BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25964_g1_i5 len=309 path=[5222:0-208 5431:209-308]

Length=309
                                                                      Score     E

gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              48.1    4e-04   



>gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Erythranthe 
guttata]
Length=727

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  178  VVDITSLKSIRLYGCSKSVISSAKCIQEEQQEYGNNTFAVDI  303
            V  I +L+ I +Y C+ SV+SSAK IQEEQQ YGN+   V I
Sbjct  661  VGGIPTLQMIEIYSCAHSVVSSAKRIQEEQQSYGNDDLEVRI  702



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513816688404