct  727   FQTIRVGTICANAYENHTLELACQ-GRSISAIKFASFGNPEGTCGSFKEGTCDSKTALSI  785

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +Q  CVGKE C++ VS+++F +TTC   ++RLAVEA C
Sbjct  786   LQKECVGKEACSIDVSESMFGSTTCGGIVKRLAVEAVC  823



>ref|XP_003519946.2| PREDICTED: beta-galactosidase-like [Glycine max]
Length=836

 Score =   555 bits (1431),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 278/573 (49%), Positives = 368/573 (64%), Gaps = 46/573 (8%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APL+EYG++NQPKWGHLK LH +L S+E  L  G++ 
Sbjct  294   YHGGTNFGRTSGGPYITTSYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSR  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DYG  M++T++ Y G+ VCFL NA+   D +I F+   YT PAWSV+ILPDC TEVYN
Sbjct  354   NIDYGNQMTATIFSYAGQSVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYN  413

Query  362   TARVNAQTTVM-VKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             TA+VNAQT++M +   +  AL W + PET +      K   SV   A+ A +L DQKV  
Sbjct  414   TAKVNAQTSIMTINNENSYALDWQWMPETHLEQMKDGKVLGSV---AITAPRLLDQKVA-  469

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             NDT+DYLWY+TS  + + +PIL  +L + VNTK HVLH F N  HIGS++A   GK+ F 
Sbjct  470   NDTSDYLWYITSVDVKQGDPILSHDLKIRVNTKGHVLHVFVNGAHIGSQYAT-YGKYTFT  528

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDLSKNT  889
             F+  +KL+   N ISL+S TVGLPNYG YF+ +  GV G V+LV  N       D+S N 
Sbjct  529   FEADIKLKLGKNEISLVSGTVGLPNYGAYFDNIHVGVTG-VQLVSQNDGSEVTKDISTNV  587

Query  890   WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNTS  1069
             W Y VG+HG +  L+      +  W  +  Q  ++F+WYK T                  
Sbjct  588   WHYKVGMHGENVKLYSPSRSTE-EWFTNGLQAHKIFMWYKTT------------------  628

Query  1070  FV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCL  1249
                             F+TP G DSVVLDL G+GKG AWVNG+NIGRYW S+LA  DGC 
Sbjct  629   ----------------FRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAGEDGCS  672

Query  1250  Q-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVT  1426
               CDYRG Y  +KC T CG P+QRWYHVP SFLR   +N LV+FEE GG P +V++ TVT
Sbjct  673   STCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVKIATVT  732

Query  1427  VGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQSAC  1606
             +   CA   EG+ +EL+C+  + IS+IKF SFG P G CGSF+  HC+++D + +++  C
Sbjct  733   IAKACAKAYEGHELELACKENQVISEIKFASFGVPEGECGSFKKGHCESSDTLSIVKRLC  792

Query  1607  VGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +GK++C++ V++ +   T C+    RLA++A C
Sbjct  793   LGKQQCSIQVNEKMLGPTGCRVPENRLAIDALC  825



>gb|KHN17741.1| Beta-galactosidase 7 [Glycine soja]
Length=830

 Score =   555 bits (1429),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 285/581 (49%), Positives = 355/581 (61%), Gaps = 58/581 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+ QPKWGHLKELH+ L ++E+ L  GN +
Sbjct  295   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNIAQPKWGHLKELHSALKAMEEALTSGNVS  354

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD G  +  T+Y   G   CFL+N N   D ++TF G NYT PAWSV+ILPDC+ E YN
Sbjct  355   ETDLGNSVKVTIYATNGSSSCFLSNTNTTADATLTFRGNNYTVPAWSVSILPDCQHEEYN  414

Query  362   TARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VM K+ S+       LKW +R E I    +G  N S        A +L DQ
Sbjct  415   TAKVNVQTSVMTKENSKAEKEAAILKWVWRSENIDKALHGKSNVS--------AHRLLDQ  466

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMT   +   +P+  + +TL +N   HV+HAF N ++I S WA   G 
Sbjct  467   KDAANDASDYLWYMTKLHVKHDDPVWSENMTLRINGSGHVIHAFVNGEYIDSHWAT-YGI  525

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
                 F+  +KL+   NTISLLS TVGL NYG +F     G++GP++LV   GE     +L
Sbjct  526   HNDKFEPKIKLKHGTNTISLLSVTVGLQNYGAFFATWHAGLVGPIELVSVKGEETIIKNL  585

Query  878   SKNTWTYMVGLHGISKGLFKLDD--HNKLTWHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             S + W+Y +GLHG    LF  D     +  W      T+RM  WYK T            
Sbjct  586   SSHKWSYKIGLHGWDHKLFSDDSPFAAQSKWESEKLPTNRMLTWYKTT------------  633

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   FK P G D VV+DL GMGKG AWVNG NIGR WPS+ A
Sbjct  634   ----------------------FKAPLGTDPVVVDLQGMGKGYAWVNGKNIGRIWPSYNA  671

Query  1232  KSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             + DGC    CDYRG Y  SKCVT CGKP+QRWYHVPRS+L K G N LVLF E+GG P  
Sbjct  672   EEDGCSDEPCDYRGEYSDSKCVTNCGKPTQRWYHVPRSYL-KDGANTLVLFAELGGNPSL  730

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDI  1582
             V  QTV VG +CAN  E  T+ELSC+ GRKIS IKF SFG+P G CG+F    C++ ++ 
Sbjct  731   VNFQTVVVGNVCANAYENKTLELSCQ-GRKISAIKFASFGDPKGVCGAFTNGSCESKSNA  789

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +P++Q ACVGKE C++ VS+  F  T C +  +RLAVEA C
Sbjct  790   LPIVQKACVGKEACSIDVSEKTFGATACGNLAKRLAVEAVC  830



>ref|XP_004288329.1| PREDICTED: beta-galactosidase 15-like [Fragaria vesca subsp. 
vesca]
Length=823

 Score =   554 bits (1428),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 372/578 (64%), Gaps = 59/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+   YI T+YDY+APLDEYG++NQPKWGHLKELH +L S+E VL YGN T
Sbjct  295   YHGGTNFDRTAAS-YITTSYDYDAPLDEYGHLNQPKWGHLKELHEVLKSMEHVLTYGNIT  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              T+ G  +S+TV+       C   NAN+  D +ITF+GK +T PAWSV+ILPDCK E YN
Sbjct  354   TTELGNSLSTTVFATNESSGCIFGNANNSVDATITFQGKTHTIPAWSVSILPDCKEEAYN  413

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QTT+ VK +++      +L+WS+RPE I H +   K +       + A +L +Q
Sbjct  414   TAKVNTQTTIKVKSVNKAEDELQSLQWSWRPEKI-HTELLGKGE-------VVANRLMEQ  465

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMTS +I++ +P+L   +TL +N   ++LHA+ N +H+GS+WA+ +  
Sbjct  466   KEAANDASDYLWYMTSVQISKDDPVLIGNMTLRINETGYILHAYVNGEHVGSQWAKYN-V  524

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ + L   +NTISLLS TVG PNYG  FE +  G++GPV+LV  +G+     +L
Sbjct  525   FNYVFEKPITLVPGVNTISLLSATVGFPNYGGGFEDIKTGIVGPVELVGQSGDETVIKNL  584

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S+  W+Y VGLHG+   LF         W       +R   WYK T              
Sbjct  585   SERKWSYKVGLHGMKDQLFSSASRK---WSVEGLPVNRTMTWYKTT--------------  627

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G + VV+DL G+GKG AWVNGH+IGRYWPS+LA++
Sbjct  628   --------------------FKAPLGTEPVVVDLQGLGKGNAWVNGHSIGRYWPSYLAQT  667

Query  1238  DGC-LQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC LQ CDYRG Y  +KCV  CGKP+QRWYH+PRSFL+    N LVLFEE GG P  V 
Sbjct  668   DGCSLQACDYRGTYDNNKCVFNCGKPTQRWYHIPRSFLQDD-ENTLVLFEEFGGNPSYVN  726

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
              QT+ VGTICAN  E +T++L+C+ GR IS IKF SFG P G+CGSF    CD+T  + +
Sbjct  727   FQTIRVGTICANAYENHTLKLACQ-GRPISAIKFASFGNPEGTCGSFRKGTCDSTTALSI  785

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +Q  CVGKE C++ VS+++F  TTC   ++RLAVEA C
Sbjct  786   LQKECVGKESCSIDVSESMFGYTTCGDIMKRLAVEAVC  823



>gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial [Erythranthe 
guttata]
Length=722

 Score =   550 bits (1417),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 325/731 (44%), Positives = 450/731 (62%), Gaps = 37/731 (5%)
 Frame = -3

Query  4388  LLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRD  4209
             LL   I   +++LG  VHA ++K  +     + N+L+  Y + G L++   +FD++   D
Sbjct  4     LLKLSIEYADIQLGKAVHASVLK--FEQDVRLFNSLITSYFELGKLNYAERVFDSILAPD  61

Query  4208  IASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELH  4032
             + S+  MISG+ K +    A   F +M R+  +  +  +   LL  C     +R G ++H
Sbjct  62    VVSYTAMISGLAKSNCENEALGFFFEM-RDSGIEPNAYSFVALLTVCMRLIDLRLGFQVH  120

Query  4031  AHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVD  3852
             A +++ G+ ++  V NA++  YT+C  +  V+ LF+ M  RD  +WN +I+  ++ G+ +
Sbjct  121   ALSIKTGHINSTYVANAVMGLYTKCSCLDYVVKLFDEMSERDVASWNTVISCVVKDGMHE  180

Query  3851  LAKELFDHLP----------EKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDF  3702
              A ELF                N  + NA++  + + G        F RM    +    +
Sbjct  181   RAFELFHRAAIHAYALKIGYGTNLSVKNALIEFYAKCGCVEDVETLFNRMHVRDV----Y  236

Query  3701  TLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRM  3522
             T T + +A        S+ +I   +    C   +    ALL    + G    A + F RM
Sbjct  237   TWTEMIDAYMGFGNVDSALEIFSKMPDRNCVTYN----ALLAGFCQNGEGFRALRWFCRM  292

Query  3521  PLGHGRLVA---LTSMLR--GYAQNGQPENAISLFF---------ETQLEGLVVVDEVAT  3384
              +  G  ++   LTS+L   G  ++ +    I  F            +   L +   +A 
Sbjct  293   -VEEGMEISDFTLTSVLHACGLVKDSRSSEQIHAFVLKIKSSTNNHIKAALLDMCTRLAI  351

Query  3383  AtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSS  3204
             A++LGVC  LG  KLGE  +C ALK   L D+ VGNAVISMY+KCG+++ A K F+ M +
Sbjct  352   ASILGVCADLGFRKLGEQFYCRALKCSLLHDIGVGNAVISMYSKCGDMEEANKVFDKMPA  411

Query  3203  RDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQ  3024
              D+ SWNSLLAGY ++R+G +AL+ W +M+R  I PD+ TC+ I+SAYRHT  N++  C+
Sbjct  412   HDIVSWNSLLAGYNVNRQGGKALEVWKKMQRGKIQPDTVTCVLIISAYRHTNSNLIEHCK  471

Query  3023  SFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIM  2844
              FF SM+  Y + P SDHYACLV VLG WGLLEEAEE I  +PFE  +SVWRALLDSC +
Sbjct  472   DFFRSMKPVYNIEPNSDHYACLVGVLGNWGLLEEAEELIENIPFEETASVWRALLDSCGI  531

Query  2843  HLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQS  2664
             H N+ IG R  KKILSMEPQDPST+ILKSNLYSASGRW CSE VR EMKE+ F+K PG+S
Sbjct  532   HKNAIIGTRAAKKILSMEPQDPSTYILKSNLYSASGRWNCSEFVREEMKERRFRKFPGRS  591

Query  2663  WVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFL  2484
             WVI Q + HSFFARD SH +SKDIYS LDIL +EC++AGY PDTS+VLH+VEE+QK +FL
Sbjct  592   WVIDQEEVHSFFARDKSHPESKDIYSVLDILFMECLRAGYKPDTSFVLHDVEEHQKVNFL  651

Query  2483  FHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCF  2304
               HSAKLA+++GL+ T+ GKPVRV+KNI +CGDCHTF K  ++VTKREIHVRD SGFHCF
Sbjct  652   LCHSAKLAVSFGLITTRVGKPVRVVKNIHMCGDCHTFLKYVTVVTKREIHVRDASGFHCF  711

Query  2303  LNGKCSCNDRW  2271
              +G+CSC D W
Sbjct  712   ADGECSCRDNW  722


 Score =   330 bits (847),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 180/396 (45%), Positives = 239/396 (60%), Gaps = 79/396 (20%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++R SGIEPN YSFVALLT C+R  +L LGFQVHAL IK G+++STYV NA+MGLY+KC 
Sbjct  87    EMRDSGIEPNAYSFVALLTVCMRLIDLRLGFQVHALSIKTGHINSTYVANAVMGLYTKCS  146

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              LD+V++LFD + +RD+ASWNT+IS +VK+ M  RAFELF+                   
Sbjct  147   CLDYVVKLFDEMSERDVASWNTVISCVVKDGMHERAFELFHR------------------  188

Query  4076  NACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
                          +HA+AL+IGY +NLSV NALI+FY +CG ++ V  LF RM VRD +T
Sbjct  189   -----------AAIHAYALKIGYGTNLSVKNALIEFYAKCGCVEDVETLFNRMHVRDVYT  237

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W EMI AYM  G VD A E+F  +P++N V YNA+LAGFCQNGEG +A+ +F RM++E +
Sbjct  238   WTEMIDAYMGFGNVDSALEIFSKMPDRNCVTYNALLAGFCQNGEGFRALRWFCRMVEEGM  297

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTR---------  3564
             E SDFTLTS+ +ACGL+ + +SS+QIH F+LK     N+ I+AALLDMCTR         
Sbjct  298   EISDFTLTSVLHACGLVKDSRSSEQIHAFVLKIKSSTNNHIKAALLDMCTRLAIASILGV  357

Query  3563  --------------------------------------CGRMEDAEKIFHRMPLGHGRLV  3498
                                                   CG ME+A K+F +MP  H  +V
Sbjct  358   CADLGFRKLGEQFYCRALKCSLLHDIGVGNAVISMYSKCGDMEEANKVFDKMP-AHD-IV  415

Query  3497  ALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEV  3390
             +  S+L GY  N Q   A+ ++ + Q  G +  D V
Sbjct  416   SWNSLLAGYNVNRQGGKALEVWKKMQ-RGKIQPDTV  450


 Score = 64.7 bits (156),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 6/69 (9%)
 Frame = -2

Query  4623  YADFLKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIE  4462
             +A  LK E+D RL N+LI++Y +LG ++YA  VFDS+ +P      A+ISG AK N E E
Sbjct  21    HASVLKFEQDVRLFNSLITSYFELGKLNYAERVFDSILAPDVVSYTAMISGLAKSNCENE  80

Query  4461  AVELFYEMR  4435
             A+  F+EMR
Sbjct  81    ALGFFFEMR  89


 Score = 60.8 bits (146),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (54%), Gaps = 1/110 (1%)
 Frame = -3

Query  4400  SFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNL  4221
             +  ++L  C      +LG Q +   +K   L    V NA++ +YSKCG ++   ++FD +
Sbjct  350   AIASILGVCADLGFRKLGEQFYCRALKCSLLHDIGVGNAVISMYSKCGDMEEANKVFDKM  409

Query  4220  PKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNA  4071
             P  DI SWN++++G        +A E++  MQR   ++ D +T   +++A
Sbjct  410   PAHDIVSWNSLLAGYNVNRQGGKALEVWKKMQRGK-IQPDTVTCVLIISA  458



>gb|KHN00665.1| Beta-galactosidase [Glycine soja]
Length=909

 Score =   556 bits (1432),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 278/573 (49%), Positives = 368/573 (64%), Gaps = 46/573 (8%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APL+EYG++NQPKWGHLK LH +L S+E  L  G++ 
Sbjct  367   YHGGTNFGRTSGGPYITTSYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSR  426

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DYG  M++T++ Y G+ VCFL NA+   D +I F+   YT PAWSV+ILPDC TEVYN
Sbjct  427   NIDYGNQMTATIFSYAGQSVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYN  486

Query  362   TARVNAQTTVM-VKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             TA+VNAQT++M +   +  AL W + PET +      K   SV   A+ A +L DQKV  
Sbjct  487   TAKVNAQTSIMTINNENSYALDWQWMPETHLEQMKDGKVLGSV---AITAPRLLDQKVA-  542

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             NDT+DYLWY+TS  + + +PIL  +L + VNTK HVLH F N  HIGS++A   GK+ F 
Sbjct  543   NDTSDYLWYITSVDVKQGDPILSHDLKIRVNTKGHVLHVFVNGAHIGSQYAT-YGKYTFT  601

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDLSKNT  889
             F+  +KL+   N ISL+S TVGLPNYG YF+ +  GV G V+LV  N       D+S N 
Sbjct  602   FEADIKLKLGKNEISLVSGTVGLPNYGAYFDNIHVGVTG-VQLVSQNDGSEVTKDISTNV  660

Query  890   WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNTS  1069
             W Y VG+HG +  L+     +   W  +  Q  ++F+WYK T                  
Sbjct  661   WHYKVGMHGENVKLYS-PSRSTEEWFTNGLQAHKIFMWYKTT------------------  701

Query  1070  FV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCL  1249
                             F+TP G DSVVLDL G+GKG AWVNG+NIGRYW S+LA  DGC 
Sbjct  702   ----------------FRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAGEDGCS  745

Query  1250  Q-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVT  1426
               CDYRG Y  +KC T CG P+QRWYHVP SFLR   +N LV+FEE GG P +V++ TVT
Sbjct  746   STCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVKIATVT  805

Query  1427  VGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQSAC  1606
             +   CA   EG+ +EL+C+  + IS+IKF SFG P G CGSF+  HC+++D + +++  C
Sbjct  806   IAKACAKAYEGHELELACKENQVISEIKFASFGVPEGECGSFKKGHCESSDTLSIVKRLC  865

Query  1607  VGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +GK++C++ V++ +   T C+    RLA++A C
Sbjct  866   LGKQQCSIQVNEKMLGPTGCRVPENRLAIDALC  898



>ref|XP_006601406.1| PREDICTED: beta-galactosidase 7-like [Glycine max]
Length=830

 Score =   552 bits (1422),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 283/581 (49%), Positives = 355/581 (61%), Gaps = 58/581 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+ QPKWGHLKELH+ L ++E+ L  GN +
Sbjct  295   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNIAQPKWGHLKELHSALKAMEEALTSGNVS  354

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD G  +  T+Y   G   CFL+N N   D ++TF G NYT PAWSV+ILPDC+ E YN
Sbjct  355   ETDLGNSVKVTIYATNGSSSCFLSNTNTTADATLTFRGNNYTVPAWSVSILPDCQHEEYN  414

Query  362   TARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+V  QT+VM K+ S+       LKW +R E I    +G  N S        A +L DQ
Sbjct  415   TAKVKEQTSVMTKENSKAEKEAAILKWVWRSENIDKALHGKSNVS--------AHRLLDQ  466

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMT   +   +P+  + +TL +N   HV+HAF N ++I S WA   G 
Sbjct  467   KDAANDASDYLWYMTKLHVKHDDPVWSENMTLRINGSGHVIHAFVNGEYIDSHWAT-YGI  525

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
                 F+  +KL+   NTISLLS TVGL NYG +F+    G++GP++LV   GE     +L
Sbjct  526   HNDKFEPKIKLKHGTNTISLLSVTVGLQNYGAFFDTWHAGLVGPIELVSVKGEETIIKNL  585

Query  878   SKNTWTYMVGLHGISKGLFKLDD--HNKLTWHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             S + W+Y +GLHG    LF  D     +  W      T+RM  WYK T            
Sbjct  586   SSHKWSYKIGLHGWDHKLFSDDSPFAAQSKWESEKLPTNRMLTWYKTT------------  633

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   FK P G D VV+DL GMGKG AWVNG NIGR WPS+ A
Sbjct  634   ----------------------FKAPLGTDPVVVDLQGMGKGYAWVNGKNIGRIWPSYNA  671

Query  1232  KSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             + DGC    CDYRG Y  SKCVT CGKP+QRWYHVPRS+L K G N LVLF E+GG P  
Sbjct  672   EEDGCSDEPCDYRGEYSDSKCVTNCGKPTQRWYHVPRSYL-KDGANTLVLFAELGGNPSL  730

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDI  1582
             V  QTV VG +CAN  E  T+ELSC+ GRKIS IKF SFG+P G CG+F    C++ ++ 
Sbjct  731   VNFQTVVVGNVCANAYENKTLELSCQ-GRKISAIKFASFGDPKGVCGAFTNGSCESKSNA  789

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +P++Q ACVGKE C++ +S+  F  T C +  +RLAVEA C
Sbjct  790   LPIVQKACVGKEACSIDLSEKTFGATACGNLAKRLAVEAVC  830



>ref|XP_004243920.1| PREDICTED: beta-galactosidase 15-like [Solanum lycopersicum]
Length=818

 Score =   549 bits (1415),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 367/578 (63%), Gaps = 57/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI TTYDYNAPLDE+GN+ QPK+GHLKELH++L+S+E +L  G   
Sbjct  288   YHGGTNFGRTSGGPYITTTYDYNAPLDEFGNLAQPKYGHLKELHDVLHSMEKILASGTVN  347

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NT+ G  ++ T+Y   G+  CF +NAN+  D +I+++   Y  PAWSVTILPDC TEVYN
Sbjct  348   NTNLGNSVAVTMYTLDGESSCFFSNANETTDATISYKNVYYNVPAWSVTILPDCITEVYN  407

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVKKL+        L+WS+RPE I       + QSS         +L DQ
Sbjct  408   TAKVNTQTSVMVKKLNNAENEPIPLQWSWRPEMIDDAIILGRGQSSF-------HELIDQ  460

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVV NDT+DYLWYMT+  IN ++PI   ++ L VN   HVLHA+ N K++GS+WA   G 
Sbjct  461   KVV-NDTSDYLWYMTNVYINNTDPIWSDDMKLRVNASGHVLHAYVNGKYLGSDWAT-YGI  518

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VKL    N+ISLLS TVG  NYG +F+ +  G++GPV+++  NG+     DL
Sbjct  519   FNYVFEKKVKLNPGKNSISLLSATVGFKNYGPHFDTIESGILGPVEIIGKNGDESIIKDL  578

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGL GI+  LF  D++N   W   +   +RM  WYK T              
Sbjct  579   SSHKWSYTVGLKGINNKLF--DEYNTGKWDSHDVPINRMMTWYKTT--------------  622

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G   VV+D+ G+GKG AWVNG +IGRYWPS+LA+ 
Sbjct  623   --------------------FKAPLGNAPVVVDMQGLGKGTAWVNGQSIGRYWPSYLAEG  662

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             +  L  CDYRG Y   KC + CG+P+QRWYHVPRSFL  +  N LVLFEE GG P  V+ 
Sbjct  663   NCSLDPCDYRGPYSADKCTSKCGEPTQRWYHVPRSFL-SSDENTLVLFEEFGGNPSHVKF  721

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPV  1591
             QT+ VG  C +  E  TMELSC G R IS I+F +FGE  GSCGSF    C +  D++ +
Sbjct  722   QTIEVGMACGSAYENKTMELSCNGSR-ISAIRFANFGETEGSCGSFGKGSCSSEQDVVSL  780

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++  CVGKEKC +  S+++F  T C +K ++L VEA C
Sbjct  781   VEKQCVGKEKCLVQASESVFGMTNCGNKEKKLIVEAVC  818



>ref|XP_002516256.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF46258.1| beta-galactosidase, putative [Ricinus communis]
Length=848

 Score =   550 bits (1417),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 282/583 (48%), Positives = 365/583 (63%), Gaps = 62/583 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH++L+S+E  L +GN +
Sbjct  313   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKQLHDILHSMEYTLTHGNIS  372

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               DY   +++T+Y    +  CF  NAN+  D +I F+G  Y  PAWSV+ILPDC+   YN
Sbjct  373   TIDYDNSVTATIYATDKESACFFGNANETSDATIVFKGTEYNVPAWSVSILPDCENVGYN  432

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPE---TIMHLKYGHKNQSSVLIDALDAKQL  517
             TA+V  QT +MVK+ +E      +LKWS+ PE   T   L  GH +          A+QL
Sbjct  433   TAKVKTQTAIMVKQKNEAEDQPSSLKWSWIPENTHTTSLLGKGHAH----------ARQL  482

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQK   ND +DYLWYMTS  I + +P+   +++L VN   HVLHA+ N KH+GS++A+ 
Sbjct  483   IDQKAAANDASDYLWYMTSLHIKKDDPVWSSDMSLRVNGSGHVLHAYVNGKHLGSQFAK-  541

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---  868
              G F ++F++S+KLR   N ISLLS TVGL NYG  F+ V  G+ GPV+++   G+    
Sbjct  542   YGVFSYVFEKSLKLRPGKNVISLLSATVGLQNYGPMFDLVQTGIPGPVEIIGHRGDEKVV  601

Query  869   MDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              DLS + W+Y VGL+G    L+  +  +   W E +  T++M IWYK T           
Sbjct  602   KDLSSHKWSYSVGLNGFHNELYSSNSRHASRWVEQDLPTNKMMIWYKTT-----------  650

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK P G+D VVLDL GMGKG AWVNG+NIGRYWPSFL
Sbjct  651   -----------------------FKAPLGKDPVVLDLQGMGKGFAWVNGNNIGRYWPSFL  687

Query  1229  AKSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             A+ DGC    CDYRG Y  +KCVT CGKP+QRWYHVPRSF      N LVLFEE GG P 
Sbjct  688   AEEDGCSTEVCDYRGAYDNNKCVTNCGKPTQRWYHVPRSFFNDY-ENTLVLFEEFGGNPA  746

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-D  1579
              V  QTVTVG +  +  EG T+ELSC  G+ IS I+F SFG+P G+ G++    C+ + D
Sbjct  747   GVNFQTVTVGKVSGSAGEGETIELSCN-GKSISAIEFASFGDPQGTSGAYVKGTCEGSND  805

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSK-IRRLAVEATC  1705
                ++Q ACVGKE C L  S  +F  T+C S  +  LAV+ATC
Sbjct  806   AFSIVQKACVGKETCKLEASKDVFGPTSCGSDVVNTLAVQATC  848



>ref|XP_002297749.2| hypothetical protein POPTR_0001s06310g, partial [Populus trichocarpa]
 gb|EEE82554.2| hypothetical protein POPTR_0001s06310g, partial [Populus trichocarpa]
Length=819

 Score =   549 bits (1415),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 283/583 (49%), Positives = 367/583 (63%), Gaps = 64/583 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+NQPKWGHLKELH++L+S+ED L  G + 
Sbjct  286   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKELHDVLHSMEDTLHEGTSP  345

Query  182   NTDYGRMMS-STVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
                   +    T+Y  +    CFL N + ++D +I F+G +Y  PAWSV+ILPDC+  VY
Sbjct  346   QLTLAILSRFGTIYSTEKGSSCFLTNTDSRNDTTINFQGLDYEVPAWSVSILPDCQDVVY  405

Query  359   NTARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLI--DALDAKQL  517
             NTA+V+AQT+VMVKK +       AL WS+RPET         N  S+L     +   Q+
Sbjct  406   NTAKVSAQTSVMVKKKNVAEDEPAALTWSWRPET---------NDKSILFGKGEVSVNQI  456

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQK   ND +DYL+YMTS  + E +PI G  +TL +     VLH F N + IGS+WA+ 
Sbjct  457   LDQKDAANDLSDYLFYMTSVSLKEDDPIWGDNMTLRITGSGQVLHVFVNGEFIGSQWAK-  515

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM--  871
              G F ++F++ +KL K  NTI+LLS TVG  NYG  F+    GV GPV+LV  + + +  
Sbjct  516   YGVFDYVFEQQIKLNKGKNTITLLSATVGFANYGANFDLTQAGVRGPVELVGYHDDEIII  575

Query  872   -DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              DLS + W+Y VGL G+ + L+  D      W + N+ T++MF WYK T           
Sbjct  576   KDLSSHKWSYKVGLEGLRQNLYSSDSSK---WQQDNYPTNKMFTWYKAT-----------  621

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK P G D VV+DL G+GKG+AWVNG++IGRYWPSF+
Sbjct  622   -----------------------FKAPLGTDPVVVDLLGLGKGLAWVNGNSIGRYWPSFI  658

Query  1229  AKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             A+ DGC    CDYRG+Y  +KCVT CGKP+QRWYHVPRSFL   G+N LVLFEE GG P 
Sbjct  659   AE-DGCSLDPCDYRGSYDNNKCVTNCGKPTQRWYHVPRSFLNNEGDNTLVLFEEFGGDPS  717

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-D  1579
              V  QT  +G+ C N  E   +ELSC+ GR IS IKF SFG P+G+CGSF    C+A+ D
Sbjct  718   SVNFQTTAIGSACVNAEEKKKIELSCQ-GRPISAIKFASFGNPLGTCGSFSKGTCEASND  776

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSK-IRRLAVEATC  1705
              + ++Q ACVG+E CT+ VS+  F +TTC    I+ LAVEA C
Sbjct  777   ALSIVQKACVGQESCTIDVSEDTFGSTTCGDDVIKTLAVEAIC  819



>ref|XP_009801177.1| PREDICTED: beta-galactosidase 15-like [Nicotiana sylvestris]
Length=874

 Score =   551 bits (1419),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 277/582 (48%), Positives = 365/582 (63%), Gaps = 61/582 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI TTYDY+APLDE+GN+NQPK+GHLKELH++L+S+E  L  GN +
Sbjct  340   YHGGTNFGRTAGGPYITTTYDYDAPLDEFGNLNQPKYGHLKELHDVLHSMEKTLTSGNIS  399

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D G  +S T+Y    K  CFL+NAN   D +IT+EG  Y  PAWSV+ILPDCKTEVYN
Sbjct  400   NNDLGNSVSVTIYALDDKSSCFLSNANTTTDATITYEGVKYNVPAWSVSILPDCKTEVYN  459

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETI---MHLKYGHKNQSSVLIDALDAKQL  517
             TA+VN QT++MVKK +EG     +L+WS+RPE +   + L  GH          + A +L
Sbjct  460   TAKVNTQTSIMVKKSNEGESETASLQWSWRPEKLDETVLLGKGH----------VSANKL  509

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQKV  +D +DY+WYMTSF + + +PI   ++TL VN   H+LH + N +++GS+WA  
Sbjct  510   LDQKVA-DDVSDYMWYMTSFNLGKDDPIWSDDMTLRVNGTGHILHVYVNGQYLGSKWAT-  567

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM--  871
              G F ++F+  +KL    N I+LLS TVGL NYG  F+ +  GV GPV++V  NG+    
Sbjct  568   YGIFNYVFENKIKLNPGKNQITLLSATVGLQNYGPRFDLIQTGVPGPVEIVGRNGDERVV  627

Query  872   -DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              DLS + W+Y V LHG+   L+  +      W   +   +RM  WYK T           
Sbjct  628   KDLSAHKWSYKVDLHGLENKLYAGNPRFVSQWQSHDVPINRMMTWYKAT-----------  676

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    F  P G D VV+DL G+GKG+AWVNG +IGRYWPS+L
Sbjct  677   -----------------------FTAPLGNDPVVVDLQGLGKGLAWVNGQSIGRYWPSYL  713

Query  1229  AKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             A+ DGC    CDYRG Y   KC + CG+P+QRWYHVPRSFL   G+N++VL EE GG P 
Sbjct  714   AEEDGCSTDPCDYRGPYSDKKCNSNCGQPTQRWYHVPRSFLSNDGDNEIVLLEEFGGNPS  773

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TD  1579
              V  QTV VG+ C N  E   M +SC   R IS IKF +FG+  G+CGSFE   C++ +D
Sbjct  774   LVNFQTVRVGSACGNAYEDKLMNISCH-DRPISAIKFANFGDTQGTCGSFEKGSCESNSD  832

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++ +IQ  CVGKE C++  S ++  +T C +  +RL VEA C
Sbjct  833   VLSIIQRECVGKENCSVAASQSILGSTNCDNIAKRLVVEAIC  874



>ref|XP_006367886.1| PREDICTED: beta-galactosidase 15-like [Solanum tuberosum]
Length=815

 Score =   548 bits (1413),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 281/579 (49%), Positives = 368/579 (64%), Gaps = 56/579 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI TTYDYNAPLDE+GN+ QPK+GHLKELH++L+S+E +L  G+  
Sbjct  282   YHGGTNFGRTSGGPYITTTYDYNAPLDEFGNLAQPKYGHLKELHDVLHSMEKILTSGSVN  341

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NT+ G  ++ T+Y   G+  CF +NAN+  D +I+++  NY  PAWSVTILPDC TEVYN
Sbjct  342   NTNLGNSVAVTMYSLDGESSCFFSNANETTDATISYKNVNYNVPAWSVTILPDCITEVYN  401

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT++MVKKL++      +L+WS+RPE I       + QSSV        +L DQ
Sbjct  402   TAKVNTQTSIMVKKLNDAENEPISLQWSWRPEMIDDAIILGRGQSSV-------HELLDQ  454

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVV NDT+DYLWYMT+  IN+++PI   ++ L VN   HVLHA+ N +++GS+WA   G 
Sbjct  455   KVV-NDTSDYLWYMTTVYINKTDPIWSDDMKLRVNASGHVLHAYVNGQYLGSDWAT-YGI  512

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F+  VKL    N ISLLS TVGL NYG +F+ +  G++GPV+++   G+     DL
Sbjct  513   FNYVFEEKVKLNPGKNYISLLSATVGLKNYGPHFDTIQSGILGPVEIIGKIGDESIIKDL  572

Query  878   SKNTWTYMVGLHGISKGLFKLD-DHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             S + W+Y VGL GI+  LF  +  +N   W   +   +RM  WYK T             
Sbjct  573   SSHKWSYTVGLKGINNKLFDENPKYNTRKWDSHDVPINRMMTWYKTT-------------  619

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  FK P G   VV+D+ G+GKG AWVNG +IGRYWPS+LA+
Sbjct  620   ---------------------FKAPLGNAPVVVDMQGLGKGTAWVNGQSIGRYWPSYLAE  658

Query  1235  SDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
                 L  CDYRG Y   KC + CG+P+QRWYHVPRSFL  +  N LVLFEE GG P  V 
Sbjct  659   GSCSLDPCDYRGPYSADKCTSKCGEPTQRWYHVPRSFL-SSDENTLVLFEEFGGNPSLVN  717

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIP  1588
              QT+ VG  C +  E  TMELSC  GR IS I+F +FGE  GSCGSF    C +  D++ 
Sbjct  718   FQTIEVGMACGSAYENKTMELSCN-GRPISAIRFANFGETEGSCGSFGKGSCSSEQDVVS  776

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             V++  C+GKEKC +  S+++F TT C +  +RL VEA C
Sbjct  777   VVEKECIGKEKCLVQASESVFGTTNCGNNDKRLIVEAVC  815



>emb|CBI30211.3| unnamed protein product [Vitis vinifera]
Length=829

 Score =   549 bits (1414),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 292/586 (50%), Positives = 367/586 (63%), Gaps = 70/586 (12%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APL+EYGN NQPKWGHL++LH LL S+E  L YG+  
Sbjct  296   YHGGTNFGRTAGGPYITTSYDYDAPLNEYGNKNQPKWGHLRDLHLLLLSMEKALTYGDVK  355

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DY  + S+T+Y Y+GK  CF  N+N   D++I + G NYT PAWSV+ILPDC  EVYN
Sbjct  356   NVDYETLTSATIYSYQGKSSCFFGNSNADRDVTINYGGVNYTIPAWSVSILPDCSNEVYN  415

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN+Q +  VKK SE      +L+W++R ETI ++  G             A +L DQ
Sbjct  416   TAKVNSQYSTFVKKGSEAENEPNSLQWTWRGETIQYITPGR----------FTASELLDQ  465

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K V  DT+DYL+YMT+      +PI G++LTL VNT  H+LHAF N +HIG ++A   G+
Sbjct  466   KTVAEDTSDYLYYMTT----NDDPIWGKDLTLSVNTSGHILHAFVNGEHIGYQYAL-LGQ  520

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDL  877
             F+F F+RSV L+   N I+LLS TVGL NYG  F+ V QG+ GPV+++  NG      DL
Sbjct  521   FEFQFRRSVTLQLGKNEITLLSATVGLTNYGPDFDMVNQGIHGPVQIIASNGSADIIKDL  580

Query  878   SKNT-WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             S N  W Y  GL+G  K +F L       W   N   +R F+WYK T             
Sbjct  581   SNNNQWAYKAGLNGEDKKIF-LGRARYNQWKSDNLPVNRSFVWYKAT-------------  626

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  F  P GED VV+DL G+GKG AWVNGH++GRYWPS++A+
Sbjct  627   ---------------------FDAPPGEDPVVVDLMGLGKGEAWVNGHSLGRYWPSYIAR  665

Query  1235  SDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
              +GC  +CDYRG Y   KC T CG PSQRWYHVPRSFL  T +N+LVLFEE GG P  V 
Sbjct  666   GEGCSPECDYRGPYKAEKCNTNCGNPSQRWYHVPRSFLAST-DNRLVLFEEFGGNPSSVT  724

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGS--------FETSHC  1567
              QTVTVG  CAN REG T+ELSC+ GR IS IKF SFG+P G+CG         FE   C
Sbjct  725   FQTVTVGNACANAREGYTLELSCQ-GRAISGIKFASFGDPQGTCGKPFATGSQVFEKGTC  783

Query  1568  DATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +A D + +IQ  CVGK  C++ VS+ +     C +  +RLAVEA C
Sbjct  784   EAADSLSIIQKLCVGKYSCSIDVSEQILGPAGCTADTKRLAVEAIC  829



>ref|XP_007022965.1| Beta-galactosidase 7 [Theobroma cacao]
 gb|EOY25587.1| Beta-galactosidase 7 [Theobroma cacao]
Length=823

 Score =   548 bits (1413),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 282/579 (49%), Positives = 363/579 (63%), Gaps = 57/579 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI TTYDYNAPLDEYGN NQPKWGHLK+LH++L+S+E  L +G+ T
Sbjct  291   YHGGTNFGRTSGGPYITTTYDYNAPLDEYGNPNQPKWGHLKQLHDVLHSMEYTLTHGDVT  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTD G  +S+TVY  K K  CFL+NA+++ D  + F G +Y  PAWSV+ILPDCK E YN
Sbjct  351   NTDLGNSVSTTVYSTKEKSSCFLSNAHNQTDAVVKFGGIDYYVPAWSVSILPDCKDEAYN  410

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+V AQT+V+VKK ++      +L+W +RPE I       K           A ++ DQ
Sbjct  411   TAKVYAQTSVLVKKPNKAEDEPNSLEWVWRPENIERTAVQGKGDHH-------ANRIIDQ  463

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K + ND +DYLWYMT  ++ + +P++  + TL V    HVLHA+ N ++IGS+WAQ  G 
Sbjct  464   KAMANDASDYLWYMTRVELPKDDPLVTGKATLRVTDSGHVLHAYVNGEYIGSQWAQ-YGS  522

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDL  877
              K++F++ VKL    N ISLLS TVGL NYG  F+    GV+ PV+LV   G      DL
Sbjct  523   QKYVFEKEVKLNPGKNLISLLSATVGLQNYGPMFDLNVTGVLSPVELVAHKGNEKVVKDL  582

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGL G++  L++ D  +KL W   +   DR   WYK T              
Sbjct  583   SSHKWSYKVGLDGVANKLYETDCPSKLKWSADSIPVDRNMTWYKTT--------------  628

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G   VV+DL G+GKG AWVNGH++GRYWPS++A  
Sbjct  629   --------------------FKAPLGNAPVVVDLLGLGKGHAWVNGHSLGRYWPSYIADE  668

Query  1238  DGC--LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
               C  + CDYRG Y   KCV+ CG+P+QRWYHVPRSFL K G N LVLFEE GG P  V+
Sbjct  669   HACQTVACDYRGAYSDKKCVSKCGEPTQRWYHVPRSFL-KDGENTLVLFEEFGGNPSGVQ  727

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIP  1588
              QTV +GT C N  EG  +ELSC   R IS+I F SFG+P G CGSF+ + C++T D + 
Sbjct  728   FQTVEIGTACVNAHEGKKVELSCH-NRPISRINFASFGDPQGVCGSFKKTECESTEDAVS  786

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +++  CVGKE C+  +S+  F    C   I+RLAVEA C
Sbjct  787   ILEKECVGKESCSFEISEDKFGKAYC--AIKRLAVEAVC  823



>ref|XP_002516237.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF46239.1| beta-galactosidase, putative [Ricinus communis]
Length=825

 Score =   548 bits (1413),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 270/582 (46%), Positives = 370/582 (64%), Gaps = 61/582 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDE+GN+NQPKWGHLK+LH++L+S+E++L  G  +
Sbjct  291   YHGGTNFGRTAGGPYITTSYDYDAPLDEFGNLNQPKWGHLKQLHDVLHSMEEILTSGTVS  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + DY   +++T+Y    +  CFL+NAN+  D +I F+G  YT PAWSV+ILPDC    YN
Sbjct  351   SVDYDNSVTATIYATDKESSCFLSNANETSDATIEFKGTTYTIPAWSVSILPDCANVGYN  410

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETI---MHLKYGHKNQSSVLIDALDAKQL  517
             TA+V  QT+VMVK+ ++      +L WS+RPE +   + L  GH          + AKQ+
Sbjct  411   TAKVKTQTSVMVKRDNKAEDEPTSLNWSWRPENVDKTVLLGQGH----------IHAKQI  460

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQK V ND +DYLWYMTS  + + + I  +++++ +N   H+LHA+ N +++GS+W++ 
Sbjct  461   VDQKAVANDASDYLWYMTSVDLKKDDLIWSKDMSIRINGSGHILHAYVNGEYLGSQWSEY  520

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM--  871
                  ++F++SVKL+   N I+LLS TVGL NYG  ++ +  G++GPV+LV   G+    
Sbjct  521   SVS-NYVFEKSVKLKHGRNLITLLSATVGLANYGANYDLIQAGILGPVELVGRKGDETII  579

Query  872   -DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              DLS N W+Y VGL G+   L+  D  +   W E    T++M  WYK T           
Sbjct  580   KDLSNNRWSYKVGLLGLEDKLYLSDSKHASKWQEQELPTNKMLTWYKTT-----------  628

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK P G D VVLDL G+GKG+AW+NG++IGRYWPSFL
Sbjct  629   -----------------------FKAPLGTDPVVLDLQGLGKGMAWINGNSIGRYWPSFL  665

Query  1229  AKSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             A+ DGC    CDYRG Y  +KCV+ CGKP+QRWYHVPRSFL+    N LVLFEE GG P 
Sbjct  666   AEDDGCSTDLCDYRGPYDNNKCVSNCGKPTQRWYHVPRSFLQDN-ENTLVLFEEFGGNPS  724

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-D  1579
             +V  QTV  G  C +  EG  +E+SC  G+ IS ++F SFG+P G+CGS     C+ T D
Sbjct  725   QVNFQTVVTGVACVSGDEGEVVEISCN-GQSISAVQFASFGDPQGTCGSSVKGSCEGTED  783

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              + ++Q ACVG E C+L VS  LF +T+C + + RLAVE  C
Sbjct  784   ALLIVQKACVGNESCSLEVSHKLFGSTSCDNGVNRLAVEVLC  825



>ref|XP_009790181.1| PREDICTED: beta-galactosidase 15-like [Nicotiana sylvestris]
Length=821

 Score =   546 bits (1408),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 278/576 (48%), Positives = 368/576 (64%), Gaps = 53/576 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI TTYDY+APLDE+GN+ QPK+GHLKELH++L+S+E  L  GN T
Sbjct  291   YHGGTNFGRTSGGPYITTTYDYDAPLDEFGNLAQPKYGHLKELHDVLHSMEKTLTSGNIT  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N+D G  ++ T+Y   G+  CF +NAN+  D +I ++G  Y  PAWSV+ILPDCKTEVYN
Sbjct  351   NSDLGNSVAVTIYALDGQSSCFFSNANETTDATINYKGVQYNVPAWSVSILPDCKTEVYN  410

Query  362   TARVNAQTTVMVKKLSEGA-LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             TA+VN QT+VMVKK +E A L+WS+RPE +       + +SS       A +L DQKV  
Sbjct  411   TAKVNTQTSVMVKKSNEPASLQWSWRPEKVDEAVVLGRGRSS-------AHELVDQKVA-  462

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             ND +DY+WYMT+  I +++PI    +TL VN   H+LHA+ N +++GS+WA   G F ++
Sbjct  463   NDVSDYMWYMTNVYIGKNDPIWSDNMTLRVNGSGHILHAYVNGQYLGSQWAT-YGIFNYV  521

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLSKNT  889
             F++ VKL    N ISLLS T+GL NYG +F+ V  G+ GPV+++  NG+     DLS + 
Sbjct  522   FEKQVKLNPGRNHISLLSATIGLQNYGAHFDTVQSGIPGPVEIIGKNGDESVIKDLSSHK  581

Query  890   WTYMVGLHGISKGLFKLDDH-NKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNT  1066
             W+Y V L+GI+  LF  +       W   +   +RM  WYK T                 
Sbjct  582   WSYKVDLNGINNKLFSGNPKFENGQWFSQDVPINRMMTWYKTT-----------------  624

Query  1067  SFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGC  1246
                              FK P G D VV+D  G+GKG AW+NG +IGRYWPS+LA+ +GC
Sbjct  625   -----------------FKAPLGNDPVVVDFQGLGKGHAWINGESIGRYWPSYLAEEEGC  667

Query  1247  LQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQT  1420
                 CDYRG YG  KC +GCG+P+QRWYHVPRSFL K+  N LVLFEE GG P  V  QT
Sbjct  668   STDLCDYRGKYGPDKCASGCGEPTQRWYHVPRSFL-KSDENTLVLFEEFGGNPSLVNFQT  726

Query  1421  VTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPVIQ  1597
             V VGT C +  E  TMELSC  G+ I+ I++ +FGE  G CGSF+   C +  + + +I+
Sbjct  727   VQVGTACGSAYENKTMELSCN-GKAITAIRYANFGETEGICGSFDKGSCSSENNAVSIIE  785

Query  1598  SACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
               CVGKEKC++  S+ +F +T C +  +RL VEA C
Sbjct  786   KECVGKEKCSVLASEGVFGSTNCGNNAKRLIVEAVC  821



>gb|KHN25095.1| Beta-galactosidase [Glycine soja]
Length=810

 Score =   546 bits (1406),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 275/547 (50%), Positives = 364/547 (67%), Gaps = 53/547 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPY+ T+YDY+APLDEYGN+NQPKWGHL++LHNLL S E++L  G++ 
Sbjct  294   YHGGTNFKRTAGGPYVTTSYDYDAPLDEYGNLNQPKWGHLRQLHNLLKSKENILTQGSSQ  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTDYG M+++TVY Y GK  CF+ NA+   D +I F    YT PAWSV+ILP+C +E YN
Sbjct  354   NTDYGNMVTATVYTYDGKSTCFIGNAHQSKDATINFRNNEYTIPAWSVSILPNCSSEAYN  413

Query  362   TARVNAQTTVMVKKLSEG---ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKV  532
             TA+VN QTT+MVKK +E    AL+W +R E  + +K G   Q + +ID L A +L DQKV
Sbjct  414   TAKVNTQTTIMVKKDNEDLEYALRWQWRQEPFVQMKDG---QITGIID-LTAPKLLDQKV  469

Query  533   VTNDTTDYLWYMTSFKI-NESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKF  709
             VTND +DYLWY+TS  I  + +P   +E  L V+T  HVLH F N KH+G++ A+ +G+F
Sbjct  470   VTNDFSDYLWYITSIDIKGDDDPSWTKEFRLRVHTSGHVLHVFVNGKHVGTQHAK-NGQF  528

Query  710   KFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGE--------  865
             KF+ +  +KL    N ISLLS TVGLPNYG +F+ +  GV+GPV+LV   G+        
Sbjct  529   KFVHESKIKLTTGKNEISLLSTTVGLPNYGPFFDNIEVGVLGPVQLVAAVGDYDYDDDEI  588

Query  866   GMDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
               DLSKN W+Y VGLHG  +  +  ++  K TW+     TDR+ +WYK T          
Sbjct  589   VKDLSKNQWSYKVGLHGEHEMHYSYENSLK-TWYTDAVPTDRILVWYKTT----------  637

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     FK+P G+D VV+DL+G+GKG AWVNG++IGRYW S+
Sbjct  638   ------------------------FKSPIGDDPVVVDLSGLGKGHAWVNGNSIGRYWSSY  673

Query  1226  LAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             LA  +GC  +CDYRG Y  +KC++ C +PSQRWYHVPRSFLR    N LVLFEE+GG+P 
Sbjct  674   LADENGCSPKCDYRGPYTSNKCLSMCAQPSQRWYHVPRSFLRDDDQNTLVLFEELGGQPY  733

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDI  1582
              V   TVTVG +CAN  EGNT+EL+C   + IS+IKF SFG P G CGSF+  +C++++ 
Sbjct  734   YVNFLTVTVGKVCANAYEGNTLELACNKNQVISEIKFASFGLPKGECGSFQKGNCESSEA  793

Query  1583  IPVIQSA  1603
             +  I++ 
Sbjct  794   LSAIKAV  800



>emb|CDP15330.1| unnamed protein product [Coffea canephora]
Length=820

 Score =   545 bits (1404),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 286/577 (50%), Positives = 372/577 (64%), Gaps = 60/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APL+EYG +NQPKWGHL++LH LLYSLE +L YG+  
Sbjct  294   YHGGTNFGRTSGGPYIITSYDYDAPLNEYGLLNQPKWGHLRQLHLLLYSLEKILTYGDHK  353

Query  182   NTDYGR-MMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
               ++G  M+SS+VY Y  ++VCF  NAN  D +++TFEG  YT P WSV+I  DC+T  Y
Sbjct  354   YQEHGTYMLSSSVYTYGPERVCFFGNANSNDAMTLTFEGIQYTIPPWSVSIYRDCRTLAY  413

Query  359   NTARVNAQTTVMVKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             NTA+V+AQT V+        LKW +  E I +L      Q  + +    A +L DQK VT
Sbjct  414   NTAQVSAQTNVLDAVEDIAGLKWRWTIEPIENLA-----QKGLTL----ATELLDQKTVT  464

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             NDT+DYLWYMT++     +P+ G +LTL V+T  HV+HAF N  H+GS+ AQ +G F+F 
Sbjct  465   NDTSDYLWYMTTY-----DPVWGGDLTLYVHTTGHVIHAFVNGIHVGSQAAQ-NGHFEFD  518

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGMDLSKNTWTY  898
             F   V L+  +N+ISLLS TVGL NYG +F+ V  G++GPVKLV PN E  DLSKNTW Y
Sbjct  519   FSSPVSLKHGMNSISLLSATVGLQNYGAFFDNVKNGILGPVKLVAPNHEEKDLSKNTWAY  578

Query  899   MVGLHGISKGLFKLDDHNKLTWHES--NFQTDRMFIWYKVTQSiplitlldlpiilNTSF  1072
              VG+ GI +    L+  ++ +WH S  +   +RMF+WYK T                   
Sbjct  579   KVGMGGIDQKQLYLNLPHQ-SWHSSQKSLPINRMFVWYKTT-------------------  618

Query  1073  V*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPS-FLAKSDGCL  1249
                            F TP+G D VVL+L  +GKG AWVNGHNIGRYWPS F A   GC 
Sbjct  619   ---------------FGTPSGLDPVVLNLQDLGKGTAWVNGHNIGRYWPSKFAAGQQGCQ  663

Query  1250  QCDYRGNYGGS-KCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVT  1426
              CDYRG Y  S +C  GCG  +Q+ YHVPRSFLR  GNN LVLFEE GG P+ V+ QT+ 
Sbjct  664   TCDYRGQYQPSQQCRRGCGNSTQQLYHVPRSFLRDEGNNDLVLFEEFGGDPRNVKFQTIK  723

Query  1427  VGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQSAC  1606
             +  ICANV EGN ++LSC+ GR +++I F SFG P G CG+F   +C+A+D + V+Q AC
Sbjct  724   LVKICANVEEGNILDLSCQ-GRVMTRIDFASFGNPDGVCGAFTKGNCEASDSLSVVQDAC  782

Query  1607  VGKEKCTLHVS--DALFPTTTCKS--KIRRLAVEATC  1705
             +GK +C++ ++          C+S  + RRLAVE +C
Sbjct  783   IGKSRCSIDLTAKGPFRCIAGCESSKEPRRLAVEISC  819



>gb|KCW79363.1| hypothetical protein EUGRSUZ_C00782 [Eucalyptus grandis]
Length=807

 Score =   544 bits (1402),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 279/583 (48%), Positives = 363/583 (62%), Gaps = 60/583 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+NQPKWGHLKELH++L+S+E  L  GN T
Sbjct  270   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKELHDMLHSVEGTLTTGNIT  329

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D G  + +TVY   G+  CFL N N   D +  F+GK +T PAWSV+ILPDC+ E YN
Sbjct  330   NVDLGNSVYATVYATPGQSTCFLGNTNSTSDATFVFQGKQFTVPAWSVSILPDCQNEGYN  389

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN Q++VMV + ++      +L W++RPE          +Q ++    + A +L DQ
Sbjct  390   TAKVNVQSSVMVMEPNKAESEPESLSWTWRPEIA-------DDQVTLGKGRVAAHRLVDQ  442

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   N  +DYLWYMTS  + + +P+    +TL VN    +LHA+ N  ++GS+WA   G 
Sbjct  443   KDAANGASDYLWYMTSVNLKDDDPVWSDNMTLRVNCTGQILHAYVNGNYLGSQWAL-YGN  501

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F+++VKL    N ISLLS T+GL NYG  F+ V  GV GPV++    G+     DL
Sbjct  502   FHYVFEKNVKLNPGKNLISLLSVTIGLQNYGPMFDLVQNGVPGPVEIEGRKGDERVIKDL  561

Query  878   SKNTWTYMVGLHGISKGLFK----LDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
             S + W+Y VGLHGI+   F     LD  +   W   +  T+R   WYK T          
Sbjct  562   SGHLWSYKVGLHGINHKFFSIDPALDSASASKWQSKDLPTNRSLSWYKTT----------  611

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     FK P G D VV+DL G+GKG AWVNG +IGRYWPS+
Sbjct  612   ------------------------FKAPLGTDPVVVDLQGLGKGEAWVNGKSIGRYWPSY  647

Query  1226  LAKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
              A  DGC    CDYRG Y  +KCVT CG P+QRWYHVPRSF+ +   N LVLFEE GG P
Sbjct  648   DASLDGCSTDPCDYRGAYDNTKCVTNCGGPTQRWYHVPRSFMEED-VNTLVLFEEFGGNP  706

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-  1576
               V  QTVTVG+ CAN  E  T++L+C+ GR IS +KF SFG+P GSCGSF    C+ + 
Sbjct  707   SLVNFQTVTVGSACANAHEKKTLKLACQ-GRPISAVKFASFGDPQGSCGSFAKGSCEGSN  765

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             D + ++Q+ACVGKE C++ VS+  F +TTC S  +RLAVE +C
Sbjct  766   DAVAILQNACVGKESCSIDVSEKTFGSTTCGS-TKRLAVEVSC  807



>ref|XP_002276918.2| PREDICTED: beta-galactosidase 15 [Vitis vinifera]
 emb|CBI27773.3| unnamed protein product [Vitis vinifera]
Length=835

 Score =   545 bits (1403),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 361/578 (62%), Gaps = 58/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDE+GN+NQPKWGHLK+LH +L S+E+ L  GN T
Sbjct  306   YHGGTNFGRVAGGPYITTSYDYDAPLDEFGNLNQPKWGHLKDLHTVLKSMEETLTEGNIT  365

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  +  TVY  +    CF +N+N  +D + T+ G  YT PAWSV+ILPDCK EVYN
Sbjct  366   TIDMGNSVEVTVYATQKVSSCFFSNSNTTNDATFTYGGTEYTVPAWSVSILPDCKKEVYN  425

Query  362   TARVNAQTTVMVKKLSE-----GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VNAQT+VMVK  +E      +LKWS+RPE I       K Q S       A +L DQ
Sbjct  426   TAKVNAQTSVMVKNKNEAEDQPASLKWSWRPEMIDDTAVLGKGQVS-------ANRLIDQ  478

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K  TND +DYLWYM S  ++E + +    +TL VN   H+LHA+ N +++GS+WA  +G 
Sbjct  479   K-TTNDRSDYLWYMNSVDLSEDDLVWTDNMTLRVNATGHILHAYVNGEYLGSQWAT-NGI  536

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F+  VKL+   N I+LLS T+G  NYG +++ V  G+ GPV++V   G+     DL
Sbjct  537   FNYVFEEKVKLKPGKNLIALLSATIGFQNYGAFYDLVQSGISGPVEIVGRKGDETIIKDL  596

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VG+HG++  L+  D  +   W E N   +R   WYK T              
Sbjct  597   SSHKWSYKVGMHGMAMKLY--DPESPYKWEEGNVPLNRNLTWYKTT--------------  640

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D+VV+DL G+GKG AWVNG ++GRYWPS +A+ 
Sbjct  641   --------------------FKAPLGTDAVVVDLQGLGKGEAWVNGQSLGRYWPSSIAE-  679

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC   CDYRG Y  +KCV  CG P+QRWYHVPRSFL     N LVLFEE GG P  V  
Sbjct  680   DGCNATCDYRGPYTNTKCVRNCGNPTQRWYHVPRSFL-TADENTLVLFEEFGGNPSLVNF  738

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QTVT+GT C N  E N +EL+C+  R IS IKF SFG+P GSCGSF    C+   D + +
Sbjct  739   QTVTIGTACGNAYENNVLELACQ-NRPISDIKFASFGDPQGSCGSFSKGSCEGNKDALDI  797

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             I+ ACVGKE C+L VS+  F +T+C S  +RLAVEA C
Sbjct  798   IKKACVGKESCSLDVSEKAFGSTSCGSIPKRLAVEAVC  835



>ref|XP_010050435.1| PREDICTED: beta-galactosidase 15-like [Eucalyptus grandis]
Length=829

 Score =   544 bits (1402),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 279/583 (48%), Positives = 363/583 (62%), Gaps = 60/583 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+NQPKWGHLKELH++L+S+E  L  GN T
Sbjct  292   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKELHDMLHSVEGTLTTGNIT  351

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D G  + +TVY   G+  CFL N N   D +  F+GK +T PAWSV+ILPDC+ E YN
Sbjct  352   NVDLGNSVYATVYATPGQSTCFLGNTNSTSDATFVFQGKQFTVPAWSVSILPDCQNEGYN  411

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN Q++VMV + ++      +L W++RPE          +Q ++    + A +L DQ
Sbjct  412   TAKVNVQSSVMVMEPNKAESEPESLSWTWRPEIA-------DDQVTLGKGRVAAHRLVDQ  464

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   N  +DYLWYMTS  + + +P+    +TL VN    +LHA+ N  ++GS+WA   G 
Sbjct  465   KDAANGASDYLWYMTSVNLKDDDPVWSDNMTLRVNCTGQILHAYVNGNYLGSQWAL-YGN  523

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F+++VKL    N ISLLS T+GL NYG  F+ V  GV GPV++    G+     DL
Sbjct  524   FHYVFEKNVKLNPGKNLISLLSVTIGLQNYGPMFDLVQNGVPGPVEIEGRKGDERVIKDL  583

Query  878   SKNTWTYMVGLHGISKGLFK----LDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
             S + W+Y VGLHGI+   F     LD  +   W   +  T+R   WYK T          
Sbjct  584   SGHLWSYKVGLHGINHKFFSIDPALDSASASKWQSKDLPTNRSLSWYKTT----------  633

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     FK P G D VV+DL G+GKG AWVNG +IGRYWPS+
Sbjct  634   ------------------------FKAPLGTDPVVVDLQGLGKGEAWVNGKSIGRYWPSY  669

Query  1226  LAKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
              A  DGC    CDYRG Y  +KCVT CG P+QRWYHVPRSF+ +   N LVLFEE GG P
Sbjct  670   DASLDGCSTDPCDYRGAYDNTKCVTNCGGPTQRWYHVPRSFMEED-VNTLVLFEEFGGNP  728

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-  1576
               V  QTVTVG+ CAN  E  T++L+C+ GR IS +KF SFG+P GSCGSF    C+ + 
Sbjct  729   SLVNFQTVTVGSACANAHEKKTLKLACQ-GRPISAVKFASFGDPQGSCGSFAKGSCEGSN  787

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             D + ++Q+ACVGKE C++ VS+  F +TTC S  +RLAVE +C
Sbjct  788   DAVAILQNACVGKESCSIDVSEKTFGSTTCGS-TKRLAVEVSC  829



>ref|XP_011000543.1| PREDICTED: beta-galactosidase 7-like [Populus euphratica]
Length=771

 Score =   540 bits (1390),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 273/583 (47%), Positives = 368/583 (63%), Gaps = 63/583 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR++GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH+LL+S+ED+L  GN +
Sbjct  237   YHGGTNFGRSAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKQLHDLLHSMEDILTTGNVS  296

Query  182   NTDYG-RMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
             + D G   +  T+Y  +G   CFLAN +   D  I F+G NYT PAWSV+ILPDC    Y
Sbjct  297   SVDLGDDSVWGTIYSKEGGSSCFLANVDQGSDKRINFQGVNYTVPAWSVSILPDCLNVSY  356

Query  359   NTARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQL  517
             NTA+V+ QT+VMVKK +       +LKWS+RPE          +  ++L+   D    Q+
Sbjct  357   NTAKVSTQTSVMVKKANVAEDEPISLKWSWRPEM---------DDRTILLAKGDVTVNQI  407

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQK   ND +DYL+YMTS  + + +P+    +TL V +   +LHAF N + IGS+W+++
Sbjct  408   LDQKEAANDLSDYLFYMTSVNLKKDDPVWSYNMTLRVKSSGQILHAFVNGELIGSQWSKN  467

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---  868
              G+  F+F+++VKL    NTISLLS TVG  NYG  F+    G+ GPV+L+  +G+    
Sbjct  468   GGE-NFVFEQNVKLNHKKNTISLLSATVGFTNYGANFDLAPSGITGPVELIGYHGDDEIV  526

Query  869   -MDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
               DLS   W+Y +GL G+++ L+       L W E +F  +R   WYK            
Sbjct  527   VKDLSSQKWSYKIGLEGLNQELYS---SQSLKWQEDSFPVNRTLTWYK------------  571

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                   T FK P G D VV+DL GMGKG+AWVNG++IGRYWPSF
Sbjct  572   ----------------------TVFKAPLGTDPVVVDLLGMGKGLAWVNGNSIGRYWPSF  609

Query  1226  LAKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             +A+ D  L+ CDYRG+Y  +KC++ CG P+QRWYHVPRSFL   G+N LVLFEE GG P 
Sbjct  610   IAEGDCNLEPCDYRGSYDSNKCLSNCGHPTQRWYHVPRSFLNDNGDNSLVLFEEFGGNPS  669

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-D  1579
              V  Q + +G+ C +  E   +ELSC+ GR IS +KF SFG P G+CGSF   +C+ + D
Sbjct  670   SVNFQAIAIGSACISAEENRKIELSCQ-GRPISAVKFASFGNPQGACGSFVKGYCEGSKD  728

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSK-IRRLAVEATC  1705
              + V++ ACVG+E CT+ VS+A F +TTC    I+ L+VEA C
Sbjct  729   ALSVVEKACVGQESCTIDVSEATFGSTTCGDDVIKTLSVEAIC  771



>ref|XP_008439370.1| PREDICTED: beta-galactosidase 7-like [Cucumis melo]
Length=829

 Score =   540 bits (1391),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 273/576 (47%), Positives = 357/576 (62%), Gaps = 49/576 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR++GGPYI T+YDYNAPLDEYGN+NQPKWGHLK+LH L+ S+E VL YG+  
Sbjct  295   YHGGTNFGRSAGGPYITTSYDYNAPLDEYGNMNQPKWGHLKQLHELVKSMEKVLTYGDVK  354

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + +YG + ++T Y YKGK  CF  NA + +   ITF  +NYT P WSVT+LPDCKTEVYN
Sbjct  355   HIEYGHLTTATSYTYKGKSSCFFGNAENSNR-EITFRKRNYTVPGWSVTVLPDCKTEVYN  413

Query  362   TARVNAQTTV--MVKKLS---EGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QTT+  MV  L    +  LKW +R E I H+ +    +  +   AL A  L DQ
Sbjct  414   TAKVNTQTTIREMVPSLVGKYKKPLKWQWRNEKIEHITH----EGDISGVALTANSLLDQ  469

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K+VTNDT+DYLWY+T F +N ++P+ G+ + L V T+ H+LHAFFNNKHIG+++    GK
Sbjct  470   KIVTNDTSDYLWYLTGFHLNGNDPLFGKRVKLRVKTRGHILHAFFNNKHIGTQFG-PYGK  528

Query  707   FKFLFQRSVK-LRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGMDLSK  883
             + F  ++ V+ LR   N I+LLS TVGLPNYG Y+E V  G+ GPV+L+       DLS 
Sbjct  529   YSFTLEKKVRNLRHGFNQIALLSATVGLPNYGAYYENVEVGIHGPVELIADGKTIRDLST  588

Query  884   NTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilN  1063
             N W Y VGL G     F  D   +  W  +N   ++ F WYK                  
Sbjct  589   NEWVYKVGLDGEKYEFFDPDHKFRKPWLSNNLPLNQNFTWYK------------------  630

Query  1064  TSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDG  1243
                             T F+TP G + VV+DL GMGKG AWVNG +IGRYWPS+LA  +G
Sbjct  631   ----------------TSFQTPKGREGVVVDLMGMGKGQAWVNGKSIGRYWPSYLATENG  674

Query  1244  C-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQT  1420
             C   CDYRG Y GSKC T CGKP+QRWYH+PRS++     N L+LFEE GG P  + ++T
Sbjct  675   CSSSCDYRGAYYGSKCATNCGKPTQRWYHIPRSYMNDGKENTLILFEEFGGMPLNIEIKT  734

Query  1421  VTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQS  1600
               V  +CA V  G+ +EL+C   R + +I F  FG P G+C +F    CD++    VI+ 
Sbjct  735   TRVTKVCAKVELGSKLELTCH-DRTVKRIIFVGFGNPKGNCDNFHKGSCDSSSAFSVIEK  793

Query  1601  ACVGKEKCTLHVSDALFPTTTCKS-KIRRLAVEATC  1705
              C+ K KC++  +      T CK+ K   LAV+ +C
Sbjct  794   ECLWKRKCSIEATKDKLGLTGCKNPKDNWLAVQVSC  829



>gb|EYU39588.1| hypothetical protein MIMGU_mgv1a001416mg [Erythranthe guttata]
Length=824

 Score =   539 bits (1388),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 268/580 (46%), Positives = 367/580 (63%), Gaps = 57/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APL+EYG++NQPK+GHLK+LH++L+S+E+VL YGN +
Sbjct  290   YHGGTNFGRTAGGPYITTSYDYDAPLNEYGSLNQPKYGHLKQLHDVLHSIENVLTYGNIS  349

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + D+G  +S+T+Y    +K CF  NAN   D +I ++G +Y  PAWSV+ILPDCK  +YN
Sbjct  350   SMDFGNSVSATIYSTNDQKSCFFGNANSSLDATINYQGVSYDIPAWSVSILPDCKNVLYN  409

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+ M+K  +E       LKWS+  E +       K Q S       A  L DQ
Sbjct  410   TAKVNTQTSKMIKVANEAENEPIVLKWSWMQENLDENALLGKGQVS-------ASHLLDQ  462

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KV  ND +DYLWYMT   ++E++PI  + +++ VN    ++HA+ N +++GSEWA   G 
Sbjct  463   KVA-NDVSDYLWYMTRLDLDENDPIWSKNMSIRVNATGQIVHAYINGEYLGSEWAT-YGI  520

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++F++ +KL+   N I+LLS T+G  NYG  FE    G+ GP++++  NG+     DL
Sbjct  521   YNYVFEKEIKLKPGKNQIALLSATLGYQNYGARFEMTETGLPGPIQIIGKNGDETIIKDL  580

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + WTY VGL G+   LF ++ +    W   N   ++M  WYK T              
Sbjct  581   SSHKWTYKVGLEGLDNKLFDVNTNYSSKWLSDNLPVNKMMTWYKTT--------------  626

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P GED VV+DL G+GKG AWVNG+N+GRYWPSFLA  
Sbjct  627   --------------------FKAPLGEDPVVVDLIGLGKGFAWVNGNNLGRYWPSFLADV  666

Query  1238  DGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG+Y  +KCV+ CG+PSQRWYHVPRSF+ K   N+ VLFEE GG P  V 
Sbjct  667   DGCSAEPCDYRGSYDNNKCVSNCGQPSQRWYHVPRSFMNKD-VNEFVLFEEFGGNPSLVS  725

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIP  1588
              QTV  G++C N  E   ME+SC+ G+ IS +KF SFG+  G CGSFE   C+A  D I 
Sbjct  726   FQTVRPGSVCGNAYENKDMEISCQ-GKTISDVKFASFGDVQGICGSFEKGTCEAKNDAIS  784

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCKSKI-RRLAVEATC  1705
             ++++ACVGKE C++  S ++F  T C++ + +RLAVE  C
Sbjct  785   IVKNACVGKESCSIQASASVFGATNCEASVSKRLAVEVVC  824



>ref|XP_011076997.1| PREDICTED: beta-galactosidase 15-like [Sesamum indicum]
Length=822

 Score =   538 bits (1385),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 270/580 (47%), Positives = 369/580 (64%), Gaps = 59/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI TTYDY+APL+EYG++NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  290   YHGGTNFGRTSGGPYITTTYDYDAPLNEYGSLNQPKYGHLKQLHDVLHSIEKTLTYGNVS  349

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +TDYG  +++TVY    ++ CF  NAN   D ++T++G  Y  PAWSV+ILPDCK EV+N
Sbjct  350   STDYGNSVTATVYSTNDQQTCFFGNANTTADATVTYQGAKYNVPAWSVSILPDCKKEVFN  409

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT++MVK  ++      ALKW++  E++       K + S       A  L DQ
Sbjct  410   TAKVNTQTSMMVKVSNKAEDEPMALKWTWMSESLHKTLVHGKGEVS-------ASHLLDQ  462

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KV  ND +DY+WYMTS  + + +P+   E+ + +N   HV+H+F N +H+GS+WA   G 
Sbjct  463   KVA-NDVSDYMWYMTSLHLGKDDPVWSDEMRIRINGTGHVMHSFINGEHLGSQWAT-YGV  520

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F + F++ + L+   N I+LLS T+GL NYG  F+ V  G+ GP++++   G+     DL
Sbjct  521   FNYKFEKRIHLKPGRNQITLLSATIGLQNYGPNFDVVQTGLPGPIEIIGQKGDECIIKDL  580

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             SK TWTY VGL G +  LF  +++    W       ++M  WYK T              
Sbjct  581   SKRTWTYKVGLDGFNTKLF--NNNVDKVWSTGEMPINKMMTWYKTT--------------  624

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P GE+ V +DL G+GKG+AWVNG+++GRYWPS++A+ 
Sbjct  625   --------------------FKAPLGEEPVAVDLQGLGKGMAWVNGNSLGRYWPSYMAEE  664

Query  1238  DGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG+Y  SKCV+ CG+P+QRWYHVPRSF+ +   N+LVLFEE+GG P  V 
Sbjct  665   DGCSAEPCDYRGSYDNSKCVSNCGQPTQRWYHVPRSFMNRD-VNELVLFEEIGGNPSLVN  723

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIP  1588
              QTV  G++C N  EG  MELSC  GR IS IKF SFG   G CGSF    C+A +D++ 
Sbjct  724   FQTVRPGSVCGNAYEGKDMELSCY-GRPISGIKFASFGNVQGVCGSFRKGTCEAKSDVLS  782

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCKSK-IRRLAVEATC  1705
              +Q+ACVGKE C +  S++L  +T+C S   +RL VEA C
Sbjct  783   FVQNACVGKESCVVRASESLLGSTSCDSSTTKRLVVEAMC  822



>gb|KGN66324.1| hypothetical protein Csa_1G597710 [Cucumis sativus]
Length=772

 Score =   532 bits (1371),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 269/580 (46%), Positives = 358/580 (62%), Gaps = 57/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF R +GGPYI TTYDYNAPLDEYGN+NQPK+GHLK+LH  L S+E  L+ GN T
Sbjct  238   YHGGTNFDRMAGGPYITTTYDYNAPLDEYGNLNQPKFGHLKQLHAALKSIEKALVSGNVT  297

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD    +S T Y     K CF +N N+  D  + + GK++  PAWSV+ILPDC+ EVYN
Sbjct  298   TTDLTDSVSITEYATDKGKSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYN  357

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVKK ++       L+W +RPE I +     K Q       + A +L DQ
Sbjct  358   TAKVNTQTSVMVKKENKAENEPEVLEWMWRPENIDNTARLGKGQ-------VTANKLIDQ  410

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMTS  + + +PI   E+TL +N   H++HAF N +HIGS+WA  D  
Sbjct  411   KDAANDASDYLWYMTSVNLKKKDPIWSNEMTLRINVSGHIVHAFVNGEHIGSQWASYD-V  469

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++F++ VKL+   N ISLLS T+GL NYG  ++ +  G++GPV+L+  +G+     DL
Sbjct  470   YNYIFEQEVKLKPGKNIISLLSATIGLKNYGAQYDLIQSGIVGPVQLIGRHGDETIIKDL  529

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGLHG    LF  +      W   N   +RM  WYK T              
Sbjct  530   SNHKWSYEVGLHGFENRLFSPESRFATKWQSGNLPVNRMMTWYKTT--------------  575

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D V LDL G+GKG+AWVNGH+IGRYWPSF+A+ 
Sbjct  576   --------------------FKPPLGTDPVTLDLQGLGKGMAWVNGHSIGRYWPSFIAE-  614

Query  1238  DGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG+Y  +KCV  CGKP+Q+WYHVPRS+L + G+N LVLFEE GG P  V 
Sbjct  615   DGCSDEPCDYRGSYTNTKCVRDCGKPTQQWYHVPRSWLNE-GDNTLVLFEEFGGNPSLVN  673

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIP  1588
              +T+ +   C +  E  ++ELSC+ G++I+ IKF SFG+P GSCG+F    C+   D + 
Sbjct  674   FKTIAMEKACGHAYEKKSLELSCQ-GKEITGIKFASFGDPTGSCGNFSKGSCEGKNDAMK  732

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCK-SKIRRLAVEATC  1705
             +++  C+GKE C + +S+  F  T C    ++RLAVEA C
Sbjct  733   IVEDLCIGKESCVIDISEDTFGATNCALGVVKRLAVEAVC  772



>ref|XP_010478588.1| PREDICTED: beta-galactosidase 15-like [Camelina sativa]
Length=825

 Score =   534 bits (1375),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 273/584 (47%), Positives = 362/584 (62%), Gaps = 61/584 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLL-YSLEDVLL----  166
             YHGGTNF RTSGGPYI TTYDY+APLDEYG+++QPK+G +  L   +  S+    L    
Sbjct  287   YHGGTNFDRTSGGPYITTTYDYDAPLDEYGHLSQPKYGXVFFLEVCVQMSMRRTFLSFRX  346

Query  167   -YGNATNTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDC  343
              +GN T  D+G ++++T+Y+ +    CF+ N N+  D  I F+G +Y  P WSV+ILPDC
Sbjct  347   THGNITTIDFGNLVTATIYKTEEGSSCFIGNVNETSDARINFQGTSYDVPPWSVSILPDC  406

Query  344   KTEVYNTARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDA  508
             KT  YNTA++N QT+VMVKK +E       LKWS+RPE I ++    K +S++       
Sbjct  407   KTVAYNTAKINTQTSVMVKKPNEAEDEPSTLKWSWRPENIDNVLLKGKGESTM-------  459

Query  509   KQLFDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEW  688
              +LFDQKVV+ND  DYLWYMT+  + E +P+  + ++L +N+ +HVLHAF N +HIG+ +
Sbjct  460   SKLFDQKVVSNDERDYLWYMTTVNLKEQDPVWCKNMSLRINSTAHVLHAFVNGQHIGN-Y  518

Query  689   AQDDGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG  868
               +DGKF ++F++  K     N I+LLS TVGLPNYG +FE V  G+ GPV ++  NG+ 
Sbjct  519   RVEDGKFHYVFEQDAKFNPGANVITLLSITVGLPNYGAFFENVPAGITGPVFIIGRNGDE  578

Query  869   M---DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitl  1039
                 DLS + W+Y  GL G    LF  +  +  TW   +   +R   WYK T        
Sbjct  579   TIVKDLSAHKWSYKTGLSGFENQLFSTESPS--TWSGESVPFNRTMTWYKTT--------  628

Query  1040  ldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWP  1219
                                       FK P G + VV+DL G+GKG AW+NG+NIGRYWP
Sbjct  629   --------------------------FKAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWP  662

Query  1220  SFLAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGR  1396
             SFLA  DGC  +C+Y G Y   KC T CG+P+QRWYHVPRSFL   G+N LVLFEE+GG 
Sbjct  663   SFLADIDGCSAECNYIGTYYAEKCQTNCGEPTQRWYHVPRSFLNSEGDNTLVLFEEIGGN  722

Query  1397  PQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT  1576
             P  V  QT+ VG++CANV E N +ELSC  G+ IS IKF SFG P G+CGSFE   C+A+
Sbjct  723   PSLVNFQTIGVGSVCANVYEKNVLELSCN-GKPISAIKFASFGNPGGNCGSFEKGTCEAS  781

Query  1577  -DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              D   ++   CVGKEKC++ VS+  F    C    +RLAVEA C
Sbjct  782   NDAAAILTKECVGKEKCSIDVSEEKFGAPKCGGAAKRLAVEAIC  825



>ref|XP_004144130.1| PREDICTED: beta-galactosidase 15-like [Cucumis sativus]
Length=827

 Score =   533 bits (1374),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 269/580 (46%), Positives = 358/580 (62%), Gaps = 57/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF R +GGPYI TTYDYNAPLDEYGN+NQPK+GHLK+LH  L S+E  L+ GN T
Sbjct  293   YHGGTNFDRMAGGPYITTTYDYNAPLDEYGNLNQPKFGHLKQLHAALKSIEKALVSGNVT  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD    +S T Y     K CF +N N+  D  + + GK++  PAWSV+ILPDC+ EVYN
Sbjct  353   TTDLTDSVSITEYATDKGKSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYN  412

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVKK ++       L+W +RPE I +     K Q       + A +L DQ
Sbjct  413   TAKVNTQTSVMVKKENKAENEPEVLEWMWRPENIDNTARLGKGQ-------VTANKLIDQ  465

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMTS  + + +PI   E+TL +N   H++HAF N +HIGS+WA  D  
Sbjct  466   KDAANDASDYLWYMTSVNLKKKDPIWSNEMTLRINVSGHIVHAFVNGEHIGSQWASYD-V  524

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++F++ VKL+   N ISLLS T+GL NYG  ++ +  G++GPV+L+  +G+     DL
Sbjct  525   YNYIFEQEVKLKPGKNIISLLSATIGLKNYGAQYDLIQSGIVGPVQLIGRHGDETIIKDL  584

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGLHG    LF  +      W   N   +RM  WYK T              
Sbjct  585   SNHKWSYEVGLHGFENRLFSPESRFATKWQSGNLPVNRMMTWYKTT--------------  630

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D V LDL G+GKG+AWVNGH+IGRYWPSF+A+ 
Sbjct  631   --------------------FKPPLGTDPVTLDLQGLGKGMAWVNGHSIGRYWPSFIAE-  669

Query  1238  DGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG+Y  +KCV  CGKP+Q+WYHVPRS+L + G+N LVLFEE GG P  V 
Sbjct  670   DGCSDEPCDYRGSYTNTKCVRDCGKPTQQWYHVPRSWLNE-GDNTLVLFEEFGGNPSLVN  728

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIP  1588
              +T+ +   C +  E  ++ELSC+ G++I+ IKF SFG+P GSCG+F    C+   D + 
Sbjct  729   FKTIAMEKACGHAYEKKSLELSCQ-GKEITGIKFASFGDPTGSCGNFSKGSCEGKNDAMK  787

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCK-SKIRRLAVEATC  1705
             +++  C+GKE C + +S+  F  T C    ++RLAVEA C
Sbjct  788   IVEDLCIGKESCVIDISEDTFGATNCALGVVKRLAVEAVC  827



>ref|XP_008450952.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15 [Cucumis 
melo]
Length=826

 Score =   532 bits (1371),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 272/583 (47%), Positives = 358/583 (61%), Gaps = 63/583 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF R +GGPYI TTYDYNAPLDEYGN+NQPK+GHLK+LH  L S+E  L+ GN T
Sbjct  292   YHGGTNFDRMAGGPYITTTYDYNAPLDEYGNLNQPKYGHLKQLHAALKSIEKALISGNVT  351

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD    +S T Y     K CF +N N+  D  + + GK++  PAWSV+ILPDC+ EVYN
Sbjct  352   TTDLVDSVSITEYATDEGKSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYN  411

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETI---MHLKYGHKNQSSVLIDALDAKQL  517
             TA+VN QT+VMVKK ++       L+W +RPE I     L  GH +          A +L
Sbjct  412   TAKVNTQTSVMVKKENKAEDEPEVLEWMWRPENIDSTARLGKGHAS----------ANKL  461

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              DQK   ND +DYLWYMTS  + + +PI   ++TL +N   H++HAF N +HIGS+WA  
Sbjct  462   IDQKDAANDASDYLWYMTSVNLKKRDPIWSNQMTLRINVSGHIVHAFVNGEHIGSQWASY  521

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM--  871
             D  + ++F++ VKL+   N ISLLS T+GL NYG  ++ +  G++GPV+LV  +G+    
Sbjct  522   D-VYNYIFEQEVKLKPGKNLISLLSATIGLKNYGPQYDLIQSGIVGPVQLVGRHGDETVI  580

Query  872   -DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              DLS + WTY VGLHG    LF L+      W   N   +RM  WYK T           
Sbjct  581   KDLSNHKWTYEVGLHGFDNHLFSLESRFATKWQSGNLPVNRMMTWYKTT-----------  629

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK P G + V LDL G+GKG+AWVNGH+IGRYWPSF+
Sbjct  630   -----------------------FKPPLGTEPVTLDLQGLGKGMAWVNGHSIGRYWPSFI  666

Query  1229  AKSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             AK D C    CDYRG+Y  +KCV  CGKP+Q+WYHVPRS+L + G+N LVLFEE GG P 
Sbjct  667   AK-DECSDEPCDYRGSYSNTKCVRDCGKPTQQWYHVPRSWLNE-GDNTLVLFEEFGGNPS  724

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TD  1579
              V  +T+T+   C +  E  ++ELSC+ G++IS IKF SFG+P GSCG+F    C+   D
Sbjct  725   LVNFKTITMEKACGHAYEKKSLELSCQ-GKEISGIKFASFGDPTGSCGNFSKGSCEGKND  783

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCK-SKIRRLAVEATC  1705
              + +++  CVG+E C + +S+  F  T C    ++RLAVE  C
Sbjct  784   AMKIVEDLCVGQESCVVDISEDTFGATNCALGVVKRLAVEVVC  826



>ref|XP_007012588.1| Beta-galactosidase 7 [Theobroma cacao]
 gb|EOY30207.1| Beta-galactosidase 7 [Theobroma cacao]
Length=825

 Score =   531 bits (1368),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 274/579 (47%), Positives = 353/579 (61%), Gaps = 57/579 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR+SGGPYI TTYDYNAPLDEYGN NQPKWGHLK+LH++L S+E  L  G+  
Sbjct  293   YHGGTNFGRSSGGPYITTTYDYNAPLDEYGNPNQPKWGHLKQLHDVLRSMEYTLTRGDVK  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N D G  + +TVY  K K  CFL+N+++  D  + F G +Y+ PAWSV+ILPDC  E YN
Sbjct  353   NIDLGNSIWATVYSTKEKSSCFLSNSDNVTDAEVRFGGTDYSVPAWSVSILPDCGDEAYN  412

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+V AQT+VMVKK ++      +L+W +RPE I       K           A Q+ DQ
Sbjct  413   TAKVYAQTSVMVKKSNKAEDEPNSLEWEWRPENIEKTAVQGKGDHH-------ANQIIDQ  465

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K + ND +DYLWYMT  ++   +P++ ++ TL V    HVLHA+ N K+IGS+WA    +
Sbjct  466   KAMANDASDYLWYMTRVELANDDPLVTEKATLRVTDSGHVLHAYVNGKYIGSQWANYSSQ  525

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDL  877
              K++F+  VKL    N ISLLS TVGL NYG  F+    GV+ PV+LV    +G    DL
Sbjct  526   -KYVFEHEVKLNPGKNLISLLSATVGLHNYGPMFDLNVTGVLSPVELVAHKEDGKVVKDL  584

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S   W+Y VGL G++  L++ D  +KL W   +   DR   WYK T              
Sbjct  585   SSQKWSYKVGLDGVANKLYETDCPSKLKWASDSIPVDRNLTWYKTT--------------  630

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G+  VV+DL G+GKG AWVN H++GRYWPS++A  
Sbjct  631   --------------------FKAPLGKAPVVVDLLGLGKGHAWVNSHSLGRYWPSYIADQ  670

Query  1238  DGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
               C    CDYRG Y   KCV+ CG+P+QRWYHVPRSFL K G+N LVLFEE GG P  V+
Sbjct  671   HACKAEACDYRGPYSDKKCVSKCGEPTQRWYHVPRSFL-KDGDNTLVLFEEFGGNPSRVQ  729

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIP  1588
              QTV +GT C N   G  +ELSC   R IS+I F SFG+P G CG+F+ S C++T D + 
Sbjct  730   FQTVEIGTACINAHVGKKVELSCH-DRPISRINFASFGDPQGVCGAFKKSECESTVDAVS  788

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +++  CVG+E C+  VS+  F    C   + RLAVEA C
Sbjct  789   ILEKECVGRESCSFQVSEDKFGKAYC--AVNRLAVEAIC  825



>gb|EYU25828.1| hypothetical protein MIMGU_mgv1a026608mg, partial [Erythranthe 
guttata]
Length=814

 Score =   531 bits (1367),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 268/581 (46%), Positives = 361/581 (62%), Gaps = 58/581 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APL+EYG +NQPK+GHLKELH++L+S+E  L YGN +
Sbjct  279   YHGGTNFGRTAGGPYITTSYDYDAPLNEYGGLNQPKYGHLKELHDVLHSIEKTLTYGNIS  338

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + D+G  + +T+Y   G   CF  N N   D +I ++G +YT PAWSV+ILPDCK E YN
Sbjct  339   SIDFGNSVYATIYALNGSSSCFFGNTNSTSDATIKYQGVDYTIPAWSVSILPDCKKEAYN  398

Query  362   TARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VM  K +       ALKW +R E +       K Q       + A  L DQ
Sbjct  399   TAKVNTQTSVMEMKTNGAENEPSALKWVWRDEQVKQTVVHGKGQ-------ISASHLVDQ  451

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K VTND +DYLWYMTS K+ + +PI  + +TL VN    V+HA+ N  ++GS+WA   G 
Sbjct  452   K-VTNDVSDYLWYMTSVKLEKKDPIWSRNMTLRVNGTGQVMHAYINGDYLGSQWAT-SGV  509

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ +K +   N ISLLS TVGL NYG  FEK+  G+ GP++++   G+     DL
Sbjct  510   FNYVFEKKIKPKHGTNQISLLSATVGLQNYGAEFEKIRTGLPGPIEIIGRKGDETIIKDL  569

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGL G+    F  ++     W   +  T+RM  WYK T              
Sbjct  570   SSHKWSYQVGLKGLDNKFFNTNNSADHHWKSQDLPTNRMMTWYKTT--------------  615

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P GE+ VV+D+ G+GKG+AWVNG+++GRYWPS++A  
Sbjct  616   --------------------FKAPIGEEPVVVDMQGLGKGLAWVNGNSLGRYWPSYVADV  655

Query  1238  DGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG+Y  +KCV  CG+P+QRWYHVPRSF+ +   N+LVLFEE GG P  V 
Sbjct  656   DGCSAEPCDYRGSYDSTKCVWNCGQPTQRWYHVPRSFMNED-VNELVLFEEFGGNPSLVS  714

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCG-SFETSHCDA-TDII  1585
              QTV  GT+C +  E   MELSC  GR+IS IKF  FG+  GSCG +F+   C++  D +
Sbjct  715   FQTVRPGTVCGSAYENREMELSCE-GRQISDIKFAGFGDVRGSCGAAFQKGTCESKNDAM  773

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCKSKI-RRLAVEATC  1705
              ++  ACVGKE+C +  S+ +F +T C+  I +RL VEA C
Sbjct  774   SILVQACVGKERCVVTASEGIFGSTNCEDGISKRLVVEAVC  814



>ref|XP_004171681.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15-like [Cucumis 
sativus]
Length=827

 Score =   530 bits (1366),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 268/580 (46%), Positives = 357/580 (62%), Gaps = 57/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF R +GGPYI TTYDYNAPLDEYGN+NQPK+GHLK+LH  L S+E  L+ GN T
Sbjct  293   YHGGTNFDRMAGGPYITTTYDYNAPLDEYGNLNQPKFGHLKQLHAALKSIEKALVSGNVT  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD    +S T Y     K CF +N N+  D  + + GK++  PAWSV+ILPDC+ EVYN
Sbjct  353   TTDLTDSVSITEYATDKGKSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYN  412

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT+VMVKK ++       L+W +RPE I +     K Q       + A +L DQ
Sbjct  413   TAKVNTQTSVMVKKENKAENEPEVLEWMWRPENIDNTARLGKGQ-------VTANKLIDQ  465

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K   ND +DYLWYMTS  + + +PI   E+TL +N   H++HAF N +HIGS+WA  D  
Sbjct  466   KDAANDASDYLWYMTSVNLKKKDPIWSNEMTLRINVSGHIVHAFVNGEHIGSQWASYD-V  524

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             + ++ ++ VKL+   N ISLLS T+GL NYG  ++ +  G++GPV+L+  +G+     DL
Sbjct  525   YNYIXEQEVKLKPGKNIISLLSATIGLKNYGAQYDLIQSGIVGPVQLIGRHGDETIIKDL  584

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y VGLHG    LF  +      W   N   +RM  WYK T              
Sbjct  585   SNHKWSYEVGLHGFENRLFSPESRFATKWQSGNLPVNRMMTWYKTT--------------  630

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D V LDL G+GKG+AWVNGH+IGRYWPSF+A+ 
Sbjct  631   --------------------FKPPLGTDPVTLDLQGLGKGMAWVNGHSIGRYWPSFIAE-  669

Query  1238  DGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             DGC    CDYRG+Y  +KCV  CGKP+Q+WYHVPRS+L + G+N LVLFEE GG P  V 
Sbjct  670   DGCSDEPCDYRGSYTNTKCVRDCGKPTQQWYHVPRSWLNE-GDNTLVLFEEFGGNPSLVN  728

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIP  1588
              +T+ +   C +  E  ++ELSC+ G++I+ IKF SFG+P GSCG+F    C+   D + 
Sbjct  729   FKTIAMEKACGHAYEKKSLELSCQ-GKEITGIKFASFGDPTGSCGNFSKGSCEGKNDAMK  787

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCK-SKIRRLAVEATC  1705
             +++  C+GKE C + +S+  F  T C    ++RLAVEA C
Sbjct  788   IVEDLCIGKESCVIDISEDTFGATNCALGVVKRLAVEAVC  827



>ref|XP_006475097.1| PREDICTED: beta-galactosidase 7-like [Citrus sinensis]
Length=834

 Score =   530 bits (1366),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 277/584 (47%), Positives = 361/584 (62%), Gaps = 61/584 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPY+ T+YDY+AP+DEYG++NQPKWGHL+ELH LL S+E  L YGN T
Sbjct  296   YHGGTNFGRTSGGPYLTTSYDYDAPIDEYGHLNQPKWGHLRELHKLLKSMEKTLTYGNVT  355

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTDYG  +S+TVY  +    CFLAN N  +D +ITF+G +Y  PAWSV+ILPDCKTE +N
Sbjct  356   NTDYGNSVSATVYATEEGSSCFLANENQSEDSTITFQGSSYNLPAWSVSILPDCKTEEFN  415

Query  362   TARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT V VK+ +     + +L+W +RPE I       K   ++         L DQ
Sbjct  416   TAKVNTQTNVKVKRPNQAGNDQASLQWKWRPEMINDFVVRGKGHFAL-------NTLIDQ  468

Query  527   KVVTNDTTDYLWYMTSFKINESNPIL--GQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             K  TND +DYLWYMT+  + + +PIL     +TL +N+   VLHA+ N  ++ S+W +  
Sbjct  469   K-STNDVSDYLWYMTNTDLKDDDPILSGSSNMTLRINSSGQVLHAYVNGNYVDSQWTK-Y  526

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---  871
             G    LF+R VKL +  N ISLLS TVGL NYG  F+ V  G+ GPV LV   G+     
Sbjct  527   GASNDLFERPVKLTRGKNQISLLSATVGLQNYGSKFDMVPNGIPGPVLLVGRAGDETIIK  586

Query  872   DLSKNTWTYMVGLHGISKGLF--KLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
             DLS + WTY VGL+G+    F      +++  W   N   +R   WYK T          
Sbjct  587   DLSSHKWTYKVGLYGLDDKKFYNAKAANSERGWSSKNVPLNRRMTWYKTT----------  636

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     F+ P   D VVL+L GMGKG AWVNG+N+GRYWP++
Sbjct  637   ------------------------FEAPLENDPVVLNLQGMGKGFAWVNGYNLGRYWPTY  672

Query  1226  LAKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
             LA+ DGC    CDYRG YG +KC   CG PSQ WYHVPRS++ K G N LVLFEE GG P
Sbjct  673   LAEEDGCSTEACDYRGPYGSNKCAYNCGNPSQIWYHVPRSWI-KDGVNTLVLFEEFGGNP  731

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-T  1576
              ++  QTV VGT C    E  TMEL+C  GR+IS+IK+ SFG+P G+CG+F+   C+A  
Sbjct  732   SQINFQTVVVGTACGQAHENKTMELTCH-GRRISEIKYASFGDPQGACGAFKKGSCEAEI  790

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKS-KIRRLAVEATC  1705
             D++P+I+  CVGK+ C++  S+     T+C +  ++RL VEA C
Sbjct  791   DVLPLIEKQCVGKKSCSIEASETNLGATSCAAGTVKRLVVEALC  834



>emb|CDY32304.1| BnaC05g28820D [Brassica napus]
Length=882

 Score =   531 bits (1367),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 269/578 (47%), Positives = 360/578 (62%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YH GTNF R++GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  350   YHRGTNFDRSAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKTLTYGNIS  409

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y  +    CF  N N+  D +I+F G++Y  PAWSVTILPDCKTE YN
Sbjct  410   TIDFGNSASATIYTTQEGYSCFFGNGNENSDATISFRGESYVVPAWSVTILPDCKTEAYN  469

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  470   TAKITTQTSMMVKKPNEAEDDPSTLKWSWRPENMDNFVLRGKGEST-------NTQLFDQ  522

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVV+ND +DYLWYMT+ K  + +P +G+ ++L VN+ +HVL  F N KHIG++ A+++ K
Sbjct  523   KVVSNDQSDYLWYMTTVKFRKRDPFMGKNMSLRVNSTAHVLRVFVNGKHIGNQHAENE-K  581

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++  K +   N I LLS TVGL NYG +FE V  G+ GP+ ++  NG+ +   DL
Sbjct  582   FHYVFEKDAKFKSGRNVIFLLSITVGLQNYGAFFESVPVGITGPIFIIGRNGDEIIVKDL  641

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL+G    LFK +  +K  W   +   +R   WYK T              
Sbjct  642   SSHKWSYKTGLNGFENKLFKTESPSK--WSFESVPLNRTMTWYKTT--------------  685

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG AWVNG+NIG YW +F + S
Sbjct  686   --------------------FKAPLGNDPVVVDLLGLGKGTAWVNGNNIGCYWLAFNSSS  725

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC  +C+YRG Y   K  T CG+P+QRWYHVPRSFL   G N LVLFEEMGG P  V  
Sbjct  726   DGCSAKCNYRGAYYAEKYQTNCGEPTQRWYHVPRSFLITEGVNTLVLFEEMGGNPSLVNF  785

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT  VG++CANV E N +ELSC   + IS IKF SFG   G+CGSF    C+ + + + +
Sbjct  786   QTTRVGSVCANVYEKNVIELSC-DRKTISAIKFASFGNSDGNCGSFVKGTCEGSKNAVDI  844

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   C+GKEKC++ V+   F    C    RRL +EA C
Sbjct  845   LTKECIGKEKCSIDVTAEKFGVPDCSGVARRLPIEAIC  882



>ref|XP_010535801.1| PREDICTED: beta-galactosidase 7 [Tarenaya hassleriana]
Length=822

 Score =   528 bits (1361),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 258/574 (45%), Positives = 351/574 (61%), Gaps = 49/574 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDE+GN+NQPKWGHLK+LHN+L S+E  L YGN +
Sbjct  292   YHGGTNFGRTAGGPYITTSYDYHAPLDEFGNLNQPKWGHLKQLHNVLKSMEKSLTYGNIS  351

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + D+G  +++T+Y  K    CF++N+N   D  ++F+G  Y+ PAWSV++LPDCK   YN
Sbjct  352   DIDFGNDVTATIYAMKEGSSCFISNSNTTADALVSFQGNQYSVPAWSVSVLPDCKNVAYN  411

Query  362   TARVNAQTTVMVKKLSE-GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             TA+VN Q +VM  + ++ G ++WS+RPE         K +  V+ D      LFDQK   
Sbjct  412   TAKVNTQESVMATQDADVGGIRWSWRPEIAEQTIV--KGKGDVVAD-----YLFDQKDFA  464

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             ND +DYLWYMT  ++ + +PI  + ++L V++ +HVLHA+ N KH+G+ + + DGK+ + 
Sbjct  465   NDASDYLWYMTRVRLEKDDPIWSRNMSLRVHSNAHVLHAYVNGKHVGTHFVE-DGKYDYD  523

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLSKNT  889
             F++S++L    N I+LLS TVG  NYG +FEK   G+ GPV +V   G+     DLS + 
Sbjct  524   FEKSIELAPGTNRIALLSVTVGFQNYGPFFEKSPAGINGPVMIVGYKGDERIEKDLSAHP  583

Query  890   WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNTS  1069
             W Y VGL+G+   +F  D  +   W      T RM  WYK                    
Sbjct  584   WEYKVGLNGVESKVFSPDSGSNFKWSTEKLPTSRMLTWYK--------------------  623

Query  1070  FV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCL  1249
                           T FKTP+G D VV+DL G+GKG AW+NG +IGRYWPSF A  DGC 
Sbjct  624   --------------TSFKTPSGSDPVVVDLHGLGKGEAWINGKSIGRYWPSFKASDDGCS  669

Query  1250  -QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVT  1426
              +CDYRG Y  +KC   CG+P+Q  YHVPR+FL + G N L L EEMGG P     +T++
Sbjct  670   DECDYRGPYDSNKCTFKCGEPTQTLYHVPRAFLNENGENVLALLEEMGGDPTMASFKTMS  729

Query  1427  VGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPVIQSA  1603
             VG++CA   E N +ELSC  G+KIS IKF +FG P G CGSF    C+   D + ++   
Sbjct  730   VGSVCAKADENNVIELSCN-GKKISDIKFVNFGNPTGKCGSFAKGTCEGDKDALKLVTEE  788

Query  1604  CVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             C+GK  C L  S  +F    C   ++ L VEA C
Sbjct  789   CIGKMTCQLEASSKMFGAADCGDSVKSLVVEAVC  822



>ref|XP_004288999.1| PREDICTED: beta-galactosidase 15-like [Fragaria vesca subsp. 
vesca]
Length=827

 Score =   528 bits (1361),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 280/585 (48%), Positives = 357/585 (61%), Gaps = 68/585 (12%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR + G YI T+YDYNAPLDEYG +NQPKWGHLK+LH  L S+E  L +GN T
Sbjct  294   YHGGTNFGRVAAG-YITTSYDYNAPLDEYGALNQPKWGHLKQLHETLKSMEYTLTHGNIT  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              TD G  +++TVY  +    CFL N++ K D +I+F G NY  PAWSV+ILPDCKTE YN
Sbjct  353   ATDLGNNVTTTVYATEESSSCFLCNSDYKLDANISFRGTNYFVPAWSVSILPDCKTEAYN  412

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QTTV VK+ ++      +L W++RPE I   K   K +  V         L +Q
Sbjct  413   TAKVNTQTTVKVKRNNKAEDEPQSLHWTWRPENIDETKILGKGEVVV-------NHLMEQ  465

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQE-LTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             K   ND +DYLWYMTS  + + +PI G+  +TL +N    +LHA+ N +HIGS+ A  + 
Sbjct  466   KEAANDESDYLWYMTSVDLKKDDPIWGKNNITLRINGTGCILHAYVNGEHIGSDQAARN-  524

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG----M  871
                  F+R+V L+   N ISLLS T G  NYG  ++    G++GPV LV  NG+      
Sbjct  525   -----FERNVTLKDGRNIISLLSATTGFSNYGGGYDLQPAGILGPVVLVGQNGDDESVIK  579

Query  872   DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             DLS + W+Y VGLHG++  LF  +   K  W   N   +    WYK T            
Sbjct  580   DLSGHKWSYKVGLHGLTNKLFSSEKATK--WSSENLPVNTTMTWYKTT------------  625

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   FK P G D VV+DL G+GKG AWVNGH+IGRYWPSFLA
Sbjct  626   ----------------------FKAPLGTDPVVVDLQGLGKGNAWVNGHSIGRYWPSFLA  663

Query  1232  KSDGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEV  1408
             K+DGC  +CDYRG Y   KC + CG+P+QRWYH+PRSF+R    N LVLFEE GG P  V
Sbjct  664   KTDGCSDECDYRGKYESKKCNSKCGEPTQRWYHIPRSFMRDDDENTLVLFEEFGGDPSLV  723

Query  1409  RVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFET------SHCD  1570
             + QT+ VG++CAN  E NT+EL+C  GR IS IKF SFG P G+CGSF+         CD
Sbjct  724   KFQTIAVGSVCANAYENNTLELACD-GRSISAIKFASFGNPQGTCGSFKNGTSFTKGTCD  782

Query  1571  ATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              ++ + +IQ  CVGKEKC++ VS   F +T C   ++RLAVEA C
Sbjct  783   GSNALSIIQKECVGKEKCSIDVSGDKFDSTNCGDIVKRLAVEAVC  827



>ref|XP_006452850.1| hypothetical protein CICLE_v10010454mg [Citrus clementina]
 gb|ESR66090.1| hypothetical protein CICLE_v10010454mg [Citrus clementina]
Length=834

 Score =   529 bits (1362),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 278/584 (48%), Positives = 360/584 (62%), Gaps = 61/584 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPY+ T+YDY+AP+DEYG++NQPKWGHL+ELH LL S+E  L +GN T
Sbjct  296   YHGGTNFGRTSGGPYLTTSYDYDAPIDEYGHLNQPKWGHLRELHKLLKSMEKTLTHGNVT  355

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTDYG  +S+TVY  +    CFLAN N  +D +ITF+G +Y  PAWSV+ILPDCKTE +N
Sbjct  356   NTDYGNSVSATVYATEEGSSCFLANENQSEDSTITFQGSSYNLPAWSVSILPDCKTEEFN  415

Query  362   TARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT V VK+ ++       L+W +RPE I       K   ++         L DQ
Sbjct  416   TAKVNTQTNVKVKRPNQAGNDQAPLQWKWRPEMINDFVVRGKGHFAL-------NTLIDQ  468

Query  527   KVVTNDTTDYLWYMTSFKINESNPIL--GQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             K  TND +DYLWYMT+  + + +PIL     +TL +N+   VLHA+ N  ++ S+W +  
Sbjct  469   K-STNDVSDYLWYMTNADLKDDDPILSGSSNMTLRINSSGQVLHAYVNGNYVDSQWTK-Y  526

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---  871
             G    LF+R VKL +  N ISLLS TVGL NYG  F+ V  G+ GPV LV   G+     
Sbjct  527   GASNDLFERPVKLTRGKNQISLLSATVGLQNYGSKFDMVPNGIPGPVLLVGRVGDETIIK  586

Query  872   DLSKNTWTYMVGLHGISKGLF--KLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
             DLS + WTY VGL+G+    F      +++  W   N   +R   WYK T          
Sbjct  587   DLSSHKWTYKVGLYGLDDKKFYNAKAANSERGWSSKNVPLNRRMTWYKTT----------  636

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     F+ P   D VVL+L GMGKG AWVNG+N+GRYWP++
Sbjct  637   ------------------------FEVPLENDPVVLNLQGMGKGFAWVNGYNLGRYWPTY  672

Query  1226  LAKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
             LA+ DGC    CDYRG YG  KC   CG PSQ WYHVPRS+L K G N LVLFEE GG P
Sbjct  673   LAEEDGCSTESCDYRGPYGSDKCAYNCGNPSQIWYHVPRSWL-KDGVNTLVLFEEFGGNP  731

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-T  1576
              ++  QTV VGT C    E  TMEL+C  GR+IS+IK+ SFG+P G+CG+F+   C+A  
Sbjct  732   SQINFQTVVVGTACGQAHENKTMELTCH-GRRISEIKYASFGDPQGACGAFKKGSCEAEI  790

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKS-KIRRLAVEATC  1705
             D++P+I+  CVGK+ C++  S+A    T+C +  ++RL VEA C
Sbjct  791   DVLPLIEKQCVGKKSCSVEASEANLGATSCVTGTVKRLVVEALC  834



>ref|XP_006368617.1| hypothetical protein POPTR_0001s06300g, partial [Populus trichocarpa]
 gb|ERP65186.1| hypothetical protein POPTR_0001s06300g, partial [Populus trichocarpa]
Length=783

 Score =   526 bits (1356),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 270/578 (47%), Positives = 361/578 (62%), Gaps = 71/578 (12%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR++GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH+LL+S+ED+L  GN +
Sbjct  267   YHGGTNFGRSAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKQLHDLLHSMEDILTTGNVS  326

Query  182   NTDYG-RMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
             + D G   +  T+Y  +G   CFLAN +   D +I F+G NYT PAWSV+ILPDC+   Y
Sbjct  327   SVDLGDDSVWGTIYSNEGGSSCFLANVDQGTDKTINFQGINYTVPAWSVSILPDCQNVSY  386

Query  359   NTARVNAQTTVMVKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDA--KQLFDQKV  532
             NTA          K +S   LKWS+RPE          +  ++L+   D    Q+ DQK 
Sbjct  387   NTA----------KPIS---LKWSWRPEM---------DDKTILLGKGDVTINQILDQKE  424

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
               ND +DYL+YMTS  + + +P+    +TL V +   +LHAF N + IGS+W+++ G+  
Sbjct  425   AANDLSDYLFYMTSINLKKDDPVWSYNMTLRVKSSGQILHAFVNGELIGSQWSKNGGE-S  483

Query  713   FLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGE----GMDLS  880
             F+F+++VKL    NTISLLS TVG  NYG  F+ V  G+ GPV+L+  +G+      DLS
Sbjct  484   FVFEQNVKLNHKKNTISLLSATVGFTNYGANFDLVPSGITGPVELIGYHGDDETVAKDLS  543

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
                W+Y +GL G+++ L+       L W E +F  +R   WYK                 
Sbjct  544   SQKWSYKIGLEGLNQELYS---SQSLKWQEDSFPVNRTLTWYK-----------------  583

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                              T FK P G D VV+DL GMGKG+AWVNG++IGRYWPSF+A+ D
Sbjct  584   -----------------TVFKAPLGTDPVVVDLLGMGKGLAWVNGNSIGRYWPSFIAEGD  626

Query  1241  GCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
               L+ CDYRG+Y  SKC++ CG P+QRWYHVPRSFL  TG+N LVLFEE GG P  V  Q
Sbjct  627   CNLEPCDYRGSYDSSKCLSNCGHPTQRWYHVPRSFLNDTGDNTLVLFEEFGGNPSSVNFQ  686

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPVI  1594
             T+ +G+ C +  E   +ELSC+ GR IS +KF SFG P G+CGSF    C+ + D + V+
Sbjct  687   TIAIGSACISAEENRKIELSCQ-GRSISAVKFASFGNPQGACGSFVKGFCEGSKDALSVV  745

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSK-IRRLAVEATC  1705
             + ACVG+E CT+ VS+  F +TTC    I+ L+VEA C
Sbjct  746   EKACVGQESCTIDVSEDTFSSTTCGDDVIKTLSVEAIC  783



>ref|XP_009120777.1| PREDICTED: beta-galactosidase [Brassica rapa]
Length=829

 Score =   526 bits (1356),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 269/581 (46%), Positives = 352/581 (61%), Gaps = 57/581 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH LL S+E  L YGN +
Sbjct  293   YHGGTNFGRVAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKQLHTLLKSMEKPLTYGNIS  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  +++TVY    K  CF+ N N   D  + F+GK+Y  PAWSV++LPDC  E YN
Sbjct  353   TIDLGNSVTATVYSTNEKSSCFIGNVNATADALVNFKGKDYNVPAWSVSVLPDCDKEAYN  412

Query  362   TARVNAQTTVMVKKLSEGA--LKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQK  529
             TARVN QT+++ +   +    LKW++RPE           Q ++L  + D  AK L DQK
Sbjct  413   TARVNTQTSIITEDSCDEPEKLKWTWRPE--------FTTQKTILKGSGDLIAKGLVDQK  464

Query  530   VVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKF  709
              VTND +DYLWYMT   +++ +PI  + ++L V++ +HVLHA+ N K++G++  +D+ KF
Sbjct  465   DVTNDASDYLWYMTRVHLDKKDPIWSRNMSLRVHSNAHVLHAYVNGKYVGNQIVRDN-KF  523

Query  710   KFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLS  880
              + F++ V L    N ++LLS +VGL NYG +FE    G+ GPVKLV   G+     DLS
Sbjct  524   DYRFEKKVNLVHGTNHLALLSVSVGLQNYGPFFESGPTGINGPVKLVGYKGDETVEKDLS  583

Query  881   KNTWTYMVGLHGISKGLFKLD--DHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             K+ W Y +GL+G +  LF L   +H++L W       DRM  WYK               
Sbjct  584   KHQWDYKIGLNGFNNKLFSLKSANHHQLKWSTEKLPADRMLSWYKAN-------------  630

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  FK P G+D V++DL G+GKG  W+NG +IGRYWPSF + 
Sbjct  631   ---------------------FKAPLGKDPVIVDLNGLGKGEVWINGQSIGRYWPSFNSS  669

Query  1235  SDGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
              DGC  +CDYRG YG  KC   CGKP+QRWYHVPRSFL   G+N + LFEEMGG P  V+
Sbjct  670   EDGCTEECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNDKGHNTITLFEEMGGDPSMVK  729

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCD-ATDIIP  1588
              +TV  G +CA   E N +ELSC   R IS +KF SFG P G CGSF    C+ A D   
Sbjct  730   FKTVVTGRVCAKAHEHNKVELSCN-NRPISAVKFASFGNPSGLCGSFAAGTCEGAKDAAK  788

Query  1589  VIQSACVGKEKCTLHVSDALFPTTT--CKSKIRRLAVEATC  1705
             ++   CVGK  CT++VS   F +T   C    +RL VE  C
Sbjct  789   IVAKECVGKLNCTMNVSSHKFGSTNLDCGDSPKRLFVELEC  829



>gb|AAK76465.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=621

 Score =   519 bits (1336),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 267/578 (46%), Positives = 349/578 (60%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDE+GN+NQPKWGHLK+LH +L S+E  L YGN +
Sbjct  89    YHGGTNFGRVAGGPYITTSYDYHAPLDEFGNLNQPKWGHLKQLHTVLKSMEKSLTYGNIS  148

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  + +T+Y  K    CF+ N N   D  + F+GK+Y  PAWSV++LPDC  E YN
Sbjct  149   RIDLGNSIKATIYTTKEGSSCFIGNVNATADALVNFKGKDYHVPAWSVSVLPDCDKEAYN  208

Query  362   TARVNAQTTVMVKKLSEGA-LKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQKV  532
             TA+VN QT++M +  S+   L+W++RPE+          Q  +L  + D  AK L DQK 
Sbjct  209   TAKVNTQTSIMTEDSSKPERLEWTWRPESA---------QKMILKGSGDLIAKGLVDQKD  259

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
             VTND +DYLWYMT   +++ +P+  + +TL V++ +HVLHA+ N K++G+++ + DGKF 
Sbjct  260   VTNDASDYLWYMTRLHLDKKDPLWSRNMTLRVHSNAHVLHAYVNGKYVGNQFVK-DGKFD  318

Query  713   FLFQRSVK-LRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLS  880
             + F+R V  L    N ISLLS +VGL NYG +FE    G+ GPV LV   GE     DLS
Sbjct  319   YRFERKVNHLVHGTNHISLLSVSVGLQNYGPFFESGPTGINGPVSLVGYKGEETIEKDLS  378

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
             ++ W Y +GL+G +  LF +       W      T RM  WYK                 
Sbjct  379   QHQWDYKIGLNGYNDKLFSIKSVGHQKWANEKLPTGRMLTWYKAK---------------  423

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                FK P G++ V++DL G+GKG AW+NG +IGRYWPSF +  D
Sbjct  424   -------------------FKAPLGKEPVIVDLNGLGKGEAWINGQSIGRYWPSFNSSDD  464

Query  1241  GCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC  +CDYRG YG  KC   CGKP+QRWYHVPRSFL  +G+N + LFEEMGG P  V  +
Sbjct  465   GCKDKCDYRGAYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSMVNFK  524

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPVI  1594
             TV VGT+CA   E N +ELSC   R IS +KF SFG P+G CGSF    C    D    +
Sbjct  525   TVVVGTVCARAHEHNKVELSCH-NRPISAVKFASFGNPLGHCGSFAVGTCQGDKDAAKTV  583

Query  1595  QSACVGKEKCTLHVSDALFPTT-TCKSKIRRLAVEATC  1705
                CVGK  CT++VS   F +T  C    ++LAVE  C
Sbjct  584   AKECVGKLNCTVNVSSDTFGSTLDCGDSPKKLAVELEC  621



>ref|XP_003595331.1| Beta-galactosidase [Medicago truncatula]
 gb|AES65582.1| beta-galactosidase-like protein [Medicago truncatula]
Length=830

 Score =   524 bits (1349),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 274/581 (47%), Positives = 355/581 (61%), Gaps = 58/581 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+ QPKWGHLKELH +L S+E+ L  GN +
Sbjct  293   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNIAQPKWGHLKELHLVLKSMENSLTNGNVS  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  + +TVY       CFL N N   D ++TF+G  Y  PAWSV+ILPDC+TE YN
Sbjct  353   KIDLGSYVKATVYATNDSSSCFLTNTNTTTDATVTFKGNTYNVPAWSVSILPDCQTEEYN  412

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT++MVK+ ++      ALKW +R E + +   G   +SSV         + DQ
Sbjct  413   TAKVNVQTSIMVKRENKAEDEPEALKWVWRAENVHNSLIG---KSSV-----SKNTIVDQ  464

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             K+  ND++DYLWYMT   IN+ +P+      L +N   HV+HAF N +HIGS WA   G 
Sbjct  465   KIAANDSSDYLWYMTRLDINQKDPVWTNNTILRINGTGHVIHAFVNGEHIGSHWAT-YGI  523

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
                 F+ ++KL+   N ISLLS TVGL NYG+ ++K   G++ P++L+   G+     DL
Sbjct  524   HNDQFETNIKLKHGRNDISLLSVTVGLQNYGKEYDKWQDGLVSPIELIGTKGDETIIKDL  583

Query  878   SKNTWTYMVGLHGISKGLFKLDDH--NKLTWHESNFQTDRMFIWYKVTQSiplitlldlp  1051
             S + WTY VGLHG     F  D    +   W  +    ++M  WYK T            
Sbjct  584   SSHKWTYKVGLHGWENKFFSQDTFFASSSKWESNELPINKMLTWYKTT------------  631

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   FK P   D +V+DL GMGKG AWVNGH++GRYWPS+ A
Sbjct  632   ----------------------FKAPLESDPIVVDLQGMGKGYAWVNGHSLGRYWPSYNA  669

Query  1232  KSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
               DGC    CDYRG Y  +KCV+ CGKPSQRWYHVPR F+ + G N LVLFEE+GG P +
Sbjct  670   DEDGCSDDPCDYRGEYNDTKCVSNCGKPSQRWYHVPRDFI-EDGVNTLVLFEEIGGNPSQ  728

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDI  1582
             +  QTV VG+ CAN  E  T+ELSC  GR IS IKF SFG P G+CG+F    C++  + 
Sbjct  729   INFQTVIVGSACANAYENKTLELSCH-GRSISDIKFASFGNPQGTCGAFTKGSCESNNEA  787

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + ++Q ACVGKE C++ VS+  F  T C + ++RLAVEA C
Sbjct  788   LSLVQKACVGKESCSIDVSEKTFGATNCGNMVKRLAVEAVC  828



>sp|P49676.1|BGAL_BRAOL RecName: Full=Beta-galactosidase; Short=Lactase; Flags: Precursor 
[Brassica oleracea]
 emb|CAA59162.1| beta-galactosidase [Brassica oleracea]
Length=828

 Score =   522 bits (1345),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 266/580 (46%), Positives = 349/580 (60%), Gaps = 56/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH LL S+E  L YGN +
Sbjct  293   YHGGTNFGRVAGGPYITTSYDYDAPLDEYGNLNQPKWGHLKQLHTLLKSMEKPLTYGNIS  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  +++TVY    K  CF+ N N   D  + F+GK+Y  PAWSV++LPDC  E YN
Sbjct  353   TIDLGNSVTATVYSTNEKSSCFIGNVNATADALVNFKGKDYNVPAWSVSVLPDCDKEAYN  412

Query  362   TARVNAQTTVMVKKLSEGA--LKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQK  529
             TARVN QT+++ +   +    LKW++RPE           Q ++L  + D  AK L DQK
Sbjct  413   TARVNTQTSIITEDSCDEPEKLKWTWRPE--------FTTQKTILKGSGDLIAKGLVDQK  464

Query  530   VVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKF  709
              VTND +DYLWYMT   +++ +PI  + ++L V++ +HVLHA+ N K++G++  +D+ KF
Sbjct  465   DVTNDASDYLWYMTRVHLDKKDPIWSRNMSLRVHSNAHVLHAYVNGKYVGNQIVRDN-KF  523

Query  710   KFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLS  880
              + F++ V L    N ++LLS +VGL NYG +FE    G+ GPVKLV   G+     DLS
Sbjct  524   DYRFEKKVNLVHGTNHLALLSVSVGLQNYGPFFESGPTGINGPVKLVGYKGDETIEKDLS  583

Query  881   KNTWTYMVGLHGISKGLFKLDD--HNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             K+ W Y +GL+G +  LF +    H+   W       DRM  WYK               
Sbjct  584   KHQWDYKIGLNGFNHKLFSMKSAGHHHRKWSTEKLPADRMLSWYKAN-------------  630

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  FK P G+D V++DL G+GKG  W+NG +IGRYWPSF + 
Sbjct  631   ---------------------FKAPLGKDPVIVDLNGLGKGEVWINGQSIGRYWPSFNSS  669

Query  1235  SDGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
              +GC  +CDYRG YG  KC   CGKP+QRWYHVPRSFL   G+N + LFEEMGG P  V+
Sbjct  670   DEGCTEECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNDKGHNTITLFEEMGGDPSMVK  729

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCD-ATDIIP  1588
              +TV  G +CA   E N +ELSC   R IS +KF SFG P G CGSF    C+ A D + 
Sbjct  730   FKTVVTGRVCAKAHEHNKVELSCN-NRPISAVKFASFGNPSGQCGSFAAGSCEGAKDAVK  788

Query  1589  VIQSACVGKEKCTLHVSDALFPTT-TCKSKIRRLAVEATC  1705
             V+   CVGK  CT++VS   F +   C    +RL VE  C
Sbjct  789   VVAKECVGKLNCTMNVSSHKFGSNLDCGDSPKRLFVEVEC  828



>ref|XP_006290000.1| hypothetical protein CARUB_v10003630mg [Capsella rubella]
 gb|EOA22898.1| hypothetical protein CARUB_v10003630mg [Capsella rubella]
Length=827

 Score =   522 bits (1344),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 267/579 (46%), Positives = 348/579 (60%), Gaps = 56/579 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH +L S+E  L YGN +
Sbjct  294   YHGGTNFGRVAGGPYITTSYDYHAPLDEYGNLNQPKWGHLKQLHAVLKSIEKPLTYGNIS  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  + +T+Y  K    CF+ N N   D  + F GK+Y  PAWSV+ILPDC  E YN
Sbjct  354   RIDLGNSIKATIYTTKEGSSCFIGNVNATADALVNFHGKDYHVPAWSVSILPDCDKEAYN  413

Query  362   TARVNAQTTVMVKKLSEG-ALKWSYRPETIMHLKYGHKNQSSVLIDA--LDAKQLFDQKV  532
             TA+VN QT++M    S+   L+W++RPE+          Q ++L     L AK L DQK 
Sbjct  414   TAKVNTQTSIMTDDSSKPHMLQWTWRPESA---------QKTILKGRGNLIAKGLVDQKD  464

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
             VTND +DYLWYMT   +++ +P+  + ++L V++ +HVLHA+ N K+IG ++ + DGKF 
Sbjct  465   VTNDASDYLWYMTRVHLDKKDPLWSRNMSLRVHSNAHVLHAYVNGKYIGHQFVK-DGKFD  523

Query  713   FLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLSK  883
             + F+R V L    N ISLLS +VGL NYG +F     G+ GPV LV   GE     DLSK
Sbjct  524   YRFERKVNLVHGTNHISLLSVSVGLQNYGPFFANGPTGINGPVSLVGYKGEETIEKDLSK  583

Query  884   NTWTYMVGLHGISKGLFKLDD--HNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             + W Y +G++G +  LF  +    + + W      T RM  WYK                
Sbjct  584   HQWDYKIGMNGYNHKLFSTNSIGRHHVKWANEKLATGRMLTWYKA---------------  628

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G+D V++D  G+GKG AW+NG +IGRYWPSF +  
Sbjct  629   -------------------HFKAPLGKDPVIVDFNGLGKGEAWINGQSIGRYWPSFNSSD  669

Query  1238  DGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             DGC  +CDYRG YG  KC   CGKP+QRWYHVPRSFL  +G+N + LFEEMGG P +V  
Sbjct  670   DGCKDECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSKVNF  729

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPV  1591
             +TV VGT+CA   E N +ELSC   R IS +KF SFG P+G CGSF    C    D +  
Sbjct  730   KTVVVGTVCARAHEHNKVELSCH-DRAISAVKFASFGNPVGHCGSFAVGTCQGDKDAVKT  788

Query  1592  IQSACVGKEKCTLHVSDALFPTTT-CKSKIRRLAVEATC  1705
             +   CVGK  CT+ VS   F +++ C    ++LAVE  C
Sbjct  789   LVEKCVGKLNCTIDVSSDTFGSSSDCGDSPKKLAVELEC  827



>ref|XP_010541689.1| PREDICTED: beta-galactosidase 7-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010541690.1| PREDICTED: beta-galactosidase 7-like isoform X2 [Tarenaya hassleriana]
Length=823

 Score =   521 bits (1343),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 266/574 (46%), Positives = 344/574 (60%), Gaps = 49/574 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDE+GN+NQPKWGHLKELHN+L S+E  L YGN +
Sbjct  293   YHGGTNFGRTAGGPYITTSYDYHAPLDEFGNLNQPKWGHLKELHNVLKSMERSLTYGNIS  352

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + D G  ++ T Y       CF++NAN   D  ++F+G  Y  PAWSV++LPDCK EVYN
Sbjct  353   DIDMGNSVTVTTYATSEGSSCFISNANTTVDAVVSFQGNQYNVPAWSVSVLPDCKKEVYN  412

Query  362   TARVNAQTTVMVKKLSE-GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             TA+V+ Q +VMV + +    ++WS+RPE  M      K +  V+     A  LFDQK V 
Sbjct  413   TAKVSTQESVMVAEDAHVSGIQWSWRPE--MAEDTILKGKGDVV-----ASGLFDQKAVA  465

Query  539   NDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKFL  718
             ND +DYLWYMT   +++S+PI    ++L V++ +HVLHA+ N +H+G+ + + DGK+ + 
Sbjct  466   NDASDYLWYMTRVHLDKSDPIWSHNMSLRVHSNAHVLHAYVNGEHVGTHFVK-DGKYDYD  524

Query  719   FQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLSKNT  889
             F++SVKL    N I+LLS TVG  NYG +FEK   G+ GPV +V   G+     DLS + 
Sbjct  525   FEKSVKLVHGTNRIALLSVTVGFHNYGAFFEKNAAGINGPVSIVGYKGDERIEKDLSGHQ  584

Query  890   WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNTS  1069
             W Y +GL+GI   +F  D  + L W    F T RM  WYK                    
Sbjct  585   WEYKIGLNGIENKVFSPDSASNLKWSTQQFPTFRMLTWYK--------------------  624

Query  1070  FV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCL  1249
                           T F TP+G   VV+DL G+GKG AW+NG +IGRYWPSF A +DGC 
Sbjct  625   --------------TPFDTPSGNSPVVVDLNGLGKGEAWINGRSIGRYWPSFDADNDGCS  670

Query  1250  -QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVT  1426
              +CDYRG Y  +KC   CG+P+QR YHVPR FL    +N L L EEMGG P     +T+ 
Sbjct  671   EECDYRGPYDSNKCAFKCGEPTQRLYHVPRDFLNGNSSNTLTLLEEMGGDPSMASFKTIG  730

Query  1427  VGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCD-ATDIIPVIQSA  1603
             VG+ CA   E   +ELSC  G+ IS +KF SFG P G CGSF    CD A D   V  + 
Sbjct  731   VGSACARAEENKVVELSCN-GKPISAVKFVSFGNPTGKCGSFAKGMCDGAEDAEAVASTE  789

Query  1604  CVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             CVGK  C L  S  +F    C    + LAVE  C
Sbjct  790   CVGKMTCKLEASSTVFGAADCGDLAKSLAVEVVC  823



>emb|CAB64743.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=788

 Score =   520 bits (1338),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 267/578 (46%), Positives = 349/578 (60%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDE+GN+NQPKWGHLK+LH +L S+E  L YGN +
Sbjct  256   YHGGTNFGRVAGGPYITTSYDYHAPLDEFGNLNQPKWGHLKQLHTVLKSMEKSLTYGNIS  315

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  + +T+Y  K    CF+ N N   D  + F+GK+Y  PAWSV++LPDC  E YN
Sbjct  316   RIDLGNSIKATIYTTKEGSSCFIGNVNATADALVNFKGKDYHVPAWSVSVLPDCDKEAYN  375

Query  362   TARVNAQTTVMVKKLSEGA-LKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQKV  532
             TA+VN QT++M +  S+   L+W++RPE+          Q  +L  + D  AK L DQK 
Sbjct  376   TAKVNTQTSIMTEDSSKPERLEWTWRPESA---------QKMILKGSGDLIAKGLVDQKD  426

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
             VTND +DYLWYMT   +++ +P+  + +TL V++ +HVLHA+ N K++G+++ + DGKF 
Sbjct  427   VTNDASDYLWYMTRLHLDKKDPLWSRNMTLRVHSNAHVLHAYVNGKYVGNQFVK-DGKFD  485

Query  713   FLFQRSVK-LRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLS  880
             + F+R V  L    N ISLLS +VGL NYG +FE    G+ GPV LV   GE     DLS
Sbjct  486   YRFERKVNHLVHGTNHISLLSVSVGLQNYGPFFESGPTGINGPVSLVGYKGEETIEKDLS  545

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
             ++ W Y +GL+G +  LF +       W      T RM  WYK                 
Sbjct  546   QHQWDYKIGLNGYNDKLFSIKSVGHQKWANEKLPTGRMLTWYKAK---------------  590

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                FK P G++ V++DL G+GKG AW+NG +IGRYWPSF +  D
Sbjct  591   -------------------FKAPLGKEPVIVDLNGLGKGEAWINGQSIGRYWPSFNSSDD  631

Query  1241  GCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC  +CDYRG YG  KC   CGKP+QRWYHVPRSFL  +G+N + LFEEMGG P  V  +
Sbjct  632   GCKDECDYRGAYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSMVNFK  691

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPVI  1594
             TV VGT+CA   E N +ELSC   R IS +KF SFG P+G CGSF    C    D    +
Sbjct  692   TVVVGTVCARAHEHNKVELSCH-NRPISAVKFASFGNPLGHCGSFAVGTCQGDKDAAKTV  750

Query  1595  QSACVGKEKCTLHVSDALFPTT-TCKSKIRRLAVEATC  1705
                CVGK  CT++VS   F +T  C    ++LAVE  C
Sbjct  751   AKECVGKLNCTVNVSSDTFGSTLDCGDSPKKLAVELEC  788



>ref|NP_568399.4| beta-galactosidase 7 [Arabidopsis thaliana]
 sp|Q9SCV5.2|BGAL7_ARATH RecName: Full=Beta-galactosidase 7; Short=Lactase 7; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED92880.1| beta-galactosidase 7 [Arabidopsis thaliana]
Length=826

 Score =   520 bits (1340),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 267/578 (46%), Positives = 349/578 (60%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDE+GN+NQPKWGHLK+LH +L S+E  L YGN +
Sbjct  294   YHGGTNFGRVAGGPYITTSYDYHAPLDEFGNLNQPKWGHLKQLHTVLKSMEKSLTYGNIS  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  + +T+Y  K    CF+ N N   D  + F+GK+Y  PAWSV++LPDC  E YN
Sbjct  354   RIDLGNSIKATIYTTKEGSSCFIGNVNATADALVNFKGKDYHVPAWSVSVLPDCDKEAYN  413

Query  362   TARVNAQTTVMVKKLSEGA-LKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQKV  532
             TA+VN QT++M +  S+   L+W++RPE+          Q  +L  + D  AK L DQK 
Sbjct  414   TAKVNTQTSIMTEDSSKPERLEWTWRPESA---------QKMILKGSGDLIAKGLVDQKD  464

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
             VTND +DYLWYMT   +++ +P+  + +TL V++ +HVLHA+ N K++G+++ + DGKF 
Sbjct  465   VTNDASDYLWYMTRLHLDKKDPLWSRNMTLRVHSNAHVLHAYVNGKYVGNQFVK-DGKFD  523

Query  713   FLFQRSVK-LRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLS  880
             + F+R V  L    N ISLLS +VGL NYG +FE    G+ GPV LV   GE     DLS
Sbjct  524   YRFERKVNHLVHGTNHISLLSVSVGLQNYGPFFESGPTGINGPVSLVGYKGEETIEKDLS  583

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
             ++ W Y +GL+G +  LF +       W      T RM  WYK                 
Sbjct  584   QHQWDYKIGLNGYNDKLFSIKSVGHQKWANEKLPTGRMLTWYKAK---------------  628

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                FK P G++ V++DL G+GKG AW+NG +IGRYWPSF +  D
Sbjct  629   -------------------FKAPLGKEPVIVDLNGLGKGEAWINGQSIGRYWPSFNSSDD  669

Query  1241  GCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC  +CDYRG YG  KC   CGKP+QRWYHVPRSFL  +G+N + LFEEMGG P  V  +
Sbjct  670   GCKDECDYRGAYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSMVNFK  729

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPVI  1594
             TV VGT+CA   E N +ELSC   R IS +KF SFG P+G CGSF    C    D    +
Sbjct  730   TVVVGTVCARAHEHNKVELSCH-NRPISAVKFASFGNPLGHCGSFAVGTCQGDKDAAKTV  788

Query  1595  QSACVGKEKCTLHVSDALFPTTT-CKSKIRRLAVEATC  1705
                CVGK  CT++VS   F +T  C    ++LAVE  C
Sbjct  789   AKECVGKLNCTVNVSSDTFGSTLDCGDSPKKLAVELEC  826



>ref|XP_008811417.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 13-like [Phoenix 
dactylifera]
Length=823

 Score =   517 bits (1331),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 272/580 (47%), Positives = 357/580 (62%), Gaps = 59/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI TTYDY+APLDEYGN  QPKWGHLKELH  +Y +E  L++G+  
Sbjct  291   YHGGTNFGRTTGGPYITTTYDYDAPLDEYGNKRQPKWGHLKELHAAIYMMEQALIHGDVK  350

Query  182   NTDYGRMMSSTVYEYKG-KKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
             + +  + + +T Y   G    CF++N N+  D ++ FEG  Y  PAWSV+ILPDCK EV+
Sbjct  351   DVELSKGVWATKYIANGITPGCFISNTNENSDATVDFEGAKYFVPAWSVSILPDCKQEVH  410

Query  359   NTARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             NTA+VN QT++MVKK +        LKWS+RPET+ H   G       L  +     L +
Sbjct  411   NTAKVNVQTSIMVKKPNTAENEPNDLKWSWRPETLRHSLKG-------LGGSFTDYTLLE  463

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             Q   T D +DYLWYMTS    +       E+TL VN+  H+L+AF N   IGSE+A  +G
Sbjct  464   QITTTLDESDYLWYMTSVDTKQCGITQEHEVTLRVNSTGHILYAFVNGHLIGSEYA-PNG  522

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
              F F+F+R V +    N ISLLS TVGL  YG +FE++  G++ GPV+L+  +   +DLS
Sbjct  523   NFTFMFERKVMIEPGENKISLLSATVGLKTYGSFFEQMPAGIVGGPVQLIGDDFT-IDLS  581

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
             KN W+Y +GL G  K L+  +  +K  W++    T R F WYK                 
Sbjct  582   KNEWSYKIGLDGEKKKLYLDNPEDK--WYDEKLPTKRPFTWYK-----------------  622

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                              T F+ P G D VV+DL GMGKG AWVNG+++GRYW S+L+ ++
Sbjct  623   -----------------TKFQAPLGLDPVVIDLLGMGKGAAWVNGNSLGRYWTSYLSSTN  665

Query  1241  GCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             G  +  C+YRGNY   KC TGCG+PSQRWYHVPRSFL+    N L+LFEE GG P ++  
Sbjct  666   GGCRDYCEYRGNYQSQKCQTGCGEPSQRWYHVPRSFLKAGEPNTLILFEEAGGDPSKINF  725

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QTV+VGTICA + +G T+ LSC+ G+ ISKI    FGEP GSCG FE S CD+ +    I
Sbjct  726   QTVSVGTICATIDQGKTVSLSCQNGQSISKIDITRFGEPEGSCGRFEKSGCDSNEAYFAI  785

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSK---IRRLAVEATC  1705
              +ACVGKE C++  S+ L     CKS     ++L V+ATC
Sbjct  786   SNACVGKESCSIQNSENLL--GGCKSNSLTSKKLVVQATC  823



>ref|XP_009775909.1| PREDICTED: beta-galactosidase 7-like [Nicotiana sylvestris]
Length=743

 Score =   513 bits (1321),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 265/486 (55%), Positives = 327/486 (67%), Gaps = 49/486 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI TTYDY+APL+EYG +NQPK+GHLKELH +L S+E +L YGNAT
Sbjct  294   YHGGTNFGRVAGGPYITTTYDYDAPLNEYGQLNQPKYGHLKELHEILKSVEKLLTYGNAT  353

Query  182   NTDYGR---MMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTE  352
                YG      +ST+YEY+G +VCFLANANDK+D    FEGKNYT PAWSV+ILPDC   
Sbjct  354   QKAYGDDDWQYTSTMYEYQGSRVCFLANANDKNDRIFNFEGKNYTVPAWSVSILPDCVNV  413

Query  353   VYNTARVNAQTTVMVKKLSEG----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
              YNTA+VNA   VMV+K + G     L WS+R E   HLK    N     +  L A QL 
Sbjct  414   KYNTAKVNAPKKVMVRKPNNGDNPNGLDWSWRAEKPSHLKPSFINIKKKGV--LYANQLL  471

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQKVV NDT+DYLWYMTS  I ES+P+ G E  LEV+T +HVL+AFFN KHIG++WA+ D
Sbjct  472   DQKVVANDTSDYLWYMTSVDIKESDPLYGGEAVLEVHTDAHVLYAFFNGKHIGTKWAK-D  530

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGMDLS  880
             GK+ F FQ+ +K++   NT+SLLS TVG PNYG YF+KV  G++GPV L  P+G   DL+
Sbjct  531   GKYSFDFQQLLKIKPGKNTLSLLSVTVGFPNYGAYFDKVKNGILGPVVLKSPSGVVKDLT  590

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESN-FQTDRMFIWYKVTQSiplitlldlpii  1057
              N W Y +GL G+ + L++ +D+    W  +   QT+RMF+WYK T              
Sbjct  591   NNQWEYKIGLEGLERRLWEDEDYMHRNWKPAQTLQTNRMFVWYKTT--------------  636

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF--LA  1231
                                 FKTP+G+D VVLD+ G+GKG AWVNG+NIGRYW +     
Sbjct  637   --------------------FKTPSGDDPVVLDMMGLGKGTAWVNGNNIGRYWLTSYDFE  676

Query  1232  KSDGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEV  1408
             K +GC   CDYRGNY   KC T CG+P+QRWYHVPRSFLRK+ NN LV+FEE GG P +V
Sbjct  677   KENGCSNSCDYRGNYHPEKCATNCGQPTQRWYHVPRSFLRKSDNN-LVIFEEFGGHPAKV  735

Query  1409  RVQTVT  1426
              VQTV+
Sbjct  736   NVQTVS  741



>ref|XP_009390322.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=817

 Score =   516 bits (1328),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 259/571 (45%), Positives = 349/571 (61%), Gaps = 47/571 (8%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPY+ T+YDY+APLDEYGN+ QPKWGHLK+LH+ +  +E +L YG   
Sbjct  291   YHGGTNFGRTSGGPYLTTSYDYDAPLDEYGNIRQPKWGHLKQLHSAIKMMEKILTYGEVN  350

Query  182   NTDYGRMMSSTVYEY-KGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
              T  G  ++ T +   +    CFL NAN  +D + T+ G  Y  P+ S++ILPDC+ EVY
Sbjct  351   TTQLGNALAVTKFSINETSSGCFLTNANQSNDANATYNGNTYLVPSRSISILPDCEKEVY  410

Query  359   NTARVNAQTTVMV-KKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVV  535
             NTA+V  QT++MV K +    L W +  E +     G  + S+        + L +Q + 
Sbjct  411   NTAKVTTQTSLMVNKPVKSTKLSWKWHSEIMEDTLNGKGSFSN--------ESLLEQIMT  462

Query  536   TNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKF  715
             T D +DYLWYMTS  +N+S+    +++ L V TK H+LHA+ NN+ IGS +A   G +KF
Sbjct  463   TGDASDYLWYMTSVTLNKSSTSWRKKMNLRVKTKGHILHAYVNNRLIGSGYAT-KGSYKF  521

Query  716   LFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLSKNTW  892
              F++  +LR   N I+LLS T GL NYG +F+    G+  GPV+L+    E +DL+KN W
Sbjct  522   DFEQEAELRDGHNFITLLSATDGLANYGAFFDLQKAGIDGGPVELIGNGKEKIDLTKNKW  581

Query  893   TYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilNTSF  1072
             +Y +GL+G    ++     + L W+      ++   WYK T                   
Sbjct  582   SYKIGLNGEMSKIYLPSASHGLNWNSDRLPINKSMTWYKTT-------------------  622

Query  1073  V*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCLQ  1252
                            F+ P G DS+VLDL GMGKG AWVNG +IGRYWPSFLA   GC  
Sbjct  623   ---------------FEVPDGNDSLVLDLQGMGKGHAWVNGQSIGRYWPSFLAADSGCEP  667

Query  1253  CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVTVG  1432
             CDYR  Y   KC T CG PSQRWYHVP+SF  K G N L+LFEE+GG P +V +QTVT+G
Sbjct  668   CDYRQKYDSDKCRTECGMPSQRWYHVPKSFTTK-GPNTLILFEEVGGDPSQVSLQTVTIG  726

Query  1433  TICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQSACVG  1612
             T+CANV EG+ +ELSC+G R  SKI+F SFG P GSCGSF+   C+A D + V++ AC+G
Sbjct  727   TVCANVVEGSILELSCQGSRSFSKIQFASFGNPEGSCGSFKKGSCEAPDALAVVKKACIG  786

Query  1613  KEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +  C+++V+   F  + C    RRLAV+A C
Sbjct  787   RSNCSINVTANAFGPSECSDLSRRLAVQAIC  817



>ref|XP_006400640.1| hypothetical protein EUTSA_v10012695mg [Eutrema salsugineum]
 gb|ESQ42093.1| hypothetical protein EUTSA_v10012695mg [Eutrema salsugineum]
Length=830

 Score =   516 bits (1329),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 268/582 (46%), Positives = 349/582 (60%), Gaps = 59/582 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDE+GN+NQPKWGHLK+LH LL S+E  L YGN +
Sbjct  294   YHGGTNFGRVAGGPYITTSYDYHAPLDEFGNLNQPKWGHLKQLHTLLKSMEKPLTYGNIS  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  +++TVY       CF+ N N   D  + F+GK+Y  PAWSV++LPDC  E YN
Sbjct  354   TIDLGNSVTATVYATNEGSSCFIGNVNATADALVNFKGKDYNVPAWSVSVLPDCDKEAYN  413

Query  362   TARVNAQTTVMVKKLSEGA-LKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQKV  532
             TARVN QT++M +   E   L+WS+RPE           + ++L  + D  AK L DQK 
Sbjct  414   TARVNTQTSIMTQDSREPEKLEWSWRPEF---------ERKTILKGSGDLIAKGLVDQKD  464

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
             VTND +DYLWYMT   +++ +P+  + +TL V++ +HVLHA+ N K++G++  +D+ KF 
Sbjct  465   VTNDASDYLWYMTRVHLDKKDPLWSRNMTLRVHSNAHVLHAYVNGKYVGNQIVKDN-KFD  523

Query  713   FLFQRSVK-LRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLS  880
             + F++ V  L    N ISLLS +VGL NYG +FE    G+ GPVKLV   G+     DLS
Sbjct  524   YGFEKKVNHLVHGTNHISLLSVSVGLQNYGAFFETGPTGINGPVKLVGYKGDETIEKDLS  583

Query  881   KNTWTYMVGLHGISKGLFKLDD----HNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              + W Y +GL+G +  LF         + L W       DRM  WYK             
Sbjct  584   AHKWDYKIGLNGFNHKLFSTKSVGHQTHHLKWSTEKLPADRMLTWYKAN-----------  632

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK P G+D V++D  G+GKG AW+NG +IGRYWPSF 
Sbjct  633   -----------------------FKAPLGKDPVIVDFNGLGKGEAWINGQSIGRYWPSFN  669

Query  1229  AKSDGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             +  DGC  +CDYRG YG  KC   CGKP+QRWYHVPRSFL +TG+N + LFEEMGG P  
Sbjct  670   SSDDGCTEECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNETGHNTITLFEEMGGDPTM  729

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCD-ATDI  1582
             V  +TV +GT+CA   E N +ELSC   R IS +KF SFG P G CGSF    C+ A D 
Sbjct  730   VNFKTVVIGTVCARAHEHNKVELSCN-NRPISAVKFASFGNPSGHCGSFTVGTCEGANDA  788

Query  1583  IPVIQSACVGKEKCTLHVSDALFPTTT-CKSKIRRLAVEATC  1705
               +I   CVGK  C+++VS  +F +   C    +RL VE  C
Sbjct  789   AKIIAKECVGKPNCSMNVSSHVFGSKLDCGDSPKRLFVEIEC  830



>ref|XP_010558976.1| PREDICTED: beta-galactosidase 15-like [Tarenaya hassleriana]
Length=836

 Score =   516 bits (1328),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 269/586 (46%), Positives = 366/586 (62%), Gaps = 64/586 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGP+I T+YDYNAPLDEYGN NQPKWGHLK LH +L S+E  LLYG  +
Sbjct  295   YHGGTNFGRTAGGPFITTSYDYNAPLDEYGNKNQPKWGHLKSLHKVLKSIEKPLLYGEKS  354

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              T +G+  ++TVY YKGK VCFLAN   ++D  IT +G  Y  P WSV+ILPDC+TEVYN
Sbjct  355   ETGFGQWANATVYSYKGKSVCFLANVY-QEDKDITVQGTTYRVPGWSVSILPDCETEVYN  413

Query  362   TARVNAQTTVMVKKLSE-----------GALKWSYRPETIMHL-KYGHKNQSSVLIDALD  505
             TA+VNAQT+VMVKK +            G L W +R +  + L K GH   S ++     
Sbjct  414   TAKVNAQTSVMVKKTNGEDDDNYEGNPFGGLNWVWRDDKPVGLSKSGHVRGSLMM-----  468

Query  506   AKQLFDQKVVTNDTTDYLWYMTSFKINESNPILGQE-LTLEVNTKSHVLHAFFNNKHIGS  682
             +  L DQK+  NDT+DYLWY+T   I + + ++G++ + L V+T  HV+HAFFN K++G 
Sbjct  469   SHSLLDQKIA-NDTSDYLWYITRVNIKKRDSLMGKKKINLHVHTNGHVVHAFFNKKYLGY  527

Query  683   EWAQDDGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLV-EPN  859
             +++     F  +  + +K+++  N I+LLS TVG  NYG++F++   G+ GPVKLV E +
Sbjct  528   KYSVSSNDF--VMDKRIKIKRGKNEIALLSTTVGYNNYGEFFDETRHGIWGPVKLVGENH  585

Query  860   GEGM--DLSKNTWTYMVGLHGISKGLFKLDDHN-KLTWHESNFQTDRMFIWYKVTQSipl  1030
             GE +  ++S + W Y  GL+G     ++   HN +  WH ++  ++R F+WYK T     
Sbjct  586   GEKIIKNVSSSLWIYKSGLYGEENKFYEAGIHNARRAWHSTSLPSNRPFVWYKAT-----  640

Query  1031  itlldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGR  1210
                                          F TP G D VV+DL G+ KG  WVNG +IGR
Sbjct  641   -----------------------------FPTPLGTDPVVVDLRGLSKGEVWVNGKSIGR  671

Query  1211  YWPSFLAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEM  1387
             +W S  AK  GC   CDYRG Y G KCVTGCG+P+QRWYH+PRSFL++  +N +V+F+E 
Sbjct  672   FWASLEAK--GCNDNCDYRGAYSGEKCVTGCGEPTQRWYHIPRSFLKEYEDNVMVVFDEF  729

Query  1388  GGRPQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHC  1567
             GG PQ V++QTVT+G +CA   E  T+ELSC+GG    +  F  +GEP G CG F    C
Sbjct  730   GGSPQLVKIQTVTIGKVCATAYEDKTLELSCQGGSVFKEFHFADYGEPEGDCGDFSRGSC  789

Query  1568  DATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              A   + +I   C+GKE+C + VSD  F  + C  + +RLAVEA+C
Sbjct  790   GARHTMNIINQKCLGKERCVIRVSDETFGASHCNGE-KRLAVEASC  834



>ref|XP_002871955.1| beta-galactosidase 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48214.1| beta-galactosidase 7 [Arabidopsis lyrata subsp. lyrata]
Length=826

 Score =   515 bits (1327),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 260/578 (45%), Positives = 350/578 (61%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+AP+DE+GN+NQPKWGHLK+LH +L S+E  L YGN +
Sbjct  294   YHGGTNFGRVAGGPYITTSYDYHAPIDEFGNLNQPKWGHLKQLHRVLKSMEKSLTYGNIS  353

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G  + +T+Y  K    CF+ N N   +  + F+GK+Y  PAWSV++LP+C  E YN
Sbjct  354   RIDLGNSIKATIYTTKEGSSCFIGNVNATANALVNFKGKDYHVPAWSVSVLPECDKEAYN  413

Query  362   TARVNAQTTVMVKKLSEGA-LKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQKV  532
             TA+VN QT++M +  S+   L+W++RPE+          Q  +L  + D  AK L DQK 
Sbjct  414   TAKVNTQTSIMTEDSSKPEKLEWTWRPESA---------QKMILKSSGDLIAKGLVDQKD  464

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
             VTND +DYLWYMT   +++ +P+  + +TL V++ +HVLHA+ N K++G+++ + DGKF 
Sbjct  465   VTNDASDYLWYMTRVHLDKKDPLWSRNMTLRVHSNAHVLHAYVNGKYVGNQFVK-DGKFD  523

Query  713   FLFQRSVK-LRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLS  880
             + F++ V  L    N ISLLS +VGL NYG +FE    G+ GPV LV   GE     DLS
Sbjct  524   YRFEKKVNHLVHGTNHISLLSVSVGLQNYGAFFESGPTGINGPVSLVGYKGEETIEKDLS  583

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
             ++ W Y +GL+G +  LF       + W    F T RM  WYK                 
Sbjct  584   QHQWDYKIGLNGYNNKLFSTKSVGHIKWANEMFPTSRMLTWYKAK---------------  628

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                FK P G++ V++D  G+GKG AW+NG +IGRYWPSF +  D
Sbjct  629   -------------------FKAPLGKEPVIVDFNGLGKGEAWINGQSIGRYWPSFNSSDD  669

Query  1241  GCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC  +CDYRG YG  KC   CG+P+QRWYHVPRSFL+ +G+N + LFEEMGG P  V  +
Sbjct  670   GCKDECDYRGEYGSDKCAFMCGEPTQRWYHVPRSFLKASGHNTITLFEEMGGNPSMVNFK  729

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TDIIPVI  1594
             TV VGT+CA   E N +ELSC     IS +KF SFG P+G CG+F    C    D +  +
Sbjct  730   TVVVGTVCARAHEHNKVELSCH-NHPISAVKFASFGNPVGHCGTFAVGTCQGDKDAVKTV  788

Query  1595  QSACVGKEKCTLHVSDALFPTTT-CKSKIRRLAVEATC  1705
                CVGK  CT++VS   F +T  C    ++LAVE  C
Sbjct  789   AKECVGKLNCTINVSSDTFGSTLDCGDSPKKLAVELEC  826



>emb|CAN82062.1| hypothetical protein VITISV_016430 [Vitis vinifera]
Length=773

 Score =   513 bits (1320),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 278/586 (47%), Positives = 351/586 (60%), Gaps = 91/586 (16%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APL+EYGN NQPKWGHL++LH LL S+E  L YG+  
Sbjct  261   YHGGTNFGRTAGGPYITTSYDYDAPLNEYGNKNQPKWGHLRDLHLLLLSMEKALTYGDVK  320

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             N DY  + S+T+Y Y+GK  CF  N+N   D++I + G NYT PAWSV+ILPDC  EVYN
Sbjct  321   NVDYETLTSATIYSYQGKSSCFFGNSNADRDVTINYGGVNYTIPAWSVSILPDCSNEVYN  380

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN+Q +  VKK SE      +L+W++R ETI ++  G                    
Sbjct  381   TAKVNSQYSTFVKKGSEAENEPNSLQWTWRGETIQYITPG--------------------  420

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
                            S  I+  +PI G++LTL VNT  H+LHAF N +HIG ++A   G+
Sbjct  421   ---------------SVDISNDDPIWGKDLTLSVNTSGHILHAFVNGEHIGYQYAL-LGQ  464

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG---MDL  877
             F+F F+RS+ L+   N I+LLS TVGL NYG  F+ V QG+ GPV+++  NG      DL
Sbjct  465   FEFQFRRSITLQLGKNEITLLSVTVGLTNYGPDFDMVNQGIHGPVQIIASNGSADIIKDL  524

Query  878   SKNT-WTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             S N  W Y  GL+G  K +F L       W   N   +R F+WYK T             
Sbjct  525   SNNNQWAYKAGLNGEDKKIF-LGRARYNQWKSDNLPVNRSFVWYKAT-------------  570

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  F  P GED VV+DL G+GKG AWVNGH++GRYWPS++A+
Sbjct  571   ---------------------FDAPPGEDPVVVDLMGLGKGEAWVNGHSLGRYWPSYIAR  609

Query  1235  SDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
              +GC  +CDYRG Y   KC T CG PSQRWYHVPRSFL  T +N+LVLFEE  G P  V 
Sbjct  610   GEGCSPECDYRGPYKAEKCNTNCGNPSQRWYHVPRSFLAST-DNRLVLFEEFXGNPSSVT  668

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGS--------FETSHC  1567
              QTVTVG  CAN REG T+ELSC+ GR IS IKF SFG+P G+CG         FE   C
Sbjct  669   FQTVTVGNACANAREGYTLELSCQ-GRAISXIKFASFGDPQGTCGKPFATGSQVFEKGTC  727

Query  1568  DATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +A D + +IQ  CVGK  C++ VS+ +     C +  +RLAVEA C
Sbjct  728   EAADSLSIIQKLCVGKYSCSIDVSEQILGPAGCTADTKRLAVEAIC  773



>ref|XP_006843913.1| hypothetical protein AMTR_s00007p00269020 [Amborella trichopoda]
 gb|ERN05588.1| hypothetical protein AMTR_s00007p00269020 [Amborella trichopoda]
Length=823

 Score =   512 bits (1319),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 257/577 (45%), Positives = 349/577 (60%), Gaps = 52/577 (9%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYIAT+YDY+APLDEYGN+ QPKWGHLK+LH +L S+E VL  G  +
Sbjct  290   YHGGTNFGRTAGGPYIATSYDYDAPLDEYGNLRQPKWGHLKQLHEILISMEKVLTSGTVS  349

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NT +G    +T+Y   G   CFL+N N  +D ++TF+G  Y  PAWSV+ILPDCK   YN
Sbjct  350   NTSFGFGADATIYTLDGASSCFLSNTNTTNDATVTFQGIQYFLPAWSVSILPDCKQVAYN  409

Query  362   TARVNAQTTVMVKKLSEG------ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             TA+V  QT +M  K +         L W +RPE I       K    +      + QL +
Sbjct  410   TAKVTTQTALMEMKPNSAESIIPEQLDWQWRPEII-------KGILKLANSTFTSTQLIE  462

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK    D +DYLWY TS  I +++P   +E+ L VNT  HVLHA+ N K  GS++A  +G
Sbjct  463   QKQAAADESDYLWYSTSVVIGKNDPSHSKEMVLSVNTTGHVLHAYVNGKLAGSQYAA-NG  521

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             K++F+F ++V L+   N ISLLS TVGL NYG +F+    G++ GPV+++       D+S
Sbjct  522   KYQFVFNQTVHLKSGRNYISLLSVTVGLQNYGAFFDMGPSGIVGGPVQIIGSGNVTKDIS  581

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
              + W Y VGL    K L+++D+  K+ WH  +  T R   WYK +               
Sbjct  582   SSKWLYKVGLISEQKKLYEIDNLKKVKWHNESLPTKRAMTWYKAS---------------  626

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                F  P G D VV+DL GMGKG AW+NG NIGRYWP+ LA  D
Sbjct  627   -------------------FPAPLGTDPVVVDLQGMGKGSAWINGQNIGRYWPTNLASQD  667

Query  1241  GCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC   C+YRG Y    C TGCG+P+QR+YHVPRSFL     N +VLFEE+GG P+++  Q
Sbjct  668   GCPSVCNYRGVYKPENCPTGCGEPTQRYYHVPRSFLGDD-ENIIVLFEEIGGDPKDINFQ  726

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQ  1597
             TV+VG +C+ + EG+T++L C  G+ IS I+F SFG P G CGSF+   C+    +  +Q
Sbjct  727   TVSVGKVCSKIEEGSTLQLKCPSGKSISAIEFASFGNPEGQCGSFQKGGCNIASALSAVQ  786

Query  1598  SACVGKEKCTLHVSDALFPT-TTCKSKIRRLAVEATC  1705
              ACVG   C++ V++ +  + ++C +  + LAV+ATC
Sbjct  787   KACVGNVSCSVSVTEEVLGSDSSCGNLHKSLAVQATC  823



>ref|XP_009398904.1| PREDICTED: beta-galactosidase 1-like [Musa acuminata subsp. malaccensis]
Length=664

 Score =   505 bits (1301),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 264/576 (46%), Positives = 343/576 (60%), Gaps = 63/576 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APLDEYG   QPKWGHLKELH  +  +E  L YG   
Sbjct  144   YHGGTNFGRTSGGPYIVTSYDYDAPLDEYGYTRQPKWGHLKELHASIKLMEKALTYGEVE  203

Query  182   NTDYGRMMSSTVYEYKG-KKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
               +    ++ T Y   G    CFL+N N K + +I +EG+ Y  PAWSV+ILPDCK+EVY
Sbjct  204   EVNLDNELTITKYSGDGVNPACFLSNQNSKLNATIDYEGRTYFLPAWSVSILPDCKSEVY  263

Query  359   NTARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             NTA+V  QT++MVKK +        L WS+RPE +     G     +V         L +
Sbjct  264   NTAKVKTQTSLMVKKRNTAMEASEVLYWSWRPERLGTSAKGFGGTFTV-------NNLLE  316

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK VT D +DYLWY TS  + E      +E TL VNT  H+LHAF N + +GS++    G
Sbjct  317   QKSVTLDESDYLWYTTSVDVGEK-----EEFTLSVNTTGHILHAFVNGRLVGSQYGL-AG  370

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             +  F F+R V      N ISLLS TVGL NYG Y++    G++ GPVKL+  N   +DLS
Sbjct  371   QLNFTFERKVWFNPGRNVISLLSATVGLQNYGAYYDLAPTGIVGGPVKLIGEN-TTLDLS  429

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
               TW+Y +GL G      +L D   + WH   F T+R F WYK T               
Sbjct  430   NYTWSYKIGLDG------EL-DQRAVKWHSGMFPTNRPFTWYKAT---------------  467

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                F+ P G ++VV+DL GMGKG AWVNG++IGR+WP++ A +D
Sbjct  468   -------------------FQAPLGSEAVVVDLLGMGKGTAWVNGNSIGRFWPNYTASAD  508

Query  1241  GCLQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQT  1420
             GC +CDYRG +  +KC TGCG+PSQRWYHVPRSFL+    N L+LFEE GG P +V  QT
Sbjct  509   GCHECDYRGTFSSNKCQTGCGEPSQRWYHVPRSFLKLGEPNTLMLFEEAGGNPLQVNFQT  568

Query  1421  VTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSH-CDATDIIPVIQ  1597
             VTVG  CA+  EG+T+ LSC  GR IS + F SF EP G+CG+FE    C + +   VI+
Sbjct  569   VTVGAACASASEGDTLSLSCLRGRTISSVDFASFEEPEGTCGAFEGGKGCSSDEAFAVIK  628

Query  1598  SACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              +C+GKE C++ +++    +       R+LAV+ TC
Sbjct  629   DSCLGKESCSIEITEEFGKSCGTLPSPRKLAVQVTC  664



>gb|KFK26294.1| hypothetical protein AALP_AA8G229300 [Arabis alpina]
Length=824

 Score =   510 bits (1313),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 261/578 (45%), Positives = 348/578 (60%), Gaps = 55/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR +GGPYI T+YDY+APLDEYGN+NQPKWGHLK+LH +L S+E  L YGN +
Sbjct  292   YHGGTNFGRVAGGPYITTSYDYHAPLDEYGNLNQPKWGHLKQLHTILKSMEKRLTYGNIS  351

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D G   ++TVY       CF+ N N   +  + F+GK+Y  PAWSV++LPDCK E YN
Sbjct  352   TVDLGNSATATVYSTNEGSSCFIGNVNATANALVNFQGKDYHIPAWSVSVLPDCKKEAYN  411

Query  362   TARVNAQTTVMVKKLSEG-ALKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQKV  532
             TA+VN QT++M ++ S+   L+W++RPE           + ++L  + D  AK L DQK 
Sbjct  412   TAKVNTQTSIMTEESSKPKTLEWTWRPEVA---------RKTILKGSGDLIAKGLVDQKD  462

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFK  712
             VTND +DYLWYMT   +++ +PI  + ++L +++ +HVLHA+ N K++G +   +D KF 
Sbjct  463   VTNDASDYLWYMTRVHLDKKDPIWSRNMSLRIHSNAHVLHAYANGKYVGHK-IVNDTKFD  521

Query  713   FLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DLSK  883
             + F++ V L    N ISLLS +VGL NYG +FE    G+ GPVKLV   G+     DLS+
Sbjct  522   YRFEKKVNLVHGTNHISLLSVSVGLHNYGAFFENSPTGINGPVKLVGYRGDETIEKDLSE  581

Query  884   NTWTYMVGLHGISKGLFKLDDHNK-LTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
             + W Y +GL+G    LF  +   + L W      ++RM  WYK                 
Sbjct  582   HQWNYKIGLNGFDHKLFSTNSVGRHLKWSAEKLPSNRMLTWYKAN---------------  626

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                FK P G+D V++D  G+GKG AW+NG +IGRYWPSF +  D
Sbjct  627   -------------------FKAPFGKDPVIVDFNGLGKGEAWINGQSIGRYWPSFNSSDD  667

Query  1241  GCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             GC  +CDYRG YG  KC   CGKP+QRWYHVPR FL ++G+N + LFEE+GG P  V  +
Sbjct  668   GCSDECDYRGEYGSDKCAFMCGKPTQRWYHVPRGFLNESGHNTITLFEELGGNPSMVNFK  727

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCD-ATDIIPVI  1594
             TV   T+CA   E N +ELSC   R I+ +KF SFG P G CGSF    C+ A D + V+
Sbjct  728   TVVTRTVCARAYEQNKLELSCN-SRPITAVKFASFGNPSGHCGSFAVGTCEGANDAVKVV  786

Query  1595  QSACVGKEKCTLHVSDALFPTT-TCKSKIRRLAVEATC  1705
                CVGK  CT++VS   F +T  C     RL VE  C
Sbjct  787   AKECVGKFNCTMNVSSHKFGSTLDCGDSPTRLFVEIEC  824



>ref|XP_009621302.1| PREDICTED: beta-galactosidase 7-like [Nicotiana tomentosiformis]
Length=706

 Score =   506 bits (1302),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 325/485 (67%), Gaps = 49/485 (10%)
 Frame = +2

Query  5     HGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNATN  184
             HGGTNFGR +GGPYI TTYDY+APL+EYG +NQPK+GHLKELH +L S+E +L YGNAT 
Sbjct  258   HGGTNFGRVAGGPYITTTYDYDAPLNEYGQLNQPKYGHLKELHEILKSVEKLLTYGNATQ  317

Query  185   TDYGR---MMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEV  355
               YG      ++TVYEY+G +VCFLANANDK+D    FEGKNYT PAWSV+ILPDC    
Sbjct  318   KSYGDDDWQYTTTVYEYQGSRVCFLANANDKNDRIFNFEGKNYTVPAWSVSILPDCVNVK  377

Query  356   YNTARVNAQTTVMVKKLSEG----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             YNTA+VNA   VMV+K +       L WS+R E   HLK    N     +  L A QL D
Sbjct  378   YNTAKVNAPKKVMVRKPNNADNPNGLDWSWRAERPSHLKPSFINIKKKGV--LYANQLLD  435

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK+V NDT+DYLWY+TS  I ES+P+ G E  LE++T +HVL+AFFN KHIG++WA+ DG
Sbjct  436   QKIVANDTSDYLWYITSVDIKESDPLYGGEAVLEIHTNAHVLYAFFNGKHIGTKWAK-DG  494

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGMDLSK  883
             K+ F FQ+ +K++   NT+SLLS TVG PNYG YF+KV  G++GPV L  P+G   DL+ 
Sbjct  495   KYSFDFQQLLKIKPGKNTLSLLSVTVGFPNYGAYFDKVKNGILGPVVLKSPSGVVKDLTN  554

Query  884   NTWTYMVGLHGISKGLFKLDDHNKLTWHESN-FQTDRMFIWYKVTQSiplitlldlpiil  1060
             N W Y +GL G+ + L++ +D+    W  +   QT+RMF+W+K T               
Sbjct  555   NQWEYKIGLEGLERKLWEDEDYMHRNWKPAQTLQTNRMFVWFKTT---------------  599

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF--LAK  1234
                                FKTP+G+D VVLD+ G+GKG AWVNG+NIGRYW +     K
Sbjct  600   -------------------FKTPSGDDPVVLDMMGLGKGTAWVNGNNIGRYWLTSYDFEK  640

Query  1235  SDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
              +GC   CDYRGNY   KC T CG+P+QRWYHVPRSFLRK+ NN LV+FEE GG P +V 
Sbjct  641   ENGCSSSCDYRGNYHPEKCATNCGQPTQRWYHVPRSFLRKSDNN-LVIFEEFGGHPAKVN  699

Query  1412  VQTVT  1426
             VQTV+
Sbjct  700   VQTVS  704



>ref|XP_008811996.1| PREDICTED: beta-galactosidase 1-like [Phoenix dactylifera]
Length=817

 Score =   509 bits (1310),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 266/576 (46%), Positives = 351/576 (61%), Gaps = 58/576 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT GGPYI T+YDY+APLDEYGN+ QPKWGHLKELH  L  +E  L YG+  
Sbjct  292   YHGGTNFGRTPGGPYITTSYDYDAPLDEYGNIRQPKWGHLKELHAALKLMEKALTYGDVN  351

Query  182   NTDYGRMMSSTVYEY-KGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
             NTD+G  +++T + Y +    CFL+NAN   D ++ ++G  Y  PAWSV+ILPDCK EVY
Sbjct  352   NTDFGNGVAATKFSYNETLSGCFLSNANQSSDATLEYQGAKYFLPAWSVSILPDCKQEVY  411

Query  359   NTARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             NTA+V  QT++MVKK ++       LKWS+RPE +        +  S L       +L D
Sbjct  412   NTAKVTTQTSIMVKKPNKAVDEASDLKWSWRPEIL-------GSSVSGLGGNFTENKLSD  464

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             Q     D +DYLWYMTS  I+       Q++TL VNT  HVLHAF N + +GS++   +G
Sbjct  465   QITTAFDESDYLWYMTSVDISHQ-----QQMTLRVNTTGHVLHAFVNGQLVGSQYGP-NG  518

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
              + F+ +++   +   N ISLLS TVGL NYG  +E    G++ GPV+L+  N   +DLS
Sbjct  519   NWVFVLEQTANFKAGKNHISLLSVTVGLKNYGARYELDPAGIVGGPVQLIGGNIT-IDLS  577

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiil  1060
              N W+Y +GL G    ++ LD+ ++  W+     T R F WYK T               
Sbjct  578   TNEWSYKIGLDGEKTKVY-LDNPDR-KWYSGMIPTQRPFTWYKTT---------------  620

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                F+TP G D VV+DL GMGKG AWVNG+NIGR+WP++ A +D
Sbjct  621   -------------------FETPLGLDPVVVDLVGMGKGAAWVNGNNIGRFWPNYTASAD  661

Query  1241  GCLQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQT  1420
             GC  CDYRG Y   KC TGCG+PSQRWYHVPRSFL+    N LVLFEE GG P +V  QT
Sbjct  662   GCNGCDYRGAYKAEKCQTGCGEPSQRWYHVPRSFLKPGEPNTLVLFEEAGGDPVQVNFQT  721

Query  1421  VTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQS  1600
             VTVGT C++  +G T++LSC+GG  IS I F SFG+P G+CG +E   C++  +  +I  
Sbjct  722   VTVGTACSSADQGKTLKLSCQGGLTISNIDFASFGDPKGTCGGYERGGCESDVVYSLISE  781

Query  1601  ACVGKEKCTLHVSDALF-PTTTCKSKIRRLAVEATC  1705
              CVGKE C++ + + L        +  + L V+ATC
Sbjct  782   ECVGKESCSIQIGENLLGKCNGSNTSSKSLVVQATC  817



>ref|XP_009400604.1| PREDICTED: beta-galactosidase 1-like [Musa acuminata subsp. malaccensis]
Length=818

 Score =   508 bits (1309),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 255/577 (44%), Positives = 352/577 (61%), Gaps = 62/577 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYIAT+YDY+APLDEYGN+ QPKWGHLKELH  +  +E  L YG   
Sbjct  294   YHGGTNFGRTSGGPYIATSYDYDAPLDEYGNIRQPKWGHLKELHASVKLMEKALTYGEVV  353

Query  182   NTDYGRMMSSTVYEYKGKKV---CFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTE  352
                 G  +  T+ ++ G  +   CFL+N N   D +I+F+G NY  PAWSV+ILPDCK E
Sbjct  354   EDHLGNGL--TITKFSGDGIVPGCFLSNQNSTVDATISFQGTNYFLPAWSVSILPDCKKE  411

Query  353   VYNTARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
             VYNTA+V  QT++MV K          L+WS++PE +     G  N  +V        +L
Sbjct  412   VYNTAKVKTQTSIMVTKKDNAGDQSKDLRWSWKPERLHDSAKGFGNSFTV-------NKL  464

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              +QK  T D +DYLWY T+ ++++      +  TL V+T  H+L+AF N + +GSE+A  
Sbjct  465   LEQKTTTVDASDYLWYTTNVEVSKK-----ESFTLSVSTTGHILYAFVNGRLVGSEYAT-  518

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMD  874
              G + F+F+R V  +   N ISLLS TVGL NYG +++    G++ GPVKL+  N   +D
Sbjct  519   GGTYNFIFERKVTFKPGKNQISLLSATVGLSNYGAFYDNTPVGIVGGPVKLIGKNNTILD  578

Query  875   LSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             LS++ W+Y +GL G  + L +LD+     W+     T R F WYK T             
Sbjct  579   LSESNWSYKIGLDGEVRKL-QLDEER---WYSGVIPTKRPFTWYKTT-------------  621

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  F+ P G + VV+DL G+GKG AWVNG+++GR+WP+F A 
Sbjct  622   ---------------------FQAPLGSEPVVVDLLGLGKGEAWVNGNSLGRFWPNFTAN  660

Query  1235  SDGCLQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
              DGC QCDYRGN+  +KC T CG+ SQRWYHVPRSFL++   N L LFEE GG P +V  
Sbjct  661   PDGCKQCDYRGNFQTNKCQTACGEASQRWYHVPRSFLKRGEPNTLTLFEEAGGDPNQVNF  720

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QTVTVGT C +  EG+ + LSC+GGR IS + F +FGEP G+CG +E+  C + + + ++
Sbjct  721   QTVTVGTACTSAGEGDALSLSCQGGRTISSVDFATFGEPDGTCGDYESGGCGSDEAVAIL  780

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + AC+G+E C++ +SD +  +    +  R+L  + TC
Sbjct  781   KDACLGRESCSIKISDTIGTSCAKLASPRKLVGQVTC  817



>gb|EPS73924.1| hypothetical protein M569_00825, partial [Genlisea aurea]
Length=821

 Score =   508 bits (1307),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 272/582 (47%), Positives = 361/582 (62%), Gaps = 63/582 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGR++GGPYI T+YDY+APLDEYG +NQPK+GHLK+LH +L+S+E  L  GN T
Sbjct  289   YHGGTNFGRSAGGPYITTSYDYDAPLDEYGGLNQPKYGHLKQLHRVLHSIEKQLTDGNVT  348

Query  182   NTDYGRMMSSTVYEYK-GKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
             + DYG  +++TVY    G+K CFL NAN     ++ + G NYT PAWSV+ILPDCK EVY
Sbjct  349   DIDYGNSVTATVYALPNGRKSCFLGNANSTTAATVVYGGVNYTVPAWSVSILPDCKREVY  408

Query  359   NTARVNAQTTVMVKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKVVT  538
             NTA+V  QTTVM ++     LKW +R E +       K QSS       +K L+DQK + 
Sbjct  409   NTAKVKTQTTVMAREGGTQTLKWEWRREALDDAVLFGKGQSS-------SKHLWDQKAI-  460

Query  539   NDTTDYLWYMTSFKINESNPIL-GQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKF  715
             +D +DYLWYMTS  + E +P+   + ++++VNT   ++HA+ N +H+GS W+   G FK 
Sbjct  461   DDASDYLWYMTSVDLEEEDPLFAAKNMSIQVNTTGQIVHAYVNGRHVGSNWST-YGDFKT  519

Query  716   LFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVE-PNGE---GMDLSK  883
             LF +  K RK  N ISLLS TVGL NYG +++ +  G++GPV++V   NG+     DLSK
Sbjct  520   LFSKEAKFRKGKNQISLLSATVGLQNYGSFYDMMEDGIVGPVQIVGIINGDESITKDLSK  579

Query  884   NTWTYMVGLHGISKGLFKLDDHNKLTWHESN-FQTDRMFIWYKVTQSiplitlldlpiil  1060
             + W Y VGL    +GL      N   W  S     +RM  WY+                 
Sbjct  580   HKWNYQVGL----RGLKDARSVNVDRWTTSEPLPVNRMMTWYRAA---------------  620

Query  1061  NTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSD  1240
                                F++P GED V +DL GMGKG AWVNG+++GRYWPSFLA  +
Sbjct  621   -------------------FESPPGEDPVAVDLKGMGKGYAWVNGNSLGRYWPSFLADEN  661

Query  1241  GCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP-QEVR  1411
             GC    CDYRG Y  +KCV  CGKP+QR+YHVPRSFL   G+N+LVLFEE GG P   V 
Sbjct  662   GCSDDPCDYRGAYDNNKCVYNCGKPTQRYYHVPRSFLNAGGHNELVLFEEFGGNPTSHVG  721

Query  1412  VQTVTVGTICANVREGNT-MELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DII  1585
              +T+  G++CA  ++ N  + LSC  GR+IS IKF S+G+P G+CGSF+   C+++ D +
Sbjct  722   FKTLRPGSVCATAKQQNQRVTLSCH-GRRISAIKFASYGDPNGTCGSFQKGTCESSKDAV  780

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCKSKI--RRLAVEATC  1705
              V+Q  CVGKE CT   SD +F  T C +     +L VEA C
Sbjct  781   AVLQ-FCVGKETCTFIHSDQMFGATDCAAAAIDVKLVVEAVC  821



>ref|XP_008462666.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
melo]
Length=826

 Score =   508 bits (1307),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 270/587 (46%), Positives = 346/587 (59%), Gaps = 68/587 (12%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T YDYNAPLDEYGN+NQPKW HLK+L+ LL S+E VL YG+  
Sbjct  289   YHGGTNFGRTSGGPYIKTFYDYNAPLDEYGNINQPKWEHLKQLNELLMSMEKVLTYGDVK  348

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +TDYG   +       GK  CF+ NA + D  ++TF  + Y  P WSV ILPDCK+EVYN
Sbjct  349   HTDYGHSTT-------GKSSCFIGNAENGDR-NVTFGDRTYNIPGWSVGILPDCKSEVYN  400

Query  362   TARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQKV  532
             TA VN QTT+  K  S+      KW +R E I H+ Y  +   SV+     A +L DQKV
Sbjct  401   TAEVNTQTTIREKVSSQRTNKGFKWQWRSEKIEHMTYEDRVDGSVIT----ANRLLDQKV  456

Query  533   VTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIG-----------  679
             VTND +DYLWY+T F +  S+P+ G+ + L VNT+ H+LHAF N +HI            
Sbjct  457   VTNDASDYLWYLTGFHLEGSDPLFGKRVKLRVNTRGHILHAFVNKRHIDLTSYIDKLQIQ  516

Query  680   ---SEWAQDDGKFKFLFQRSVK-LRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKL  847
                S++A    K+ F+F++ V+ LR   N I LLS TVGLP+YG +FE V  GV GPV+L
Sbjct  517   ISRSQYALKS-KYNFIFEKEVRNLRHGFNQIVLLSATVGLPHYGAHFEDVEAGVHGPVEL  575

Query  848   VEPNGEGMDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSip  1027
             V       DLS N W Y +GL G     F  +   +  W   N  +++ F W K T    
Sbjct  576   VADGETIRDLSNNEWAYKIGLDGEKYEFFDPNHRFRKPWLSDNLPSNQNFTWXKTT----  631

Query  1028  litlldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIG  1207
                                           F+TP   + VV+DL GMGKG AWVNG +IG
Sbjct  632   ------------------------------FQTPKKREGVVVDLLGMGKGHAWVNGKSIG  661

Query  1208  RYWPSFLAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEE  1384
             RYWPS+ A  + C   CD+RG Y  +KCVT CGKP+QRWYH+PRS+L K   N L+LFEE
Sbjct  662   RYWPSYHANENDCSSHCDFRGAYYDNKCVTNCGKPTQRWYHIPRSYLNKGKENTLILFEE  721

Query  1385  MGGRPQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSH  1564
              GG P  + +Q   V  +CA    G+T+ELSC   R I  I F SFG P G+C +F+   
Sbjct  722   FGGVPLNIDIQITRVKKVCAKPYAGSTLELSCH-DRTIKNINFVSFGNPHGNCDNFQKGT  780

Query  1565  CDATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             CD++  + VI+ AC+GK KC++ V+ +    T CK K  RLAV+ TC
Sbjct  781   CDSSTALSVIEKACLGKRKCSIEVTKSNLGNTGCK-KHNRLAVQVTC  826



>ref|XP_009400603.1| PREDICTED: beta-galactosidase 13-like [Musa acuminata subsp. 
malaccensis]
Length=818

 Score =   502 bits (1292),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 251/577 (44%), Positives = 353/577 (61%), Gaps = 62/577 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDY+APLDEYGN+ QPKWGHLKELH  +  +E  L YG   
Sbjct  294   YHGGTNFGRTSGGPYIVTSYDYDAPLDEYGNIRQPKWGHLKELHASVKLMEKALTYGEVV  353

Query  182   NTDYGRMMSSTVYEYKGKKV---CFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTE  352
                 G  +  T+ ++ G  +   CFL+N N   D +I+F+G  Y  PAWSV+ILPDC+ E
Sbjct  354   EDHLGNGL--TITKFSGDGIVPGCFLSNQNSTVDATISFQGTKYFLPAWSVSILPDCEKE  411

Query  353   VYNTARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
             VYNTA+V  QT++MVKK          L+WS++PE + +   G  +  +V        +L
Sbjct  412   VYNTAKVKTQTSIMVKKKDNAGDQSKDLRWSWKPERLHNSAKGFGSSFTV-------NKL  464

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              +QK  T D +DYLWY T+ ++++      +  TL V+T  H+L+AF N + +GSE+A  
Sbjct  465   LEQKTTTVDASDYLWYTTNVEVSKK-----ESFTLSVSTTGHILYAFVNGRLVGSEYAT-  518

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMD  874
              G + F+F+R V  +   N ISLLS TVGL NYG +++    G++ GPVKL+  N   +D
Sbjct  519   GGSYNFIFERKVTFKPGKNQISLLSATVGLRNYGAFYDNTPVGIVGGPVKLIGKNNTILD  578

Query  875   LSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpi  1054
             LS++ W+Y +GL G  + L +LD+     WH     T+R F WYK T             
Sbjct  579   LSESNWSYKIGLDGEVRKL-QLDEKR---WHSGVIPTNRPFTWYKTT-------------  621

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                  F+ P G + VV+DL G+GKG AWVNG+++GR+WP+F A 
Sbjct  622   ---------------------FQAPLGSEPVVVDLLGLGKGEAWVNGNSLGRFWPNFTAN  660

Query  1235  SDGCLQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
               GC QCDYRGN+  +KC T CG+ SQRWYHVPRSFL++   N L LFEE GG P +V  
Sbjct  661   PYGCNQCDYRGNFQPNKCQTACGEASQRWYHVPRSFLKRGEPNTLTLFEEAGGNPNQVNF  720

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QTVTVGT C +  EG+ + LSC+GGR IS + F +FGEP G+CG++ +  C + + + ++
Sbjct  721   QTVTVGTACTSASEGDVLSLSCQGGRTISSVDFATFGEPDGTCGAYGSGGCVSDEAVAIL  780

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + AC+G++ C++ +SD +  +    +  R+L V+ TC
Sbjct  781   KDACLGRDSCSIQISDKIGTSCAKLASPRKLVVQVTC  817



>ref|XP_010273985.1| PREDICTED: beta-galactosidase 15-like [Nelumbo nucifera]
Length=837

 Score =   502 bits (1292),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 266/584 (46%), Positives = 351/584 (60%), Gaps = 63/584 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT GG YI T+YDY+A LDEYGN+NQPKWGHL +LH ++ S + VL YG  +
Sbjct  301   YHGGTNFGRTPGG-YITTSYDYDALLDEYGNLNQPKWGHLTQLHAVIKSAQSVLTYGTYS  359

Query  182   NTDYGRMMSSTVY--EYKGKKVCFLANANDKDDISITFE--GKNYTTPAWSVTILPDCKT  349
                 G  +  T Y     G+ +CFL+NAN  +D +I  +  G +Y  PAWS TIL +C  
Sbjct  360   TKLLGAGLELTTYVNNGTGESICFLSNANTVNDTNIVLQSNGNDYFVPAWSATILANCSK  419

Query  350   EVYNTARVNAQTTVMVKKLSEG-------ALKWSYRPETIMHLKYGHKNQSSVLIDALDA  508
             EVYNTA+VN QT++M KK +          LKW ++PE +  +  G           L  
Sbjct  420   EVYNTAKVNTQTSLMTKKPATTDQSEHNHQLKWVWKPEPVRDVLKGW--------GPLKV  471

Query  509   KQLFDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEW  688
             K+L +QK  T D +DYLWYMTS  + + +    ++  L VNT  HVLHAF N + +GS+W
Sbjct  472   KKLLEQKSTTIDVSDYLWYMTSVLVAKKD---AKKAILRVNTTGHVLHAFVNRRLVGSQW  528

Query  689   AQDDGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGE  865
              Q  G + F+F+R + L+   N I+LLS TVGL NYG +F+    G+  GPV+LV     
Sbjct  529   GQ-GGNYGFVFERPIMLKPGQNQITLLSATVGLQNYGPFFDLTPTGIAGGPVQLVLSGNV  587

Query  866   GMDLSKNTWTYMVGLHGISKGLFK-LDDHNKLTWHESNFQTDRMFIWYKVTQSiplitll  1042
               DLS N W Y +GL+G     +K +  H+   W       +R   WYK T         
Sbjct  588   TKDLSSNQWYYKIGLNGELMQFYKDIKIHHHKYWRSKKLPINRPMTWYKTT---------  638

Query  1043  dlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPS  1222
                                      FKTP G D+VV+D+ GMGKG AWVNG +IGR+WP+
Sbjct  639   -------------------------FKTPLGTDAVVVDMVGMGKGHAWVNGESIGRFWPA  673

Query  1223  FLA-KSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGR  1396
             FLA K  GC   CDYRG Y  +KC+T CG PSQRWYH+PRSFL K  +N L+LFEE+GG 
Sbjct  674   FLADKKAGCNDTCDYRGTYDPTKCLTNCGNPSQRWYHIPRSFLMKNRSNTLILFEEIGGN  733

Query  1397  PQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT  1576
             P +V  QTVTVGT C N  EGNT++LSC+GGRK + I+F SFG+P GSCG F    C++ 
Sbjct  734   PSQVSFQTVTVGTACGNAYEGNTLQLSCQGGRKFTAIQFASFGDPQGSCGMFRKGTCESA  793

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKI-RRLAVEATC  1705
             + + V++ AC+G+E+C +  S+A F ++ C   I RRLAV+A C
Sbjct  794   NTLNVVRKACLGQERCKITSSEATFGSSKCNGNITRRLAVQAIC  837



>emb|CDY34975.1| BnaA01g27590D [Brassica napus]
Length=788

 Score =   500 bits (1287),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 259/577 (45%), Positives = 342/577 (59%), Gaps = 84/577 (15%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  287   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERTLTYGNIS  346

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y+ +    CF  N N+  D  I+F+G++Y  PAWSVTILPDCK E YN
Sbjct  347   TIDFGNSASATIYKTEEGSSCFFGNGNENSDAKISFQGESYVIPAWSVTILPDCKNEAYN  406

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  407   TAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENVDNFILKGKGEST-------QTQLFDQ  459

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +  LG+ ++L VN+ +HVLHAF N KHIG++ A+ DGK
Sbjct  460   KVVTNDQSDYLWYMTTVKFKKRDLFLGKSMSLRVNSTAHVLHAFVNGKHIGNQHAE-DGK  518

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   NG+     DL
Sbjct  519   FNYVFEKDVKFKSGRNVIALLSITVGLANYGIFFESKPAGITGPIFITGRNGDETIVKDL  578

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL+G    LF+ +  +K  W   +   +R   WYK T              
Sbjct  579   SAHKWSYKTGLNGFENQLFRTESMSK--WSVESVPFNRTMTWYKAT--------------  622

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG                    
Sbjct  623   --------------------FKAPLGNDPVVVDLMGLGKGA-------------------  643

Query  1238  DGCLQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
                        Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  Q
Sbjct  644   -----------YHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLVSFQ  692

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPVI  1594
             T  VG++CANV E   +ELSC   + IS IKF SFG P G+CGSFE   C+++ + + ++
Sbjct  693   TTRVGSVCANVYENKIIELSCD-RKPISAIKFASFGNPHGNCGSFEKGTCESSNNTVDIL  751

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                CVGKEKC++ VS   F    C    R+LAVE  C
Sbjct  752   TQECVGKEKCSIDVSTKKFGAPDCSGAARKLAVEVIC  788



>ref|XP_007138632.1| hypothetical protein PHAVU_009G2251001g, partial [Phaseolus vulgaris]
 gb|ESW10626.1| hypothetical protein PHAVU_009G2251001g, partial [Phaseolus vulgaris]
Length=558

 Score =   491 bits (1264),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 266/582 (46%), Positives = 338/582 (58%), Gaps = 71/582 (12%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLL-YGNA  178
             YHGGTNFGRT+GGPYI TTYDY+APLDE+GN+ QPKWGHLKELH +L S+E+ L  YGN 
Sbjct  34    YHGGTNFGRTAGGPYITTTYDYDAPLDEFGNIAQPKWGHLKELHRVLKSMENSLTNYGNV  93

Query  179   TNTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVY  358
             +  D G  + +TVY       CFL N N   D ++TF G  Y  PAWSV++LPDC+TE Y
Sbjct  94    SEVDLGHSVKATVYATNDSSSCFLTNTNTTTDATVTFRGNKYNIPAWSVSLLPDCQTEEY  153

Query  359   NTARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             NTA+VN QT++MVK  ++      AL W +R E I     G  N S         K+L D
Sbjct  154   NTAKVNVQTSLMVKGRNKAEDEPTALNWVWRAENIDDALLGKGNFSE--------KRLID  205

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK V +DT+DYLWYMT   I++++PIL   ++L +N    V+HAF N +HIGS WA   G
Sbjct  206   QKTVASDTSDYLWYMTRLDIDQNDPILSDNMSLSINGSGQVIHAFVNGEHIGSHWAT-YG  264

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---D  874
                 +F+  +KL+   N +SLLS TVGL NYG  ++K   G++GP+ ++    +     D
Sbjct  265   IRNDIFEPEIKLKPGKNIVSLLSVTVGLQNYGPNYDKWPTGLVGPISVISRKDDETVVKD  324

Query  875   LSKNTWTYMVGLHGISKGLFKLDDH--NKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
             LS N W+Y VGLHG     F  D    +   W      T+RM  WYK T           
Sbjct  325   LSSNKWSYKVGLHGWDNKFFSEDSSYASDSKWESEYLTTNRMLTWYKTT-----------  373

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK P G + VV+DL GMGKG AWVNGHN+GR WPS+ 
Sbjct  374   -----------------------FKAPLGSEGVVVDLQGMGKGYAWVNGHNLGRTWPSYE  410

Query  1229  AKSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQ  1402
             A  DGC    CDYRG Y   K            YHVPRSF++  G N +VLFEE+GG P 
Sbjct  411   ASEDGCSDDPCDYRGEYDDKK------------YHVPRSFIQD-GLNTMVLFEEIGGNPS  457

Query  1403  EVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-TD  1579
              V  QTV+VG+ C N  E  T+ELSC  G  IS IKF SFG P G CG+F    C++ +D
Sbjct  458   LVNFQTVSVGSACGNTHENKTLELSCH-GHPISDIKFASFGNPQGECGAFSKGSCESKSD  516

Query  1580  IIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              + ++Q+ACVGKE C + VS+  F    C   ++RLAVEA C
Sbjct  517   ALTIVQNACVGKESCIIDVSEKTFGPANCGDMVKRLAVEAVC  558



>gb|KGN66624.1| hypothetical protein Csa_1G650110 [Cucumis sativus]
Length=821

 Score =   498 bits (1282),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 265/577 (46%), Positives = 351/577 (61%), Gaps = 56/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L     +
Sbjct  289   YHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNSTRS  348

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISITF-EGKNYTTPAWSVTILPDCKTE  352
             N ++G  ++ T +     G++ CFL+N + K+D +I   E   Y  PAWSV+IL  C  E
Sbjct  349   NQNFGSSVTLTKFSNPTTGERFCFLSNTDGKNDATIDLQEDGKYFVPAWSVSILDGCNKE  408

Query  353   VYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             VYNTA+VN+QT++ VK+ +E     L W++ PE +     G+            A  L +
Sbjct  409   VYNTAKVNSQTSMFVKEQNEKENAQLSWAWAPEPMKDTLQGN--------GKFAANLLLE  460

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK VT D +DY WYMT    N ++ +  Q +TL+VNTK HVLHAF N ++IGS+W  +  
Sbjct  461   QKRVTVDFSDYFWYMTKVDTNGTSSL--QNVTLQVNTKGHVLHAFVNKRYIGSKWGSNGQ  518

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
                F+F++ + L+  INTI+LLS TVGL NY  +++ V  G+  GP+ L+       DLS
Sbjct  519   --SFVFEKPILLKSGINTITLLSATVGLKNYDAFYDMVPTGIDGGPIYLIGDGNVTTDLS  576

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  K ++      +  W   N ++  R   WYK                
Sbjct  577   SNLWSYKVGLNGEMKQIYNPMFSQRTNWIPLNQKSIGRRMTWYK----------------  620

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FKTPAG D VVLD+ GMGKG AWVNG +IGR+WPSF+A +
Sbjct  621   ------------------TSFKTPAGIDPVVLDMQGMGKGQAWVNGQSIGRFWPSFIAGN  662

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C   CDYRG Y  SKCV  CG PSQRWYHVPRSFL  +  N L+LFEE+GG PQ+V V
Sbjct  663   DSCSATCDYRGAYNPSKCVENCGNPSQRWYHVPRSFL-SSDTNTLILFEEIGGNPQQVSV  721

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+GTIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF+    D T+I  ++
Sbjct  722   QTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGNPGGKCGSFKKGSWDVTNIALIL  781

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + AC+G E C++ VS   F      +   RLAV+A C
Sbjct  782   EKACIGMESCSIDVSAKSFGLGDATNLSARLAVQALC  818



>gb|KHN04556.1| Beta-galactosidase [Glycine soja]
Length=769

 Score =   496 bits (1276),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 263/580 (45%), Positives = 353/580 (61%), Gaps = 59/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPY+ T+Y+Y+APLDEYGN+NQPKWGHLK+LH  +   E ++  G  T
Sbjct  237   YHGGTNFGRTAGGPYMTTSYEYDAPLDEYGNLNQPKWGHLKQLHAAIKLGEKIITNGTRT  296

Query  182   NTDYGRMMSSTVYEY-KGKKVCFLANANDKDDISITFEGK-NYTTPAWSVTILPDCKTEV  355
             + D+G  ++ T Y +  G++ CFL+N ND  D ++  +   NY  PAWSVTIL  C  EV
Sbjct  297   DKDFGNEVTLTTYTHTNGERFCFLSNTNDSKDANVDLQQDGNYFLPAWSVTILDGCNKEV  356

Query  356   YNTARVNAQTTVMVKKLSEGA--LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQK  529
             +NTA+VN+QT++MVKK  + +  L W++ PE      +G  N            QL +QK
Sbjct  357   FNTAKVNSQTSIMVKKSDDASNKLTWAWIPEKKKDTMHGKGN--------FKVNQLLEQK  408

Query  530   VVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKF  709
              +T D +DYLWYMTS  IN+++  +    TL VNT+ H L A+ N +H+G +++Q  G F
Sbjct  409   ELTFDVSDYLWYMTSVDINDTS--IWSNATLRVNTRGHTLRAYVNGRHVGYKFSQWGGNF  466

Query  710   KFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLSKN  886
                +++ V L+K +N I+LLS TVGLPNYG  F+K+  G+  GPV+L+  N E +DLS N
Sbjct  467   T--YEKYVSLKKGLNVITLLSATVGLPNYGAKFDKIKTGIAGGPVQLIGNNNETIDLSTN  524

Query  887   TWTYMVGLHGISKGLFKLDDHNKLTWH-ESNFQTDRMFIWYKVTQSiplitlldlpiilN  1063
              W+Y +GL+G  K L+       ++W   S +   R   WYK                  
Sbjct  525   LWSYKIGLNGEKKRLYDPQPRIGVSWRTNSPYPIGRSLTWYKAD----------------  568

Query  1064  TSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDG  1243
                               F  P+G D VV+DL G+GKG AWVNG +IGRYW S++  ++G
Sbjct  569   ------------------FVAPSGNDPVVVDLLGLGKGEAWVNGQSIGRYWTSWITATNG  610

Query  1244  CLQ-CDYRGNY-GGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             C   CDYRG Y    KC T CG PSQRWYHVPRSFL K   N LVLFEE+GG PQ V  Q
Sbjct  611   CSDTCDYRGKYVPAQKCNTNCGNPSQRWYHVPRSFL-KNDKNTLVLFEEIGGNPQNVSFQ  669

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQ  1597
             TV  GTICA V+EG  +ELSC+GG+ IS+I+F SFG P G+CGSF+    +ATD   V++
Sbjct  670   TVITGTICAQVQEGALLELSCQGGKTISQIQFSSFGNPTGNCGSFKKGTWEATDGQSVVE  729

Query  1598  SACVGKEKCTLHVSDALFPTT----TCKSKIRRLAVEATC  1705
             +ACVG+  C   V+   F           ++ RLAV+ATC
Sbjct  730   AACVGRNSCGFMVTKEAFGVAIGPMNVDERVARLAVQATC  769



>gb|KDP29226.1| hypothetical protein JCGZ_16615 [Jatropha curcas]
Length=843

 Score =   498 bits (1282),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 261/587 (44%), Positives = 361/587 (61%), Gaps = 61/587 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFG T+GGPY+ T+YDY+APLDEYGN NQPKWGHLK LH +L+SL   L++G+ T
Sbjct  296   YHGGTNFGETAGGPYVTTSYDYDAPLDEYGNPNQPKWGHLKNLHEVLFSLGINLIFGDKT  355

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               + G  +++ +  YKG++ CF +N  D DD  ITFEG  +  P+WSV+I PDCKTEVYN
Sbjct  356   EVNLGGSITAKIISYKGQRSCFFSNIYD-DDSFITFEGNEFFLPSWSVSISPDCKTEVYN  414

Query  362   TARVNAQTTVMVKKL-------SEGALKWSYRPETIMHL-KYGHKNQSSVLIDALDAKQL  517
             TA+VNAQT++M+ +        +   L+W   PE I+++ +YG+ ++     D + +  L
Sbjct  415   TAKVNAQTSIMMYRPIHPLGNNTPYQLEWESTPEQIININRYGNLDKG----DFIASNYL  470

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNP-ILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQ  694
              DQK VTN T+DYLW +T +  N ++P  + +++ L+V+T   V+HAF N K  GS+ A+
Sbjct  471   LDQKTVTNGTSDYLWLLTLYTHNSTDPEWVNKDIFLQVHTFGPVIHAFVNTKFFGSQTAE  530

Query  695   DDGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEG--  868
              DG F F F+  + L + IN I L+S +VGLP YG  FE +G G++GP+K++  +  G  
Sbjct  531   -DGNFDFQFETKIHLLEGINRIVLVSVSVGLPYYGASFENLGTGIVGPIKIIARSKTGND  589

Query  869   ----MDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplit  1036
                  D+S N W Y  GLHG+  G        +  W  S  +T+R F WY+         
Sbjct  590   SEVIRDISTNRWVYKTGLHGVDLGYQSPIHCYRANW-SSALETNRPFTWYR---------  639

Query  1037  lldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYW  1216
                                      T F  P G + VV+DL+GMGKG+AWVNG NIGRYW
Sbjct  640   -------------------------TNFYYPRGNNPVVVDLSGMGKGVAWVNGINIGRYW  674

Query  1217  PSFLAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGG  1393
               +LA  +GC   CDY+G Y   KC TGCG+P+Q++YH+PR FL K   N  VLFEE+GG
Sbjct  675   TKYLASEEGCDSNCDYKGEYTREKCNTGCGEPAQKYYHIPRGFL-KPHRNMFVLFEELGG  733

Query  1394  RPQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA  1573
              PQ V++ TVTVG ICA   EG+T+EL+C GG  I+KI F SFG P G CG ++   C A
Sbjct  734   NPQNVQIHTVTVGKICAFAYEGSTLELACTGGHSIAKISFASFGNPQGKCGEYDMGTCHA  793

Query  1574  TDIIPVIQSACVGKEKCTLHVSDALFPTTT--CKSKIR-RLAVEATC  1705
             +D + V+Q AC+ ++KC+++V    F      CK++    LAVEA C
Sbjct  794   SDSMEVVQQACLLQKKCSINVDVDHFAQLPQDCKTRFSYNLAVEAVC  840



>ref|XP_003547766.1| PREDICTED: beta-galactosidase 7-like [Glycine max]
Length=826

 Score =   496 bits (1277),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 263/580 (45%), Positives = 353/580 (61%), Gaps = 59/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPY+ T+Y+Y+APLDEYGN+NQPKWGHLK+LH  +   E ++  G  T
Sbjct  294   YHGGTNFGRTAGGPYMTTSYEYDAPLDEYGNLNQPKWGHLKQLHAAIKLGEKIITNGTRT  353

Query  182   NTDYGRMMSSTVYEY-KGKKVCFLANANDKDDISITFEGK-NYTTPAWSVTILPDCKTEV  355
             + D+G  ++ T Y +  G++ CFL+N ND  D ++  +   NY  PAWSVTIL  C  EV
Sbjct  354   DKDFGNEVTLTTYTHTNGERFCFLSNTNDSKDANVDLQQDGNYFLPAWSVTILDGCNKEV  413

Query  356   YNTARVNAQTTVMVKKLSEGA--LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQK  529
             +NTA+VN+QT++MVKK  + +  L W++ PE      +G  N            QL +QK
Sbjct  414   FNTAKVNSQTSIMVKKSDDASNKLTWAWIPEKKKDTMHGKGN--------FKVNQLLEQK  465

Query  530   VVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKF  709
              +T D +DYLWYMTS  IN+++  +    TL VNT+ H L A+ N +H+G +++Q  G F
Sbjct  466   ELTFDVSDYLWYMTSVDINDTS--IWSNATLRVNTRGHTLRAYVNGRHVGYKFSQWGGNF  523

Query  710   KFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLSKN  886
                +++ V L+K +N I+LLS TVGLPNYG  F+K+  G+  GPV+L+  N E +DLS N
Sbjct  524   T--YEKYVSLKKGLNVITLLSATVGLPNYGAKFDKIKTGIAGGPVQLIGNNNETIDLSTN  581

Query  887   TWTYMVGLHGISKGLFKLDDHNKLTWH-ESNFQTDRMFIWYKVTQSiplitlldlpiilN  1063
              W+Y +GL+G  K L+       ++W   S +   R   WYK                  
Sbjct  582   LWSYKIGLNGEKKRLYDPQPRIGVSWRTNSPYPIGRSLTWYKAD----------------  625

Query  1064  TSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDG  1243
                               F  P+G D VV+DL G+GKG AWVNG +IGRYW S++  ++G
Sbjct  626   ------------------FVAPSGNDPVVVDLLGLGKGEAWVNGQSIGRYWTSWITATNG  667

Query  1244  CLQ-CDYRGNY-GGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
             C   CDYRG Y    KC T CG PSQRWYHVPRSFL K   N LVLFEE+GG PQ V  Q
Sbjct  668   CSDTCDYRGKYVPAQKCNTNCGNPSQRWYHVPRSFL-KNDKNTLVLFEEIGGNPQNVSFQ  726

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQ  1597
             TV  GTICA V+EG  +ELSC+GG+ IS+I+F SFG P G+CGSF+    +ATD   V++
Sbjct  727   TVITGTICAQVQEGALLELSCQGGKTISQIQFSSFGNPTGNCGSFKKGTWEATDGQSVVE  786

Query  1598  SACVGKEKCTLHVSDALFPTT----TCKSKIRRLAVEATC  1705
             +ACVG+  C   V+   F           ++ RLAV+ATC
Sbjct  787   AACVGRNSCGFMVTKEAFGVAIGPMNVDERVARLAVQATC  826



>emb|CDY28339.1| BnaC01g35090D [Brassica napus]
Length=788

 Score =   494 bits (1272),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 256/577 (44%), Positives = 339/577 (59%), Gaps = 84/577 (15%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E  L YGN +
Sbjct  287   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERTLTYGNIS  346

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y+ +    CF  N N+  D  I+F+G++Y  PAWSVTILPDCK E YN
Sbjct  347   TIDFGNSASATIYKTEEGSSCFFGNGNENSDAKISFQGESYVVPAWSVTILPDCKNEAYN  406

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K  S+         QLFDQ
Sbjct  407   TAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENVDNFILKGKGDST-------QTQLFDQ  459

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +  LG+ ++L VN+ +H LHAF N KHIG++ A+ +GK
Sbjct  460   KVVTNDQSDYLWYMTTVKFKKRDLFLGKSMSLRVNSTAHALHAFVNGKHIGNQHAE-NGK  518

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   NG+     DL
Sbjct  519   FNYVFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPIFITGINGDETIVKDL  578

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL+G     F+ +  +K  W   +   +R   WYK T              
Sbjct  579   SAHKWSYKTGLNGFENQFFRTESMSK--WSVESVPFNRSMTWYKAT--------------  622

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G D VV+DL G+GKG                    
Sbjct  623   --------------------FKAPLGNDPVVVDLMGLGKGA-------------------  643

Query  1238  DGCLQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
                        Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  Q
Sbjct  644   -----------YHAEKCLTNCGEPTQRWYHVPRSFLNGEGDNTLVLFEEMGGNPSLVSFQ  692

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPVI  1594
             T  VG++CANV E   +ELSC   + IS IKF SFG P G+CGSFE   C+++ + + ++
Sbjct  693   TTRVGSVCANVYENKIIELSCD-RKPISAIKFASFGNPYGNCGSFEKGTCESSNNTVDIL  751

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                CVGKEKC++ VS   F    C    R+LAVE  C
Sbjct  752   TQECVGKEKCSIDVSTKKFGAPDCSGAARKLAVEVIC  788



>emb|CDY53917.1| BnaA07g38250D [Brassica napus]
Length=1029

 Score =   501 bits (1289),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 259/577 (45%), Positives = 345/577 (60%), Gaps = 84/577 (15%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNF RT+GGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E +L YGN +
Sbjct  528   YHGGTNFDRTAGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERILTYGNIS  587

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               D+G   S+T+Y+ +    CF  N N+  D +I+F+G++Y  PAWSVTILPDCK E +N
Sbjct  588   TIDFGNSASATIYKTEEGSSCFFGNGNETSDATISFQGESYVVPAWSVTILPDCKNEAFN  647

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA++  QT++MVKK +E       LKWS+RPE + +     K +S+         QLFDQ
Sbjct  648   TAKIITQTSMMVKKPNEAEDAPSTLKWSWRPENMDNFLLKGKGEST-------QTQLFDQ  700

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
             KVVTND +DYLWYMT+ K  + +PI G+ ++L VN+ +HVLHAF N KHIG++ A+ +GK
Sbjct  701   KVVTNDQSDYLWYMTTVKFKKRDPISGKIMSLRVNSTAHVLHAFVNGKHIGNQHAE-NGK  759

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---DL  877
             F ++F++ VK +   N I+LLS TVGL NYG +FE    G+ GP+ +   NG+     DL
Sbjct  760   FNYIFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPIFITGKNGDETIVKDL  819

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpii  1057
             S + W+Y  GL+G    LF+ +  +K  W       +R   WYK T              
Sbjct  820   SAHKWSYKTGLNGFENQLFRTESMSK--WSVEGVPFNRTMTWYKAT--------------  863

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FK P G + VV+DL G+GKG                    
Sbjct  864   --------------------FKAPLGNEPVVVDLMGLGKGA-------------------  884

Query  1238  DGCLQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQ  1417
                        Y   KC+T CG+P+QRWYHVPRSFL   G+N LVLFEEMGG P  V  Q
Sbjct  885   -----------YHAEKCLTNCGEPTQRWYHVPRSFLNAQGDNTLVLFEEMGGNPSLVNFQ  933

Query  1418  TVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPVI  1594
             T  VG++CANV E   +ELSC   + IS IKF SFG P G+CGSFE   C+++ + + ++
Sbjct  934   TTRVGSVCANVNEKKIIELSCD-RKPISAIKFASFGNPNGNCGSFEKGTCESSKNTVDIL  992

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                CVGKEKC++ VS   F    C    RRLAVEA C
Sbjct  993   TQECVGKEKCSIDVSTEKFGAPDCSGATRRLAVEAIC  1029



>ref|XP_008437707.1| PREDICTED: beta-galactosidase 7-like, partial [Cucumis melo]
Length=777

 Score =   492 bits (1267),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 264/577 (46%), Positives = 352/577 (61%), Gaps = 56/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L  G  +
Sbjct  245   YHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGTRS  304

Query  182   NTDYGRMMSSTVY--EYKGKKVCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCKTE  352
             + ++G  ++ T +     G++ CFL+N + K+D +I  +G   Y  PAWSV+IL  C  E
Sbjct  305   DQNFGSSVTLTKFFNPTTGERFCFLSNTDRKNDATIDLQGDGKYFVPAWSVSILDGCNKE  364

Query  353   VYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             VYNTA+VN+QT++ VK+ +E     L W++ PE +     G+            A  L +
Sbjct  365   VYNTAKVNSQTSMFVKEQNEKENAQLSWTWAPEPMKDTLQGN--------GKFAANLLLE  416

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK VT D +DY WYMT  K++ S     Q +TL+VNTK HVLHAF N ++IGS+W + +G
Sbjct  417   QKRVTVDFSDYFWYMT--KVDTSRTSSLQNVTLQVNTKGHVLHAFVNKRYIGSQW-KSNG  473

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             +  F+F++ + L+   NTI+LLS TVGL NY  +++ V  G+  GP+ L+       DLS
Sbjct  474   Q-SFVFEKPILLKSGTNTITLLSATVGLKNYDAFYDMVPTGIDGGPIYLIGDGNVTTDLS  532

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  K ++      +  W   N ++  R   WYK                
Sbjct  533   SNLWSYKVGLNGEMKQIYNPMFSERTNWIALNKKSIGRRMTWYK----------------  576

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FKTP G D VVLD+ GMGKG AWVNG +IGR+WPSF+A +
Sbjct  577   ------------------TSFKTPGGIDPVVLDMQGMGKGQAWVNGQSIGRFWPSFIAGN  618

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C   CDYRG Y  SKCV  CG PSQRWYHVPRSFL  +  N L+LFEE+GG PQ+V V
Sbjct  619   DSCNATCDYRGAYDPSKCVQNCGNPSQRWYHVPRSFL-SSDKNTLILFEEIGGNPQQVSV  677

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+GTIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF+    D T+    +
Sbjct  678   QTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGNPEGKCGSFKQGSWDVTNSALFV  737

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + AC+G E C++ VS   F      +   RLAV+A C
Sbjct  738   EKACIGMESCSIDVSAKSFGLGDVTNLSARLAVQALC  774



>ref|XP_002324727.2| hypothetical protein POPTR_0018s07470g [Populus trichocarpa]
 gb|EEF03292.2| hypothetical protein POPTR_0018s07470g [Populus trichocarpa]
Length=855

 Score =   494 bits (1271),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 271/590 (46%), Positives = 350/590 (59%), Gaps = 69/590 (12%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L  G  T
Sbjct  293   YHGGTNFGRTAGGPYITTSYDYNAPLDEYGNLNQPKWGHLKQLHEAIKQGERILTNGTVT  352

Query  182   NTDYGRMMSSTVY--EYKGKKVCFLANAN-DKDDISITFEGKNYTTPAWSVTILPDCKTE  352
             + ++   +  T Y  +  G++ CFL+N N ++ ++ +  +GK Y+ PAWSVTIL DC  E
Sbjct  353   SKNFWGGVDQTTYTNQGTGERFCFLSNTNMEEANVDLGQDGK-YSLPAWSVTILQDCNKE  411

Query  353   VYNTARVNAQTTVMVKKLSEG----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             +YNTA+VN QT++MVKKL E      L W++ PE +  +  G             A +L 
Sbjct  412   IYNTAKVNTQTSIMVKKLHEEDKPVQLSWTWAPEPMKGVLQGKGR--------FRATELL  463

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEW----  688
             +QK  T DTTDYLWYMTS  +NE+       +TL V T+ H LHA+ N K IG+++    
Sbjct  464   EQKETTVDTTDYLWYMTSVNLNETTLKKWTNVTLRVGTRGHTLHAYVNKKEIGTQFSKQA  523

Query  689   -AQDDGK---FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVE  853
              AQ   K   + FLF++ V L    NTISLLS TVGL NYGQY++K   G+  GPV+LV 
Sbjct  524   NAQQSVKGDDYSFLFEKPVTLTSGTNTISLLSATVGLANYGQYYDKKPVGIAEGPVQLVA  583

Query  854   PNGEGMDLSKNTWTYMVGLHGISKGLFKLDDHN-----KLTWHESNFQTDRMFIWYKVTQ  1018
                  MDL+   W+Y +GL G +K   + +D N     K T    N  T R   WYK T 
Sbjct  584   NGKPFMDLTSYQWSYKIGLSGEAK---RYNDPNSPHASKFT-ASDNLPTGRAMTWYKTT-  638

Query  1019  SiplitlldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGH  1198
                                              F +P+G + VV+DL GMGKG AWVNG 
Sbjct  639   ---------------------------------FASPSGTEPVVVDLLGMGKGHAWVNGK  665

Query  1199  NIGRYWPSFLAKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVL  1375
             ++GR+WP+ +A + GC   CDYRG+Y G KCVT CG PSQRWYH+PRS+L K G N L+L
Sbjct  666   SLGRFWPTQIADAKGCPDTCDYRGSYNGDKCVTNCGNPSQRWYHIPRSYLNKDGQNTLIL  725

Query  1376  FEEMGGRPQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFE  1555
             FEE+GG P  V  Q V V TIC N  EG+T+ELSC GGR IS I+F S+G+P G+CG+F 
Sbjct  726   FEEVGGNPTNVSFQIVAVETICGNAYEGSTLELSCEGGRTISDIQFASYGDPEGTCGAFM  785

Query  1556  TSHCDATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                  AT    V++ ACVGK+ C + VS   F          RLAV+A C
Sbjct  786   KGSFYATRSAAVVEKACVGKQSCGILVSGETFGLKKRSDIANRLAVQAVC  835



>ref|XP_008437703.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
melo]
Length=821

 Score =   492 bits (1267),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 264/577 (46%), Positives = 350/577 (61%), Gaps = 56/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L  G  +
Sbjct  289   YHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGTRS  348

Query  182   NTDYGRMMSSTVY--EYKGKKVCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCKTE  352
             + + G  ++ T +     G++ CFL+N + K+D +I  +    Y  PAWSV+IL  C  E
Sbjct  349   DQNLGGSVTLTKFFNPTTGERFCFLSNTDGKNDATINLQADGKYFVPAWSVSILDGCNKE  408

Query  353   VYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             VYNTA+VN+QT++ +K+ +E     L W++ PE +     G+            A  L +
Sbjct  409   VYNTAKVNSQTSIFIKEQNEKENAQLSWAWAPEPMKDTLQGN--------GKFAANLLLE  460

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK VT D +DY WYMT    NE++  L Q +TL+VNTK HVLHAF N ++IGS+W + +G
Sbjct  461   QKRVTVDFSDYFWYMTKVDTNETS--LLQNVTLQVNTKGHVLHAFVNKRYIGSQW-KSNG  517

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             +  F+F++ + L+   NTI+LLS TVGL NY  +++ V  G+  GP+ L+       DLS
Sbjct  518   Q-SFVFEKPILLKSGTNTITLLSATVGLKNYDAFYDMVPTGIDGGPIYLIGDGNVTTDLS  576

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W Y VGL+G  K ++      +  W   N ++  R   WYK                
Sbjct  577   SNLWYYKVGLNGEMKQIYNPIFSQRTNWIALNQKSIGRRMTWYK----------------  620

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FKTPAG D VVLD+ GMGKG AWVNG +IGR+WPSF+A +
Sbjct  621   ------------------TSFKTPAGIDPVVLDMQGMGKGQAWVNGQSIGRFWPSFIAGN  662

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C   CDYRG Y  SKCV  CG PSQRWYHVPRSFL  +  N L+LFEE+GG PQ+V V
Sbjct  663   DSCSATCDYRGAYNPSKCVENCGNPSQRWYHVPRSFL-SSDTNTLILFEEIGGNPQQVSV  721

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+GTIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF+    D T+    +
Sbjct  722   QTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGNPEGKCGSFKEGSWDVTNSALFV  781

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + AC+G E C + VS   F      +   RLAV+A C
Sbjct  782   EKACIGMESCLIDVSAKSFGLGDATNLSARLAVQALC  818



>ref|XP_011006177.1| PREDICTED: beta-galactosidase 7-like [Populus euphratica]
Length=855

 Score =   493 bits (1269),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 265/586 (45%), Positives = 350/586 (60%), Gaps = 61/586 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L  G  T
Sbjct  293   YHGGTNFGRTAGGPYITTSYDYNAPLDEYGNLNQPKWGHLKQLHAAIKQGERILTNGTVT  352

Query  182   NTDYGRMMSSTVY--EYKGKKVCFLANAN-DKDDISITFEGKNYTTPAWSVTILPDCKTE  352
             + ++   +  T Y  +  G++ CFL+N N ++ ++ +  +GK Y+ P WSVTIL DC  E
Sbjct  353   SKNFWGGVDQTTYTNQGTGERFCFLSNTNMEEANVDLGQDGK-YSLPDWSVTILQDCNKE  411

Query  353   VYNTARVNAQTTVMVKKLSEGA----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             +YNTA+VN QT++MVKKL E      L W++ PE +  +  G             A +L 
Sbjct  412   IYNTAKVNTQTSIMVKKLHEEDKPVHLSWTWAPEPMKGVLQGKGR--------FRATELL  463

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWA-QD  697
             +QK  T DTTDYLWYMTS  +NE+       +TL V T+ H LHA+ N K IG++++ Q 
Sbjct  464   EQKETTVDTTDYLWYMTSVNLNETTLKKWTNVTLRVGTRGHTLHAYVNKKEIGTQFSKQA  523

Query  698   DGK-------FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVE  853
             +G+       + FLF++ V L    NTISLLS TVGL NYGQY++K   G+  GPV+LV 
Sbjct  524   NGQQSVKGDDYSFLFEKPVTLTSGTNTISLLSATVGLANYGQYYDKKPVGIAEGPVQLVA  583

Query  854   PNGEGMDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHES-NFQTDRMFIWYKVTQSipl  1030
                  MDL+   W+Y +GL G +K  +  +  +   +  S N  T R   WYK T     
Sbjct  584   NGKPFMDLTSYQWSYKIGLSGEAKRYYDPNSPHASKFTASDNLPTGRAMTWYKTT-----  638

Query  1031  itlldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGR  1210
                                          F +P+G + V +DL GMGKG AWVNG ++GR
Sbjct  639   -----------------------------FASPSGTEPVAVDLLGMGKGHAWVNGKSLGR  669

Query  1211  YWPSFLAKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEM  1387
             +WP+ +A + GC   CDYRG+Y G KCVT CG PSQRWYH+PRS+L K G N L++FEE+
Sbjct  670   FWPTQIADAKGCPDTCDYRGSYNGDKCVTNCGNPSQRWYHIPRSYLNKDGQNTLIVFEEV  729

Query  1388  GGRPQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHC  1567
             GG P  V  Q V VGTIC N  EG+T+ELSC GGR IS I+F S+G+P G+CG+F     
Sbjct  730   GGNPTNVSFQIVAVGTICGNAYEGSTLELSCEGGRTISDIQFASYGDPEGTCGAFMKGSF  789

Query  1568  DATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              AT    V++ ACVGK+ C + VS   F          RLAV+A C
Sbjct  790   YATRSAAVVEKACVGKQSCGILVSGETFGLKKRSDIANRLAVQAVC  835



>gb|KDO73841.1| hypothetical protein CISIN_1g036343mg [Citrus sinensis]
Length=795

 Score =   491 bits (1264),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 265/584 (45%), Positives = 342/584 (59%), Gaps = 89/584 (15%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPY+ T+YDY+AP+DEYG++NQPKWGHL+ELH LL S+E  L YGN T
Sbjct  285   YHGGTNFGRTSGGPYLTTSYDYDAPIDEYGHLNQPKWGHLRELHKLLKSMEKTLTYGNVT  344

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             NTDYG  +S                            G +Y  PAWSV+ILPDCKTE +N
Sbjct  345   NTDYGNSVS----------------------------GSSYNLPAWSVSILPDCKTEEFN  376

Query  362   TARVNAQTTVMVKKLSEGA-----LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT V VK+ ++       L+W +RPE I       K   ++         L DQ
Sbjct  377   TAKVNTQTNVKVKRPNQAGNDQAPLQWKWRPEMINDFVVRGKGHFAL-------NTLIDQ  429

Query  527   KVVTNDTTDYLWYMTSFKINESNPIL--GQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             K  TND +DYLWYMT+  + + +PIL     +TL +N+   VLHA+ N  ++ S+W +  
Sbjct  430   K-STNDVSDYLWYMTNADLKDDDPILSGSSNMTLRINSSGQVLHAYVNGNYVDSQWTK-Y  487

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGM---  871
             G    LF+R VKL +  N ISLLS TVGL NYG  F+ V  G+ GPV LV   G+     
Sbjct  488   GASNDLFERPVKLTRGKNQISLLSATVGLQNYGSKFDMVPNGIPGPVLLVGRAGDETIIK  547

Query  872   DLSKNTWTYMVGLHGISKGLF--KLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlld  1045
             DLS + WTY VGL+G+    F      +++  W   N   +R   WYK T          
Sbjct  548   DLSSHKWTYKVGLYGLDDKKFYNAKAANSERGWSSKNVPLNRRMTWYKTT----------  597

Query  1046  lpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSF  1225
                                     F+ P   D VVL+L GMGKG AWVNG+N+GRYWP++
Sbjct  598   ------------------------FEAPLENDPVVLNLQGMGKGFAWVNGYNLGRYWPTY  633

Query  1226  LAKSDGCL--QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRP  1399
             LA+ DGC    CDYRG YG  KC   CG PSQ WYHVPRS++ K G N LVLFEE GG P
Sbjct  634   LAEEDGCSTESCDYRGPYGSDKCAYNCGNPSQIWYHVPRSWI-KDGVNTLVLFEEFGGNP  692

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDA-T  1576
              ++  QTV VGT C    E  TMEL+C  GR+IS+IK+ SFG+P G+CG+F+   C+A  
Sbjct  693   SQINFQTVVVGTACGQAHENKTMELTCH-GRRISEIKYASFGDPQGACGAFKKGSCEAEI  751

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKS-KIRRLAVEATC  1705
             D++P+I+  CVGK+ C++  S+A    T+C +  ++RL VEA C
Sbjct  752   DVLPLIEKQCVGKKSCSIEASEANLGATSCAAGTVKRLVVEALC  795



>gb|ABR17838.1| unknown [Picea sitchensis]
Length=795

 Score =   490 bits (1262),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 261/737 (35%), Positives = 421/737 (57%), Gaps = 40/737 (5%)
 Frame = -3

Query  4472  VKLKPWSSSMR*--DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDST  4299
             VK   W+ ++R    ++ +GI P++  F++++ AC    +L+ G +VH  +I  G+    
Sbjct  96    VKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDIIARGFESDV  155

Query  4298  YVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRN  4119
              V  AL  +Y+KCGSL+   ++FD +PKRD+ SWN +I+G  +      A  LF++MQ N
Sbjct  156   IVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALALFSEMQVN  215

Query  4118  DCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKS  3942
               ++ +  TL +++  C+    + +G+++H +A+R G ES++ V N L+  Y +CG+   
Sbjct  216   G-IKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGN---  271

Query  3941  VMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEG  3762
                                         V+ A +LF+ +P ++   +NA++ G+  N + 
Sbjct  272   ----------------------------VNTAHKLFERMPIRDVASWNAIIGGYSLNSQH  303

Query  3761  LKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAAL  3582
              +A+AFF RM    I+ +  T+ S+  AC  L   +  +QIHG+ ++SG E ND +  AL
Sbjct  304   HEALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNAL  363

Query  3581  LDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVV  3402
             ++M  +CG +  A K+F RMP     +VA  +++ GY+Q+G P  A++LF E Q +G + 
Sbjct  364   VNMYAKCGNVNSAYKLFERMP--KKNVVAWNAIISGYSQHGHPHEALALFIEMQAQG-IK  420

Query  3401  VDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKA  3222
              D  A  +VL  C     L+ G+ +H   ++ GF S+VVVG  ++ +YAKCG ++ A K 
Sbjct  421   PDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKL  480

Query  3221  FELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKN  3042
             FE M  +D+ SW +++  Y +H  G++AL  +S+M+  G   D      IL+A  H    
Sbjct  481   FERMPEQDVVSWTTMILAYGIHGHGEDALALFSKMQETGTKLDHIAFTAILTACSHA--G  538

Query  3041  VVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRAL  2862
             +V++   +F  M+S YG+ P  +HYACLV +LG  G L+EA   I  M  EP ++VW AL
Sbjct  539   LVDQGLQYFQCMKSDYGLAPKLEHYACLVDLLGRAGHLDEANGIIKNMSLEPDANVWGAL  598

Query  2861  LDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQ  2682
             L +C +H N  +G++  K +  ++P +   ++L SN+Y+ + RW+    +R  MKEKG +
Sbjct  599   LGACRIHCNIELGEQAAKHLFELDPDNAGYYVLLSNIYAEAQRWEDVAKLRKMMKEKGVK  658

Query  2681  KIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEY  2502
             K PG S V       +F   D +H QS+ IY+ L+IL  +  KAGYVP+T+  L +VEE 
Sbjct  659   KQPGCSVVAVHRDVQTFLVGDRTHPQSEQIYAMLEILYEQMRKAGYVPNTNLALQDVEEE  718

Query  2501  QKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDT  2322
              K++ L  HS KLA+++G++ T  G P+R+MKN+ +C DCH   K  S +  REI VRD 
Sbjct  719   AKENILSSHSEKLAISFGIINTSPGIPIRIMKNLRVCSDCHNATKFISKIVGREIIVRDA  778

Query  2321  SGFHCFLNGKCSCNDRW  2271
             + FH   NG CSC D W
Sbjct  779   NRFHHVKNGFCSCGDYW  795


 Score =   206 bits (525),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/389 (31%), Positives = 206/389 (53%), Gaps = 36/389 (9%)
 Frame = -3

Query  4217  KRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNAC-SECFMRRGQ  4041
             + +   W   I G VK   + +A  L+  MQR   +  D +   +++ AC S+  ++ G+
Sbjct  82    RNNAVVWKETIIGYVKNGFWNKALRLYYQMQRTG-INPDKLVFLSVIKACGSQSDLQAGR  140

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESG  3861
             ++H   +  G+ES++ V  AL   YT+CGS+++   +F+RM  RD  +WN          
Sbjct  141   KVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWN----------  190

Query  3860  LVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIAN  3681
                                  A++AG+ QNG+  +A+A F  M    I+ +  TL S+  
Sbjct  191   ---------------------AIIAGYSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMP  229

Query  3680  ACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRL  3501
              C  L+  +  KQIH + ++SG E +  +   L++M  +CG +  A K+F RMP+    +
Sbjct  230   VCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPI--RDV  287

Query  3500  VALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHC  3321
              +  +++ GY+ N Q   A++ F   Q+ G +  + +   +VL  C  L  L+ G+ +H 
Sbjct  288   ASWNAIIGGYSLNSQHHEALAFFNRMQVRG-IKPNSITMVSVLPACAHLFALEQGQQIHG  346

Query  3320  LALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDE  3141
              A++ GF S+ VVGNA+++MYAKCG +++A K FE M  +++ +WN++++GY  H    E
Sbjct  347   YAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHE  406

Query  3140  ALDTWSRMERLGIVPDSFTCLHILSAYRH  3054
             AL  +  M+  GI PDSF  + +L A  H
Sbjct  407   ALALFIEMQAQGIKPDSFAIVSVLPACAH  435



>gb|KDP33944.1| hypothetical protein JCGZ_07515 [Jatropha curcas]
Length=825

 Score =   490 bits (1262),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 266/585 (45%), Positives = 360/585 (62%), Gaps = 67/585 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APL+EYGN+NQPK+GHLK+LH +L+S+E  L +G+ +
Sbjct  291   YHGGTNFGRTAGGPYITTSYDYDAPLNEYGNLNQPKYGHLKQLHAVLHSMEYTLTHGDIS  350

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
               +Y   +++T+Y  +    CFL+NAN   D +I F+   Y  PAWSV+ILPDCK   YN
Sbjct  351   TINYDNAVTATIYASEKGSSCFLSNANSTTDATIVFQYLEYKIPAWSVSILPDCKNVAYN  410

Query  362   TARVNAQTTVMVKKLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALD--AKQLFDQKVV  535
             TA+V  QTT MV + +     WS+RPE +          S++++ + D  A QL DQK+ 
Sbjct  411   TAKVTTQTTTMVNQKTTSFFDWSWRPEDV---------NSTIVLGSGDFSADQLLDQKIF  461

Query  536   TNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGKFKF  715
              ND++DYLW+MTS  + + +PI   +++L +N   HVLHAF N + +GS+W ++D     
Sbjct  462   -NDSSDYLWHMTSVDLKKDDPIWTDDMSLRINGTGHVLHAFVNGEIVGSQWRKND-----  515

Query  716   LFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLV-EPNGEGM--DLSKN  886
             LF++S+KL++  N I++LS TVGL NYG  F+    G+ GPV+LV   N E +  DLS  
Sbjct  516   LFEKSIKLKQGRNLITILSSTVGLQNYGARFDLGPTGIPGPVELVGRKNDETIIKDLSSG  575

Query  887   TWTYMVGLHGISKG------LFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldl  1048
              WTY VGL G+++       ++ L+      W + +     M  WYK T           
Sbjct  576   NWTYRVGLQGLNQTVVDNNIMYNLNLPETFKWQDKDLPFFTMMTWYKGT-----------  624

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FKTP+G D VVLD+ GM KG+AWVNG++IGRYWPS L
Sbjct  625   -----------------------FKTPSGNDPVVLDMLGMEKGLAWVNGYSIGRYWPSIL  661

Query  1229  AKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGN--NQLVLFEEMGGRP  1399
             A  D C + CDYRG Y  +KC+T CGKPSQR YH+PRSFL+   N  N LVLFEE GG P
Sbjct  662   ADDDDCTEKCDYRGAYNNNKCLTNCGKPSQRVYHIPRSFLKNDPNATNTLVLFEEFGGSP  721

Query  1400  QEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEP-IGSCGSFETSHCDAT  1576
               + +QTVTVG +     EG+T+ELSC  G+ IS I+F SFG+P   S GSFE   C+ +
Sbjct  722   FFITLQTVTVGKVSGRGNEGDTIELSCY-GKPISAIQFASFGDPQRTSNGSFEKGSCEGS  780

Query  1577  -DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIR-RLAVEATC  1705
              D + + Q ACVGKE C + VS  +F  T C+  +   LAVEA C
Sbjct  781   KDALSIAQKACVGKETCAIKVSADVFGCTNCEEGVENSLAVEALC  825



>gb|KDP29228.1| hypothetical protein JCGZ_16617 [Jatropha curcas]
Length=846

 Score =   490 bits (1262),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 258/590 (44%), Positives = 350/590 (59%), Gaps = 62/590 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFG T GGPYI T+YDY+AP+DEYGN+NQPKWGHLK LH  LYS++D ++YG+ T
Sbjct  297   YHGGTNFGETGGGPYITTSYDYDAPIDEYGNLNQPKWGHLKNLHEALYSMKDHIVYGDKT  356

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             + D G+   +T++ Y+GK+ CF +N  D +D ++TFEG +   P WSV++ PDC  EVYN
Sbjct  357   DIDCGQNKWATIFSYQGKRSCFFSNI-DYNDQTLTFEGADLFLPGWSVSLSPDCFHEVYN  415

Query  362   TARVNAQTTVMVKKL--------SEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
             TA+VNAQT+VMV +         +   L+W   PE I+H+       S   +    +  +
Sbjct  416   TAKVNAQTSVMVNRPIHPVDEDDTPYKLEWQSTPEQIVHINRNGNLDSGAFV---ASNAV  472

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNP-ILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQ  694
              DQK VTN T+DYL+ +T +  N S+P  + +++ L+V T   ++HAF N + +GS+++ 
Sbjct  473   LDQKTVTNGTSDYLYLLTLYFHNSSDPQWVNKDIFLQVRTNGPIIHAFVNKRFVGSQYSD  532

Query  695   DDG---KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGE  865
               G    + F F+R ++L    N I L S +VGLPNYG  F+  G G++GP++L+  +  
Sbjct  533   YHGHLDDYGFQFEREIRLVNGANRIVLASVSVGLPNYGPNFDYWGCGIVGPIQLIARSRN  592

Query  866   GM------DLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSip  1027
             G       D+S N W +  GLHG+     KL      +W  +  Q DR F WYK      
Sbjct  593   GSEPEVIKDISTNRWIHKTGLHGVDLEYHKLLHRYSPSW-SAIPQIDRPFTWYK------  645

Query  1028  litlldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIG  1207
                                         T F  P G D VV+DL GMGKG+AW+NG NIG
Sbjct  646   ----------------------------TNFLYPHGTDPVVVDLNGMGKGVAWINGINIG  677

Query  1208  RYWPSFLAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEE  1384
             RYWP  +A  +GC + CDY+  Y   KC TGCG+P+QR+YH+PR +LR   NN LVLFEE
Sbjct  678   RYWPKNVASEEGCSIFCDYKNKYDSGKCSTGCGQPTQRYYHIPRDWLRPD-NNLLVLFEE  736

Query  1385  MGGRPQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSH  1564
              GG PQ V++QTVTVG +CAN  E N +EL+C GG  I+KI F SFG P G CG +    
Sbjct  737   FGGNPQNVQIQTVTVGKVCANAYEWNKLELACAGGHNITKINFASFGNPQGKCGDYSPGR  796

Query  1565  CDATDIIPVIQSACVGKEKCTLHV---SDALFPTTTCKSKIRRLAVEATC  1705
             C A D + V+Q AC+ +  CT+ V   S AL P    +    RLAVEA C
Sbjct  797   CHAIDSLDVVQKACLNQRNCTIDVNINSFALLPPECRQIFSYRLAVEAFC  846



>ref|XP_002528629.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF33732.1| beta-galactosidase, putative [Ricinus communis]
Length=822

 Score =   488 bits (1256),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 265/591 (45%), Positives = 368/591 (62%), Gaps = 64/591 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFG T GGPYI  +YDY+APLDEYGN+ QPKWGHL++LH++L S+E  L YG + 
Sbjct  273   YHGGTNFGTTGGGPYITASYDYDAPLDEYGNLRQPKWGHLRDLHSVLNSMEQTLTYGESK  332

Query  182   NTDY--GRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEV  355
             N++Y     +  T++ Y+GK+ CF ++ + KD  +I+FEG +Y  PAWSV+ILPDC TEV
Sbjct  333   NSNYPDNNNIFITIFAYQGKRSCFFSSIDYKDQ-TISFEGTDYFLPAWSVSILPDCFTEV  391

Query  356   YNTARVNAQTTVMVKKLSEG-------ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQ  514
             YNTA VN QT++M  K +         +L+W +RPE I  L      Q   + + L A +
Sbjct  392   YNTATVNVQTSIMENKANAADSFREPNSLQWKWRPEKIRGLSL----QGDFVGNTLVANE  447

Query  515   LFDQKVVTNDTTDYLWYMTSFKINESNPI--LGQELTLEVNTKSHVLHAFFNNKHIGSEW  688
             L DQK VTN T+DYLW MT++  N ++ +   G+++ L+V+T  HV+HAF N KH+GS+ 
Sbjct  448   LMDQKAVTNGTSDYLWIMTNYDHNMNDSLWGAGKDIILQVHTNGHVVHAFVNGKHVGSQS  507

Query  689   AQ-DDGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGE  865
             A  + G+F F+F+  +KL++ IN ISL+S +VGL NYG  F+    G+ GP+ ++  +  
Sbjct  508   ASIESGRFDFVFESKIKLKRGINRISLVSVSVGLQNYGANFDTAPTGINGPITIIGRSKL  567

Query  866   G------MDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSip  1027
             G      +D+S N W Y  GLHG  +G   +   ++  ++  +   ++ F+WYK      
Sbjct  568   GNQPDVTVDISSNRWVYKTGLHGEDQGFQAVRPRHRRQFYTKHVLINQPFVWYK------  621

Query  1028  litlldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIG  1207
                                         T F  P G+D VV+DL G+GKG AWVNG NIG
Sbjct  622   ----------------------------TSFNAPLGQDPVVVDLLGLGKGTAWVNGRNIG  653

Query  1208  RYWPSFLAKSDGCLQ--CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFE  1381
             R+WP  LA  DG     C Y G Y   +CVTGCG+P+QR+YH+PR +L K  +N+LVLFE
Sbjct  654   RFWPKALAPDDGTCNAPCSYIGTYEPKQCVTGCGEPTQRYYHIPRDWL-KPEDNKLVLFE  712

Query  1382  EMGGRPQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETS  1561
             E+GG P  V VQTVTVG +C +  EG+T+ELSC+ GRK SKI F SFG P G CGSF  S
Sbjct  713   ELGGTPDFVSVQTVTVGKVCVHGYEGHTVELSCQHGRKFSKITFASFGLPQGKCGSFTPS  772

Query  1562  H---CDATDIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   C A D+  +++ ACVGKE+C++ +S+       C ++I RLAVEA C
Sbjct  773   NNHDCHA-DVSTIVEKACVGKERCSIDISEKALAPIHCDARIYRLAVEAVC  822



>ref|XP_008444022.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=824

 Score =   488 bits (1255),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 257/577 (45%), Positives = 348/577 (60%), Gaps = 56/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L  G+ +
Sbjct  292   YHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGSRS  351

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCKTE  352
             +  +G  ++ T +     G++ CFL+N ND +D ++  +    Y  PAWSV+IL  CK E
Sbjct  352   DKKFGSFVTLTKFSNPITGERFCFLSNTNDTNDATVDLKADGKYFVPAWSVSILNGCKKE  411

Query  353   VYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             V+NTA +N+QT++ VK  +E     L W + PE +     G             A  L +
Sbjct  412   VFNTANINSQTSMFVKVQNEKENAQLSWVWAPEAMTDTLQGK--------GTFKANLLLE  463

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK  T D +DYLWYMT  + N ++ +  Q +TL+VNTK HVLHAF NN +IGS+W + +G
Sbjct  464   QKGTTVDFSDYLWYMTDVETNGTSAL--QNVTLQVNTKGHVLHAFVNNMYIGSQW-ESNG  520

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             +  F+F++ ++L+   NTI+LLS TVGL NY  +++ V  G+  GP+ L+E      +LS
Sbjct  521   Q-SFVFEKPIQLKTGTNTITLLSATVGLKNYDAFYDTVPTGIDGGPIYLIEDGNVTTNLS  579

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESN-FQTDRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  + L+         W + N    +R   WYK                
Sbjct  580   SNLWSYKVGLNGEKEQLYNPMFSKGTNWSKLNKTSVERRMTWYK----------------  623

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FKTP+G D + LD+ GMGKG AW+NG +IGR+WPSF+A +
Sbjct  624   ------------------TSFKTPSGIDPIALDMQGMGKGEAWINGQSIGRFWPSFIAGN  665

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C + CDYRG Y  SKCV  CG PSQRWYH+PRSFL     N LVLFEE+GG PQ+V V
Sbjct  666   DNCSEACDYRGAYDPSKCVENCGNPSQRWYHIPRSFLSDD-TNTLVLFEEIGGNPQQVSV  724

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+GTIC N  EG+ +ELSC+GG  IS+I+F S+G P G CGSF+    D T+    +
Sbjct  725   QTITIGTICGNANEGSILELSCQGGHIISEIQFASYGNPKGKCGSFKQGSWDVTNTALFV  784

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +  C+G + C+L VS   F      +   RLAV+A C
Sbjct  785   EKTCIGMKNCSLDVSAKSFGLRKAANLSARLAVQALC  821



>ref|XP_010688541.1| PREDICTED: beta-galactosidase 15-like [Beta vulgaris subsp. vulgaris]
Length=802

 Score =   484 bits (1247),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 266/611 (44%), Positives = 354/611 (58%), Gaps = 88/611 (14%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             +HGGTNFGRTSGGPYI T+YDY+APLDEYGN+NQPK+GHLK+LH++L+S+E +L YG+  
Sbjct  237   FHGGTNFGRTSGGPYITTSYDYDAPLDEYGNLNQPKYGHLKQLHSVLHSMEKLLTYGDVN  296

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
              T  G  ++ T +       CFL+NAN  +D +I      +T PAWSV+ILPDCK E YN
Sbjct  297   TTAMGNSVTVTTFTNNKTSSCFLSNANSTNDATIVLNHHTFTIPAWSVSILPDCKNEAYN  356

Query  362   TARVNAQTTVMVKKLSEG-----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             TA+VN QT ++ KK +E      +L W++R E+I   KY  + +     D L      +Q
Sbjct  357   TAKVNTQTNMIEKKHNEAEQEPSSLTWNWRRESIS--KYVKEGKGQFAGDVL-----LEQ  409

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKH-----------  673
             K  TNDT+DYLWYMTS  +++++ I   ++ L +N+ +HVLH + N +            
Sbjct  410   KAATNDTSDYLWYMTSLHLDKNDIIWSDDMRLRINSSAHVLHVYVNGEELGKISFIILLL  469

Query  674   -------------------IGSEWAQDDGKFKFLFQRSVKLRKDINTISLLSETVGLPNY  796
                                IG E+A++D  F ++F+  V L+K  N ISLLS TVGL NY
Sbjct  470   SFYLVFILAYAVTNISFYSIGYEYAKED-SFTYIFEGKVNLKKGKNIISLLSATVGLQNY  528

Query  797   GQYFEKVGQGVIGPVKLVEPNGEGM---DLSKNTWTYMVGLHGISKG-LFKLDDHNKLTW  964
             G Y++    G++GPV+LV   G+ +   DLS + W Y  GL G+    L+     +   W
Sbjct  529   GPYYDMTPVGIVGPVELVGKRGDEIVIKDLSSHVWAYKTGLQGVDHDMLYSETSPSVRRW  588

Query  965   H-ESNFQTDRMFIWYKVTQSiplitlldlpiilNTSFV*M*LLCSFWILQTFFKTPAGED  1141
               E++   D    WYK T                                  FK P G +
Sbjct  589   KTETDMPVDTQMTWYKTT----------------------------------FKPPLGTN  614

Query  1142  SVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKSDGCL--QCDYRGNYGGSKCVTGCGKPSQ  1315
              V+LDL+ MGKG AWVNG +IGRYWPS+LA  DGC    CDYRG Y  +KCVT CGK  Q
Sbjct  615   PVILDLSSMGKGEAWVNGISIGRYWPSYLADEDGCSLDPCDYRGEYDNTKCVTNCGKSIQ  674

Query  1316  RWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRVQTVTVGTICANVREGNTMELSCRGGRK  1495
               YHVPRSFLR   N  LVLFEE GG P +V+ +T+ V   CAN  EG+T+ELSC+ G  
Sbjct  675   TEYHVPRSFLRDDVNT-LVLFEEFGGNPTQVKFKTIGVKGACANGYEGSTLELSCK-GSS  732

Query  1496  ISKIKFGSFGEPIGSCGSFETSHCDATDIIPVIQSACVGKEKCTLHVSDALF-PTTTCKS  1672
             IS IKF SFG P+G CGSF+   CD  D   ++  ACVG+E C++ +S+  F     C+ 
Sbjct  733   ISAIKFASFGNPLGDCGSFKKGSCD-IDAQHILTKACVGQEICSVDISEKTFGAALNCEE  791

Query  1673  KIRRLAVEATC  1705
             K +RLAVE TC
Sbjct  792   KTKRLAVEITC  802



>ref|XP_008464891.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=824

 Score =   483 bits (1243),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 259/578 (45%), Positives = 349/578 (60%), Gaps = 58/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDY+APLDEYGN+NQPKWGHLK+LH+ +   E +L  G  +
Sbjct  292   YHGGTNFGRTSGGPFITTSYDYDAPLDEYGNLNQPKWGHLKQLHSSIKLGEKILTNGTQS  351

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISITFE--GKNYTTPAWSVTILPDCKT  349
             N DYG  ++ T +     G++ CFL+N N  +D +I  +  GK Y  PAWSVTIL  C  
Sbjct  352   NQDYGASVTLTKFSNPSTGERFCFLSNTNGSNDATIDLQTDGK-YFVPAWSVTILDGCNK  410

Query  350   EVYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             E+YNTA++N+QT+  VK+ +E     L W++ PE +     G             A +L 
Sbjct  411   EIYNTAKINSQTSKFVKEQNEKNNAKLLWTWTPEPMKDTLQGK--------GKFKANRLL  462

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             +QK  T D +DYLWYMT  K N +  +  + ++L+V+TK HVLHAF N ++IGS+W + +
Sbjct  463   EQKGTTIDASDYLWYMTHVKTNATFSL--RYVSLQVHTKGHVLHAFVNKRYIGSQW-KSN  519

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDL  877
             G+  F+F++ + L+   N I+LLS TVGL NYG +++ V  G+  GP+ L+      +DL
Sbjct  520   GQ-SFVFEKPILLKSRKNIITLLSATVGLNNYGAFYDTVPTGIDGGPIHLIGDGNVTIDL  578

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpi  1054
             S N W+Y VGL+G  K L+      K  W   N ++  R   WYK               
Sbjct  579   SSNLWSYKVGLNGEMKKLYDATFSQKTKWRALNKKSIGRRMTWYK---------------  623

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                T FKTP+G DSV LD+ GMGKG AWVNG +IGR+WPSF++ 
Sbjct  624   -------------------TNFKTPSGTDSVALDMQGMGKGQAWVNGVSIGRFWPSFISG  664

Query  1235  SDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             +D C  +CDYRG Y  +KC   CG PSQRWYHVPRSFL     N L+LFEE+GG PQ+V 
Sbjct  665   NDNCSAKCDYRGEYNPNKCADNCGSPSQRWYHVPRSFLSND-TNTLILFEELGGNPQQVS  723

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
             +QT+ + TIC N  EG+T+ELSC  GR IS+I+F S+G P G CGSFE    D T+   +
Sbjct  724   IQTIALRTICGNAYEGSTLELSCTKGRIISEIQFASYGNPEGKCGSFEKGSWDVTNSTFL  783

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++  C+G E CT+ VS   F      +   RL V+A C
Sbjct  784   VKKTCIGMENCTIDVSARFFGVENTTNLPARLVVQALC  821



>ref|XP_004171705.1| PREDICTED: beta-galactosidase 7-like [Cucumis sativus]
Length=826

 Score =   481 bits (1238),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 253/578 (44%), Positives = 353/578 (61%), Gaps = 57/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDY+APLDEYGN+NQPKWGHLK+LH  +   E +L     +
Sbjct  293   YHGGTNFGRTSGGPFITTSYDYDAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNSTRS  352

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISITFEG-KNYTTPAWSVTILPDCKTE  352
             + D+G  ++ T +     G+K CFL+NA++ +D  +   G + Y  PAWSV+IL  C  E
Sbjct  353   DQDFGSSVTFTKFSNLETGEKFCFLSNADENNDAIVDMLGDRKYFLPAWSVSILDGCNKE  412

Query  353   VYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             ++NTA+V++QT++  KK +E     L W++  E +     G+            A  L +
Sbjct  413   IFNTAKVSSQTSLFFKKQNEKENAKLSWNWASEPMRDTLQGY--------GTFKANLLLE  464

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK  T D++DYLWYMT+   N ++ +  Q LTL+VNTK HVLHAF N ++IGS+W  +  
Sbjct  465   QKGATIDSSDYLWYMTNVNSNTTSSL--QNLTLQVNTKGHVLHAFINRRYIGSQWGSNGQ  522

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
                F+F++ ++L+   NTI+LLS TVGL NY  +++ V  G+  GP+ L+       DLS
Sbjct  523   --SFVFEKPIQLKLGTNTITLLSATVGLKNYDAFYDTVPTGIDGGPIYLIGDGNVTTDLS  580

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  K L+     N+  W   N ++  R   W+K T              
Sbjct  581   SNLWSYKVGLNGERKQLYNPMFSNRTKWSTLNKKSIGRRMTWFKAT--------------  626

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FKTP+G D VVLD+ GMGKG AWVNG +IGR+WPSF+A +
Sbjct  627   --------------------FKTPSGTDPVVLDMQGMGKGQAWVNGRSIGRFWPSFIASN  666

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C + CDY+G+Y  +KCV  CG  SQRWYH+PRSF+  +  N L+LFEE+GG PQ V V
Sbjct  667   DSCSETCDYKGSYNPNKCVRNCGNSSQRWYHIPRSFMNDS-INTLILFEEIGGNPQMVSV  725

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+GTIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF++   D T    +I
Sbjct  726   QTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGHPEGKCGSFQSGLWDVTKSTTII  785

Query  1595  -QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              + AC+G + C++ +S  LF  +       +LAV+A C
Sbjct  786   VEKACIGMKNCSIDISPNLFKLSKVAYPYAKLAVQALC  823



>ref|XP_008459141.1| PREDICTED: beta-galactosidase 15-like [Cucumis melo]
Length=824

 Score =   481 bits (1238),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 260/578 (45%), Positives = 348/578 (60%), Gaps = 58/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDY+APLDEYG++NQPKWGHLK+LH  +   E +L  G  +
Sbjct  292   YHGGTNFGRTSGGPFITTSYDYDAPLDEYGSLNQPKWGHLKQLHASIKLGEKILTNGTRS  351

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISITFE--GKNYTTPAWSVTILPDCKT  349
             N DYG  ++ T +     G++ CFL+N N  +D +I  +  GK Y  PAWSVTIL  C  
Sbjct  352   NQDYGGSVTLTKFSNPSTGERFCFLSNTNGSNDATIDLQTDGK-YFVPAWSVTILDGCNK  410

Query  350   EVYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             EVYNTA+VN+QT+  VK+ +E     L W++ PE +     G             A +L 
Sbjct  411   EVYNTAKVNSQTSKFVKEQNEKNNAKLLWTWTPEPMKDTLQGK--------GKFKANRLL  462

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             +QK  T D +DYLWYMT  + N +  +  + ++L+V+TK HVLHAF N ++IGS+W + D
Sbjct  463   EQKGTTVDASDYLWYMTHIETNATFSL--RNVSLQVSTKGHVLHAFVNKRYIGSQW-KSD  519

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDL  877
             G+  F+F++ + L+   N I+LLS TVGL NYG +++ V  G+  GP+ L+      +DL
Sbjct  520   GQ-SFVFEKPILLKPRKNIITLLSATVGLNNYGAFYDTVPTGIDGGPIYLIGGGNVTVDL  578

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpi  1054
             S N W+Y VGL+G  K L+      K  W   N ++  R   WYK               
Sbjct  579   SSNLWSYKVGLNGEMKKLYDPTFSQKKKWRALNKKSIGRRMTWYK---------------  623

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                T FKTP+G + V LD+ GMGKG AWVNG +IGR+WPSF++ 
Sbjct  624   -------------------TNFKTPSGTNPVALDMQGMGKGQAWVNGVSIGRFWPSFISG  664

Query  1235  SDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             +D C   CDYRG Y   KC   CG PSQRWYHVPRSFL     N L+LFEE+GG PQ+V 
Sbjct  665   NDSCSANCDYRGGYNPKKCADNCGNPSQRWYHVPRSFLSND-TNTLILFEEIGGNPQQVS  723

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
             +QT+ +GTIC N  EG+T+ELSC+ GR IS+I+F S+G P G CGSF+    D T+   +
Sbjct  724   IQTIALGTICGNAYEGSTLELSCQEGRIISEIQFASYGNPDGKCGSFKKGSWDVTNSTVL  783

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++  CVG E CT+ VS   F      +   RLAV+A C
Sbjct  784   VEKTCVGVENCTIDVSARFFGVENATNLSARLAVQALC  821



>ref|XP_002314911.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEF01082.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=743

 Score =   477 bits (1227),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 254/679 (37%), Positives = 396/679 (58%), Gaps = 6/679 (1%)
 Frame = -3

Query  4304  STYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQ  4125
             +++  N ++  YSK G L  + E+F  +P RD  SWN++ISG V       A + +N M 
Sbjct  70    NSFSWNTMLSAYSKSGDLSTMQEIFSIMPNRDGVSWNSLISGYVCYGSVVEAVKTYNSMM  129

Query  4124  RNDCLRIDYITLST-LLNACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSI  3948
             ++  L ++ IT ST LL   S+  +  G+++H   ++ G+ + + V ++L+  Y + G +
Sbjct  130   KDGVLNLNRITFSTMLLLVSSQGCVDLGRQIHGQIVKFGFGAYVFVGSSLVDMYAKMGLV  189

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
                  +F+ +  R+   +N MIT  + SG+V  +K LF  + E++++ +  ++ G  QNG
Sbjct  190   SVASQVFDEVQERNVVMYNTMITGLLRSGMVKDSKRLFHGMKERDSISWTTMITGLIQNG  249

Query  3767  EGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEA  3588
                +AM  F  M +E +    +T  S+  ACG L   K  K+IH  I++SG   N  + +
Sbjct  250   LEAEAMDLFRDMRQEGMAMDQYTFGSVLTACGGLRALKEGKEIHTLIIRSGYNHNVFVGS  309

Query  3587  ALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
             AL+DM  +C  +  AE +F RM   +  +V+ T+ML GY QNG  E A+ +F + Q  G 
Sbjct  310   ALVDMYCKCRSVRYAEAVFKRM--ANKNVVSWTAMLVGYGQNGFSEEAVRVFCDMQRNG-  366

Query  3407  VVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAV  3228
             +  D+    +V+  C  L  L+ G   HC AL  G +S + V NA+I++Y KCG ++++ 
Sbjct  367   IEPDDFTLGSVISSCANLASLEEGAQFHCQALVSGLISFITVSNALITLYGKCGSIEDSN  426

Query  3227  KAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTT  3048
             + F+ MS RD  SW +L++GY    + +E +D + RM   G+ PD+ T + +LSA   + 
Sbjct  427   QLFDEMSFRDEVSWTALVSGYAQFGKANETIDLFERMLVQGLKPDAVTFIAVLSAC--SR  484

Query  3047  KNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWR  2868
               +V R Q +F SM   +G++P SDHY C++ + G  G LEEA+  IN MPF P S  W 
Sbjct  485   AGLVERGQQYFESMLKDHGIIPFSDHYTCMIDLFGRAGRLEEAKNFINKMPFSPDSIGWA  544

Query  2867  ALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKG  2688
              LL SC ++ N  IGK   + +L ++PQ+P+ +IL S++Y+A G+W     +R  M+EKG
Sbjct  545   TLLSSCRLYGNEEIGKWAAESLLELDPQNPAGYILLSSIYAAKGKWSNVAQLRRGMREKG  604

Query  2687  FQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVE  2508
              +K PG SW+  + K + F A D S   S  IY+ L+ L  + ++ GYVPD S VLH+VE
Sbjct  605   ARKEPGFSWIKYKSKVYIFSADDQSSPFSDQIYAELEKLNHKMIEEGYVPDASSVLHDVE  664

Query  2507  EYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVR  2328
             + +K   L HHS KLA+ +GLL   HG P+RV+KN+ +CGDCH   K  S +++REI VR
Sbjct  665   DSEKMKMLNHHSEKLAIAFGLLFIPHGLPIRVVKNLRVCGDCHNATKYISKISQREILVR  724

Query  2327  DTSGFHCFLNGKCSCNDRW  2271
             D   FH F +G CSC D W
Sbjct  725   DAVRFHLFKDGTCSCGDFW  743


 Score =   144 bits (363),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/347 (30%), Positives = 174/347 (50%), Gaps = 23/347 (7%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R  G+  ++Y+F ++LTAC   + L+ G ++H L+I+ GY  + +V +AL+ +Y KC 
Sbjct  260   DMRQEGMAMDQYTFGSVLTACGGLRALKEGKEIHTLIIRSGYNHNVFVGSALVDMYCKCR  319

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             S+ +   +F  +  +++ SW  M+ G  +      A  +F DMQRN  +  D  TL +++
Sbjct  320   SVRYAEAVFKRMANKNVVSWTAMLVGYGQNGFSEEAVRVFCDMQRNG-IEPDDFTLGSVI  378

Query  4076  NACSE-CFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
             ++C+    +  G + H  AL  G  S ++V+NALI  Y +CGSI+    LF+ M  RD  
Sbjct  379   SSCANLASLEEGAQFHCQALVSGLISFITVSNALITLYGKCGSIEDSNQLFDEMSFRDEV  438

Query  3899  TWNEMITAYMESGLVDLAKELFDHL----PEKNAVLYNAVLAGFCQNGEGLKAMAFFYRM  3732
             +W  +++ Y + G  +   +LF+ +     + +AV + AVL+   + G   +   +F  M
Sbjct  439   SWTALVSGYAQFGKANETIDLFERMLVQGLKPDAVTFIAVLSACSRAGLVERGQQYFESM  498

Query  3731  IKES--IEFSD-FT-LTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTR  3564
             +K+   I FSD +T +  +    G L E K+      FI K    P+    A LL  C  
Sbjct  499   LKDHGIIPFSDHYTCMIDLFGRAGRLEEAKN------FINKMPFSPDSIGWATLLSSCRL  552

Query  3563  CGRME----DAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISL  3435
              G  E     AE +    P      + L+S+   YA  G+  N   L
Sbjct  553   YGNEEIGKWAAESLLELDPQNPAGYILLSSI---YAAKGKWSNVAQL  596


 Score = 35.8 bits (81),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (55%), Gaps = 6/64 (9%)
 Frame = -2

Query  4602  EEDTRLSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVELFYE  4441
             E +  + N +I+  L+ G+V  +  +F      DS+S   +I+G  +   E EA++LF +
Sbjct  201   ERNVVMYNTMITGLLRSGMVKDSKRLFHGMKERDSISWTTMITGLIQNGLEAEAMDLFRD  260

Query  4440  MRLE  4429
             MR E
Sbjct  261   MRQE  264


 Score =   150 bits (378),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 116/482 (24%), Positives = 208/482 (43%), Gaps = 69/482 (14%)
 Frame = -3

Query  4409  NEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELF  4230
             N  +F  +L        ++LG Q+H  ++K G+    +V ++L+ +Y+K G +    ++F
Sbjct  137   NRITFSTMLLLVSSQGCVDLGRQIHGQIVKFGFGAYVFVGSSLVDMYAKMGLVSVASQVF  196

Query  4229  DNLPKRDIASWNTMISGMVKESMF-------------------------------TRAFE  4143
             D + +R++  +NTMI+G+++  M                                  A +
Sbjct  197   DEVQERNVVMYNTMITGLLRSGMVKDSKRLFHGMKERDSISWTTMITGLIQNGLEAEAMD  256

Query  4142  LFNDMQRNDCLRIDYITLSTLLNACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFY  3966
             LF DM R + + +D  T  ++L AC     ++ G+E+H   +R GY  N+ V +AL+  Y
Sbjct  257   LFRDM-RQEGMAMDQYTFGSVLTACGGLRALKEGKEIHTLIIRSGYNHNVFVGSALVDMY  315

Query  3965  TRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLA  3786
              +C S++   A+F+RM  ++  +W  M                               L 
Sbjct  316   CKCRSVRYAEAVFKRMANKNVVSWTAM-------------------------------LV  344

Query  3785  GFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEP  3606
             G+ QNG   +A+  F  M +  IE  DFTL S+ ++C  L   +   Q H   L SG   
Sbjct  345   GYGQNGFSEEAVRVFCDMQRNGIEPDDFTLGSVISSCANLASLEEGAQFHCQALVSGLIS  404

Query  3605  NDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE  3426
                +  AL+ +  +CG +ED+ ++F  M       V+ T+++ GYAQ G+    I LF  
Sbjct  405   FITVSNALITLYGKCGSIEDSNQLFDEMSFRDE--VSWTALVSGYAQFGKANETIDLFER  462

Query  3425  TQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG  3246
               ++GL        A +        + +  +    +   HG +        +I ++ + G
Sbjct  463   MLVQGLKPDAVTFIAVLSACSRAGLVERGQQYFESMLKDHGIIPFSDHYTCMIDLFGRAG  522

Query  3245  ELDNAVKAFELMS-SRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHIL  3069
              L+ A      M  S D   W +LL+   L+  G+E +  W+    L + P +     +L
Sbjct  523   RLEEAKNFINKMPFSPDSIGWATLLSSCRLY--GNEEIGKWAAESLLELDPQNPAGYILL  580

Query  3068  SA  3063
             S+
Sbjct  581   SS  582


 Score = 27.7 bits (60),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 9/87 (10%)
 Frame = -2

Query  4671  LINSSISTYPEQHAVDYAD--FLKLEEDTRLS-NALISAYLKLGLVDYALAVF------D  4519
             L N+ I+ Y +   + YA   F K+ +    S N ++SAY K G +     +F      D
Sbjct  42    LYNNLINAYSKLGNITYARHVFDKMPQPNSFSWNTMLSAYSKSGDLSTMQEIFSIMPNRD  101

Query  4518  SLSSPAIISGFAKINREIEAVELFYEM  4438
              +S  ++ISG+      +EAV+ +  M
Sbjct  102   GVSWNSLISGYVCYGSVVEAVKTYNSM  128


 Score =   143 bits (361),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 113/416 (27%), Positives = 207/416 (50%), Gaps = 55/416 (13%)
 Frame = -3

Query  3986  NALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAV  3807
             N LI  Y++ G+I     +F++M   ++F+WN M++AY +SG +   +E+F  +P ++ V
Sbjct  44    NNLINAYSKLGNITYARHVFDKMPQPNSFSWNTMLSAYSKSGDLSTMQEIFSIMPNRDGV  103

Query  3806  LYNAVLAGFCQNGEGLKAMAFFYRMIKES------IEFSDFTLTSIANACGLLMERKSSK  3645
              +N++++G+   G  ++A+  +  M+K+       I FS   L   +  C  L      +
Sbjct  104   SWNSLISGYVCYGSVVEAVKTYNSMMKDGVLNLNRITFSTMLLLVSSQGCVDL-----GR  158

Query  3644  QIHGFILKSGCEPNDCIEAALLDMCT-------------------------------RCG  3558
             QIHG I+K G      + ++L+DM                                 R G
Sbjct  159   QIHGQIVKFGFGAYVFVGSSLVDMYAKMGLVSVASQVFDEVQERNVVMYNTMITGLLRSG  218

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAt  3378
              ++D++++FH M       ++ T+M+ G  QNG    A+ LF + + EG+  +D+    +
Sbjct  219   MVKDSKRLFHGMK--ERDSISWTTMITGLIQNGLEAEAMDLFRDMRQEGM-AMDQYTFGS  275

Query  3377  vlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRD  3198
             VL  CG L  LK G+ +H L ++ G+  +V VG+A++ MY KC  +  A   F+ M++++
Sbjct  276   VLTACGGLRALKEGKEIHTLIIRSGYNHNVFVGSALVDMYCKCRSVRYAEAVFKRMANKN  335

Query  3197  LCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTT---KNVVNRC  3027
             + SW ++L GY  +   +EA+  +  M+R GI PD FT   ++S+  +     +     C
Sbjct  336   VVSWTAMLVGYGQNGFSEEAVRVFCDMQRNGIEPDDFTLGSVISSCANLASLEEGAQFHC  395

Query  3026  QSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALL  2859
             Q+    + S   V  A      L+++ G  G +E++ +  + M F  + S W AL+
Sbjct  396   QALVSGLISFITVSNA------LITLYGKCGSIEDSNQLFDEMSFRDEVS-WTALV  444



>ref|XP_007226966.1| hypothetical protein PRUPE_ppa025241mg [Prunus persica]
 gb|EMJ28165.1| hypothetical protein PRUPE_ppa025241mg [Prunus persica]
Length=743

 Score =   474 bits (1221),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 251/674 (37%), Positives = 394/674 (58%), Gaps = 6/674 (1%)
 Frame = -3

Query  4289  NALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCL  4110
             NA++ +YSK G L  + E+FD +P+ D  SWN+ ISG     +   A + ++ M  +   
Sbjct  75    NAILSVYSKSGYLSDMQEIFDRMPRLDGVSWNSFISGHASCGLLAEAVKFYSLMLTDGAA  134

Query  4109  RIDYITLSTLLNACS-ECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMA  3933
              ++ IT ST+L  CS +  +  G++LH H ++ G+ES + V + L+  Y++ G I     
Sbjct  135   NLNRITFSTMLVLCSSQRCVNLGRQLHGHIVKFGFESYVFVGSPLVDMYSKAGLILDAKR  194

Query  3932  LFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKA  3753
             +F  M  R+   +N +IT  +  GL++ ++ LF  +PEK+++ +  ++ G  QNG G KA
Sbjct  195   VFNSMPERNVVMYNTLITGLLRCGLIEDSECLFSKMPEKDSISWTTMITGLTQNGSGSKA  254

Query  3752  MAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDM  3573
             +  F  MI E +    +T  S+  ACG L   +  KQ+H +I+++    N  + +AL+DM
Sbjct  255   LDKFREMILEGLSMDQYTFGSVLTACGGLFALEEGKQVHAYIIRTELIDNIFVGSALVDM  314

Query  3572  CTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDE  3393
               +C  ++ AE +F RM   +  +V+ T+ML GY QNG  E A+ +F + Q +G V  D+
Sbjct  315   YCKCRSIKAAEGVFKRM--SYKNVVSWTAMLVGYGQNGYSEEAVRVFCDMQRKG-VEPDD  371

Query  3392  VATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFEL  3213
                 +V+  C  L  L+ G   HC AL  G +S + V NA++++Y KCG ++++ + F  
Sbjct  372   FTLGSVISSCANLASLEEGAQFHCQALASGLISFITVSNALVTLYGKCGSIEDSHRLFNE  431

Query  3212  MSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVN  3033
             M+ RD  SW +L++GY    +  E +D + RM   G+ PD  T + +LSA   +   +V+
Sbjct  432   MNIRDEVSWTALVSGYAQFGKAYETIDLFERMLAHGLKPDGVTFIGVLSAC--SRAGLVD  489

Query  3032  RCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDS  2853
             +   +F SM   +G+ P  DHY C++ +L   G LEEA+  IN MPF P +  W  LL S
Sbjct  490   KGHQYFESMVKEHGITPIMDHYTCIIDLLSRAGRLEEAKRFINEMPFHPDAIGWATLLSS  549

Query  2852  CIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIP  2673
             C +H N  IGK   + +L +EPQ+P+++IL S++Y+A G+W     +R  M++KG +K P
Sbjct  550   CRLHRNIEIGKWAAESLLELEPQNPASYILLSSIYAAKGKWNEVANLRRGMRDKGVRKEP  609

Query  2672  GQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKK  2493
             G SW+  + + H F A D S   S  IY+ L+ L  + ++ GY PD S VLH+VEE +KK
Sbjct  610   GCSWIKYKSRVHIFSADDQSSPFSDQIYAKLEKLNCKMIEEGYEPDMSSVLHDVEESEKK  669

Query  2492  DFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGF  2313
               L +HS KLA+ +GL+    G P+RV+KN+ +CGDCH   K  S +TKREI VRD   +
Sbjct  670   KMLNYHSEKLAIAFGLIFLPAGVPIRVVKNLRVCGDCHNATKYISKITKREILVRDAVRY  729

Query  2312  HCFLNGKCSCNDRW  2271
             H F +G CSC D W
Sbjct  730   HLFKDGTCSCGDFW  743


 Score =   145 bits (366),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 113/481 (23%), Positives = 208/481 (43%), Gaps = 67/481 (14%)
 Frame = -3

Query  4409  NEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELF  4230
             N  +F  +L  C   + + LG Q+H  ++K G+    +V + L+ +YSK G +     +F
Sbjct  137   NRITFSTMLVLCSSQRCVNLGRQLHGHIVKFGFESYVFVGSPLVDMYSKAGLILDAKRVF  196

Query  4229  DNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDC---------------------  4113
             +++P+R++  +NT+I+G+++  +   +  LF+ M   D                      
Sbjct  197   NSMPERNVVMYNTLITGLLRCGLIEDSECLFSKMPEKDSISWTTMITGLTQNGSGSKALD  256

Query  4112  ---------LRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYT  3963
                      L +D  T  ++L AC   F +  G+++HA+ +R     N+ V +AL+  Y 
Sbjct  257   KFREMILEGLSMDQYTFGSVLTACGGLFALEEGKQVHAYIIRTELIDNIFVGSALVDMYC  316

Query  3962  RCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAG  3783
             +C SIK+   +F+RM  ++  +W  M                               L G
Sbjct  317   KCRSIKAAEGVFKRMSYKNVVSWTAM-------------------------------LVG  345

Query  3782  FCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPN  3603
             + QNG   +A+  F  M ++ +E  DFTL S+ ++C  L   +   Q H   L SG    
Sbjct  346   YGQNGYSEEAVRVFCDMQRKGVEPDDFTLGSVISSCANLASLEEGAQFHCQALASGLISF  405

Query  3602  DCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFET  3423
               +  AL+ +  +CG +ED+ ++F+ M +     V+ T+++ GYAQ G+    I LF   
Sbjct  406   ITVSNALVTLYGKCGSIEDSHRLFNEMNIRDE--VSWTALVSGYAQFGKAYETIDLFERM  463

Query  3422  QLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGE  3243
                GL          +        + K  +    +  +HG    +     +I + ++ G 
Sbjct  464   LAHGLKPDGVTFIGVLSACSRAGLVDKGHQYFESMVKEHGITPIMDHYTCIIDLLSRAGR  523

Query  3242  LDNAVKAF-ELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILS  3066
             L+ A +   E+    D   W +LL+   LHR  +  +  W+    L + P +     +LS
Sbjct  524   LEEAKRFINEMPFHPDAIGWATLLSSCRLHRNIE--IGKWAAESLLELEPQNPASYILLS  581

Query  3065  A  3063
             +
Sbjct  582   S  582


 Score =   145 bits (365),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 112/428 (26%), Positives = 210/428 (49%), Gaps = 37/428 (9%)
 Frame = -3

Query  4049  RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYM  3870
             + ++LH H ++        + N +I  Y R G+++    +F++M     F+WN +++ Y 
Sbjct  23    QAKKLHCHIIKTVASPETFLLNNIITTYGRLGNLRYARHVFDQMPHPTLFSWNAILSVYS  82

Query  3869  ESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE-SIEFSDFTLT  3693
             +SG +   +E+FD +P  + V +N+ ++G    G   +A+ F+  M+ + +   +  T +
Sbjct  83    KSGYLSDMQEIFDRMPRLDGVSWNSFISGHASCGLLAEAVKFYSLMLTDGAANLNRITFS  142

Query  3692  SIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMP--  3519
             ++   C         +Q+HG I+K G E    + + L+DM ++ G + DA+++F+ MP  
Sbjct  143   TMLVLCSSQRCVNLGRQLHGHIVKFGFESYVFVGSPLVDMYSKAGLILDAKRVFNSMPER  202

Query  3518  -------LGHGRL--------------------VALTSMLRGYAQNGQPENAISLFFETQ  3420
                    L  G L                    ++ T+M+ G  QNG    A+  F E  
Sbjct  203   NVVMYNTLITGLLRCGLIEDSECLFSKMPEKDSISWTTMITGLTQNGSGSKALDKFREMI  262

Query  3419  LEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL  3240
             LEGL  +D+    +VL  CG L  L+ G+ +H   ++   + ++ VG+A++ MY KC  +
Sbjct  263   LEGL-SMDQYTFGSVLTACGGLFALEEGKQVHAYIIRTELIDNIFVGSALVDMYCKCRSI  321

Query  3239  DNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAY  3060
               A   F+ MS +++ SW ++L GY  +   +EA+  +  M+R G+ PD FT   ++S  
Sbjct  322   KAAEGVFKRMSYKNVVSWTAMLVGYGQNGYSEEAVRVFCDMQRKGVEPDDFTLGSVIS--  379

Query  3059  RHTTKNVVNRCQSFFFSMQS-AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPK  2883
               +  N+ +  +   F  Q+ A G++        LV++ G  G +E++    N M    +
Sbjct  380   --SCANLASLEEGAQFHCQALASGLISFITVSNALVTLYGKCGSIEDSHRLFNEMNIRDE  437

Query  2882  SSVWRALL  2859
              S W AL+
Sbjct  438   VS-WTALV  444


 Score =   131 bits (329),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/319 (27%), Positives = 151/319 (47%), Gaps = 41/319 (13%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G+  ++Y+F ++LTAC     LE G QVHA +I+   +D+ +V +AL+ +Y KC S+   
Sbjct  265   GLSMDQYTFGSVLTACGGLFALEEGKQVHAYIIRTELIDNIFVGSALVDMYCKCRSIKAA  324

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
               +F  +  +++ SW  M+ G  +      A  +F DMQR   +  D  TL +++++C+ 
Sbjct  325   EGVFKRMSYKNVVSWTAMLVGYGQNGYSEEAVRVFCDMQRKG-VEPDDFTLGSVISSCAN  383

Query  4061  -CFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                +  G + H  AL  G  S ++V+NAL+  Y +CGSI+    LF  M +RD  +W  +
Sbjct  384   LASLEEGAQFHCQALASGLISFITVSNALVTLYGKCGSIEDSHRLFNEMNIRDEVSWTAL  443

Query  3884  ITAYMESG----LVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             ++ Y + G     +DL + +  H  + + V +  VL+   + G   K   +F  M+KE  
Sbjct  444   VSGYAQFGKAYETIDLFERMLAHGLKPDGVTFIGVLSACSRAGLVDKGHQYFESMVKE--  501

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
                                              G  P       ++D+ +R GR+E+A++
Sbjct  502   --------------------------------HGITPIMDHYTCIIDLLSRAGRLEEAKR  529

Query  3536  IFHRMPLGHGRLVALTSML  3480
               + MP  H   +   ++L
Sbjct  530   FINEMPF-HPDAIGWATLL  547


 Score = 76.3 bits (186),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 93/192 (48%), Gaps = 8/192 (4%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D++  G+EP++++  +++++C    +LE G Q H   +  G +    V NAL+ LY KCG
Sbjct  361   DMQRKGVEPDDFTLGSVISSCANLASLEEGAQFHCQALASGLISFITVSNALVTLYGKCG  420

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQR--NDCLRIDYITLST  4083
             S++    LF+ +  RD  SW  ++SG  +   F +A+E  +  +R     L+ D +T   
Sbjct  421   SIEDSHRLFNEMNIRDEVSWTALVSGYAQ---FGKAYETIDLFERMLAHGLKPDGVTFIG  477

Query  4082  LLNACSEC-FMRRG-QELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVR  3909
             +L+ACS    + +G Q   +     G    +     +I   +R G ++        M   
Sbjct  478   VLSACSRAGLVDKGHQYFESMVKEHGITPIMDHYTCIIDLLSRAGRLEEAKRFINEMPFH  537

Query  3908  -DAFTWNEMITA  3876
              DA  W  ++++
Sbjct  538   PDAIGWATLLSS  549



>ref|XP_003612351.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95309.1| beta-galactosidase-like protein [Medicago truncatula]
Length=806

 Score =   476 bits (1226),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 259/580 (45%), Positives = 351/580 (61%), Gaps = 61/580 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLL-YGNA  178
             YHGGTNFGRT+GGPYI T+YDY+AP+DEYGN+NQPKWGHLK LH  +   E+VL  Y   
Sbjct  276   YHGGTNFGRTAGGPYITTSYDYDAPIDEYGNLNQPKWGHLKNLHAAIKLGENVLTNYSAR  335

Query  179   TNTDYGRMMSSTVY-EYKGKKVCFLANANDKDDISITFEGKN---YTTPAWSVTILPDCK  346
              + D G  ++ T Y    G + CFL+N N+  D+    + KN   Y  PAWSV+I+  C 
Sbjct  336   KDEDLGNGLTLTTYTNSSGARFCFLSN-NNNTDLGARVDLKNDGVYIVPAWSVSIINGCN  394

Query  347   TEVYNTARVNAQTTVMVKK---LSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
              EV+NTA+VN+QT++MVKK   +S   L W ++ E      +G+         +L A++L
Sbjct  395   QEVFNTAKVNSQTSMMVKKSDNVSSTNLTWEWKVEPKRDTIHGN--------GSLKAQKL  446

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              +QK +T D +DYLWYMTS  IN+++  +    TL VNT  H LH + N +++G +++Q 
Sbjct  447   LEQKELTLDASDYLWYMTSADINDTS--IWSNATLRVNTSGHSLHGYVNQRYVGYQFSQY  504

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMD  874
               +F   +++ V L+   N I+LLS TVGL NYG +F+    G+  GPV+L+  N   MD
Sbjct  505   GNQFT--YEKQVSLKNGTNIITLLSATVGLANYGAWFDDKKTGISGGPVELIGKNNVTMD  562

Query  875   LSKNTWTYMVGLHGISKGLFKLDDHNKLTWH--ESNFQTDRMFIWYKVTQSiplitlldl  1048
             LS N W+Y +GL+G  + L+    +  + WH   S     +  IWY+             
Sbjct  563   LSTNLWSYKIGLNGERRHLYDAQQNVSVAWHTNSSYIPIGKPLIWYRAK-----------  611

Query  1049  piilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFL  1228
                                    FK+P G + +V+DL G+GKG AWVNGH+IGRYW S++
Sbjct  612   -----------------------FKSPFGTNPIVVDLQGLGKGHAWVNGHSIGRYWSSWI  648

Query  1229  AKSDGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQE  1405
             + SDGC   CDYRGNY   KC T CG PSQRWYHVPRSFL     N LVLFEE+GG PQ 
Sbjct  649   SPSDGCSDTCDYRGNYVPVKCNTNCGSPSQRWYHVPRSFLNHD-MNTLVLFEEIGGNPQS  707

Query  1406  VRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDII  1585
             V+ QTVT GTICANV EG   ELSC+ G+ +S+I+F S+G P G CGSF+  + DA +  
Sbjct  708   VQFQTVTTGTICANVYEGAQFELSCQSGQVMSQIQFASYGNPEGQCGSFKKGNFDAANSQ  767

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
              V++++CVGK  C  +V+  +F  T   S I RLAV+ TC
Sbjct  768   SVVEASCVGKNNCGFNVTKEMFGVTNV-SSIPRLAVQVTC  806



>ref|XP_008452141.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
melo]
Length=821

 Score =   477 bits (1227),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 259/577 (45%), Positives = 347/577 (60%), Gaps = 56/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNA LDEYGN+NQPKWGHLK+LH  +   E +L  G  +
Sbjct  289   YHGGTNFGRTSGGPFITTSYDYNALLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGTRS  348

Query  182   NTDYGRMMSSTVY--EYKGKKVCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCKTE  352
             + ++G  ++ T +     G++ CFL+N + K+D +I  +    Y  PAWSV+IL  C  E
Sbjct  349   DQNFGNSVTLTKFFNPTTGERFCFLSNTDGKNDATIDLQADGKYFVPAWSVSILDGCNKE  408

Query  353   VYNTARVNAQTTVMVKKLSEG---ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             VYNTA+VN+QT++ VK+ +E     L W++ PE +     G+            A  L +
Sbjct  409   VYNTAKVNSQTSMFVKEKNEKENVQLSWAWAPEPMKDTLQGN--------GKFAANLLLE  460

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK VT D +DY WYMT+   N ++ +  Q +TL+VNTK HVLH F N ++IGS+W   +G
Sbjct  461   QKRVTVDFSDYFWYMTNVDTNGTSSL--QNVTLQVNTKGHVLHVFVNKRYIGSQWG-SNG  517

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             K  F+F++ + L+   NTI+LLS TVGL NY  +++ V  G+  GP+ L+       DLS
Sbjct  518   K-SFVFEKPILLKSRTNTITLLSATVGLKNYDAFYDMVPTGIDGGPIYLIGDGNVTTDLS  576

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  K ++      +  W   N ++  R   WYK                
Sbjct  577   SNLWSYKVGLNGEMKQIYNPMFSQRTNWIALNQKSIGRRMTWYK----------------  620

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FKTPAG D VVLD+ GMGKG AWVN  +IGR+WPSF+A +
Sbjct  621   ------------------TSFKTPAGIDPVVLDMQGMGKGQAWVNEKSIGRFWPSFIAGN  662

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C   CDYRG Y  SKCV  CG PSQRWYHVPRSFL  +  N L+LFEE+GG PQ+V V
Sbjct  663   DSCSATCDYRGAYNPSKCVGNCGNPSQRWYHVPRSFL-SSNTNTLILFEEIGGNPQQVSV  721

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+ TIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF+    D T+    +
Sbjct  722   QTITIRTICGNANEGSTLELSCQGGHVISEIQFASYGNPGGKCGSFKQGSWDVTNSALFV  781

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             + AC+G E C++ V    F      +   RLAV+A C
Sbjct  782   EKACIGMESCSIDVFAKSFGLGDATNLSARLAVQALC  818



>ref|XP_008451143.1| PREDICTED: beta-galactosidase 15-like [Cucumis melo]
Length=940

 Score =   480 bits (1235),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 255/579 (44%), Positives = 347/579 (60%), Gaps = 60/579 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L   N+T
Sbjct  408   YHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHASIKMGEKILT--NST  465

Query  182   NTDYGRMMSSTVYEYK----GKKVCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCK  346
              +D       T+ ++     G++ CFL+N ++K+D +I  +    Y  PAWSV+IL  C 
Sbjct  466   RSDQKISSFITLTKFSNPTTGERFCFLSNTDNKNDATIDLQADGKYFVPAWSVSILDSCN  525

Query  347   TEVYNTARVNAQTTVMVK---KLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
              EV+NTA++N+QT++ VK   K       W + PE +     G             A  L
Sbjct  526   KEVFNTAKINSQTSMFVKVQNKKENAQFSWVWAPEPMRDTLQGK--------GTFKANLL  577

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              +QK  T D +DYLWYMT+   N ++ +  Q +TL+VNTK H+LHAF N ++IGS+W ++
Sbjct  578   LEQKGTTVDFSDYLWYMTNIDSNTTSSL--QNITLQVNTKGHMLHAFVNRRYIGSQW-RN  634

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMD  874
             +G+  F+F++ + ++   NTI+LLS TVGL NY  +++ V  G+  GP+ L+      +D
Sbjct  635   NGQ-SFVFEKPILIKPGTNTITLLSATVGLKNYDAFYDTVPTGIDGGPIYLIGDGNVTID  693

Query  875   LSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlp  1051
             LS N W+Y VGL+G  K L+      +  W E N ++  R   WYK              
Sbjct  694   LSSNLWSYKVGLNGEMKQLYNPVFSQRTNWREINQKSIGRRMTWYK--------------  739

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                 T FKTP G D V LD+ GMGKG AWVNG +IGR+WPSF+A
Sbjct  740   --------------------TSFKTPPGTDPVTLDMQGMGKGQAWVNGQSIGRFWPSFIA  779

Query  1232  KSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEV  1408
              +D C   CDYRG Y  SKCV  CG PSQRWYH+PRSFL     N L+LFEE+GG PQ+V
Sbjct  780   GNDSCSTTCDYRGAYNPSKCVENCGNPSQRWYHIPRSFLSDD-TNTLILFEEIGGNPQQV  838

Query  1409  RVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIP  1588
              VQT+T+GTIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF+    D  +   
Sbjct  839   SVQTITIGTICGNANEGSTLELSCQGGHIISEIQFASYGNPEGKCGSFKQGSWDVINSAI  898

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +++  C+G E C++ VS   F      +   RLA++A C
Sbjct  899   LVEKICIGMESCSIDVSAKSFGLGDVTNLSARLAIQALC  937



>ref|XP_011009234.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
 ref|XP_011009241.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
 ref|XP_011009249.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
Length=743

 Score =   473 bits (1217),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 252/679 (37%), Positives = 395/679 (58%), Gaps = 6/679 (1%)
 Frame = -3

Query  4304  STYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQ  4125
             +++  N ++  YSK G L  + E+F  +P RD  SWN++ISG         A + +N M 
Sbjct  70    NSFSWNTMLSAYSKSGDLSTMQEIFSIMPSRDGVSWNSLISGYACYGSVVEAVKTYNSMM  129

Query  4124  RNDCLRIDYITLST-LLNACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSI  3948
             ++  L ++ IT ST LL   S+  +  G+++H   ++ G+ + + V ++L+  Y + G +
Sbjct  130   KDGVLNLNRITFSTMLLLVSSQGCVDLGRQIHGQIVKFGFGAYVFVGSSLVDMYAKMGLV  189

Query  3947  KSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNG  3768
                  +F+ +  R+   +N MIT  +  G+V  +K LF  + E++++ +  ++ G  QNG
Sbjct  190   SVASQVFDEVQERNVVMYNTMITGLLRCGMVKDSKRLFHGMKERDSISWTTMITGLIQNG  249

Query  3767  EGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEA  3588
                +AM  F  M +E +    +T  S+  ACG LM  K  K+IH  I++SG   N  + +
Sbjct  250   LEAEAMDLFRDMRQEGMAMDQYTFGSVLTACGGLMALKEGKEIHTLIIRSGYNHNVFVGS  309

Query  3587  ALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
             AL+DM  +C  +  AE +F RM   +  +V+ T+ML GY QNG  E A+ +F + Q  G 
Sbjct  310   ALVDMYCKCRSVRYAEAVFKRM--ANKNVVSWTAMLVGYGQNGFSEEAVRVFCDMQRNG-  366

Query  3407  VVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAV  3228
             +  D+    +V+  C  L  L+ G   HC AL  G +S + V NA+I++Y KCG ++++ 
Sbjct  367   IEPDDFTLGSVISSCANLASLEEGAQFHCQALVSGLISFITVSNALITLYGKCGSIEDSN  426

Query  3227  KAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTT  3048
             + F+ MS RD  SW +L++GY    + +E +D + RM   G+ PD+ T + +LSA   + 
Sbjct  427   QLFDEMSFRDEVSWTALVSGYAQFGKANETIDLFERMLVQGLKPDAVTFIAVLSAC--SR  484

Query  3047  KNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWR  2868
               +V R Q +F SM   +G++P SDHY C++ + G  G LEEA+  IN MP  P S  W 
Sbjct  485   AGLVERGQHYFESMLKDHGIIPFSDHYTCMIDLFGRAGRLEEAKSFINKMPSSPDSIGWA  544

Query  2867  ALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKG  2688
              LL SC ++ N  IGK   + +L ++PQ+P+ +IL S++Y+A G+W     +R  M+EKG
Sbjct  545   TLLSSCRLYGNEEIGKWAAESLLELDPQNPAGYILLSSIYAAKGKWSNVAQLRRGMREKG  604

Query  2687  FQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVE  2508
              +K PG SW+  + K + F A D S   S  IY+ L+ L  + ++ GYVPD+S VLH+VE
Sbjct  605   ARKEPGFSWIKYKSKVYIFSAEDQSSPFSDQIYAELEKLNHKMIEEGYVPDSSSVLHDVE  664

Query  2507  EYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVR  2328
             + +K   L HHS KLA+ +GLL   HG P+RV+KN+ +CGDCH   K  S +++REI VR
Sbjct  665   DSEKMKMLNHHSEKLAIAFGLLFIPHGLPIRVVKNLRVCGDCHNATKYISKISQREILVR  724

Query  2327  DTSGFHCFLNGKCSCNDRW  2271
             D   FH F +G CSC D W
Sbjct  725   DAVRFHLFKDGTCSCGDFW  743


 Score =   145 bits (365),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/347 (30%), Positives = 173/347 (50%), Gaps = 23/347 (7%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D+R  G+  ++Y+F ++LTAC     L+ G ++H L+I+ GY  + +V +AL+ +Y KC 
Sbjct  260   DMRQEGMAMDQYTFGSVLTACGGLMALKEGKEIHTLIIRSGYNHNVFVGSALVDMYCKCR  319

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
             S+ +   +F  +  +++ SW  M+ G  +      A  +F DMQRN  +  D  TL +++
Sbjct  320   SVRYAEAVFKRMANKNVVSWTAMLVGYGQNGFSEEAVRVFCDMQRNG-IEPDDFTLGSVI  378

Query  4076  NACSE-CFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
             ++C+    +  G + H  AL  G  S ++V+NALI  Y +CGSI+    LF+ M  RD  
Sbjct  379   SSCANLASLEEGAQFHCQALVSGLISFITVSNALITLYGKCGSIEDSNQLFDEMSFRDEV  438

Query  3899  TWNEMITAYMESGLVDLAKELFDHL----PEKNAVLYNAVLAGFCQNGEGLKAMAFFYRM  3732
             +W  +++ Y + G  +   +LF+ +     + +AV + AVL+   + G   +   +F  M
Sbjct  439   SWTALVSGYAQFGKANETIDLFERMLVQGLKPDAVTFIAVLSACSRAGLVERGQHYFESM  498

Query  3731  IKES--IEFSD-FT-LTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTR  3564
             +K+   I FSD +T +  +    G L E KS      FI K    P+    A LL  C  
Sbjct  499   LKDHGIIPFSDHYTCMIDLFGRAGRLEEAKS------FINKMPSSPDSIGWATLLSSCRL  552

Query  3563  CGRME----DAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISL  3435
              G  E     AE +    P      + L+S+   YA  G+  N   L
Sbjct  553   YGNEEIGKWAAESLLELDPQNPAGYILLSSI---YAAKGKWSNVAQL  596


 Score = 37.4 bits (85),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (55%), Gaps = 6/64 (9%)
 Frame = -2

Query  4602  EEDTRLSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVELFYE  4441
             E +  + N +I+  L+ G+V  +  +F      DS+S   +I+G  +   E EA++LF +
Sbjct  201   ERNVVMYNTMITGLLRCGMVKDSKRLFHGMKERDSISWTTMITGLIQNGLEAEAMDLFRD  260

Query  4440  MRLE  4429
             MR E
Sbjct  261   MRQE  264


 Score =   152 bits (384),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 123/483 (25%), Positives = 215/483 (45%), Gaps = 71/483 (15%)
 Frame = -3

Query  4409  NEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELF  4230
             N  +F  +L        ++LG Q+H  ++K G+    +V ++L+ +Y+K G +    ++F
Sbjct  137   NRITFSTMLLLVSSQGCVDLGRQIHGQIVKFGFGAYVFVGSSLVDMYAKMGLVSVASQVF  196

Query  4229  DNLPKRDIASWNTMIS-----GMVKES-----------------MFT---------RAFE  4143
             D + +R++  +NTMI+     GMVK+S                 M T          A +
Sbjct  197   DEVQERNVVMYNTMITGLLRCGMVKDSKRLFHGMKERDSISWTTMITGLIQNGLEAEAMD  256

Query  4142  LFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFY  3966
             LF DM R + + +D  T  ++L AC     ++ G+E+H   +R GY  N+ V +AL+  Y
Sbjct  257   LFRDM-RQEGMAMDQYTFGSVLTACGGLMALKEGKEIHTLIIRSGYNHNVFVGSALVDMY  315

Query  3965  TRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLA  3786
              +C S++   A+F+RM  ++  +W  M                               L 
Sbjct  316   CKCRSVRYAEAVFKRMANKNVVSWTAM-------------------------------LV  344

Query  3785  GFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEP  3606
             G+ QNG   +A+  F  M +  IE  DFTL S+ ++C  L   +   Q H   L SG   
Sbjct  345   GYGQNGFSEEAVRVFCDMQRNGIEPDDFTLGSVISSCANLASLEEGAQFHCQALVSGLIS  404

Query  3605  NDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE  3426
                +  AL+ +  +CG +ED+ ++F  M       V+ T+++ GYAQ G+    I LF  
Sbjct  405   FITVSNALITLYGKCGSIEDSNQLFDEMSFRDE--VSWTALVSGYAQFGKANETIDLFER  462

Query  3425  TQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG  3246
               ++GL        A +        + +       +   HG +        +I ++ + G
Sbjct  463   MLVQGLKPDAVTFIAVLSACSRAGLVERGQHYFESMLKDHGIIPFSDHYTCMIDLFGRAG  522

Query  3245  ELDNAVKAF--ELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHI  3072
              L+ A K+F  ++ SS D   W +LL+   L+  G+E +  W+    L + P +     +
Sbjct  523   RLEEA-KSFINKMPSSPDSIGWATLLSSCRLY--GNEEIGKWAAESLLELDPQNPAGYIL  579

Query  3071  LSA  3063
             LS+
Sbjct  580   LSS  582


 Score = 29.6 bits (65),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 9/87 (10%)
 Frame = -2

Query  4671  LINSSISTYPEQHAVDYADFL--KLEEDTRLS-NALISAYLKLGLVDYALAVF------D  4519
             L N+ I+ Y +   + YA  L  K+ +    S N ++SAY K G +     +F      D
Sbjct  42    LYNNLINAYSKLGNITYARHLFDKMPQPNSFSWNTMLSAYSKSGDLSTMQEIFSIMPSRD  101

Query  4518  SLSSPAIISGFAKINREIEAVELFYEM  4438
              +S  ++ISG+A     +EAV+ +  M
Sbjct  102   GVSWNSLISGYACYGSVVEAVKTYNSM  128


 Score =   149 bits (375),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 115/416 (28%), Positives = 208/416 (50%), Gaps = 55/416 (13%)
 Frame = -3

Query  3986  NALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAV  3807
             N LI  Y++ G+I     LF++M   ++F+WN M++AY +SG +   +E+F  +P ++ V
Sbjct  44    NNLINAYSKLGNITYARHLFDKMPQPNSFSWNTMLSAYSKSGDLSTMQEIFSIMPSRDGV  103

Query  3806  LYNAVLAGFCQNGEGLKAMAFFYRMIKES------IEFSDFTLTSIANACGLLMERKSSK  3645
              +N++++G+   G  ++A+  +  M+K+       I FS   L   +  C  L      +
Sbjct  104   SWNSLISGYACYGSVVEAVKTYNSMMKDGVLNLNRITFSTMLLLVSSQGCVDL-----GR  158

Query  3644  QIHGFILKSGCEPNDCIEAALLDMCT-------------------------------RCG  3558
             QIHG I+K G      + ++L+DM                                 RCG
Sbjct  159   QIHGQIVKFGFGAYVFVGSSLVDMYAKMGLVSVASQVFDEVQERNVVMYNTMITGLLRCG  218

Query  3557  RMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAt  3378
              ++D++++FH M       ++ T+M+ G  QNG    A+ LF + + EG+  +D+    +
Sbjct  219   MVKDSKRLFHGMK--ERDSISWTTMITGLIQNGLEAEAMDLFRDMRQEGM-AMDQYTFGS  275

Query  3377  vlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRD  3198
             VL  CG L  LK G+ +H L ++ G+  +V VG+A++ MY KC  +  A   F+ M++++
Sbjct  276   VLTACGGLMALKEGKEIHTLIIRSGYNHNVFVGSALVDMYCKCRSVRYAEAVFKRMANKN  335

Query  3197  LCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTT---KNVVNRC  3027
             + SW ++L GY  +   +EA+  +  M+R GI PD FT   ++S+  +     +     C
Sbjct  336   VVSWTAMLVGYGQNGFSEEAVRVFCDMQRNGIEPDDFTLGSVISSCANLASLEEGAQFHC  395

Query  3026  QSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALL  2859
             Q+    + S   V  A      L+++ G  G +E++ +  + M F  + S W AL+
Sbjct  396   QALVSGLISFITVSNA------LITLYGKCGSIEDSNQLFDEMSFRDEVS-WTALV  444



>ref|XP_008358674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Malus domestica]
Length=928

 Score =   476 bits (1226),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 257/719 (36%), Positives = 412/719 (57%), Gaps = 38/719 (5%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             SG+ PNEYS  +++ AC    +   G ++H  MIKLGY   ++  NAL+ +Y+K  SL+ 
Sbjct  247   SGVRPNEYSLSSIINACTGFGDGSRGRKIHGYMIKLGYESDSFSANALVDMYAKVKSLED  306

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
              + +F+ + + DI SWN +I+G V      RA + F  M +   +R +  TLS+ L AC+
Sbjct  307   AVTVFEKIEQPDIVSWNAVIAGCVLHEYHGRALKFFRQM-KGSGIRPNMFTLSSALKACA  365

Query  4064  EC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
                F + G++LH+  +++  ES+  VN  LI  Y +C                      E
Sbjct  366   GLGFKKLGRQLHSFLIKMDTESDSFVNVGLIDMYCKC----------------------E  403

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             M++          A+ LFD +P+K+ + +NAV++G  QNGE ++A++ F  M KE +EF+
Sbjct  404   MMSN---------ARVLFDMMPKKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKEGVEFN  454

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
               TL+++  A   L      +Q+H   +K+G E +  +  +LLD   +CG++EDA +IF 
Sbjct  455   QTTLSTVLKATASLQAIDVCEQVHALSVKTGFESDMYVINSLLDTYGKCGKVEDAARIFK  514

Query  3527  RMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgl  3348
               P+    +VA TSM+  Y+Q  Q E A+ L+ +  LE     D    +++L  C  L  
Sbjct  515   ECPIED--VVAFTSMITAYSQYEQGEEALKLYLQ-MLERENKPDSFVCSSLLNACANLSA  571

Query  3347  lklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAG  3168
              + G+ +H   LK GF+SD   GN++++MYAKCG +++A +AF  +  R + SW++++ G
Sbjct  572   YEQGKQIHVHILKFGFMSDAFAGNSLVNMYAKCGSIEDADRAFAEVPERGIVSWSAMIGG  631

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGV  2988
                H  G EAL+ +++M + G+ P+  T + +L A  H    +V   + +F SM+  +GV
Sbjct  632   LAQHGHGREALNFFTQMLKDGVPPNHITLVSVLCACNHA--GLVTEAKKYFESMRELFGV  689

Query  2987  LPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIK  2808
             +P  +HYAC++ +LG  G + EA E +NTMPF+  +SVW ALL +  +H N  +G+R  +
Sbjct  690   VPRQEHYACMIDLLGRAGKINEAMELVNTMPFQANASVWGALLGAARIHKNVELGERAAE  749

Query  2807  KILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFF  2628
              +L +EP+   T +L +N+Y+++G W     +R  MK+   +K PG SW+  + + H+F 
Sbjct  750   MLLVLEPEKSGTHVLLANIYASAGMWDNVAKMRKLMKDDQVKKEPGMSWIEVKDQVHTFI  809

Query  2627  ARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYG  2448
               D +H +S +IY+ LD L     KAGYVP     LH+VE+ +K+  L +HS KLA+ + 
Sbjct  810   VGDRNHSRSDEIYAKLDELFDLMYKAGYVPMVEMDLHDVEQSEKQRLLRYHSEKLAVAFA  869

Query  2447  LLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             L+ T  G P+RV KN+ +C DCHT  K  S +  REI VRD + FH F +G CSC D W
Sbjct  870   LIATPRGAPIRVKKNLRVCVDCHTALKFISKIVSREIIVRDVNRFHHFRDGSCSCGDYW  928


 Score =   227 bits (579),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 154/536 (29%), Positives = 272/536 (51%), Gaps = 56/536 (10%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G++ NE++F ++L AC  +++L LG QVH + +  G+    +V N L+ +Y+KCG     
Sbjct  147   GVKCNEFTFPSVLKACSITKDLGLGTQVHGVALLTGFESDEFVANTLVVMYAKCGEFGDS  206

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
               LFD +P+R++ SWN + S  V+      A +LF +M  +  +R +  +LS+++NAC+ 
Sbjct  207   RRLFDAIPERNVVSWNALFSCYVQSDFHGEAMDLFQEMVLSG-VRPNEYSLSSIINACTG  265

Query  4061  CF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                  RG+++H + +++GYES+    NAL+  Y +  S++  + +FE++   D  +W   
Sbjct  266   FGDGSRGRKIHGYMIKLGYESDSFSANALVDMYAKVKSLEDAVTVFEKIEQPDIVSW---  322

Query  3884  ITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSD  3705
                                         NAV+AG   +    +A+ FF +M    I  + 
Sbjct  323   ----------------------------NAVIAGCVLHEYHGRALKFFRQMKGSGIRPNM  354

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHR  3525
             FTL+S   AC  L  +K  +Q+H F++K   E +  +   L+DM  +C  M +A  +F  
Sbjct  355   FTLSSALKACAGLGFKKLGRQLHSFLIKMDTESDSFVNVGLIDMYCKCEMMSNARVLFDM  414

Query  3524  MPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgll  3345
             MP     ++A  +++ G++QNG+   A+SLF E   EG V  ++   +TVL    +L  +
Sbjct  415   MP--KKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKEG-VEFNQTTLSTVLKATASLQAI  471

Query  3344  klGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGY  3165
              + E +H L++K GF SD+ V N+++  Y KCG++++A + F+     D+ ++ S++  Y
Sbjct  472   DVCEQVHALSVKTGFESDMYVINSLLDTYGKCGKVEDAARIFKECPIEDVVAFTSMITAY  531

Query  3164  VLHRRGDEALDTWSRMERLGIVPDSFTCLHI------LSAYRHTTKNVVNRCQSFFFSMQ  3003
               + +G+EAL  + +M      PDSF C  +      LSAY    +  V+  +  F    
Sbjct  532   SQYEQGEEALKLYLQMLERENKPDSFVCSSLLNACANLSAYEQGKQIHVHILKFGFM---  588

Query  3002  SAYGVLPASDHYA--CLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMH  2841
                     SD +A   LV++    G +E+A+     +P E     W A++     H
Sbjct  589   --------SDAFAGNSLVNMYAKCGSIEDADRAFAEVP-ERGIVSWSAMIGGLAQH  635


 Score =   169 bits (427),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 139/541 (26%), Positives = 252/541 (47%), Gaps = 51/541 (9%)
 Frame = -3

Query  4484  QKSTVKLKPWSSSMR*DLRGSGIEPN----EYSFVALLTACIRSQNLELGFQVHALMIKL  4317
             Q+  +  KP  +S++       + PN       +  LL+ C  S+++ +G ++HA MI+ 
Sbjct  21    QRLYLPFKPIQTSVQFSTEAKTLNPNFTPTSVLYSKLLSQCTASKSVGVGREIHAHMIRF  80

Query  4316  GYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELF  4137
             G  +   + N L+ LY+KC       +L D  P+ D+ SW+ +ISG  +  +   A   F
Sbjct  81    GCSEDPNLRNHLINLYAKCRFFRHARKLVDESPEPDLVSWSALISGYAQNGLGKEALSAF  140

Query  4136  NDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYTR  3960
              +M  +  ++ +  T  ++L ACS    +  G ++H  AL  G+ES              
Sbjct  141   REMH-SLGVKCNEFTFPSVLKACSITKDLGLGTQVHGVALLTGFES--------------  185

Query  3959  CGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGF  3780
                              D F  N ++  Y + G    ++ LFD +PE+N V +NA+ + +
Sbjct  186   -----------------DEFVANTLVVMYAKCGEFGDSRRLFDAIPERNVVSWNALFSCY  228

Query  3779  CQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPND  3600
              Q+    +AM  F  M+   +  ++++L+SI NAC    +    ++IHG+++K G E + 
Sbjct  229   VQSDFHGEAMDLFQEMVLSGVRPNEYSLSSIINACTGFGDGSRGRKIHGYMIKLGYESDS  288

Query  3599  CIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQ  3420
                 AL+DM  +   +EDA  +F ++      +V+  +++ G   +     A+  F   Q
Sbjct  289   FSANALVDMYAKVKSLEDAVTVFEKIE--QPDIVSWNAVIAGCVLHEYHGRALKFF--RQ  344

Query  3419  LEGLVVVDEVAT-AtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGE  3243
             ++G  +   + T ++ L  C  LG  KLG  LH   +K    SD  V   +I MY KC  
Sbjct  345   MKGSGIRPNMFTLSSALKACAGLGFKKLGRQLHSFLIKMDTESDSFVNVGLIDMYCKCEM  404

Query  3242  LDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
             + NA   F++M  +D+ +WN++++G+  +    EA+  +S M + G+  +  T   +L A
Sbjct  405   MSNARVLFDMMPKKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKEGVEFNQTTLSTVLKA  464

Query  3062  YRHTTKNVVNRC-QSFFFSMQSAYGVLPASDHYA--CLVSVLGYWGLLEEAEETINTMPF  2892
                 +   ++ C Q    S+++ +     SD Y    L+   G  G +E+A       P 
Sbjct  465   T--ASLQAIDVCEQVHALSVKTGF----ESDMYVINSLLDTYGKCGKVEDAARIFKECPI  518

Query  2891  E  2889
             E
Sbjct  519   E  519


 Score =   154 bits (389),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/343 (28%), Positives = 174/343 (51%), Gaps = 35/343 (10%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             ++GSGI PN ++  + L AC      +LG Q+H+ +IK+     ++V   L+ +Y KC  
Sbjct  345   MKGSGIRPNMFTLSSALKACAGLGFKKLGRQLHSFLIKMDTESDSFVNVGLIDMYCKCEM  404

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             +     LFD +PK+D+ +WN +ISG  +      A  LF++M + + +  +  TLST+L 
Sbjct  405   MSNARVLFDMMPKKDMIAWNAVISGHSQNGEDIEAVSLFSEMYK-EGVEFNQTTLSTVLK  463

Query  4073  ACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             A +    +   +++HA +++ G+ES++ V N+L+  Y +CG ++    +F+   + D   
Sbjct  464   ATASLQAIDVCEQVHALSVKTGFESDMYVINSLLDTYGKCGKVEDAARIFKECPIEDVVA  523

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             +  MITAY                                Q  +G +A+  + +M++   
Sbjct  524   FTSMITAY-------------------------------SQYEQGEEALKLYLQMLEREN  552

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             +   F  +S+ NAC  L   +  KQIH  ILK G   +     +L++M  +CG +EDA++
Sbjct  553   KPDSFVCSSLLNACANLSAYEQGKQIHVHILKFGFMSDAFAGNSLVNMYAKCGSIEDADR  612

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
              F  +P     +V+ ++M+ G AQ+G    A++ F +   +G+
Sbjct  613   AFAEVP--ERGIVSWSAMIGGLAQHGHGREALNFFTQMLKDGV  653


 Score = 29.3 bits (64),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 33/65 (51%), Gaps = 6/65 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVEL  4450
             L  E D+  +NAL+  Y K+  ++ A+ VF+ +  P      A+I+G         A++ 
Sbjct  282   LGYESDSFSANALVDMYAKVKSLEDAVTVFEKIEQPDIVSWNAVIAGCVLHEYHGRALKF  341

Query  4449  FYEMR  4435
             F +M+
Sbjct  342   FRQMK  346


 Score =   101 bits (251),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 94/352 (27%), Positives = 163/352 (46%), Gaps = 29/352 (8%)
 Frame = -3

Query  3740  YRMIKESIEFS--------DFTLTSIA-----NACGLLMERKSSKQIHGFILKSGCEPND  3600
             ++ I+ S++FS        +FT TS+      + C         ++IH  +++ GC  + 
Sbjct  27    FKPIQTSVQFSTEAKTLNPNFTPTSVLYSKLLSQCTASKSVGVGREIHAHMIRFGCSEDP  86

Query  3599  CIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQ  3420
              +   L+++  +C     A K+    P     LV+ ++++ GYAQNG  + A+S F E  
Sbjct  87    NLRNHLINLYAKCRFFRHARKLVDESP--EPDLVSWSALISGYAQNGLGKEALSAFREMH  144

Query  3419  LEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGEL  3240
               G V  +E    +VL  C     L LG  +H +AL  GF SD  V N ++ MYAKCGE 
Sbjct  145   SLG-VKCNEFTFPSVLKACSITKDLGLGTQVHGVALLTGFESDEFVANTLVVMYAKCGEF  203

Query  3239  DNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAY  3060
              ++ + F+ +  R++ SWN+L + YV      EA+D +  M   G+ P+ ++   I++A 
Sbjct  204   GDSRRLFDAIPERNVVSWNALFSCYVQSDFHGEAMDLFQEMVLSGVRPNEYSLSSIINAC  263

Query  3059  RHTTKNVVNRCQSFFFSMQSAYGVLPASDHYA--CLVSVLGYWGLLEEAEETINTMPFEP  2886
                      R +   + ++  Y     SD ++   LV +      LE+A      +  +P
Sbjct  264   TGFGDGSRGR-KIHGYMIKLGY----ESDSFSANALVDMYAKVKSLEDAVTVFEKIE-QP  317

Query  2885  KSSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQD--PSTFILKSNLYSASG  2736
                 W A++  C++H       R +K    M+     P+ F L S L + +G
Sbjct  318   DIVSWNAVIAGCVLH---EYHGRALKFFRQMKGSGIRPNMFTLSSALKACAG  366



>emb|CAN74095.1| hypothetical protein VITISV_023708 [Vitis vinifera]
Length=906

 Score =   475 bits (1223),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 257/761 (34%), Positives = 429/761 (56%), Gaps = 50/761 (7%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G++ NE++F ++L AC   ++L +G QVH +++  G+    +V N L+ +Y+KC      
Sbjct  152   GVKCNEFTFSSVLKACSIVKDLRIGKQVHGVVVVSGFEGDVFVANTLVVMYAKCDEFLDS  211

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
               LFD +P+R++ SWN + S  V+      A  LF +M  +  ++ +  +LS+++NAC+ 
Sbjct  212   KRLFDEIPERNVVSWNALFSCYVQXDFCGEAVGLFYEMVLSG-IKPNEFSLSSMVNACTG  270

Query  4061  CF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                  RG+ +H + +++GY+ +    NAL+  Y + G +   +++FE++   D  +WN +
Sbjct  271   LRDSSRGKIIHGYLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQPDIVSWNAV  330

Query  3884  ITA----------------------------------YMESGLVDL---------AKELF  3834
             I                                    ++  GLVD+         A+  F
Sbjct  331   IAGCVLHEHHEQALELLGQMKRQLHSSLMKMDMESDLFVSVGLVDMYSKCDLLEDARMAF  390

Query  3833  DHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERK  3654
             + LPEK+ + +NA+++G+ Q  E ++A++ F  M KE I F+  TL++I  +   L    
Sbjct  391   NLLPEKDLIAWNAIISGYSQYWEDMEALSLFVEMHKEGIGFNQTTLSTILKSTAGLQVVH  450

Query  3653  SSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRG  3474
               +Q+HG  +KSG   +  +  +L+D   +C  +EDAE+IF    +G   LV+ TSM+  
Sbjct  451   VCRQVHGLSVKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIG--DLVSFTSMITA  508

Query  3473  YAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLS  3294
             YAQ GQ E A+ LF E Q +  +  D    +++L  C  L   + G+ LH   LK+GF+ 
Sbjct  509   YAQYGQGEEALKLFLEMQ-DMELKPDRFVCSSLLNACANLSAFEQGKQLHVHILKYGFVL  567

Query  3293  DVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRME  3114
             D+  GN++++MYAKCG +D+A +AF  ++ R + SW++++ G   H  G +AL  +++M 
Sbjct  568   DIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIGGLAQHGHGRQALQLFNQML  627

Query  3113  RLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWG  2934
             + G+ P+  T + +L A  H    +V   + +F SM+  +G  P  +HYAC++ +LG  G
Sbjct  628   KEGVSPNHITLVSVLGACNHA--GLVTEAKLYFESMEELFGFKPMQEHYACMIDLLGRAG  685

Query  2933  LLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQDPSTFILKSN  2754
              + EA E +N MPFE  +SVW ALL +  +H +  +G+R  + +  +EP+   T +L +N
Sbjct  686   KINEAVELVNKMPFEANASVWGALLGAARIHKDVELGRRAAEMLFILEPEKSGTHVLLAN  745

Query  2753  LYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFFARDTSHLQSKDIYSALDI  2574
             +Y+++G+W+    VR  M++   +K PG SW+  + K ++F   D SH +S++IY+ LD 
Sbjct  746   IYASAGKWENVAEVRRLMRDSKVKKEPGMSWIEVKDKVYTFLVGDRSHYRSQEIYAKLDE  805

Query  2573  LILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYGLLMTKHGKPVRVMKNILL  2394
             L     KAGYVP     LH+VE+ +K+  L+HHS KLA+ +GL+ T  G P+RV KN+ +
Sbjct  806   LSDLMDKAGYVPMVEIDLHDVEQSEKELLLYHHSEKLAVAFGLIATPQGAPIRVKKNLRV  865

Query  2393  CGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             C DCHT FK    +  REI VRD + FH F +G CSC D W
Sbjct  866   CVDCHTAFKYICKIVSREIIVRDINRFHHFKDGSCSCGDYW  906


 Score =   173 bits (438),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 122/486 (25%), Positives = 222/486 (46%), Gaps = 64/486 (13%)
 Frame = -3

Query  4514  FPPRPSYRVLQK-STVKLKPWSSSMR*DLRGSGIEPNEYSFVALLTACIRSQNLELGFQV  4338
              P +P+ +++Q        P ++++   +      P   S+  LL+ C  +++L  G Q+
Sbjct  19    LPFKPAPKLIQTVPQFSEDPQTTAILNLIDKGNFTPTSVSYSKLLSQCCTTKSLRPGLQI  78

Query  4337  HALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMF  4158
             HA + K G  D   + N L+ LYSKC    +  +L D   + D+ SW+ +ISG  +  + 
Sbjct  79    HAHITKSGLSDDPSIRNHLINLYSKCRXFGYARKLVDESSEPDLVSWSALISGYAQNGLG  138

Query  4157  TRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNA  3981
               A   F++M     ++ +  T S++L ACS    +R G+++H   +  G+E ++ V N 
Sbjct  139   GGALMAFHEMHLLG-VKCNEFTFSSVLKACSIVKDLRIGKQVHGVVVVSGFEGDVFVANT  197

Query  3980  LIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLY  3801
             L+  Y +C        LF+ +  R+  +WN + + Y++                      
Sbjct  198   LVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQ----------------------  235

Query  3800  NAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILK  3621
                   FC  GE   A+  FY M+   I+ ++F+L+S+ NAC  L +    K IHG+++K
Sbjct  236   ----XDFC--GE---AVGLFYEMVLSGIKPNEFSLSSMVNACTGLRDSSRGKIIHGYLIK  286

Query  3620  SGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAI  3441
              G + +     AL+DM  + G + DA  +F ++      +V+  +++ G   +   E A+
Sbjct  287   LGYDWDPFSANALVDMYAKVGDLADAISVFEKIK--QPDIVSWNAVIAGCVLHEHHEQAL  344

Query  3440  SLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISM  3261
              L  + +                              LH   +K    SD+ V   ++ M
Sbjct  345   ELLGQMK----------------------------RQLHSSLMKMDMESDLFVSVGLVDM  376

Query  3260  YAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTC  3081
             Y+KC  L++A  AF L+  +DL +WN++++GY  +    EAL  +  M + GI  +  T 
Sbjct  377   YSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEALSLFVEMHKEGIGFNQTTL  436

Query  3080  LHILSA  3063
               IL +
Sbjct  437   STILKS  442


 Score =   139 bits (349),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 102/403 (25%), Positives = 191/403 (47%), Gaps = 52/403 (13%)
 Frame = -3

Query  4097  ITLSTLLNAC-SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFER  3921
             ++ S LL+ C +   +R G ++HAH  + G   + S+ N LI  Y++C            
Sbjct  57    VSYSKLLSQCCTTKSLRPGLQIHAHITKSGLSDDPSIRNHLINLYSKCRXF---------  107

Query  3920  MLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFF  3741
                                     A++L D   E + V ++A+++G+ QNG G  A+  F
Sbjct  108   ----------------------GYARKLVDESSEPDLVSWSALISGYAQNGLGGGALMAF  145

Query  3740  YRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
             + M    ++ ++FT +S+  AC ++ + +  KQ+HG ++ SG E +  +   L+ M  +C
Sbjct  146   HEMHLLGVKCNEFTFSSVLKACSIVKDLRIGKQVHGVVVVSGFEGDVFVANTLVVMYAKC  205

Query  3560  GRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATA  3381
                 D++++F  +P     +V+  ++   Y Q      A+ LF+E  L G +  +E + +
Sbjct  206   DEFLDSKRLFDEIP--ERNVVSWNALFSCYVQXDFCGEAVGLFYEMVLSG-IKPNEFSLS  262

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
             +++  C  L     G+ +H   +K G+  D    NA++ MYAK G+L +A+  FE +   
Sbjct  263   SMVNACTGLRDSSRGKIIHGYLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQP  322

Query  3200  DLCSWNSLLAGYVLHRRGDEALDTWSRMER--------LGIVPDSFTCLHILSAYRHTTK  3045
             D+ SWN+++AG VLH   ++AL+   +M+R        + +  D F  + ++  Y     
Sbjct  323   DIVSWNAVIAGCVLHEHHEQALELLGQMKRQLHSSLMKMDMESDLFVSVGLVDMY-----  377

Query  3044  NVVNRCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAE  2916
                ++C       + A+ +LP  D  A    + GY    E+ E
Sbjct  378   ---SKC-DLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDME  416


 Score =   125 bits (315),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/315 (27%), Positives = 147/315 (47%), Gaps = 46/315 (15%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++   GI  N+ +   +L +    Q + +  QVH L +K G+    YVVN+L+  Y KC 
Sbjct  423   EMHKEGIGFNQTTLSTILKSTAGLQVVHVCRQVHGLSVKSGFHSDIYVVNSLIDSYGKCS  482

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              ++    +F+     D+ S+ +MI+   +      A +LF +MQ  + L+ D    S+LL
Sbjct  483   HVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLEMQDME-LKPDRFVCSSLL  541

Query  4076  NACSE-CFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
             NAC+      +G++LH H L+ G+  ++   N+L+  Y +CGSI      F  +  R   
Sbjct  542   NACANLSAFEQGKQLHVHILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIV  601

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             +W+ MI                                G  Q+G G +A+  F +M+KE 
Sbjct  602   SWSAMI-------------------------------GGLAQHGHGRQALQLFNQMLKEG  630

Query  3719  IEFSDFTLTSIANAC---GLLMERK----SSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
             +  +  TL S+  AC   GL+ E K    S +++ GF      +P     A ++D+  R 
Sbjct  631   VSPNHITLVSVLGACNHAGLVTEAKLYFESMEELFGF------KPMQEHYACMIDLLGRA  684

Query  3560  GRMEDAEKIFHRMPL  3516
             G++ +A ++ ++MP 
Sbjct  685   GKINEAVELVNKMPF  699


 Score = 34.7 bits (78),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 36/67 (54%), Gaps = 6/67 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVEL  4450
             + +E D  +S  L+  Y K  L++ A   F      D ++  AIISG+++   ++EA+ L
Sbjct  361   MDMESDLFVSVGLVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEALSL  420

Query  4449  FYEMRLE  4429
             F EM  E
Sbjct  421   FVEMHKE  427



>ref|XP_008243776.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Prunus mume]
Length=743

 Score =   470 bits (1210),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 250/674 (37%), Positives = 394/674 (58%), Gaps = 6/674 (1%)
 Frame = -3

Query  4289  NALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCL  4110
             NA++ +YSK G L  + E+FD +P+RD  SWN+ ISG     +   A + ++ M  +  +
Sbjct  75    NAILSVYSKSGYLSDMQEIFDRMPRRDGVSWNSFISGHASCGLLAEAGKFYSLMLTDGAV  134

Query  4109  RIDYITLSTLLNACS-ECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMA  3933
              ++ IT ST+L  CS +  +  G++LH H ++ G+ES + V + L+  Y++ G I     
Sbjct  135   NLNRITFSTMLVLCSSQRCVNLGRQLHGHIVKFGFESYVFVGSPLVDMYSKAGLILDAKR  194

Query  3932  LFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKA  3753
             +F  M  R+   +N +IT  +  GL++ ++ LF  +PEK+++ +  ++ G  QNG G KA
Sbjct  195   VFNSMPERNVVMYNTLITGLLRCGLIEDSECLFSKMPEKDSISWTTMITGLTQNGSGSKA  254

Query  3752  MAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDM  3573
             +  F  MI E +    +T  S+  ACG L   +  KQ+H +I+++    N  + +AL+DM
Sbjct  255   LDKFREMILEGLSMDQYTFGSVLTACGGLFALEEGKQVHAYIIRTELIDNIFVGSALVDM  314

Query  3572  CTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDE  3393
               +C  ++ AE +F RM   +  +V+ T+ML GY QNG  E A+ +F + Q +G V  D+
Sbjct  315   YCKCRSIKAAEGVFKRMSCKN--VVSWTAMLVGYGQNGYSEEAVRVFCDMQRKG-VEPDD  371

Query  3392  VATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFEL  3213
                 +V+  C  L  L+ G   H  AL  G +S + V NA++++Y KCG ++++ + F  
Sbjct  372   FTLGSVISSCANLASLEEGAQFHGQALASGLISFITVSNALVTLYGKCGSIEDSHRLFNE  431

Query  3212  MSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVN  3033
             M+ RD  SW +L++GY    +  E +D + RM    + PD  T + +LSA   +   +V+
Sbjct  432   MNIRDEVSWTALVSGYAQFGKAYETIDLFERMLAHSLKPDGVTFIGVLSAC--SRAGLVD  489

Query  3032  RCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDS  2853
             +   +F SM   +G+ P  DHY C++ +L   G LEEA+  IN MPF P +  W  LL S
Sbjct  490   KGHQYFESMVKEHGITPIMDHYTCIIDLLSRAGRLEEAKRFINEMPFHPDAIGWATLLSS  549

Query  2852  CIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIP  2673
             C +H N  IGK   + +L +EPQ+P+++IL S++Y+A G+W     +R  M++KG +K P
Sbjct  550   CRLHRNIEIGKWAAESLLELEPQNPASYILLSSIYAAKGKWNEVANLRRGMRDKGVRKEP  609

Query  2672  GQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKK  2493
             G SW+  + + H F A D S   S  IY+ L+ L  + ++ GY PD S VLH+VEE +KK
Sbjct  610   GCSWIKYKSRVHIFSADDQSSPFSDKIYAKLEKLNCKMIEEGYEPDMSSVLHDVEESEKK  669

Query  2492  DFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGF  2313
               L +HS KLA+ +GL+    G P+RV+KN+ +CGDCH   K  S +TKREI VRD   +
Sbjct  670   KMLNYHSEKLAIAFGLIFLPAGIPIRVVKNLRVCGDCHNATKYISKITKREILVRDAVRY  729

Query  2312  HCFLNGKCSCNDRW  2271
             H F +G CSC D W
Sbjct  730   HLFKDGTCSCGDFW  743


 Score =   147 bits (372),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 117/490 (24%), Positives = 214/490 (44%), Gaps = 69/490 (14%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             L    +  N  +F  +L  C   + + LG Q+H  ++K G+    +V + L+ +YSK G 
Sbjct  129   LTDGAVNLNRITFSTMLVLCSSQRCVNLGRQLHGHIVKFGFESYVFVGSPLVDMYSKAGL  188

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDC-------------  4113
             +     +F+++P+R++  +NT+I+G+++  +   +  LF+ M   D              
Sbjct  189   ILDAKRVFNSMPERNVVMYNTLITGLLRCGLIEDSECLFSKMPEKDSISWTTMITGLTQN  248

Query  4112  -----------------LRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVN  3987
                              L +D  T  ++L AC   F +  G+++HA+ +R     N+ V 
Sbjct  249   GSGSKALDKFREMILEGLSMDQYTFGSVLTACGGLFALEEGKQVHAYIIRTELIDNIFVG  308

Query  3986  NALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAV  3807
             +AL+  Y +C SIK+   +F+RM  ++  +W  M                          
Sbjct  309   SALVDMYCKCRSIKAAEGVFKRMSCKNVVSWTAM--------------------------  342

Query  3806  LYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFI  3627
                  L G+ QNG   +A+  F  M ++ +E  DFTL S+ ++C  L   +   Q HG  
Sbjct  343   -----LVGYGQNGYSEEAVRVFCDMQRKGVEPDDFTLGSVISSCANLASLEEGAQFHGQA  397

Query  3626  LKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPEN  3447
             L SG      +  AL+ +  +CG +ED+ ++F+ M +     V+ T+++ GYAQ G+   
Sbjct  398   LASGLISFITVSNALVTLYGKCGSIEDSHRLFNEMNIRDE--VSWTALVSGYAQFGKAYE  455

Query  3446  AISLFFETQLEGLVVVDEVA-TAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAV  3270
              I L FE  L   +  D V     +        + K  +    +  +HG    +     +
Sbjct  456   TIDL-FERMLAHSLKPDGVTFIGVLSACSRAGLVDKGHQYFESMVKEHGITPIMDHYTCI  514

Query  3269  ISMYAKCGELDNAVKAF-ELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPD  3093
             I + ++ G L+ A +   E+    D   W +LL+   LHR  +  +  W+    L + P 
Sbjct  515   IDLLSRAGRLEEAKRFINEMPFHPDAIGWATLLSSCRLHR--NIEIGKWAAESLLELEPQ  572

Query  3092  SFTCLHILSA  3063
             +     +LS+
Sbjct  573   NPASYILLSS  582


 Score =   147 bits (371),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 112/430 (26%), Positives = 209/430 (49%), Gaps = 41/430 (10%)
 Frame = -3

Query  4049  RGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYM  3870
             + ++LH H ++        + N +I  Y R G+++    +F++M     F+WN +++ Y 
Sbjct  23    QAKKLHCHIIKTLTSPETFLLNNIITTYGRLGNLRYARHVFDQMPHPTLFSWNAILSVYS  82

Query  3869  ESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE-SIEFSDFTLT  3693
             +SG +   +E+FD +P ++ V +N+ ++G    G   +A  F+  M+ + ++  +  T +
Sbjct  83    KSGYLSDMQEIFDRMPRRDGVSWNSFISGHASCGLLAEAGKFYSLMLTDGAVNLNRITFS  142

Query  3692  SIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCT------------------  3567
             ++   C         +Q+HG I+K G E    + + L+DM +                  
Sbjct  143   TMLVLCSSQRCVNLGRQLHGHIVKFGFESYVFVGSPLVDMYSKAGLILDAKRVFNSMPER  202

Query  3566  -------------RCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFE  3426
                          RCG +ED+E +F +MP      ++ T+M+ G  QNG    A+  F E
Sbjct  203   NVVMYNTLITGLLRCGLIEDSECLFSKMP--EKDSISWTTMITGLTQNGSGSKALDKFRE  260

Query  3425  TQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCG  3246
               LEGL  +D+    +VL  CG L  L+ G+ +H   ++   + ++ VG+A++ MY KC 
Sbjct  261   MILEGL-SMDQYTFGSVLTACGGLFALEEGKQVHAYIIRTELIDNIFVGSALVDMYCKCR  319

Query  3245  ELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILS  3066
              +  A   F+ MS +++ SW ++L GY  +   +EA+  +  M+R G+ PD FT   ++S
Sbjct  320   SIKAAEGVFKRMSCKNVVSWTAMLVGYGQNGYSEEAVRVFCDMQRKGVEPDDFTLGSVIS  379

Query  3065  AYRHTTKNVVNRCQSFFFSMQS-AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFE  2889
                 +  N+ +  +   F  Q+ A G++        LV++ G  G +E++    N M   
Sbjct  380   ----SCANLASLEEGAQFHGQALASGLISFITVSNALVTLYGKCGSIEDSHRLFNEMNIR  435

Query  2888  PKSSVWRALL  2859
              + S W AL+
Sbjct  436   DEVS-WTALV  444


 Score = 77.4 bits (189),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 93/192 (48%), Gaps = 8/192 (4%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             D++  G+EP++++  +++++C    +LE G Q H   +  G +    V NAL+ LY KCG
Sbjct  361   DMQRKGVEPDDFTLGSVISSCANLASLEEGAQFHGQALASGLISFITVSNALVTLYGKCG  420

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQR--NDCLRIDYITLST  4083
             S++    LF+ +  RD  SW  ++SG  +   F +A+E  +  +R     L+ D +T   
Sbjct  421   SIEDSHRLFNEMNIRDEVSWTALVSGYAQ---FGKAYETIDLFERMLAHSLKPDGVTFIG  477

Query  4082  LLNACSEC-FMRRG-QELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVR  3909
             +L+ACS    + +G Q   +     G    +     +I   +R G ++        M   
Sbjct  478   VLSACSRAGLVDKGHQYFESMVKEHGITPIMDHYTCIIDLLSRAGRLEEAKRFINEMPFH  537

Query  3908  -DAFTWNEMITA  3876
              DA  W  ++++
Sbjct  538   PDAIGWATLLSS  549



>ref|XP_008447673.1| PREDICTED: beta-galactosidase 15-like [Cucumis melo]
Length=826

 Score =   473 bits (1216),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 250/578 (43%), Positives = 347/578 (60%), Gaps = 57/578 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDY+APLDEYGN+NQPKWGHLK+LH  +   E +L     +
Sbjct  293   YHGGTNFGRTSGGPFITTSYDYDAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNSTRS  352

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISI-TFEGKNYTTPAWSVTILPDCKTE  352
             N ++   ++ T +     G+  CFL+N ++ +D  I     + Y  PAWSV+IL  C  E
Sbjct  353   NQNFSSSITLTKFSNLETGEMFCFLSNVDENNDAIIDLLADRKYFLPAWSVSILDGCNKE  412

Query  353   VYNTARVNAQTTVMVKKLSE---GALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             V+NTA+V +QT++  K+ +E     L W++  E +     G+          + A  L +
Sbjct  413   VFNTAKVTSQTSIFFKEQNEKENAKLSWTWASEPMRDTLQGY--------GTIKANLLLE  464

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK  T D++DYLWYMT+   N ++ +  Q +TL+VNTK HVLHAF N ++IGS+W  +  
Sbjct  465   QKGTTIDSSDYLWYMTNVNTNATSSL--QNVTLQVNTKGHVLHAFINRRYIGSQWGSNGQ  522

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
                F+F++ ++L+   NTI+LLS TVGL NY  +++ V  G+  GP+ L+       DLS
Sbjct  523   --SFVFEKPIQLKLGNNTITLLSATVGLKNYDAFYDTVPTGIDGGPIYLIGDGNVTTDLS  580

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  K L+     N+  W++ N ++  R   W+K T              
Sbjct  581   SNLWSYKVGLNGERKQLYNPMFSNRTKWNQLNKKSIGRRMTWFKAT--------------  626

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                                 FKTP+G D VVLD+ GMGKG AWVNG +IGR+WPSF+A +
Sbjct  627   --------------------FKTPSGTDPVVLDMQGMGKGQAWVNGRSIGRFWPSFIASN  666

Query  1238  DGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C   CDY+G Y  SKCV  CG  SQRWYH+PRSF+    N  L+LFEE+GG PQ V V
Sbjct  667   DSCSATCDYKGAYDPSKCVENCGNSSQRWYHIPRSFMSDDMNT-LILFEEIGGNPQRVSV  725

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT-DIIPV  1591
             QT+T+GTIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF+    D T +   +
Sbjct  726   QTITIGTICGNADEGSTLELSCQGGHIISQIQFASYGHPEGKCGSFQPGLWDVTKNTTIM  785

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++ AC+G E C++ VS  LF  +       +L V+A C
Sbjct  786   VEKACIGMENCSIDVSPNLFEMSNVAGPSAKLTVQALC  823



>ref|XP_007214178.1| hypothetical protein PRUPE_ppa019185mg [Prunus persica]
 gb|EMJ15377.1| hypothetical protein PRUPE_ppa019185mg [Prunus persica]
Length=858

 Score =   473 bits (1216),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 260/719 (36%), Positives = 409/719 (57%), Gaps = 38/719 (5%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             SG+ PNEYS  +++ AC    +   G ++H  M+KLGY   ++  NAL+ +Y+K   L+ 
Sbjct  177   SGVRPNEYSLSSIINACTGLGDGSRGRKIHGYMVKLGYESDSFSANALVDMYAKVKGLED  236

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACS  4065
              I +F+ + +RDI SWN +I+G V       A + F  M  +  +  +  TLS+ L AC+
Sbjct  237   AISVFEKIAQRDIVSWNAVIAGCVLHEYHDWALQFFGQMNGSG-ICPNMFTLSSALKACA  295

Query  4064  EC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNE  3888
                F + G++LH+  +++  ES+  VN  LI  Y +C                      E
Sbjct  296   GLGFEKLGRQLHSFLIKMDTESDSFVNVGLIDMYCKC----------------------E  333

Query  3887  MITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFS  3708
             MI         D A+ LF+ +P+K  + +NAV++G  QNGE ++A++ F  M KE IEF+
Sbjct  334   MI---------DHARVLFNMMPKKEMIAWNAVISGHSQNGEDIEAVSQFSEMYKEGIEFN  384

Query  3707  DFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFH  3528
               TL+++  +   +   K  +QIH   +KSG + +  +  +LLD   +CG++EDA KIF 
Sbjct  385   QTTLSTVLKSTASVQAIKFCEQIHALSVKSGFQCDMYVINSLLDAYGKCGKVEDAAKIFE  444

Query  3527  RMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgl  3348
               P     +VA TSM+  Y+Q  Q E A+ L+ + Q  G    D    +++L  C  L  
Sbjct  445   GCPTED--VVAFTSMITAYSQYEQGEEALKLYLQMQQRG-NKPDSFVCSSLLNACANLSA  501

Query  3347  lklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAG  3168
              + G+ +H   LK GF+SD   GN++++MYAKCG +D+A +AF  +  R L SW++++ G
Sbjct  502   YEQGKQIHVHILKFGFMSDAFAGNSLVNMYAKCGSIDDADRAFSEVPQRGLVSWSAMIGG  561

Query  3167  YVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYGV  2988
                H  G  AL+ +++M + G+ P+  T + +L A  H    +V   + +F SM+  +GV
Sbjct  562   LAQHGHGKRALNLFNQMLKDGVSPNHITLVSVLCACNHA--GLVTEARKYFESMKELFGV  619

Query  2987  LPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIK  2808
             +P  +HYAC++ +LG  G + EA E +NTMPF+  +SVW ALL +  +H N  +G+R  +
Sbjct  620   VPRQEHYACMIDLLGRAGKINEAMELVNTMPFQANASVWGALLGAARIHKNVELGQRAAE  679

Query  2807  KILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSFF  2628
              +L++EP+   T +L +N+Y+++G W     +R  M++   +K PG SW+  + K H+F 
Sbjct  680   MLLALEPEKSGTHVLLANIYASAGMWDNVAKMRRLMRDGQVKKEPGMSWIEVKDKVHTFI  739

Query  2627  ARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTYG  2448
               D SH +S++IY+ LD L     KAGY P     LH+VE  +K+  L +HS KLA+ +G
Sbjct  740   VGDRSHSRSREIYAELDELFDLMYKAGYAPMVEIDLHDVEHSEKQRLLRYHSEKLAVAFG  799

Query  2447  LLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             L+ T  G P+RV KN+ +C DCHT FK    +  REI VRD + FH F +G CSC D W
Sbjct  800   LIATPPGAPIRVKKNLRVCVDCHTAFKFICKIVSREIIVRDINRFHHFKDGSCSCGDYW  858


 Score =   228 bits (581),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 154/546 (28%), Positives = 281/546 (51%), Gaps = 59/546 (11%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G++ NE++F ++L AC  +++L +G QVH + +  G+    +V N L+ +Y+KCG     
Sbjct  77    GVKCNEFTFPSVLKACSITRDLVVGKQVHGIALLTGFESDEFVANTLVVMYAKCGEFGDS  136

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
               LFD +P+R++ SWN + S  V+   +  A +LF +M  +  +R +  +LS+++NAC+ 
Sbjct  137   RRLFDAIPERNVVSWNALFSCYVQSDSYGEAMDLFQEMILSG-VRPNEYSLSSIINACTG  195

Query  4061  CF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                  RG+++H + +++GYES+    NAL+  Y +   ++  +++FE++  RD  +W   
Sbjct  196   LGDGSRGRKIHGYMVKLGYESDSFSANALVDMYAKVKGLEDAISVFEKIAQRDIVSW---  252

Query  3884  ITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSD  3705
                                         NAV+AG   +     A+ FF +M    I  + 
Sbjct  253   ----------------------------NAVIAGCVLHEYHDWALQFFGQMNGSGICPNM  284

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHR  3525
             FTL+S   AC  L   K  +Q+H F++K   E +  +   L+DM  +C  ++ A  +F+ 
Sbjct  285   FTLSSALKACAGLGFEKLGRQLHSFLIKMDTESDSFVNVGLIDMYCKCEMIDHARVLFNM  344

Query  3524  MPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgll  3345
             MP     ++A  +++ G++QNG+   A+S F E   EG +  ++   +TVL    ++  +
Sbjct  345   MP--KKEMIAWNAVISGHSQNGEDIEAVSQFSEMYKEG-IEFNQTTLSTVLKSTASVQAI  401

Query  3344  klGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGY  3165
             K  E +H L++K GF  D+ V N+++  Y KCG++++A K FE   + D+ ++ S++  Y
Sbjct  402   KFCEQIHALSVKSGFQCDMYVINSLLDAYGKCGKVEDAAKIFEGCPTEDVVAFTSMITAY  461

Query  3164  VLHRRGDEALDTWSRMERLGIVPDSFTCLHI------LSAYRHTTKNVVNRCQSFFFSMQ  3003
               + +G+EAL  + +M++ G  PDSF C  +      LSAY    +  V+  +  F    
Sbjct  462   SQYEQGEEALKLYLQMQQRGNKPDSFVCSSLLNACANLSAYEQGKQIHVHILKFGFM---  518

Query  3002  SAYGVLPASDHYA--CLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSS  2829
                     SD +A   LV++    G +++A+   + +P     S W A++     H +  
Sbjct  519   --------SDAFAGNSLVNMYAKCGSIDDADRAFSEVPQRGLVS-WSAMIGGLAQHGH--  567

Query  2828  IGKRVI  2811
              GKR +
Sbjct  568   -GKRAL  572


 Score =   145 bits (367),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 175/351 (50%), Gaps = 35/351 (10%)
 Frame = -3

Query  4457  WSSSMR*DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALM  4278
             W+      + GSGI PN ++  + L AC      +LG Q+H+ +IK+     ++V   L+
Sbjct  267   WALQFFGQMNGSGICPNMFTLSSALKACAGLGFEKLGRQLHSFLIKMDTESDSFVNVGLI  326

Query  4277  GLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDY  4098
              +Y KC  +D    LF+ +PK+++ +WN +ISG  +      A   F++M + + +  + 
Sbjct  327   DMYCKCEMIDHARVLFNMMPKKEMIAWNAVISGHSQNGEDIEAVSQFSEMYK-EGIEFNQ  385

Query  4097  ITLSTLLNACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFER  3921
              TLST+L + +    ++  +++HA +++ G++ ++ V N+L+  Y +CG ++    +FE 
Sbjct  386   TTLSTVLKSTASVQAIKFCEQIHALSVKSGFQCDMYVINSLLDAYGKCGKVEDAAKIFEG  445

Query  3920  MLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFF  3741
                 D   +  MITAY                                Q  +G +A+  +
Sbjct  446   CPTEDVVAFTSMITAY-------------------------------SQYEQGEEALKLY  474

Query  3740  YRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
              +M +   +   F  +S+ NAC  L   +  KQIH  ILK G   +     +L++M  +C
Sbjct  475   LQMQQRGNKPDSFVCSSLLNACANLSAYEQGKQIHVHILKFGFMSDAFAGNSLVNMYAKC  534

Query  3560  GRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
             G ++DA++ F  +P     LV+ ++M+ G AQ+G  + A++LF +   +G+
Sbjct  535   GSIDDADRAFSEVP--QRGLVSWSAMIGGLAQHGHGKRALNLFNQMLKDGV  583


 Score = 26.6 bits (57),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSPAIIS  4492
             L  E D+  +NAL+  Y K+  ++ A++VF+ ++   I+S
Sbjct  212   LGYESDSFSANALVDMYAKVKGLEDAISVFEKIAQRDIVS  251


 Score =   145 bits (367),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 137/538 (25%), Positives = 241/538 (45%), Gaps = 53/538 (10%)
 Frame = -3

Query  4343  QVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKES  4164
             +VHA +I+ G      + N L+ LYSKC       +L D   + D+ SW+ +ISG  +  
Sbjct  2     EVHAHIIRCGCSGDQSIRNHLINLYSKCRFFRHARKLVDESTEPDLVSWSALISGYAQNG  61

Query  4163  MFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVN  3987
             +   A   F +M     ++ +  T  ++L ACS    +  G+++H  AL  G+ES+  V 
Sbjct  62    LGKEALSAFREMHSLG-VKCNEFTFPSVLKACSITRDLVVGKQVHGIALLTGFESDEFVA  120

Query  3986  NALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAV  3807
             N L+  Y +CG       LF+ +  R+  +WN + + Y++S          D   E    
Sbjct  121   NTLVVMYAKCGEFGDSRRLFDAIPERNVVSWNALFSCYVQS----------DSYGE----  166

Query  3806  LYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFI  3627
                              AM  F  MI   +  ++++L+SI NAC  L +    ++IHG++
Sbjct  167   -----------------AMDLFQEMILSGVRPNEYSLSSIINACTGLGDGSRGRKIHGYM  209

Query  3626  LKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPEN  3447
             +K G E +     AL+DM  +   +EDA  +F +  +    +V+  +++ G   +   + 
Sbjct  210   VKLGYESDSFSANALVDMYAKVKGLEDAISVFEK--IAQRDIVSWNAVIAGCVLHEYHDW  267

Query  3446  AISLFFETQLEGLVVVDEVAT-AtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAV  3270
             A+  F   Q+ G  +   + T ++ L  C  LG  KLG  LH   +K    SD  V   +
Sbjct  268   ALQFF--GQMNGSGICPNMFTLSSALKACAGLGFEKLGRQLHSFLIKMDTESDSFVNVGL  325

Query  3269  ISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDS  3090
             I MY KC  +D+A   F +M  +++ +WN++++G+  +    EA+  +S M + GI  + 
Sbjct  326   IDMYCKCEMIDHARVLFNMMPKKEMIAWNAVISGHSQNGEDIEAVSQFSEMYKEGIEFNQ  385

Query  3089  FTCLHILSAYRHTTKNVVNRCQSFF-FSMQSAYGVLPASDHYA--CLVSVLGYWGLLEEA  2919
              T   +L +    +   +  C+     S++S +      D Y    L+   G  G +E+A
Sbjct  386   TTLSTVLKST--ASVQAIKFCEQIHALSVKSGF----QCDMYVINSLLDAYGKCGKVEDA  439

Query  2918  EETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILSMEPQ--DPSTFILKSNL  2751
              +     P E       A       +     G+  +K  L M+ +   P +F+  S L
Sbjct  440   AKIFEGCPTEDVV----AFTSMITAYSQYEQGEEALKLYLQMQQRGNKPDSFVCSSLL  493



>ref|XP_004135782.1| PREDICTED: beta-galactosidase 7-like [Cucumis sativus]
Length=838

 Score =   472 bits (1214),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 257/583 (44%), Positives = 350/583 (60%), Gaps = 66/583 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH  +   E +L   N+T
Sbjct  304   YHGGTNFGRTAGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHASIKMGEKILT--NST  361

Query  182   NTDYGRMMSSTVYEYK------GKKVCFLANANDKDDISITFE--GKNYT-TPAWSVTIL  334
              +D  + +SS V   K      G++ CFL+N ++K+D +I  +  GK +   PAWSV+IL
Sbjct  362   RSD--QKISSFVTLTKFSNPTSGERFCFLSNTDNKNDATIDLQADGKYFVPVPAWSVSIL  419

Query  335   PDCKTEVYNTARVNAQTTVMVK---KLSEGALKWSYRPETIMHLKYGHKNQSSVLIDALD  505
               C  EV+NTA++N+QT++ VK   K       W + PE +     G             
Sbjct  420   DGCNKEVFNTAKINSQTSMFVKVQNKKENAQFSWVWAPEPMRDTLQGK--------GTFK  471

Query  506   AKQLFDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSE  685
             A  L +QK  T D +DYLWYMT+   N ++ +  Q +TL+VNTK H+LHAF N ++IGS+
Sbjct  472   ANLLLEQKGTTVDFSDYLWYMTNIDSNATSSL--QNVTLQVNTKGHMLHAFVNRRYIGSQ  529

Query  686   WAQDDGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNG  862
             W + +G+  F+F++ + ++   NTI+LLS TVGL NY  +++ V  G+  GP+ L+    
Sbjct  530   W-RSNGQ-SFVFEKPILIKPGTNTITLLSATVGLKNYDAFYDTVPTGIDGGPIYLIGDGN  587

Query  863   EGMDLSKNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitl  1039
               +DLS N W+Y VGL+G  K L+      +  W   N ++  R   WYK          
Sbjct  588   VKIDLSSNLWSYKVGLNGEMKQLYNPVFSQRTNWSTINQKSIGRRMTWYK----------  637

Query  1040  ldlpiilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWP  1219
                                     T FKTP+G D V LD+ GMGKG AWVNG +IGR+WP
Sbjct  638   ------------------------TSFKTPSGIDRVTLDMQGMGKGQAWVNGQSIGRFWP  673

Query  1220  SFLAKSDGC-LQCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGR  1396
             SF+A +D C   CDYRG Y  SKCV  CG PSQRWYH+PRSFL     N LVLFEE+GG 
Sbjct  674   SFIASNDSCSTTCDYRGAYNPSKCVENCGNPSQRWYHIPRSFLSDD-TNTLVLFEEIGGN  732

Query  1397  PQEVRVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDAT  1576
             PQ+V VQT+T+GTIC N  EG+T+ELSC+GG  IS+I+F S+G P G CGSF+       
Sbjct  733   PQQVSVQTITIGTICGNANEGSTLELSCQGGHIISEIQFASYGNPEGKCGSFKQGSWHVI  792

Query  1577  DIIPVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +   +++  C+G+E C++ VS   F      +   RLA++A C
Sbjct  793   NSAILVEKLCIGRESCSIDVSAKSFGLGDVTNLSARLAIQALC  835



>ref|XP_002516236.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF46238.1| beta-galactosidase, putative [Ricinus communis]
Length=775

 Score =   469 bits (1206),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 257/580 (44%), Positives = 338/580 (58%), Gaps = 60/580 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             Y+GGTNFGRT+GGPYI  +YDY++PLDEYGN+NQPKWGHLK+LH  +   E ++  G  T
Sbjct  229   YYGGTNFGRTAGGPYITASYDYDSPLDEYGNLNQPKWGHLKQLHASIKLGEKIITNGTVT  288

Query  182   NTDYGRMMSSTVYEYKG--KKVCFLANANDKDD-ISITFEGKNYTTPAWSVTILPDCKTE  352
               ++   +  T Y      ++ CFL+N N  D  I +  +G NYT PAWSV+IL +C  E
Sbjct  289   IKNFQAGVDLTAYTNNATRERFCFLSNINIADAHIDLQQDG-NYTIPAWSVSILQNCSKE  347

Query  353   VYNTARVNAQTTVMVKKLSEG----ALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLF  520
             ++NTA+VN QT++MVKKL E      L W + PE +     G               QL 
Sbjct  348   IFNTAKVNTQTSLMVKKLYENDKPTNLSWVWAPEPMKDTLLGKGR--------FRTSQLL  399

Query  521   DQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDD  700
             DQK  T D +DYLWYMTSF +N+ N +    +TL V ++ HVLHA+ N K I        
Sbjct  400   DQKETTVDASDYLWYMTSFDMNK-NTLQWTNVTLRVTSRGHVLHAYVNKKLIVGSQLVIQ  458

Query  701   GKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDL  877
             G+F   F++ V L+   N ISLLS TVGL NYG +F+K   G++ GPV+L+      MDL
Sbjct  459   GEFT--FEKPVTLKPGNNVISLLSATVGLANYGSFFDKTPVGIVDGPVQLMANGKPVMDL  516

Query  878   SKNTWTYMVGLHGISKGLF-KLDDHNKLTWHESN-FQTDRMFIWYKVTQSiplitlldlp  1051
             S N W+Y +GL+G +K  +     HNK  W  +N   T R   WYK T            
Sbjct  517   SSNLWSYKIGLNGEAKRFYDPTSRHNK--WSAANGVSTARPMTWYKTT------------  562

Query  1052  iilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLA  1231
                                   F +P+G D VV+DL GMGKG AW NG ++GRYWPS +A
Sbjct  563   ----------------------FSSPSGTDPVVVDLQGMGKGHAWANGKSLGRYWPSQIA  600

Query  1232  KSDGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEV  1408
              ++GC   CDYRG Y   KC   CG P+QRWYHVPRSFL   G N L+LFEE+GG P  +
Sbjct  601   NANGCSGTCDYRGPYNAGKCTRNCGIPTQRWYHVPRSFLNSNGKNTLILFEEVGGDPSGI  660

Query  1409  RVQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIP  1588
               Q VT  TIC N  EG+T+ELSC+GGR IS+I+F S+G P G+C SF+    DA + + 
Sbjct  661   SFQIVTTETICGNAYEGSTLELSCQGGRTISEIQFASYGNPQGTCSSFKKGSFDAMNSVQ  720

Query  1589  VIQSACVGKEKCTLHVSDALFPTTTCKS-KIRRLAVEATC  1705
             ++Q  CVGK+ C++  SD  F     +    +RLAV+A C
Sbjct  721   MVQKECVGKDSCSIIASDETFMVNEPQGISNKRLAVQAHC  760



>ref|XP_010272360.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
isoform X2 [Nelumbo nucifera]
Length=858

 Score =   471 bits (1212),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 258/723 (36%), Positives = 404/723 (56%), Gaps = 38/723 (5%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++   G +PNE+S  ++L AC  S++   G +VH  ++KLGY    Y  NAL+ +YSK G
Sbjct  173   EMVAEGTKPNEFSLSSILNACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLG  232

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
               +  + +F N+   DI SWN  I+G V       A EL   M+       +  TLS++L
Sbjct  233   DFEASMAIFQNIALPDIVSWNAAIAGCVLHGCHDWALELLGQMKDAGTFP-NKFTLSSIL  291

Query  4076  NACSECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              AC+   M+  G+++H++ +++  ES+  V+  LI  Y++C             LV DA 
Sbjct  292   KACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLIDMYSKC------------TLVHDA-  338

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
                               + +FD +PE + + +NA+++G+ QNGE  +A++ F  M+KE 
Sbjct  339   ------------------RMVFDLMPEHDVISWNAIISGYSQNGEDKEAISLFIDMLKEG  380

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
               F+  TL+ I  +  +L   +  KQ+H   +K+G E +  +  +L+D   +C  +EDA 
Sbjct  381   FGFNRTTLSVILKSTAVLQASEVVKQVHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDAT  440

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             +IF   P G   + + TSM+  Y+Q GQ E A+ LF +    GL   D    +++L  C 
Sbjct  441   RIFEECPFG--DVASFTSMITAYSQYGQGEEALKLFLKMLDMGLRP-DGFVCSSLLNACA  497

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
              L   + G+ +H   LK GF+SDV  GNA+++MYAKCG +D+A +AF  +  R + SW++
Sbjct  498   NLSAYEQGKQIHVHILKSGFISDVFAGNALVNMYAKCGSVDDADRAFLEIPERGIVSWSA  557

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             ++ G   H +G EAL  + +M   G+ P+  T + +L A  H    ++   + +F SM  
Sbjct  558   MIGGLAQHGQGREALSLFHQMLEEGVFPNHITLVSVLCACNHA--GLIAEAKQYFESMDK  615

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              +G+ P  +HYAC+V +LG  G L+EA E +N MPFE  +SVW ALL +  +H N  +G+
Sbjct  616   QFGIEPMQEHYACMVDLLGRAGRLDEAVELVNKMPFEANASVWGALLGASRIHGNLELGR  675

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
                + + ++EP+   T +L +N+Y++ G W+    VR  MK+   +K PG SW+  + K 
Sbjct  676   HAAEMLFTLEPEKSGTHVLLANMYASVGMWENVAKVRRLMKDSKVKKEPGMSWIEVKDKV  735

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             H+F   D SH ++ +IY+ LD L     KAGYVP     LH+V+  +K+  LFHHS KLA
Sbjct  736   HAFIVGDRSHSRTAEIYAKLDELSELMCKAGYVPMIEIDLHDVDRSEKERLLFHHSEKLA  795

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             + +GL+ T  G P+RV KN+ +C DCHT FK    +  REI VRD + FH F +G CSC 
Sbjct  796   VAFGLIATPEGAPIRVKKNLRVCVDCHTAFKFICKIVSREIIVRDINRFHHFRDGSCSCG  855

Query  2279  DRW  2271
             D W
Sbjct  856   DYW  858


 Score =   239 bits (609),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 155/542 (29%), Positives = 277/542 (51%), Gaps = 58/542 (11%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++  SG++ NE++F ++L AC  +++L+ G Q+H +++  GY    +V N L+ +Y+KCG
Sbjct  72    EMHSSGVKCNEFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVANTLVVMYAKCG  131

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+    LFD +P+R++ SWN + SG V+   +  A + F +M   +  + +  +LS++L
Sbjct  132   ELEDCKRLFDEIPERNVISWNALFSGYVQNDCYGEAVDQFKEMVA-EGTKPNEFSLSSIL  190

Query  4076  NAC--SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDA  3903
             NAC  SE +  +G+ +H + +++GY+S+L  NNAL+  Y++ G  ++ MA+F+ + + D 
Sbjct  191   NACTGSEDY-SQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDI  249

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE  3723
              +WN  I   +  G  D A EL   + +          AG   N                
Sbjct  250   VSWNAAIAGCVLHGCHDWALELLGQMKD----------AGTFPN----------------  283

Query  3722  SIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDA  3543
                   FTL+SI  AC  +  ++  KQ+H  ++K   E +  +   L+DM ++C  + DA
Sbjct  284   -----KFTLSSILKACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLIDMYSKCTLVHDA  338

Query  3542  EKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvc  3363
               +F  MP     +++  +++ GY+QNG+ + AISLF +   EG    +    + +L   
Sbjct  339   RMVFDLMP--EHDVISWNAIISGYSQNGEDKEAISLFIDMLKEGF-GFNRTTLSVILKST  395

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
               L   ++ + +H LA+K GF  D  V N++I  Y KC  +++A + FE     D+ S+ 
Sbjct  396   AVLQASEVVKQVHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDATRIFEECPFGDVASFT  455

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHI------LSAYRHTTKNVVNRCQS  3021
             S++  Y  + +G+EAL  + +M  +G+ PD F C  +      LSAY    +  V+  +S
Sbjct  456   SMITAYSQYGQGEEALKLFLKMLDMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHILKS  515

Query  3020  FFFSMQSAYGVLPASDHYA--CLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCI  2847
              F            SD +A   LV++    G +++A+     +P E     W A++    
Sbjct  516   GFI-----------SDVFAGNALVNMYAKCGSVDDADRAFLEIP-ERGIVSWSAMIGGLA  563

Query  2846  MH  2841
              H
Sbjct  564   QH  565


 Score =   157 bits (396),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/351 (30%), Positives = 173/351 (49%), Gaps = 35/351 (10%)
 Frame = -3

Query  4457  WSSSMR*DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALM  4278
             W+  +   ++ +G  PN+++  ++L AC      ELG QVH+ +IK+     T+V   L+
Sbjct  267   WALELLGQMKDAGTFPNKFTLSSILKACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLI  326

Query  4277  GLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDY  4098
              +YSKC  +     +FD +P+ D+ SWN +ISG  +      A  LF DM + +    + 
Sbjct  327   DMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYSQNGEDKEAISLFIDMLK-EGFGFNR  385

Query  4097  ITLSTLLNACSECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFER  3921
              TLS +L + +        +++HA A++ G+E +  V N+LI  Y +C  I+    +FE 
Sbjct  386   TTLSVILKSTAVLQASEVVKQVHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDATRIFEE  445

Query  3920  MLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFF  3741
                 D  ++  MITAY                                Q G+G +A+  F
Sbjct  446   CPFGDVASFTSMITAY-------------------------------SQYGQGEEALKLF  474

Query  3740  YRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
              +M+   +    F  +S+ NAC  L   +  KQIH  ILKSG   +     AL++M  +C
Sbjct  475   LKMLDMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHILKSGFISDVFAGNALVNMYAKC  534

Query  3560  GRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
             G ++DA++ F  +P     +V+ ++M+ G AQ+GQ   A+SLF +   EG+
Sbjct  535   GSVDDADRAFLEIP--ERGIVSWSAMIGGLAQHGQGREALSLFHQMLEEGV  583


 Score = 29.6 bits (65),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = -2

Query  4611  LKLEEDTRL--SNALISAYLKLGLVDYALAVFDSLSSPAIISGFAKI  4477
             +KL  D+ L  +NAL+  Y KLG  + ++A+F +++ P I+S  A I
Sbjct  210   VKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDIVSWNAAI  256


 Score =   154 bits (390),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/414 (27%), Positives = 205/414 (50%), Gaps = 36/414 (9%)
 Frame = -3

Query  4343  QVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKES  4164
             Q+HA +IK G+ + T + N L+ LYSK     F   L D +P+ D+ SW+ +ISG  +  
Sbjct  2     QIHAHIIKSGFSEDTALRNHLINLYSKRQIFCFARNLIDEIPEPDLVSWSALISGYAQNG  61

Query  4163  MFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVN  3987
                 A   F +M  +  ++ +  T  ++L ACS    ++ G+++H   +  GYES++ V 
Sbjct  62    FGKEALSAFIEMHSSG-VKCNEFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVA  120

Query  3986  NALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAV  3807
             N L+  Y +CG ++    LF+ +  R+  +W                             
Sbjct  121   NTLVVMYAKCGELEDCKRLFDEIPERNVISW-----------------------------  151

Query  3806  LYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFI  3627
               NA+ +G+ QN    +A+  F  M+ E  + ++F+L+SI NAC    +    K++HG++
Sbjct  152   --NALFSGYVQNDCYGEAVDQFKEMVAEGTKPNEFSLSSILNACTGSEDYSQGKRVHGYL  209

Query  3626  LKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPEN  3447
             +K G + +     AL+DM ++ G  E +  IF  + L    +V+  + + G   +G  + 
Sbjct  210   VKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIAL--PDIVSWNAAIAGCVLHGCHDW  267

Query  3446  AISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVI  3267
             A+ L  + +  G    ++   +++L  C  +G+ +LG+ +H   +K    SD  V   +I
Sbjct  268   ALELLGQMKDAG-TFPNKFTLSSILKACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLI  326

Query  3266  SMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLG  3105
              MY+KC  + +A   F+LM   D+ SWN++++GY  +    EA+  +  M + G
Sbjct  327   DMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYSQNGEDKEAISLFIDMLKEG  380


 Score =   147 bits (371),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/326 (28%), Positives = 166/326 (51%), Gaps = 34/326 (10%)
 Frame = -3

Query  4040  ELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESG  3861
             ++HAH ++ G+  + ++ N LI  Y++                R  F +           
Sbjct  2     QIHAHIIKSGFSEDTALRNHLINLYSK----------------RQIFCF-----------  34

Query  3860  LVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIAN  3681
                 A+ L D +PE + V ++A+++G+ QNG G +A++ F  M    ++ ++FT  S+  
Sbjct  35    ----ARNLIDEIPEPDLVSWSALISGYAQNGFGKEALSAFIEMHSSGVKCNEFTFPSVLK  90

Query  3680  ACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRL  3501
             AC +  + K  KQIHG ++ +G E +  +   L+ M  +CG +ED +++F  +P     +
Sbjct  91    ACSITKDLKGGKQIHGIVVVTGYESDVFVANTLVVMYAKCGELEDCKRLFDEIP--ERNV  148

Query  3500  VALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHC  3321
             ++  ++  GY QN     A+  F E   EG    +E + +++L  C        G+ +H 
Sbjct  149   ISWNALFSGYVQNDCYGEAVDQFKEMVAEG-TKPNEFSLSSILNACTGSEDYSQGKRVHG  207

Query  3320  LALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDE  3141
               +K G+ SD+   NA++ MY+K G+ + ++  F+ ++  D+ SWN+ +AG VLH   D 
Sbjct  208   YLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDIVSWNAAIAGCVLHGCHDW  267

Query  3140  ALDTWSRMERLGIVPDSFTCLHILSA  3063
             AL+   +M+  G  P+ FT   IL A
Sbjct  268   ALELLGQMKDAGTFPNKFTLSSILKA  293



>gb|KGN66613.1| hypothetical protein Csa_1G643050 [Cucumis sativus]
Length=803

 Score =   469 bits (1207),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 251/577 (44%), Positives = 346/577 (60%), Gaps = 56/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH+ +   E +L  G  +
Sbjct  271   YHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHSSIKLGEKILTNGTHS  330

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCKTE  352
             N  +G  ++ T +      ++ CFL+N +  +D +I  +    Y  PAWSV+I+  CK E
Sbjct  331   NKTFGSFVTLTKFSNPTTKERFCFLSNTDGTNDATIDLQADGKYFVPAWSVSIIDGCKKE  390

Query  353   VYNTARVNAQTTVMVKKLSEGA---LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             V+NTA++N+QT++ VK  +E     L W + PE +     G                L +
Sbjct  391   VFNTAKINSQTSIFVKVQNEKENVKLSWVWAPEAMSDTLQGK--------GTFKENLLLE  442

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK  T D++DYLWYMT+ + N ++ I    +TL+VNTK HVLHAF N ++IGS+W  ++G
Sbjct  443   QKGTTIDSSDYLWYMTNVETNGTSSI--HNVTLQVNTKGHVLHAFVNTRYIGSQWG-NNG  499

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             +  F+F++ + L+   N I+LLS TVGL NY  +++ +  G+  GP+ L+       +LS
Sbjct  500   Q-SFVFEKPILLKAGTNIITLLSATVGLKNYDAFYDTLPTGIDGGPIYLIGDGNVTTNLS  558

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  K L+      + +W+  N  +  R   WYK                
Sbjct  559   SNLWSYKVGLNGEIKQLYNPVFSQETSWNTLNKNSIGRRMTWYK----------------  602

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FKTP+G D V LD+ GMGKG AW+NG +IGR+WPSF+A +
Sbjct  603   ------------------TSFKTPSGIDPVTLDMQGMGKGEAWINGQSIGRFWPSFIAGN  644

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C + CDYRG Y  SKCV  CG PSQRWYH+PRSFL     N LVLFEE+GG PQ+V V
Sbjct  645   DNCSETCDYRGAYDPSKCVGNCGNPSQRWYHIPRSFLSNN-TNTLVLFEEIGGSPQQVSV  703

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+GTIC N  EG+T+ELSC+G   IS+I+F S+G P G CGSF+    D T+   ++
Sbjct  704   QTITIGTICGNANEGSTLELSCQGEYIISEIQFASYGNPKGKCGSFKQGSWDVTNSALLL  763

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +  C G + C++ VS  LF      +   RL V+A C
Sbjct  764   EKTCKGMKSCSVDVSAKLFGLGDAVNLSARLVVQALC  800



>gb|EEC66762.1| hypothetical protein OsI_33138 [Oryza sativa Indica Group]
Length=828

 Score =   469 bits (1207),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 257/580 (44%), Positives = 339/580 (58%), Gaps = 63/580 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+ QPK+GHLKELH++L S+E +LL+G+  
Sbjct  300   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLRQPKYGHLKELHSVLMSMEKILLHGDYI  359

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +T+YG  ++ T Y       CF+ N  D  D+++T +G  +  PAWSV+ILPDCKT  +N
Sbjct  360   DTNYGDNVTVTKYTLNATSACFINNRFDDRDVNVTLDGTTHFLPAWSVSILPDCKTVAFN  419

Query  362   TARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             +A++  QTTVMV K S         KWS+ PE +       K             +L +Q
Sbjct  420   SAKIKTQTTVMVNKTSMVEQQTEHFKWSWMPENLRPFMTDEKGN-------FRKNELLEQ  472

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
              V T D +DYLWY TS +             L VNT  H L+AF N K +G +++ ++  
Sbjct  473   IVTTTDQSDYLWYRTSLEHKGEG-----SYVLYVNTTGHELYAFVNGKLVGQQYSPNE-N  526

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLSK  883
             F F  +  VKL    N ISLLS TVGL NYG  FE +  G++ GPVKL++ +G  +DLS 
Sbjct  527   FTFQLKSPVKLHDGKNYISLLSGTVGLRNYGGSFELLPAGIVGGPVKLIDSSGSAIDLSN  586

Query  884   NTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilN  1063
             N+W+Y  GL G  + ++     NK   H S    +R F WYK T                
Sbjct  587   NSWSYKAGLAGEYRKIYLDKPGNKWRSHNSTIPINRPFTWYKTT----------------  630

Query  1064  TSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS-D  1240
                               F+ PAGEDSVV+DL G+ KG+AWVNG+++GRYWPS++A    
Sbjct  631   ------------------FQAPAGEDSVVVDLHGLNKGVAWVNGNSLGRYWPSYVAADMP  672

Query  1241  GCLQCDYRGNYG----GSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEV  1408
             GC  CDYRG +       KC+TGCG+PSQ+ YHVPRSFL K   N L+LFEE GG P EV
Sbjct  673   GCHHCDYRGVFKAEVEAQKCLTGCGEPSQQLYHVPRSFLHKGEPNTLILFEEAGGDPSEV  732

Query  1409  RVQTVTVGTICANVREGNTMELSCRG-GRKISKIKFGSFGEPIGSCGSFETSHCDATDII  1585
              V+TV  G++CA+   G+T+ LSC   GR IS +   SFG   G CGS++   CD+    
Sbjct  733   AVRTVVEGSVCASAELGDTVTLSCGAHGRTISSVDVASFGVARGRCGSYDGG-CDSKVAY  791

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                 +ACVGKE CT+ V+DA F    C S +  L V+ATC
Sbjct  792   DAFAAACVGKESCTVLVTDA-FANAGCVSGV--LTVQATC  828



>ref|XP_004154711.1| PREDICTED: beta-galactosidase 7-like [Cucumis sativus]
Length=803

 Score =   468 bits (1205),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 252/577 (44%), Positives = 345/577 (60%), Gaps = 56/577 (10%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGP+I T+YDYNAPLDEYGN+NQPKWGHLK+LH+ +   E +L  G  +
Sbjct  271   YHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLHSSIKLGEKILTNGTHS  330

Query  182   NTDYGRMMSSTVYEYKGKK--VCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCKTE  352
             N  +G  ++ T +     K   CFL+N +D +D +I  +    Y  PAWSV+I+  CK E
Sbjct  331   NKTFGSFVTLTKFSNPTTKERFCFLSNTDDTNDATIDLQADGKYFVPAWSVSIIDGCKKE  390

Query  353   VYNTARVNAQTTVMVKKLSEGA---LKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFD  523
             V+NTA++N+QT++ VK  +E     L W + PE +     G                L +
Sbjct  391   VFNTAKINSQTSMFVKVQNEKENVKLSWVWAPEAMSDTLQGK--------GTFKENLLLE  442

Query  524   QKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDG  703
             QK  T D++DYLWYMT+ + N ++ I    +TL+VNTK HVLHAF N ++IGS+W  ++G
Sbjct  443   QKGTTIDSSDYLWYMTNVETNGTSSI--HNVTLQVNTKGHVLHAFVNTRYIGSQWG-NNG  499

Query  704   KFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLS  880
             +  F+F++ + L+   N I+LLS TVGL NY  +++ +  G+  GP+ L+       +LS
Sbjct  500   Q-SFVFEKPILLKAGTNIITLLSATVGLKNYDAFYDTLPTGIDGGPIYLIGDGNVTTNLS  558

Query  881   KNTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQT-DRMFIWYKVTQSiplitlldlpii  1057
              N W+Y VGL+G  K L+      + +W+  N  +  R   WYK                
Sbjct  559   SNLWSYKVGLNGEIKQLYNPVFSQETSWNTLNKNSIGRRMTWYK----------------  602

Query  1058  lNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS  1237
                               T FKTP+G D V LD+ GMGKG AW+NG +IGR+WPSF+A +
Sbjct  603   ------------------TSFKTPSGIDPVTLDMQGMGKGEAWINGQSIGRFWPSFIAGN  644

Query  1238  DGCLQ-CDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVRV  1414
             D C + CDYRG Y  SKCV  CG PSQRWYH+PRSFL     N LVLFEE+GG PQ+V V
Sbjct  645   DNCSETCDYRGAYDPSKCVGNCGNPSQRWYHIPRSFLSNN-TNTLVLFEEIGGSPQQVSV  703

Query  1415  QTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPVI  1594
             QT+T+GTIC N  EG+T+ELSC+G   IS+I+F S+G P G CGSF+    D T+   ++
Sbjct  704   QTITIGTICGNANEGSTLELSCQGEYIISEIQFASYGNPKGKCGSFKQGSWDVTNSALLL  763

Query  1595  QSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             +  C   + C++ VS  LF      +   RL V+A C
Sbjct  764   EKTCKDMKSCSVDVSAKLFGLGDAVNLSARLVVQALC  800



>ref|XP_010272359.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
isoform X1 [Nelumbo nucifera]
Length=942

 Score =   471 bits (1212),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 258/723 (36%), Positives = 404/723 (56%), Gaps = 38/723 (5%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++   G +PNE+S  ++L AC  S++   G +VH  ++KLGY    Y  NAL+ +YSK G
Sbjct  257   EMVAEGTKPNEFSLSSILNACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLG  316

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
               +  + +F N+   DI SWN  I+G V       A EL   M+       +  TLS++L
Sbjct  317   DFEASMAIFQNIALPDIVSWNAAIAGCVLHGCHDWALELLGQMKDAGTFP-NKFTLSSIL  375

Query  4076  NACSECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
              AC+   M+  G+++H++ +++  ES+  V+  LI  Y++C             LV DA 
Sbjct  376   KACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLIDMYSKC------------TLVHDA-  422

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
                               + +FD +PE + + +NA+++G+ QNGE  +A++ F  M+KE 
Sbjct  423   ------------------RMVFDLMPEHDVISWNAIISGYSQNGEDKEAISLFIDMLKEG  464

Query  3719  IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAE  3540
               F+  TL+ I  +  +L   +  KQ+H   +K+G E +  +  +L+D   +C  +EDA 
Sbjct  465   FGFNRTTLSVILKSTAVLQASEVVKQVHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDAT  524

Query  3539  KIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcg  3360
             +IF   P G   + + TSM+  Y+Q GQ E A+ LF +    GL   D    +++L  C 
Sbjct  525   RIFEECPFGD--VASFTSMITAYSQYGQGEEALKLFLKMLDMGLRP-DGFVCSSLLNACA  581

Query  3359  tlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNS  3180
              L   + G+ +H   LK GF+SDV  GNA+++MYAKCG +D+A +AF  +  R + SW++
Sbjct  582   NLSAYEQGKQIHVHILKSGFISDVFAGNALVNMYAKCGSVDDADRAFLEIPERGIVSWSA  641

Query  3179  LLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS  3000
             ++ G   H +G EAL  + +M   G+ P+  T + +L A  H    ++   + +F SM  
Sbjct  642   MIGGLAQHGQGREALSLFHQMLEEGVFPNHITLVSVLCACNHA--GLIAEAKQYFESMDK  699

Query  2999  AYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGK  2820
              +G+ P  +HYAC+V +LG  G L+EA E +N MPFE  +SVW ALL +  +H N  +G+
Sbjct  700   QFGIEPMQEHYACMVDLLGRAGRLDEAVELVNKMPFEANASVWGALLGASRIHGNLELGR  759

Query  2819  RVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKF  2640
                + + ++EP+   T +L +N+Y++ G W+    VR  MK+   +K PG SW+  + K 
Sbjct  760   HAAEMLFTLEPEKSGTHVLLANMYASVGMWENVAKVRRLMKDSKVKKEPGMSWIEVKDKV  819

Query  2639  HSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLA  2460
             H+F   D SH ++ +IY+ LD L     KAGYVP     LH+V+  +K+  LFHHS KLA
Sbjct  820   HAFIVGDRSHSRTAEIYAKLDELSELMCKAGYVPMIEIDLHDVDRSEKERLLFHHSEKLA  879

Query  2459  LTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCN  2280
             + +GL+ T  G P+RV KN+ +C DCHT FK    +  REI VRD + FH F +G CSC 
Sbjct  880   VAFGLIATPEGAPIRVKKNLRVCVDCHTAFKFICKIVSREIIVRDINRFHHFRDGSCSCG  939

Query  2279  DRW  2271
             D W
Sbjct  940   DYW  942


 Score =   239 bits (611),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 155/542 (29%), Positives = 277/542 (51%), Gaps = 58/542 (11%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++  SG++ NE++F ++L AC  +++L+ G Q+H +++  GY    +V N L+ +Y+KCG
Sbjct  156   EMHSSGVKCNEFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVANTLVVMYAKCG  215

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              L+    LFD +P+R++ SWN + SG V+   +  A + F +M   +  + +  +LS++L
Sbjct  216   ELEDCKRLFDEIPERNVISWNALFSGYVQNDCYGEAVDQFKEMVA-EGTKPNEFSLSSIL  274

Query  4076  NAC--SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDA  3903
             NAC  SE +  +G+ +H + +++GY+S+L  NNAL+  Y++ G  ++ MA+F+ + + D 
Sbjct  275   NACTGSEDY-SQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDI  333

Query  3902  FTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKE  3723
              +WN  I   +  G  D A EL   + +          AG   N                
Sbjct  334   VSWNAAIAGCVLHGCHDWALELLGQMKD----------AGTFPN----------------  367

Query  3722  SIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDA  3543
                   FTL+SI  AC  +  ++  KQ+H  ++K   E +  +   L+DM ++C  + DA
Sbjct  368   -----KFTLSSILKACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLIDMYSKCTLVHDA  422

Query  3542  EKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvc  3363
               +F  MP     +++  +++ GY+QNG+ + AISLF +   EG    +    + +L   
Sbjct  423   RMVFDLMP--EHDVISWNAIISGYSQNGEDKEAISLFIDMLKEGF-GFNRTTLSVILKST  479

Query  3362  gtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWN  3183
               L   ++ + +H LA+K GF  D  V N++I  Y KC  +++A + FE     D+ S+ 
Sbjct  480   AVLQASEVVKQVHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDATRIFEECPFGDVASFT  539

Query  3182  SLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHI------LSAYRHTTKNVVNRCQS  3021
             S++  Y  + +G+EAL  + +M  +G+ PD F C  +      LSAY    +  V+  +S
Sbjct  540   SMITAYSQYGQGEEALKLFLKMLDMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHILKS  599

Query  3020  FFFSMQSAYGVLPASDHYA--CLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCI  2847
              F            SD +A   LV++    G +++A+     +P E     W A++    
Sbjct  600   GFI-----------SDVFAGNALVNMYAKCGSVDDADRAFLEIP-ERGIVSWSAMIGGLA  647

Query  2846  MH  2841
              H
Sbjct  648   QH  649


 Score =   167 bits (423),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 119/437 (27%), Positives = 216/437 (49%), Gaps = 36/437 (8%)
 Frame = -3

Query  4412  PNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIEL  4233
             P    +  LL  C  S++L+ G Q+HA +IK G+ + T + N L+ LYSK     F   L
Sbjct  63    PTSNVYSKLLVECSSSKSLKQGMQIHAHIIKSGFSEDTALRNHLINLYSKRQIFCFARNL  122

Query  4232  FDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-  4056
              D +P+ D+ SW+ +ISG  +      A   F +M  +  ++ +  T  ++L ACS    
Sbjct  123   IDEIPEPDLVSWSALISGYAQNGFGKEALSAFIEMHSSG-VKCNEFTFPSVLKACSITKD  181

Query  4055  MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITA  3876
             ++ G+++H   +  GYES++ V N L+  Y +CG ++    LF+ +  R+  +W      
Sbjct  182   LKGGKQIHGIVVVTGYESDVFVANTLVVMYAKCGELEDCKRLFDEIPERNVISW------  235

Query  3875  YMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTL  3696
                                      NA+ +G+ QN    +A+  F  M+ E  + ++F+L
Sbjct  236   -------------------------NALFSGYVQNDCYGEAVDQFKEMVAEGTKPNEFSL  270

Query  3695  TSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPL  3516
             +SI NAC    +    K++HG+++K G + +     AL+DM ++ G  E +  IF  + L
Sbjct  271   SSILNACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIAL  330

Query  3515  GHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklG  3336
                 +V+  + + G   +G  + A+ L  + +  G    ++   +++L  C  +G+ +LG
Sbjct  331   --PDIVSWNAAIAGCVLHGCHDWALELLGQMKDAG-TFPNKFTLSSILKACAGIGMKELG  387

Query  3335  ENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLH  3156
             + +H   +K    SD  V   +I MY+KC  + +A   F+LM   D+ SWN++++GY  +
Sbjct  388   KQVHSNLIKMDTESDTFVSVGLIDMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYSQN  447

Query  3155  RRGDEALDTWSRMERLG  3105
                 EA+  +  M + G
Sbjct  448   GEDKEAISLFIDMLKEG  464


 Score =   157 bits (396),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 104/351 (30%), Positives = 173/351 (49%), Gaps = 35/351 (10%)
 Frame = -3

Query  4457  WSSSMR*DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALM  4278
             W+  +   ++ +G  PN+++  ++L AC      ELG QVH+ +IK+     T+V   L+
Sbjct  351   WALELLGQMKDAGTFPNKFTLSSILKACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLI  410

Query  4277  GLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDY  4098
              +YSKC  +     +FD +P+ D+ SWN +ISG  +      A  LF DM + +    + 
Sbjct  411   DMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYSQNGEDKEAISLFIDMLK-EGFGFNR  469

Query  4097  ITLSTLLNACSECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFER  3921
              TLS +L + +        +++HA A++ G+E +  V N+LI  Y +C  I+    +FE 
Sbjct  470   TTLSVILKSTAVLQASEVVKQVHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDATRIFEE  529

Query  3920  MLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFF  3741
                 D  ++  MITAY                                Q G+G +A+  F
Sbjct  530   CPFGDVASFTSMITAY-------------------------------SQYGQGEEALKLF  558

Query  3740  YRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
              +M+   +    F  +S+ NAC  L   +  KQIH  ILKSG   +     AL++M  +C
Sbjct  559   LKMLDMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHILKSGFISDVFAGNALVNMYAKC  618

Query  3560  GRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
             G ++DA++ F  +P     +V+ ++M+ G AQ+GQ   A+SLF +   EG+
Sbjct  619   GSVDDADRAFLEIP--ERGIVSWSAMIGGLAQHGQGREALSLFHQMLEEGV  667


 Score = 31.6 bits (70),  Expect(2) = 6e-38, Method: Composition-based stats.
 Identities = 16/45 (36%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVFDSLSSPAIISGFAKI  4477
             L  + D   +NAL+  Y KLG  + ++A+F +++ P I+S  A I
Sbjct  296   LGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDIVSWNAAI  340


 Score =   153 bits (387),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/343 (28%), Positives = 175/343 (51%), Gaps = 35/343 (10%)
 Frame = -3

Query  4088  STLLNACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLV  3912
             S LL  CS    +++G ++HAH ++ G+  + ++ N LI  Y++                
Sbjct  69    SKLLVECSSSKSLKQGMQIHAHIIKSGFSEDTALRNHLINLYSK----------------  112

Query  3911  RDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRM  3732
             R  F +               A+ L D +PE + V ++A+++G+ QNG G +A++ F  M
Sbjct  113   RQIFCF---------------ARNLIDEIPEPDLVSWSALISGYAQNGFGKEALSAFIEM  157

Query  3731  IKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRM  3552
                 ++ ++FT  S+  AC +  + K  KQIHG ++ +G E +  +   L+ M  +CG +
Sbjct  158   HSSGVKCNEFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVANTLVVMYAKCGEL  217

Query  3551  EDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvl  3372
             ED +++F  +P     +++  ++  GY QN     A+  F E   EG    +E + +++L
Sbjct  218   EDCKRLFDEIP--ERNVISWNALFSGYVQNDCYGEAVDQFKEMVAEG-TKPNEFSLSSIL  274

Query  3371  gvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLC  3192
               C        G+ +H   +K G+ SD+   NA++ MY+K G+ + ++  F+ ++  D+ 
Sbjct  275   NACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDIV  334

Query  3191  SWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
             SWN+ +AG VLH   D AL+   +M+  G  P+ FT   IL A
Sbjct  335   SWNAAIAGCVLHGCHDWALELLGQMKDAGTFPNKFTLSSILKA  377



>ref|XP_007040803.1| Beta-galactosidase 7 [Theobroma cacao]
 gb|EOY25304.1| Beta-galactosidase 7 [Theobroma cacao]
Length=1196

 Score =   478 bits (1229),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 256/578 (44%), Positives = 334/578 (58%), Gaps = 61/578 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRTSGGPYI T+YDYNAPLDEYGN+NQPKWGHLK+LH  L   E  L  G + 
Sbjct  288   YHGGTNFGRTSGGPYITTSYDYNAPLDEYGNLNQPKWGHLKQLHEALRVGEKFLTNGTSE  347

Query  182   NTDYGRMMSSTVYE--YKGKKVCFLANANDKDDISITFEGKN-YTTPAWSVTILPDCKTE  352
               D G  +  T +     G++ CFL+N N+  D+++  +    +  PAWSV+IL  CK E
Sbjct  348   TKDSGDGIQLTTFTDGQTGERFCFLSNTNNNKDVNVDLKDDGMHFVPAWSVSILGACKKE  407

Query  353   VYNTARVNAQTTVMVKKL-----SEGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQL  517
             +YN+A+VN QT+VMVKK            W++  E +     G             A  L
Sbjct  408   IYNSAKVNTQTSVMVKKQIGDEDKSAQFNWTWTLEPMRDTLEGK--------GTFSANTL  459

Query  518   FDQKVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQD  697
              +QK  ++D +DYLWYMTS  IN ++     E T+  N+   V+HA+ N + IG++    
Sbjct  460   LEQKRASDDLSDYLWYMTSVDINGTS---FNEGTIFANSSGQVVHAYVNGRLIGTK----  512

Query  698   DGKFKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVIGPVKLVEPNGEGMDL  877
                + F F+  V L    N I+LLS TVGL NYG +F+   +GV GPV L++   + +DL
Sbjct  513   -SGYSFQFRNPVSLVPGRNNITLLSVTVGLQNYGDHFDLGPEGVTGPVGLIDVGNKTIDL  571

Query  878   SKNTWTYMVGLHGISKGLFKLDDHNKLTWHES-NFQTDRMFIWYKVTQSiplitlldlpi  1054
             S N W Y VGL+G +K L+  +  N   W  S      R   WYK               
Sbjct  572   SSNAWNYKVGLNGEAKKLYDPNSPNLQLWRTSEELPIGRPMTWYK---------------  616

Query  1055  ilNTSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAK  1234
                                T FK P+G D VVLDL GMGKG AW+NG++IGR+WP+ +A 
Sbjct  617   -------------------TAFKAPSGTDPVVLDLMGMGKGHAWINGNSIGRFWPAQIAD  657

Query  1235  SDGCL-QCDYRGNYGGSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEVR  1411
             ++GC  +CDYRG Y   KC++ CG PSQRWYHVPRSF+  +G N LVLFEE+GG P EV 
Sbjct  658   NNGCTDECDYRGAYKEQKCLSNCGNPSQRWYHVPRSFI-TSGTNFLVLFEEIGGDPSEVS  716

Query  1412  VQTVTVGTICANVREGNTMELSCRGGRKISKIKFGSFGEPIGSCGSFETSHCDATDIIPV  1591
              QTVT G+ICAN  EG+ +ELSC GG  ISKI+F S+G P G CGS     C+A   +  
Sbjct  717   FQTVTTGSICANANEGSLLELSCHGGNVISKIEFASYGNPKGRCGSLTKGSCEAEGSLSA  776

Query  1592  IQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
             ++  CVGKE CT+ VS+  F +  C    + LAVEA C
Sbjct  777   LEKICVGKESCTVDVSEKTFGSADCGEDKKSLAVEALC  814



>ref|XP_002273710.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Vitis vinifera]
Length=933

 Score =   469 bits (1207),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 256/720 (36%), Positives = 413/720 (57%), Gaps = 40/720 (6%)
 Frame = -3

Query  4424  SGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDF  4245
             SGI+PNE+S  +++ AC   ++   G  +H  +IKLGY    +  NAL+ +Y+K G L  
Sbjct  252   SGIKPNEFSLSSMVNACTGLRDSSRGKIIHGYLIKLGYDWDPFSANALVDMYAKVGDLAD  311

Query  4244  VIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRND-CLRIDYITLSTLLNAC  4068
              I +F+ + + DI SWN +I+G V      +A EL   M+R+  C  I   TLS+ L AC
Sbjct  312   AISVFEKIKQPDIVSWNAVIAGCVLHEHHEQALELLGQMKRSGICPNI--FTLSSALKAC  369

Query  4067  SECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWN  3891
             +   ++  G++LH+  +++  ES+L V+  L+  Y++C                      
Sbjct  370   AGMGLKELGRQLHSSLMKMDMESDLFVSVGLVDMYSKCD---------------------  408

Query  3890  EMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEF  3711
                       L++ A+  F+ LPEK+ + +NA+++G+ Q  E ++A++ F  M KE I F
Sbjct  409   ----------LLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEALSLFVEMHKEGIGF  458

Query  3710  SDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIF  3531
             +  TL++I  +   L      +Q+HG  +KSG   +  +  +L+D   +C  +EDAE+IF
Sbjct  459   NQTTLSTILKSTAGLQVVHVCRQVHGLSVKSGFHSDIYVVNSLIDSYGKCSHVEDAERIF  518

Query  3530  HRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlg  3351
                 +G   LV+ TSM+  YAQ GQ E A+ LF E Q +  +  D    +++L  C  L 
Sbjct  519   EECTIG--DLVSFTSMITAYAQYGQGEEALKLFLEMQ-DMELKPDRFVCSSLLNACANLS  575

Query  3350  llklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLA  3171
               + G+ LH   LK+GF+ D+  GN++++MYAKCG +D+A +AF  ++ R + SW++++ 
Sbjct  576   AFEQGKQLHVHILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIG  635

Query  3170  GYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQSAYG  2991
             G   H  G +AL  +++M + G+ P+  T + +L A  H    +V   + +F SM+  +G
Sbjct  636   GLAQHGHGRQALQLFNQMLKEGVSPNHITLVSVLGACNHA--GLVTEAKLYFESMEELFG  693

Query  2990  VLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVI  2811
               P  +HYAC++ +LG  G + EA E +N MPFE  +SVW ALL +  +H +  +G+R  
Sbjct  694   FKPMQEHYACMIDLLGRAGKINEAVELVNKMPFEANASVWGALLGAARIHKDVELGRRAA  753

Query  2810  KKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIPGQSWVICQHKFHSF  2631
             + +  +EP+   T +L +N+Y+++G+W+    VR  M++   +K PG SW+  + K ++F
Sbjct  754   EMLFILEPEKSGTHVLLANIYASAGKWENVAEVRRLMRDSKVKKEPGMSWIEVKDKVYTF  813

Query  2630  FARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKKDFLFHHSAKLALTY  2451
                D SH +S++IY+ LD L     KAGYVP     LH+VE+ +K+  L+HHS KLA+ +
Sbjct  814   LVGDRSHYRSQEIYAKLDELSDLMDKAGYVPMVEIDLHDVEQSEKELLLYHHSEKLAVAF  873

Query  2450  GLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGFHCFLNGKCSCNDRW  2271
             GL+ T  G P+RV KN+ +C DCHT FK    +  REI VRD + FH F +G CSC D W
Sbjct  874   GLIATPQGAPIRVKKNLRVCVDCHTAFKYICKIVSREIIVRDINRFHHFKDGSCSCGDYW  933


 Score =   201 bits (512),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 126/454 (28%), Positives = 237/454 (52%), Gaps = 36/454 (8%)
 Frame = -3

Query  4421  GIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFV  4242
             G++ NE++F ++L AC   ++L +G QVH +++  G+    +V N L+ +Y+KC      
Sbjct  152   GVKCNEFTFSSVLKACSIVKDLRIGKQVHGVVVVSGFEGDVFVANTLVVMYAKCDEFLDS  211

Query  4241  IELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLNACSE  4062
               LFD +P+R++ SWN + S  V+      A  LF +M  +  ++ +  +LS+++NAC+ 
Sbjct  212   KRLFDEIPERNVVSWNALFSCYVQIDFCGEAVGLFYEMVLSG-IKPNEFSLSSMVNACTG  270

Query  4061  CF-MRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFTWNEM  3885
                  RG+ +H + +++GY+ +    NAL+  Y + G +   +++FE++   D  +W   
Sbjct  271   LRDSSRGKIIHGYLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQPDIVSW---  327

Query  3884  ITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESIEFSD  3705
                                         NAV+AG   +    +A+    +M +  I  + 
Sbjct  328   ----------------------------NAVIAGCVLHEHHEQALELLGQMKRSGICPNI  359

Query  3704  FTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEKIFHR  3525
             FTL+S   AC  +  ++  +Q+H  ++K   E +  +   L+DM ++C  +EDA   F+ 
Sbjct  360   FTLSSALKACAGMGLKELGRQLHSSLMKMDMESDLFVSVGLVDMYSKCDLLEDARMAFNL  419

Query  3524  MPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgll  3345
             +P     L+A  +++ GY+Q  +   A+SLF E   EG +  ++   +T+L     L ++
Sbjct  420   LP--EKDLIAWNAIISGYSQYWEDMEALSLFVEMHKEG-IGFNQTTLSTILKSTAGLQVV  476

Query  3344  klGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGY  3165
              +   +H L++K GF SD+ V N++I  Y KC  +++A + FE  +  DL S+ S++  Y
Sbjct  477   HVCRQVHGLSVKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAY  536

Query  3164  VLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA  3063
               + +G+EAL  +  M+ + + PD F C  +L+A
Sbjct  537   AQYGQGEEALKLFLEMQDMELKPDRFVCSSLLNA  570


 Score = 30.0 bits (66),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 6/64 (9%)
 Frame = -2

Query  4605  LEEDTRLSNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVELFY  4444
             L +D  + N LI+ Y K     YA  + D  S P      A+ISG+A+      A+  F+
Sbjct  87    LSDDPSIRNHLINLYSKCRNFGYARKLVDESSEPDLVSWSALISGYAQNGLGGGALMAFH  146

Query  4443  EMRL  4432
             EM L
Sbjct  147   EMHL  150


 Score =   178 bits (452),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 144/538 (27%), Positives = 259/538 (48%), Gaps = 46/538 (9%)
 Frame = -3

Query  4514  FPPRPSYRVLQK-STVKLKPWSSSMR*DLRGSGIEPNEYSFVALLTACIRSQNLELGFQV  4338
              P +P+ +++Q        P ++++   +      P   S+  LL+ C  +++L  G Q+
Sbjct  19    LPFKPAPKLIQTVPQFSQDPQTTAILNLIDKGNFTPTSVSYSKLLSQCCTTKSLRPGLQI  78

Query  4337  HALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMF  4158
             HA + K G  D   + N L+ LYSKC +  +  +L D   + D+ SW+ +ISG  +  + 
Sbjct  79    HAHITKSGLSDDPSIRNHLINLYSKCRNFGYARKLVDESSEPDLVSWSALISGYAQNGLG  138

Query  4157  TRAFELFNDMQRNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNA  3981
               A   F++M     ++ +  T S++L ACS    +R G+++H   +  G+E ++ V N 
Sbjct  139   GGALMAFHEMHLLG-VKCNEFTFSSVLKACSIVKDLRIGKQVHGVVVVSGFEGDVFVANT  197

Query  3980  LIKFYTRCGSIKSVMALFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLY  3801
             L+  Y +C        LF+ +  R+  +WN + + Y++   +D                 
Sbjct  198   LVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQ---ID-----------------  237

Query  3800  NAVLAGFCQNGEGLKAMAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILK  3621
                   FC  GE   A+  FY M+   I+ ++F+L+S+ NAC  L +    K IHG+++K
Sbjct  238   ------FC--GE---AVGLFYEMVLSGIKPNEFSLSSMVNACTGLRDSSRGKIIHGYLIK  286

Query  3620  SGCEPNDCIEAALLDMCTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAI  3441
              G + +     AL+DM  + G + DA  +F ++      +V+  +++ G   +   E A+
Sbjct  287   LGYDWDPFSANALVDMYAKVGDLADAISVFEKIK--QPDIVSWNAVIAGCVLHEHHEQAL  344

Query  3440  SLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISM  3261
              L  + +  G +  +    ++ L  C  +GL +LG  LH   +K    SD+ V   ++ M
Sbjct  345   ELLGQMKRSG-ICPNIFTLSSALKACAGMGLKELGRQLHSSLMKMDMESDLFVSVGLVDM  403

Query  3260  YAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTC  3081
             Y+KC  L++A  AF L+  +DL +WN++++GY  +    EAL  +  M + GI  +  T 
Sbjct  404   YSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEALSLFVEMHKEGIGFNQTTL  463

Query  3080  LHILSAYRHTTKNVVNRC-QSFFFSMQSAYGVLPASDHYAC--LVSVLGYWGLLEEAE  2916
               IL +       VV+ C Q    S++S +     SD Y    L+   G    +E+AE
Sbjct  464   STILKST--AGLQVVHVCRQVHGLSVKSGF----HSDIYVVNSLIDSYGKCSHVEDAE  515


 Score =   148 bits (373),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 110/415 (27%), Positives = 198/415 (48%), Gaps = 41/415 (10%)
 Frame = -3

Query  4097  ITLSTLLNAC-SECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFER  3921
             ++ S LL+ C +   +R G ++HAH  + G   + S+ N LI  Y++C +          
Sbjct  57    VSYSKLLSQCCTTKSLRPGLQIHAHITKSGLSDDPSIRNHLINLYSKCRNF---------  107

Query  3920  MLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFF  3741
                                     A++L D   E + V ++A+++G+ QNG G  A+  F
Sbjct  108   ----------------------GYARKLVDESSEPDLVSWSALISGYAQNGLGGGALMAF  145

Query  3740  YRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
             + M    ++ ++FT +S+  AC ++ + +  KQ+HG ++ SG E +  +   L+ M  +C
Sbjct  146   HEMHLLGVKCNEFTFSSVLKACSIVKDLRIGKQVHGVVVVSGFEGDVFVANTLVVMYAKC  205

Query  3560  GRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDEVATA  3381
                 D++++F  +P     +V+  ++   Y Q      A+ LF+E  L G +  +E + +
Sbjct  206   DEFLDSKRLFDEIP--ERNVVSWNALFSCYVQIDFCGEAVGLFYEMVLSG-IKPNEFSLS  262

Query  3380  tvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFELMSSR  3201
             +++  C  L     G+ +H   +K G+  D    NA++ MYAK G+L +A+  FE +   
Sbjct  263   SMVNACTGLRDSSRGKIIHGYLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQP  322

Query  3200  DLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSA-YRHTTKNVVNRCQ  3024
             D+ SWN+++AG VLH   ++AL+   +M+R GI P+ FT    L A      K +  +  
Sbjct  323   DIVSWNAVIAGCVLHEHHEQALELLGQMKRSGICPNIFTLSSALKACAGMGLKELGRQLH  382

Query  3023  SFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALL  2859
             S    M     +  +      LV +     LLE+A    N +P E     W A++
Sbjct  383   SSLMKMDMESDLFVS----VGLVDMYSKCDLLEDARMAFNLLP-EKDLIAWNAII  432


 Score =   135 bits (339),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 94/343 (27%), Positives = 167/343 (49%), Gaps = 35/343 (10%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             ++ SGI PN ++  + L AC      ELG Q+H+ ++K+      +V   L+ +YSKC  
Sbjct  350   MKRSGICPNIFTLSSALKACAGMGLKELGRQLHSSLMKMDMESDLFVSVGLVDMYSKCDL  409

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             L+     F+ LP++D+ +WN +ISG  +      A  LF +M + + +  +  TLST+L 
Sbjct  410   LEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEALSLFVEMHK-EGIGFNQTTLSTILK  468

Query  4073  ACSEC-FMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             + +    +   +++H  +++ G+ S++ V N+LI  Y +C  ++    +FE   + D  +
Sbjct  469   STAGLQVVHVCRQVHGLSVKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIGDLVS  528

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             +  MITAY                                Q G+G +A+  F  M    +
Sbjct  529   FTSMITAY-------------------------------AQYGQGEEALKLFLEMQDMEL  557

Query  3716  EFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMEDAEK  3537
             +   F  +S+ NAC  L   +  KQ+H  ILK G   +     +L++M  +CG ++DA +
Sbjct  558   KPDRFVCSSLLNACANLSAFEQGKQLHVHILKYGFVLDIFAGNSLVNMYAKCGSIDDAGR  617

Query  3536  IFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGL  3408
              F    L    +V+ ++M+ G AQ+G    A+ LF +   EG+
Sbjct  618   AFSE--LTERGIVSWSAMIGGLAQHGHGRQALQLFNQMLKEGV  658


 Score = 30.8 bits (68),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 6/56 (11%)
 Frame = -2

Query  4584  SNALISAYLKLGLVDYALAVFDSLSSP------AIISGFAKINREIEAVELFYEMR  4435
             +NAL+  Y K+G +  A++VF+ +  P      A+I+G        +A+EL  +M+
Sbjct  296   ANALVDMYAKVGDLADAISVFEKIKQPDIVSWNAVIAGCVLHEHHEQALELLGQMK  351


 Score =   125 bits (315),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/315 (27%), Positives = 147/315 (47%), Gaps = 46/315 (15%)
 Frame = -3

Query  4436  DLRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCG  4257
             ++   GI  N+ +   +L +    Q + +  QVH L +K G+    YVVN+L+  Y KC 
Sbjct  450   EMHKEGIGFNQTTLSTILKSTAGLQVVHVCRQVHGLSVKSGFHSDIYVVNSLIDSYGKCS  509

Query  4256  SLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLL  4077
              ++    +F+     D+ S+ +MI+   +      A +LF +MQ  + L+ D    S+LL
Sbjct  510   HVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLEMQDME-LKPDRFVCSSLL  568

Query  4076  NACSE-CFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAF  3900
             NAC+      +G++LH H L+ G+  ++   N+L+  Y +CGSI      F  +  R   
Sbjct  569   NACANLSAFEQGKQLHVHILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIV  628

Query  3899  TWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKES  3720
             +W+ MI                                G  Q+G G +A+  F +M+KE 
Sbjct  629   SWSAMI-------------------------------GGLAQHGHGRQALQLFNQMLKEG  657

Query  3719  IEFSDFTLTSIANAC---GLLMERK----SSKQIHGFILKSGCEPNDCIEAALLDMCTRC  3561
             +  +  TL S+  AC   GL+ E K    S +++ GF      +P     A ++D+  R 
Sbjct  658   VSPNHITLVSVLGACNHAGLVTEAKLYFESMEELFGF------KPMQEHYACMIDLLGRA  711

Query  3560  GRMEDAEKIFHRMPL  3516
             G++ +A ++ ++MP 
Sbjct  712   GKINEAVELVNKMPF  726


 Score = 34.7 bits (78),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 36/67 (54%), Gaps = 6/67 (9%)
 Frame = -2

Query  4611  LKLEEDTRLSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVEL  4450
             + +E D  +S  L+  Y K  L++ A   F      D ++  AIISG+++   ++EA+ L
Sbjct  388   MDMESDLFVSVGLVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEALSL  447

Query  4449  FYEMRLE  4429
             F EM  E
Sbjct  448   FVEMHKE  454



>gb|EEE50782.1| hypothetical protein OsJ_31141 [Oryza sativa Japonica Group]
Length=828

 Score =   466 bits (1199),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 255/580 (44%), Positives = 339/580 (58%), Gaps = 63/580 (11%)
 Frame = +2

Query  2     YHGGTNFGRTSGGPYIATTYDYNAPLDEYGNVNQPKWGHLKELHNLLYSLEDVLLYGNAT  181
             YHGGTNFGRT+GGPYI T+YDY+APLDEYGN+ QPK+GHLKELH++L S+E +LL+G+  
Sbjct  300   YHGGTNFGRTAGGPYITTSYDYDAPLDEYGNLRQPKYGHLKELHSVLMSMEKILLHGDYI  359

Query  182   NTDYGRMMSSTVYEYKGKKVCFLANANDKDDISITFEGKNYTTPAWSVTILPDCKTEVYN  361
             +T+YG  ++ T Y       CF+ N  D  D+++T +G  +  PAWSV+ILP+CKT  +N
Sbjct  360   DTNYGDNVTVTKYTLNATSACFINNRFDDRDVNVTLDGTTHFLPAWSVSILPNCKTVAFN  419

Query  362   TARVNAQTTVMVKKLS-----EGALKWSYRPETIMHLKYGHKNQSSVLIDALDAKQLFDQ  526
             +A++  QTTVMV K S         KWS+ PE +       K             +L +Q
Sbjct  420   SAKIKTQTTVMVNKTSMVEQQTEHFKWSWMPENLRPFMTDEKGN-------FRKNELLEQ  472

Query  527   KVVTNDTTDYLWYMTSFKINESNPILGQELTLEVNTKSHVLHAFFNNKHIGSEWAQDDGK  706
              V T D +DYLWY TS +             L VNT  H L+AF N K +G +++ ++  
Sbjct  473   IVTTTDQSDYLWYRTSLEHKGEG-----SYVLYVNTTGHELYAFVNGKLVGQQYSPNE-N  526

Query  707   FKFLFQRSVKLRKDINTISLLSETVGLPNYGQYFEKVGQGVI-GPVKLVEPNGEGMDLSK  883
             F F  +  VKL    N ISLLS TVGL NYG  FE +  G++ GPVKL++ +G  +DLS 
Sbjct  527   FTFQLKSPVKLHDGKNYISLLSGTVGLRNYGGSFELLPAGIVGGPVKLIDSSGSAIDLSN  586

Query  884   NTWTYMVGLHGISKGLFKLDDHNKLTWHESNFQTDRMFIWYKVTQSiplitlldlpiilN  1063
             N+W+Y  GL G  + ++     NK   H S    +R F WYK T                
Sbjct  587   NSWSYKAGLAGEYRKIYLDKPGNKWRSHNSTIPINRPFTWYKTT----------------  630

Query  1064  TSFV*M*LLCSFWILQTFFKTPAGEDSVVLDLTGMGKGIAWVNGHNIGRYWPSFLAKS-D  1240
                               F+ PAGEDSVV+DL G+ KG+AWVNG+++GRYWPS++A    
Sbjct  631   ------------------FQAPAGEDSVVVDLHGLNKGVAWVNGNSLGRYWPSYVAADMP  672

Query  1241  GCLQCDYRGNYG----GSKCVTGCGKPSQRWYHVPRSFLRKTGNNQLVLFEEMGGRPQEV  1408
             GC  CDYRG +       KC+TGCG+PSQ+ YHVPRSFL K   N L+LFEE GG P EV
Sbjct  673   GCHHCDYRGVFKAEVEAQKCLTGCGEPSQQLYHVPRSFLNKGEPNTLILFEEAGGDPSEV  732

Query  1409  RVQTVTVGTICANVREGNTMELSCRG-GRKISKIKFGSFGEPIGSCGSFETSHCDATDII  1585
              V+TV  G++CA+   G+T+ LSC   GR IS +   SFG   G CGS++   C++    
Sbjct  733   AVRTVVEGSVCASAEVGDTVTLSCGAHGRTISSVDVASFGVARGRCGSYDGG-CESKVAY  791

Query  1586  PVIQSACVGKEKCTLHVSDALFPTTTCKSKIRRLAVEATC  1705
                 +ACVGKE CT+ V+DA F    C S +  L V+ATC
Sbjct  792   DAFAAACVGKESCTVLVTDA-FANAGCVSGV--LTVQATC  828



>ref|XP_010250314.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Nelumbo nucifera]
 ref|XP_010250315.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Nelumbo nucifera]
Length=743

 Score =   463 bits (1191),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 240/674 (36%), Positives = 390/674 (58%), Gaps = 6/674 (1%)
 Frame = -3

Query  4289  NALMGLYSKCGSLDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCL  4110
             N ++  YSK G L  + E+F  +P RD  SWN +ISG     +   +  ++  M ++   
Sbjct  75    NGILSAYSKSGHLSEMEEIFKRIPSRDGVSWNCVISGYANCGLGEESVNMYKLMLKDGPA  134

Query  4109  RIDYITLSTLLN-ACSECFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMA  3933
              ++ IT ST+L  + ++  +  G+++H   ++ G+ES + V + L+  YT+ G I     
Sbjct  135   NLNRITFSTMLILSSTQSAIYLGRQIHGQIMKFGFESYVFVGSPLVDMYTKAGLIYDAKR  194

Query  3932  LFERMLVRDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKA  3753
             +FE M  R+   +N MIT  +  G+++ +K LF  +PE++++ +  ++ G  QNG  ++A
Sbjct  195   VFEEMSERNVVMYNTMITGLLRCGMLEESKSLFLEMPERDSISWTTMITGLTQNGLAIEA  254

Query  3752  MAFFYRMIKESIEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDM  3573
             +  F RM  E +    FT  S+  ACG L+  +  KQ H +I+++  + N  + +AL+DM
Sbjct  255   LEVFRRMRSEGLAIDQFTFGSVLTACGGLVALEQGKQSHAYIIRTDYKDNIFVGSALVDM  314

Query  3572  CTRCGRMEDAEKIFHRMPLGHGRLVALTSMLRGYAQNGQPENAISLFFETQLEGLVVVDE  3393
              ++ G ++ AE +F RM   H  +V+ T+ML GY QNG  E A+ +F + Q  G +  D+
Sbjct  315   YSKSGSIKYAEAVFKRM--AHKNIVSWTAMLVGYGQNGFSEEAVRIFSDMQRNG-IKPDD  371

Query  3392  VATAtvlgvcgtlgllklGENLHCLALKHGFLSDVVVGNAVISMYAKCGELDNAVKAFEL  3213
                 +V+  C  L  L+ G   H  AL  G +S + V NA++++Y KCG +D++ + F  
Sbjct  372   YTLGSVISSCANLASLEEGAQFHGQALVLGLISSITVANALVTLYGKCGSIDDSHRLFNE  431

Query  3212  MSSRDLCSWNSLLAGYVLHRRGDEALDTWSRMERLGIVPDSFTCLHILSAYRHTTKNVVN  3033
             M  +D  SW +L++ Y    + ++ ++ + RM   G+ PD  T + +LSA   +   +V 
Sbjct  432   MHIKDEVSWTALVSSYAQFGKANQTIELFERMLADGLQPDGVTFIGVLSAC--SRAGLVE  489

Query  3032  RCQSFFFSMQSAYGVLPASDHYACLVSVLGYWGLLEEAEETINTMPFEPKSSVWRALLDS  2853
             +   +F SM   YG+ P  DHY C++ +L   G LEEA++ IN MPF P +  W  LL S
Sbjct  490   KGYKYFDSMVQEYGIDPIPDHYTCMIDLLSRAGRLEEAKDFINKMPFHPDAIGWATLLSS  549

Query  2852  CIMHLNSSIGKRVIKKILSMEPQDPSTFILKSNLYSASGRWQCSELVRAEMKEKGFQKIP  2673
             C +H N  IGK     +  +EPQ+P+ +IL S++Y++ G+W     +R  M++KG +K P
Sbjct  550   CRLHGNMEIGKWAADSLFELEPQNPAGYILLSSIYASKGKWDDVAKLRRGMRDKGVRKEP  609

Query  2672  GQSWVICQHKFHSFFARDTSHLQSKDIYSALDILILECMKAGYVPDTSYVLHEVEEYQKK  2493
             G SW+  ++K + F A D S+  S+ IY+ L+ L  + ++ GYVPD S VLH+V+E +K+
Sbjct  610   GFSWIKYKNKVYIFSADDRSNPYSEQIYTELEKLNSKMIEEGYVPDMSSVLHDVDEAEKR  669

Query  2492  DFLFHHSAKLALTYGLLMTKHGKPVRVMKNILLCGDCHTFFKSASIVTKREIHVRDTSGF  2313
               L HHS KLA+ +GL+    G P+RV+KN+ +CGDCH   K  S + +REI VRD   F
Sbjct  670   KLLSHHSEKLAIAFGLIFIPPGLPIRVVKNLRVCGDCHNATKFISKIVQREILVRDAVRF  729

Query  2312  HCFLNGKCSCNDRW  2271
             H F +G CSC D W
Sbjct  730   HLFRDGTCSCGDFW  743


 Score =   148 bits (373),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/322 (27%), Positives = 159/322 (49%), Gaps = 39/322 (12%)
 Frame = -3

Query  4433  LRGSGIEPNEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGS  4254
             +R  G+  ++++F ++LTAC     LE G Q HA +I+  Y D+ +V +AL+ +YSK GS
Sbjct  261   MRSEGLAIDQFTFGSVLTACGGLVALEQGKQSHAYIIRTDYKDNIFVGSALVDMYSKSGS  320

Query  4253  LDFVIELFDNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQRNDCLRIDYITLSTLLN  4074
             + +   +F  +  ++I SW  M+ G  +      A  +F+DMQRN     DY TL ++++
Sbjct  321   IKYAEAVFKRMAHKNIVSWTAMLVGYGQNGFSEEAVRIFSDMQRNGIKPDDY-TLGSVIS  379

Query  4073  ACSE-CFMRRGQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLVRDAFT  3897
             +C+    +  G + H  AL +G  S+++V NAL+  Y +CGSI     LF  M ++D  +
Sbjct  380   SCANLASLEEGAQFHGQALVLGLISSITVANALVTLYGKCGSIDDSHRLFNEMHIKDEVS  439

Query  3896  WNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRMIKESI  3717
             W  ++++Y + G  +   ELF+                               RM+ + +
Sbjct  440   WTALVSSYAQFGKANQTIELFE-------------------------------RMLADGL  468

Query  3716  EFSDFTLTSIANAC---GLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMCTRCGRMED  3546
             +    T   + +AC   GL+   K  K     + + G +P       ++D+ +R GR+E+
Sbjct  469   QPDGVTFIGVLSACSRAGLV--EKGYKYFDSMVQEYGIDPIPDHYTCMIDLLSRAGRLEE  526

Query  3545  AEKIFHRMPLGHGRLVALTSML  3480
             A+   ++MP  H   +   ++L
Sbjct  527   AKDFINKMPF-HPDAIGWATLL  547


 Score = 37.0 bits (84),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 36/64 (56%), Gaps = 6/64 (9%)
 Frame = -2

Query  4602  EEDTRLSNALISAYLKLGLVDYALAVF------DSLSSPAIISGFAKINREIEAVELFYE  4441
             E +  + N +I+  L+ G+++ + ++F      DS+S   +I+G  +    IEA+E+F  
Sbjct  201   ERNVVMYNTMITGLLRCGMLEESKSLFLEMPERDSISWTTMITGLTQNGLAIEALEVFRR  260

Query  4440  MRLE  4429
             MR E
Sbjct  261   MRSE  264


 Score =   148 bits (373),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 135/508 (27%), Positives = 249/508 (49%), Gaps = 62/508 (12%)
 Frame = -3

Query  4088  STLLNACSECFMRR-GQELHAHALRIGYESNLSVNNALIKFYTRCGSIKSVMALFERMLV  3912
             S+LL  C E   +R  Q+LH   ++     +  ++N LI  Y+R G +      F+++  
Sbjct  9     SSLLKFCWETNNQRLAQKLHCLIIKTQRHPDTFLSNNLIAAYSRFGLLIYARRTFDQIPH  68

Query  3911  RDAFTWNEMITAYMESGLVDLAKELFDHLPEKNAVLYNAVLAGFCQNGEGLKAMAFFYRM  3732
              + F+WN +++AY +SG +   +E+F  +P ++ V +N V++G+   G G +++  +  M
Sbjct  69    PNLFSWNGILSAYSKSGHLSEMEEIFKRIPSRDGVSWNCVISGYANCGLGEESVNMYKLM  128

Query  3731  IKES------IEFSDFTLTSIANACGLLMERKSSKQIHGFILKSGCEPNDCIEAALLDMC  3570
             +K+       I FS   + S   +   L      +QIHG I+K G E    + + L+DM 
Sbjct  129   LKDGPANLNRITFSTMLILSSTQSAIYL-----GRQIHGQIMKFGFESYVFVGSPLVDMY  183

Query  3569  TRCGRMEDAEKIFHRMP--------------LGHGRL---------------VALTSMLR  3477
             T+ G + DA+++F  M               L  G L               ++ T+M+ 
Sbjct  184   TKAGLIYDAKRVFEEMSERNVVMYNTMITGLLRCGMLEESKSLFLEMPERDSISWTTMIT  243

Query  3476  GYAQNGQPENAISLFFETQLEGLVVVDEVATAtvlgvcgtlgllklGENLHCLALKHGFL  3297
             G  QNG    A+ +F   + EGL  +D+    +VL  CG L  L+ G+  H   ++  + 
Sbjct  244   GLTQNGLAIEALEVFRRMRSEGL-AIDQFTFGSVLTACGGLVALEQGKQSHAYIIRTDYK  302

Query  3296  SDVVVGNAVISMYAKCGELDNAVKAFELMSSRDLCSWNSLLAGYVLHRRGDEALDTWSRM  3117
              ++ VG+A++ MY+K G +  A   F+ M+ +++ SW ++L GY  +   +EA+  +S M
Sbjct  303   DNIFVGSALVDMYSKSGSIKYAEAVFKRMAHKNIVSWTAMLVGYGQNGFSEEAVRIFSDM  362

Query  3116  ERLGIVPDSFTCLHILSAYRHTTKNVVNRCQSFFFSMQS-AYGVLPASDHYACLVSVLGY  2940
             +R GI PD +T   ++S    +  N+ +  +   F  Q+   G++ +      LV++ G 
Sbjct  363   QRNGIKPDDYTLGSVIS----SCANLASLEEGAQFHGQALVLGLISSITVANALVTLYGK  418

Query  2939  WGLLEEAEETINTMPFEPKSSVWRALLDSCIMHLNSSIGKRVIKKILS--MEPQDPSTFI  2766
              G ++++    N M  + + S W AL+ S      ++    + +++L+  ++P D  TFI
Sbjct  419   CGSIDDSHRLFNEMHIKDEVS-WTALVSSYAQFGKANQTIELFERMLADGLQP-DGVTFI  476

Query  2765  LKSNLYSASGRWQCSELVRAEMKEKGFQ  2682
                 + SA     CS   RA + EKG++
Sbjct  477   ---GVLSA-----CS---RAGLVEKGYK  493


 Score =   134 bits (337),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/365 (25%), Positives = 165/365 (45%), Gaps = 64/365 (18%)
 Frame = -3

Query  4409  NEYSFVALLTACIRSQNLELGFQVHALMIKLGYLDSTYVVNALMGLYSKCGSLDFVIELF  4230
             N  +F  +L        + LG Q+H  ++K G+    +V + L+ +Y+K G +     +F
Sbjct  137   NRITFSTMLILSSTQSAIYLGRQIHGQIMKFGFESYVFVGSPLVDMYTKAGLIYDAKRVF  196

Query  4229  DNLPKRDIASWNTMISGMVKESMFTRAFELFNDMQ-------------------------  4125
             + + +R++  +NTMI+G+++  M   +  LF +M                          
Sbjct  197   EEMSERNVVMYNTMITGLLRCGMLEESKSLFLEMPERDSISWTTMITGLTQNGLAIEALE  256

Query  4124  -----RNDCLRIDYITLSTLLNACSECF-MRRGQELHAHALRIGYESNLSVNNALIKFYT  3963
                  R++ L ID  T  ++L AC     + +G++ HA+ +R  Y+ N+ V +AL+