BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25956_g3_i10 len=647 path=[23804:0-110 31184:111-111 23915:112-431
31248:432-433 26508:434-646]

Length=647
                                                                      Score     E

ref|XP_009594666.1|  PREDICTED: uncharacterized protein LOC104091...    142   2e-36   
ref|XP_009773989.1|  PREDICTED: uncharacterized protein LOC104224106    141   4e-36   
ref|XP_009788702.1|  PREDICTED: uncharacterized protein LOC104236...    137   1e-34   
ref|XP_011081930.1|  PREDICTED: uncharacterized protein LOC105164...    129   1e-31   
gb|EYU29234.1|  hypothetical protein MIMGU_mgv1a018882mg                120   2e-28   
ref|XP_010254324.1|  PREDICTED: uncharacterized protein LOC104595328    114   3e-26   
ref|XP_010249984.1|  PREDICTED: uncharacterized protein LOC104592353    111   3e-25   
ref|XP_008365180.1|  PREDICTED: uncharacterized protein LOC103428...    110   4e-25   
ref|XP_011019768.1|  PREDICTED: uncharacterized protein LOC105122...    109   1e-24   
ref|XP_003550833.1|  PREDICTED: uncharacterized protein LOC100795...    106   1e-23   
ref|XP_002285023.2|  PREDICTED: uncharacterized protein LOC100267997    106   2e-23   Vitis vinifera
gb|KHN15124.1|  hypothetical protein glysoja_011742                     105   2e-23   
ref|XP_002309608.1|  agenet domain-containing family protein            105   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006450493.1|  hypothetical protein CICLE_v10010442mg             104   6e-23   
gb|KHN27405.1|  hypothetical protein glysoja_022114                     104   6e-23   
ref|XP_006483315.1|  PREDICTED: uncharacterized protein LOC102609...    104   9e-23   
ref|XP_007013344.1|  RNA binding protein, putative isoform 4            103   2e-22   
ref|XP_007223007.1|  hypothetical protein PRUPE_ppa006810mg             102   3e-22   
ref|XP_010047789.1|  PREDICTED: uncharacterized protein LOC104436647    102   6e-22   
ref|XP_011026479.1|  PREDICTED: uncharacterized protein LOC105127...    100   2e-21   
ref|XP_011019769.1|  PREDICTED: uncharacterized protein LOC105122...    100   2e-21   
ref|XP_009610690.1|  PREDICTED: uncharacterized protein LOC104104335  98.6    3e-21   
ref|XP_006451000.1|  hypothetical protein CICLE_v10008447mg           99.8    4e-21   
gb|KDO80339.1|  hypothetical protein CISIN_1g012860mg                 99.8    4e-21   
ref|XP_006345863.1|  PREDICTED: uncharacterized protein LOC102579...  99.8    4e-21   
ref|XP_006345862.1|  PREDICTED: uncharacterized protein LOC102579...  99.8    5e-21   
gb|KDO80331.1|  hypothetical protein CISIN_1g012860mg                 99.8    5e-21   
emb|CDP03409.1|  unnamed protein product                              99.0    8e-21   
ref|XP_002524440.1|  RNA binding protein, putative                    98.2    1e-20   Ricinus communis
ref|XP_009334812.1|  PREDICTED: uncharacterized protein LOC103927597  97.4    2e-20   
gb|KDP32359.1|  hypothetical protein JCGZ_13284                       97.4    2e-20   
emb|CDP04795.1|  unnamed protein product                              97.4    2e-20   
ref|XP_004287366.1|  PREDICTED: uncharacterized protein LOC101310150  97.1    2e-20   
ref|XP_009623057.1|  PREDICTED: uncharacterized protein LOC104114...  97.4    3e-20   
ref|XP_006578160.1|  PREDICTED: uncharacterized protein LOC100812...  97.1    3e-20   
ref|XP_002324847.2|  hypothetical protein POPTR_0018s01440g           97.4    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007202060.1|  hypothetical protein PRUPE_ppa006804mg           96.3    5e-20   
ref|XP_009775015.1|  PREDICTED: uncharacterized protein LOC104224...  96.3    5e-20   
gb|KEH32112.1|  plant tudor-like RNA-binding protein                  96.3    5e-20   
gb|EYU21950.1|  hypothetical protein MIMGU_mgv1a019248mg              95.1    6e-20   
ref|XP_008802277.1|  PREDICTED: uncharacterized protein LOC103716...  96.3    6e-20   
gb|KDP33621.1|  hypothetical protein JCGZ_07192                       98.6    8e-20   
gb|EPS73371.1|  hypothetical protein M569_01385                       93.2    8e-20   
ref|XP_008337334.1|  PREDICTED: uncharacterized protein LOC103400461  95.5    1e-19   
ref|XP_008242720.1|  PREDICTED: uncharacterized protein LOC103341019  95.5    1e-19   
ref|XP_004240187.1|  PREDICTED: uncharacterized protein LOC101262...  95.9    1e-19   
ref|XP_003609252.1|  RNA binding protein                              95.5    2e-19   
ref|XP_010321342.1|  PREDICTED: uncharacterized protein LOC101262...  95.5    2e-19   
ref|XP_010648620.1|  PREDICTED: uncharacterized protein LOC100264...  93.6    3e-19   
ref|XP_010648619.1|  PREDICTED: uncharacterized protein LOC100264...  93.6    4e-19   
ref|XP_010688085.1|  PREDICTED: uncharacterized protein LOC104902102  94.0    4e-19   
ref|XP_010087113.1|  hypothetical protein L484_012544                 92.4    9e-19   
ref|XP_002282448.1|  PREDICTED: uncharacterized protein LOC100264...  93.6    9e-19   Vitis vinifera
emb|CBI21002.3|  unnamed protein product                              91.3    3e-18   
ref|XP_010935823.1|  PREDICTED: uncharacterized protein LOC105055623  91.3    4e-18   
ref|XP_006475784.1|  PREDICTED: uncharacterized protein LOC102613557  91.3    5e-18   
ref|XP_010906704.1|  PREDICTED: uncharacterized protein LOC105033...  89.4    2e-17   
ref|XP_004501301.1|  PREDICTED: uncharacterized protein LOC101515...  89.7    2e-17   
ref|XP_010906703.1|  PREDICTED: uncharacterized protein LOC105033...  89.4    2e-17   
ref|XP_008385858.1|  PREDICTED: uncharacterized protein LOC103448...  88.6    3e-17   
ref|XP_009348186.1|  PREDICTED: uncharacterized protein LOC103939799  88.6    3e-17   
ref|XP_006361441.1|  PREDICTED: uncharacterized protein LOC102595...  87.8    6e-17   
ref|XP_010048245.1|  PREDICTED: uncharacterized protein LOC104437066  86.3    7e-17   
ref|XP_006361440.1|  PREDICTED: uncharacterized protein LOC102595...  87.8    8e-17   
gb|KDP21387.1|  hypothetical protein JCGZ_21858                       87.0    1e-16   
ref|XP_004249991.2|  PREDICTED: uncharacterized protein LOC101249876  87.4    1e-16   
ref|XP_010923509.1|  PREDICTED: uncharacterized protein LOC105046579  87.0    1e-16   
ref|XP_008785020.1|  PREDICTED: uncharacterized protein LOC103703...  87.0    1e-16   
ref|XP_008775033.1|  PREDICTED: uncharacterized protein LOC103695472  87.0    1e-16   
ref|XP_008786060.1|  PREDICTED: uncharacterized protein LOC103704...  86.7    1e-16   
dbj|BAJ53247.1|  JHL25H03.10                                          86.3    2e-16   
ref|XP_008457864.1|  PREDICTED: uncharacterized protein LOC103497445  86.3    2e-16   
gb|KGN60658.1|  hypothetical protein Csa_2G006040                     86.3    2e-16   
ref|XP_002520966.1|  RNA binding protein, putative                    85.5    3e-16   Ricinus communis
ref|XP_010049963.1|  PREDICTED: uncharacterized protein LOC104438...  85.9    3e-16   
ref|XP_010546572.1|  PREDICTED: uncharacterized protein LOC104818...  85.1    5e-16   
ref|XP_010526204.1|  PREDICTED: uncharacterized protein LOC104803...  85.1    5e-16   
ref|XP_010546575.1|  PREDICTED: uncharacterized protein LOC104818...  85.1    5e-16   
ref|XP_010535876.1|  PREDICTED: uncharacterized protein LOC104811043  84.7    7e-16   
ref|XP_004139421.1|  PREDICTED: uncharacterized protein LOC101208549  85.9    7e-16   
gb|KGN65299.1|  hypothetical protein Csa_1G305720                     84.7    8e-16   
gb|KHG19300.1|  Protein EMSY                                          84.3    9e-16   
ref|XP_010279295.1|  PREDICTED: uncharacterized protein LOC104613259  84.3    1e-15   
ref|NP_001172846.1|  Os02g0204500                                     80.5    1e-15   
ref|XP_010919219.1|  PREDICTED: uncharacterized protein LOC105043...  84.3    1e-15   
gb|KHG04820.1|  Protein EMSY                                          84.0    1e-15   
ref|XP_007137045.1|  hypothetical protein PHAVU_009G095200g           83.6    2e-15   
gb|EAY84934.1|  hypothetical protein OsI_06301                        83.6    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009403411.1|  PREDICTED: uncharacterized protein LOC103986974  83.2    3e-15   
ref|XP_006657502.1|  PREDICTED: uncharacterized protein LOC102722972  82.0    5e-15   
gb|KDO68598.1|  hypothetical protein CISIN_1g016251mg                 82.0    5e-15   
ref|XP_006443952.1|  hypothetical protein CICLE_v10020513mg           82.0    5e-15   
ref|XP_006479620.1|  PREDICTED: uncharacterized protein LOC102613...  82.4    6e-15   
ref|XP_004291486.1|  PREDICTED: uncharacterized protein LOC101295485  81.6    8e-15   
ref|XP_007050457.1|  Uncharacterized protein TCM_004243               79.3    1e-14   
ref|XP_002517573.1|  hypothetical protein RCOM_0897890                82.0    1e-14   Ricinus communis
dbj|BAD16008.1|  putative agenet domain-containing protein            81.3    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008785237.1|  PREDICTED: uncharacterized protein LOC103703...  80.9    2e-14   
ref|XP_006647055.1|  PREDICTED: uncharacterized protein LOC102712...  80.9    2e-14   
ref|XP_010918089.1|  PREDICTED: uncharacterized protein LOC105042529  80.5    2e-14   
ref|XP_006841934.1|  hypothetical protein AMTR_s00042p00209060        79.0    3e-14   
ref|XP_002307616.1|  hypothetical protein POPTR_0005s23770g           79.7    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008785245.1|  PREDICTED: uncharacterized protein LOC103703...  80.1    4e-14   
gb|EMT01979.1|  hypothetical protein F775_26969                       79.7    4e-14   
ref|XP_011032621.1|  PREDICTED: uncharacterized protein LOC105131379  79.7    4e-14   
ref|XP_008790188.1|  PREDICTED: uncharacterized protein LOC103707469  78.2    4e-14   
ref|XP_008785228.1|  PREDICTED: uncharacterized protein LOC103703...  80.1    4e-14   
ref|XP_003603435.1|  RNA binding protein                              79.7    5e-14   
gb|AFK44933.1|  unknown                                               79.7    6e-14   
gb|EMS47996.1|  hypothetical protein TRIUR3_08002                     79.3    6e-14   
ref|XP_009108874.1|  PREDICTED: uncharacterized protein LOC103834...  78.6    6e-14   
emb|CDY23326.1|  BnaA08g12200D                                        78.6    6e-14   
ref|XP_003603436.1|  ABC transporter G family member                  79.7    6e-14   
ref|XP_004981435.1|  PREDICTED: uncharacterized protein LOC101770262  77.4    9e-14   
ref|XP_010447388.1|  PREDICTED: uncharacterized protein LOC104730...  78.6    1e-13   
ref|XP_009408508.1|  PREDICTED: uncharacterized protein LOC103990932  78.6    1e-13   
ref|XP_010274252.1|  PREDICTED: uncharacterized protein LOC104609591  78.2    1e-13   
emb|CDY39887.1|  BnaC03g67300D                                        77.8    1e-13   
ref|XP_002300812.2|  hypothetical protein POPTR_0002s04760g           77.4    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010918992.1|  PREDICTED: uncharacterized protein LOC105043...  77.8    2e-13   
ref|XP_009781192.1|  PREDICTED: uncharacterized protein LOC104230153  76.6    3e-13   
ref|NP_194970.1|  tudor-like RNA-binding protein                      77.0    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670685.1|  PREDICTED: uncharacterized protein LOC104887...  77.0    4e-13   
ref|XP_009381265.1|  PREDICTED: uncharacterized protein LOC103969...  77.0    4e-13   
ref|XP_004292586.1|  PREDICTED: uncharacterized protein LOC101309999  75.5    1e-12   
gb|KHG21627.1|  Calpain-A                                             74.3    2e-12   
tpg|DAA42551.1|  TPA: hypothetical protein ZEAMMB73_650642            69.7    3e-12   
ref|NP_001148982.1|  RNA binding protein                              73.2    3e-12   Zea mays [maize]
ref|XP_008676588.1|  PREDICTED: RNA binding protein isoform X1        73.2    3e-12   
ref|XP_006838905.1|  hypothetical protein AMTR_s00002p00269570        73.2    6e-12   
gb|EAZ02975.1|  hypothetical protein OsI_25115                        72.8    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006284938.1|  hypothetical protein CARUB_v10006237mg           72.8    1e-11   
dbj|BAC83034.1|  hypothetical protein                                 72.4    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009108875.1|  PREDICTED: uncharacterized protein LOC103834...  71.2    2e-11   
ref|XP_002869273.1|  agenet domain-containing protein                 71.6    2e-11   
ref|XP_010447385.1|  PREDICTED: uncharacterized protein LOC104730...  71.6    3e-11   
ref|XP_010447389.1|  PREDICTED: uncharacterized protein LOC104730...  71.6    3e-11   
ref|XP_008797067.1|  PREDICTED: uncharacterized protein LOC103712348  69.7    3e-11   
ref|XP_008461067.1|  PREDICTED: uncharacterized protein LOC103499...  71.2    3e-11   
ref|XP_002298112.2|  hypothetical protein POPTR_0001s17380g           71.2    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009407652.1|  PREDICTED: uncharacterized protein LOC103990...  70.9    6e-11   
ref|XP_009108876.1|  PREDICTED: uncharacterized protein LOC103834...  69.7    8e-11   
ref|XP_011035647.1|  PREDICTED: uncharacterized protein LOC105133...  70.1    9e-11   
gb|KGN45306.1|  hypothetical protein Csa_7G433350                     69.7    9e-11   
ref|NP_001131239.1|  uncharacterized protein LOC100192548             69.3    9e-11   Zea mays [maize]
ref|XP_004135835.1|  PREDICTED: uncharacterized protein LOC101203701  69.7    1e-10   
ref|XP_009381129.1|  PREDICTED: uncharacterized protein LOC103969...  70.1    1e-10   
ref|XP_010454295.1|  PREDICTED: uncharacterized protein LOC104736072  69.3    1e-10   
ref|NP_974660.1|  tudor-like RNA-binding protein                      69.7    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412489.1|  PREDICTED: uncharacterized protein LOC103993966  69.3    1e-10   
ref|XP_006650728.1|  PREDICTED: uncharacterized protein LOC102711242  68.6    2e-10   
gb|KDO80332.1|  hypothetical protein CISIN_1g012860mg                 68.9    2e-10   
ref|XP_010432715.1|  PREDICTED: uncharacterized protein LOC104716934  68.9    2e-10   
ref|XP_002463742.1|  hypothetical protein SORBIDRAFT_01g005220        68.2    2e-10   Sorghum bicolor [broomcorn]
ref|XP_008219898.1|  PREDICTED: uncharacterized protein LOC103320063  68.6    2e-10   
ref|XP_006400568.1|  hypothetical protein EUTSA_v10014035mg           68.2    3e-10   
ref|XP_006289073.1|  hypothetical protein CARUB_v10002476mg           67.8    4e-10   
ref|XP_002873978.1|  agenet domain-containing protein                 67.4    4e-10   
ref|XP_009420672.1|  PREDICTED: uncharacterized protein LOC104000372  68.2    4e-10   
gb|EAY92179.1|  hypothetical protein OsI_13894                        68.6    5e-10   Oryza sativa Indica Group [Indian rice]
tpg|DAA59766.1|  TPA: hypothetical protein ZEAMMB73_643406            63.2    5e-10   
dbj|BAK08257.1|  predicted protein                                    66.6    7e-10   
ref|XP_009125972.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.4    8e-10   
emb|CDX75245.1|  BnaA01g04570D                                        67.0    9e-10   
ref|XP_010493095.1|  PREDICTED: uncharacterized protein LOC104770379  66.6    9e-10   
emb|CDX68847.1|  BnaC01g06060D                                        66.6    1e-09   
ref|XP_010670878.1|  PREDICTED: uncharacterized protein LOC104887824  65.5    1e-09   
gb|ACN27195.1|  unknown                                               62.0    1e-09   Zea mays [maize]
ref|NP_001051555.1|  Os03g0796400                                     65.9    1e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CDY69656.1|  BnaA03g56010D                                        65.9    2e-09   
ref|XP_009126409.1|  PREDICTED: uncharacterized protein LOC103851318  65.9    2e-09   
gb|ADE77810.1|  unknown                                               63.5    2e-09   
ref|XP_004955643.1|  PREDICTED: uncharacterized protein LOC101762...  65.9    2e-09   
ref|XP_006412474.1|  hypothetical protein EUTSA_v10025566mg           65.5    3e-09   
ref|XP_010667644.1|  PREDICTED: uncharacterized protein LOC104884659  64.3    3e-09   
ref|XP_010670102.1|  PREDICTED: uncharacterized protein LOC104887204  64.7    3e-09   
ref|XP_002878866.1|  hypothetical protein ARALYDRAFT_344161           65.1    3e-09   
ref|XP_010670861.1|  PREDICTED: uncharacterized protein LOC104887807  64.3    4e-09   
ref|XP_008656642.1|  PREDICTED: uncharacterized protein LOC103636063  65.1    4e-09   
gb|ADE77621.1|  unknown                                               64.7    4e-09   
ref|XP_010228418.1|  PREDICTED: uncharacterized protein LOC100837...  64.3    4e-09   
ref|XP_010228411.1|  PREDICTED: uncharacterized protein LOC100837...  64.3    4e-09   
emb|CDY42325.1|  BnaC02g09310D                                        64.3    5e-09   
ref|XP_011026079.1|  PREDICTED: uncharacterized protein LOC105126795  64.7    5e-09   
ref|NP_197503.1|  plant Tudor-like RNA-binding protein                64.3    6e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44959.1|  BnaA02g04640D                                        64.3    6e-09   
ref|NP_001145054.1|  uncharacterized protein LOC100278243             62.8    7e-09   Zea mays [maize]
ref|XP_010942488.1|  PREDICTED: uncharacterized protein LOC105060469  63.9    7e-09   
ref|XP_008651255.1|  PREDICTED: uncharacterized protein LOC100278...  62.4    9e-09   
ref|XP_008651258.1|  PREDICTED: uncharacterized protein LOC100278...  62.4    9e-09   
gb|EAY74934.1|  hypothetical protein OsI_02828                        64.3    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010942486.1|  PREDICTED: uncharacterized protein LOC105060465  63.2    1e-08   
dbj|BAD61500.1|  hypothetical protein                                 63.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54973.1|  hypothetical protein OsJ_02576                        63.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010437909.1|  PREDICTED: uncharacterized protein LOC104721...  62.4    3e-08   
ref|XP_006294433.1|  hypothetical protein CARUB_v10023448mg           62.4    4e-08   
ref|XP_008461071.1|  PREDICTED: uncharacterized protein LOC103499772  60.5    4e-08   
ref|XP_006392332.1|  hypothetical protein EUTSA_v10023523mg           61.6    7e-08   
ref|XP_010472563.1|  PREDICTED: uncharacterized protein LOC104752...  61.6    7e-08   
gb|AFW83227.1|  hypothetical protein ZEAMMB73_750073                  60.8    7e-08   
ref|XP_010423760.1|  PREDICTED: uncharacterized protein LOC104708...  61.2    7e-08   
ref|XP_010670872.1|  PREDICTED: uncharacterized protein LOC104887818  60.5    1e-07   
emb|CDX70905.1|  BnaC03g09890D                                        60.8    1e-07   
emb|CDY35351.1|  BnaA04g14960D                                        60.5    1e-07   
ref|XP_004136079.1|  PREDICTED: uncharacterized protein LOC101221277  59.7    1e-07   
gb|EMT23141.1|  hypothetical protein F775_02552                       59.7    3e-07   
ref|XP_010417324.1|  PREDICTED: uncharacterized protein LOC104703...  59.3    4e-07   
emb|CDX76748.1|  BnaC08g33340D                                        58.9    4e-07   
ref|XP_010472558.1|  PREDICTED: uncharacterized protein LOC104752...  59.3    4e-07   
ref|XP_009413910.1|  PREDICTED: uncharacterized protein LOC103995118  58.9    4e-07   
ref|XP_010472562.1|  PREDICTED: uncharacterized protein LOC104752...  58.9    5e-07   
ref|XP_010472559.1|  PREDICTED: uncharacterized protein LOC104752...  58.9    5e-07   
ref|XP_010233454.1|  PREDICTED: uncharacterized protein LOC104583298  58.9    5e-07   
ref|XP_008385872.1|  PREDICTED: uncharacterized protein LOC103448...  58.5    7e-07   
ref|NP_001132464.1|  hypothetical protein                             57.8    1e-06   Zea mays [maize]
ref|XP_010911315.1|  PREDICTED: uncharacterized protein LOC105037337  56.2    3e-06   
emb|CDM81154.1|  unnamed protein product                              55.8    5e-06   
dbj|BAD32839.1|  agenet domain-containing protein-like                55.5    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458148.1|  hypothetical protein SORBIDRAFT_03g027680        55.5    8e-06   Sorghum bicolor [broomcorn]
ref|XP_004969142.1|  PREDICTED: uncharacterized protein LOC101756780  54.7    1e-05   
ref|XP_009376121.1|  PREDICTED: uncharacterized protein LOC103964...  54.3    2e-05   
ref|XP_009376118.1|  PREDICTED: uncharacterized protein LOC103964...  54.3    2e-05   
ref|XP_009376120.1|  PREDICTED: uncharacterized protein LOC103964...  54.3    2e-05   
ref|XP_009376122.1|  PREDICTED: uncharacterized protein LOC103964...  53.9    2e-05   
ref|XP_008465006.1|  PREDICTED: uncharacterized protein LOC103502...  54.3    2e-05   
ref|XP_008649109.1|  PREDICTED: uncharacterized protein LOC103629...  53.9    2e-05   
gb|EEC80923.1|  hypothetical protein OsI_23601                        53.5    4e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_008658132.1|  PREDICTED: hypothetical protein isoform X3       53.1    4e-05   
ref|XP_009407886.1|  PREDICTED: uncharacterized protein LOC103990...  53.1    5e-05   
ref|XP_007203122.1|  hypothetical protein PRUPE_ppa024006mg           51.6    5e-05   
ref|XP_009407885.1|  PREDICTED: uncharacterized protein LOC103990...  53.1    5e-05   
ref|XP_009407887.1|  PREDICTED: uncharacterized protein LOC103990...  53.1    5e-05   
ref|XP_008658131.1|  PREDICTED: hypothetical protein isoform X2       52.4    7e-05   
ref|XP_008244157.1|  PREDICTED: uncharacterized protein LOC103342...  52.4    9e-05   
ref|XP_008244158.1|  PREDICTED: uncharacterized protein LOC103342...  52.0    9e-05   
gb|KHG07775.1|  Protein EMSY                                          52.0    1e-04   
ref|XP_008244156.1|  PREDICTED: uncharacterized protein LOC103342...  52.0    1e-04   
ref|XP_009396314.1|  PREDICTED: uncharacterized protein LOC103981...  52.0    1e-04   
ref|XP_010913906.1|  PREDICTED: uncharacterized protein LOC105039...  52.0    1e-04   
ref|XP_009396315.1|  PREDICTED: uncharacterized protein LOC103981...  52.0    1e-04   
ref|XP_004497901.1|  PREDICTED: uncharacterized protein LOC101491037  51.6    1e-04   
ref|XP_007145678.1|  hypothetical protein PHAVU_007G259000g           51.6    1e-04   
ref|XP_010913907.1|  PREDICTED: uncharacterized protein LOC105039...  51.6    1e-04   
gb|EEE65974.1|  hypothetical protein OsJ_21886                        52.0    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391876.1|  PREDICTED: uncharacterized protein LOC103977...  51.6    1e-04   
ref|XP_010913908.1|  PREDICTED: uncharacterized protein LOC105039...  51.6    2e-04   
ref|XP_006373760.1|  hypothetical protein POPTR_0016s04800g           51.6    2e-04   
ref|XP_011004823.1|  PREDICTED: uncharacterized protein LOC105111214  51.6    2e-04   
ref|XP_009391875.1|  PREDICTED: uncharacterized protein LOC103977...  51.6    2e-04   
ref|XP_008808092.1|  PREDICTED: uncharacterized protein LOC103720257  51.6    2e-04   
ref|XP_007145677.1|  hypothetical protein PHAVU_007G259000g           51.6    2e-04   
ref|XP_009391874.1|  PREDICTED: uncharacterized protein LOC103977...  51.6    2e-04   
ref|XP_006373759.1|  hypothetical protein POPTR_0016s04800g           51.2    2e-04   
ref|XP_011033349.1|  PREDICTED: uncharacterized protein LOC105131866  51.2    2e-04   
ref|XP_006381903.1|  hypothetical protein POPTR_0006s20580g           51.2    2e-04   
ref|XP_008375132.1|  PREDICTED: uncharacterized protein LOC103438...  51.2    2e-04   
ref|XP_008805474.1|  PREDICTED: uncharacterized protein LOC103718...  50.8    2e-04   
ref|XP_009356283.1|  PREDICTED: uncharacterized protein LOC103947...  50.8    2e-04   
gb|KEH41697.1|  emsy amine-terminus (ENT)/plant tudor-like domain...  50.8    3e-04   
ref|XP_008805473.1|  PREDICTED: uncharacterized protein LOC103718...  50.8    3e-04   
ref|XP_009354681.1|  PREDICTED: uncharacterized protein LOC103945...  50.8    3e-04   
ref|XP_009353072.1|  PREDICTED: uncharacterized protein LOC103944...  50.8    3e-04   
ref|XP_008649113.1|  PREDICTED: uncharacterized protein LOC103629...  50.8    3e-04   
ref|XP_008375133.1|  PREDICTED: uncharacterized protein LOC103438...  50.8    3e-04   
ref|XP_009356282.1|  PREDICTED: uncharacterized protein LOC103947...  50.8    3e-04   
ref|XP_008375134.1|  PREDICTED: uncharacterized protein LOC103438...  50.8    3e-04   
ref|XP_009353071.1|  PREDICTED: uncharacterized protein LOC103944...  50.8    3e-04   
ref|XP_006575234.1|  PREDICTED: uncharacterized protein LOC100789...  50.8    3e-04   
ref|XP_009388305.1|  PREDICTED: uncharacterized protein LOC103975...  50.8    3e-04   
ref|XP_009354683.1|  PREDICTED: uncharacterized protein LOC103945...  50.8    3e-04   
ref|XP_009356284.1|  PREDICTED: uncharacterized protein LOC103947...  50.8    3e-04   
ref|XP_010265883.1|  PREDICTED: uncharacterized protein LOC104603...  50.8    3e-04   
ref|XP_006575233.1|  PREDICTED: uncharacterized protein LOC100789...  50.8    3e-04   
ref|XP_010265886.1|  PREDICTED: uncharacterized protein LOC104603...  50.4    3e-04   
ref|XP_006844134.1|  hypothetical protein AMTR_s00006p00258600        50.4    3e-04   
ref|XP_010265885.1|  PREDICTED: uncharacterized protein LOC104603...  50.8    3e-04   
ref|XP_009388303.1|  PREDICTED: uncharacterized protein LOC103975...  50.4    3e-04   
emb|CDP10126.1|  unnamed protein product                              50.4    3e-04   
ref|XP_010265884.1|  PREDICTED: uncharacterized protein LOC104603...  50.8    3e-04   
ref|XP_008649112.1|  PREDICTED: uncharacterized protein LOC103629...  50.4    3e-04   
gb|KCW48094.1|  hypothetical protein EUGRSUZ_K01833                   50.4    3e-04   
ref|XP_008649114.1|  PREDICTED: uncharacterized protein LOC103629...  50.4    3e-04   
ref|XP_010036481.1|  PREDICTED: uncharacterized protein LOC104425...  50.4    4e-04   
gb|KCW48092.1|  hypothetical protein EUGRSUZ_K01833                   50.4    4e-04   
ref|XP_006587214.1|  PREDICTED: uncharacterized protein LOC100781...  50.4    4e-04   
ref|XP_011078834.1|  PREDICTED: uncharacterized protein LOC105162...  50.4    4e-04   
gb|KHN35210.1|  hypothetical protein glysoja_041327                   50.4    4e-04   
gb|KCW48091.1|  hypothetical protein EUGRSUZ_K01833                   50.4    4e-04   
gb|ACN27251.1|  unknown                                               48.9    4e-04   
ref|XP_010036482.1|  PREDICTED: uncharacterized protein LOC104425...  50.4    4e-04   
ref|XP_010943524.1|  PREDICTED: uncharacterized protein LOC105061...  50.4    4e-04   
ref|XP_011078835.1|  PREDICTED: uncharacterized protein LOC105162...  50.4    4e-04   
ref|XP_010943523.1|  PREDICTED: uncharacterized protein LOC105061...  50.4    4e-04   
ref|XP_011078836.1|  PREDICTED: uncharacterized protein LOC105162...  50.1    4e-04   
ref|XP_008778127.1|  PREDICTED: uncharacterized protein LOC103697955  50.1    4e-04   
ref|XP_009797984.1|  PREDICTED: uncharacterized protein LOC104244...  50.1    5e-04   
ref|XP_003533923.1|  PREDICTED: uncharacterized protein LOC100781...  50.1    5e-04   
ref|XP_009797985.1|  PREDICTED: uncharacterized protein LOC104244...  50.1    5e-04   
ref|XP_006298127.1|  hypothetical protein CARUB_v10014171mg           50.1    5e-04   
ref|XP_010464969.1|  PREDICTED: uncharacterized protein LOC104745433  50.1    5e-04   
ref|XP_009348970.1|  PREDICTED: uncharacterized protein LOC103940...  50.1    5e-04   
ref|XP_009348972.1|  PREDICTED: uncharacterized protein LOC103940...  50.1    5e-04   
ref|XP_009348971.1|  PREDICTED: uncharacterized protein LOC103940...  50.1    5e-04   
ref|XP_009631006.1|  PREDICTED: uncharacterized protein LOC104120...  50.1    5e-04   
ref|XP_010486905.1|  PREDICTED: uncharacterized protein LOC104764978  50.1    5e-04   
ref|NP_187821.1|  Emsy N Terminus and plant Tudor-like domain-con...  50.1    5e-04   
ref|XP_009631014.1|  PREDICTED: uncharacterized protein LOC104120...  50.1    5e-04   
ref|XP_009349200.1|  PREDICTED: uncharacterized protein LOC103940751  50.1    5e-04   
ref|XP_006575236.1|  PREDICTED: uncharacterized protein LOC100789...  50.1    5e-04   
ref|XP_010498621.1|  PREDICTED: uncharacterized protein LOC104776...  49.7    5e-04   
gb|EYU20698.1|  hypothetical protein MIMGU_mgv1a007748mg              50.1    5e-04   
ref|XP_010653901.1|  PREDICTED: uncharacterized protein LOC100253...  50.1    5e-04   
ref|XP_007028971.1|  Emsy N Terminus/ plant Tudor-like domains-co...  49.7    6e-04   
gb|KDP25135.1|  hypothetical protein JCGZ_22670                       49.7    6e-04   
ref|XP_009348974.1|  PREDICTED: uncharacterized protein LOC103940...  49.7    6e-04   
ref|XP_007028972.1|  Emsy N Terminus/ plant Tudor-like domains-co...  49.7    6e-04   
ref|XP_002275316.3|  PREDICTED: uncharacterized protein LOC100253...  49.7    6e-04   
ref|XP_010102551.1|  hypothetical protein L484_018022                 49.7    6e-04   
ref|XP_010265887.1|  PREDICTED: uncharacterized protein LOC104603...  49.7    7e-04   
ref|XP_007028973.1|  Emsy N Terminus/ plant Tudor-like domains-co...  49.7    7e-04   
ref|XP_006344033.1|  PREDICTED: uncharacterized protein LOC102591...  49.7    7e-04   
ref|XP_010265888.1|  PREDICTED: uncharacterized protein LOC104603...  49.7    7e-04   
ref|XP_004234821.1|  PREDICTED: uncharacterized protein LOC101267...  49.7    7e-04   
ref|XP_006344035.1|  PREDICTED: uncharacterized protein LOC102591...  49.7    7e-04   
ref|XP_008358869.1|  PREDICTED: DNA mismatch repair protein MSH6-...  48.9    7e-04   
ref|XP_006344034.1|  PREDICTED: uncharacterized protein LOC102591...  49.7    8e-04   
ref|NP_001030677.1|  Emsy N Terminus and plant Tudor-like domain-...  49.3    8e-04   
ref|XP_009365040.1|  PREDICTED: uncharacterized protein LOC103954...  49.3    8e-04   
gb|AFW65221.1|  hypothetical protein ZEAMMB73_151925                  48.9    8e-04   
ref|XP_010317904.1|  PREDICTED: uncharacterized protein LOC101267...  49.3    0.001   
ref|XP_008350162.1|  PREDICTED: uncharacterized protein LOC103413476  49.3    0.001   
ref|XP_010317905.1|  PREDICTED: uncharacterized protein LOC101267...  49.3    0.001   
ref|XP_009365041.1|  PREDICTED: uncharacterized protein LOC103954...  49.3    0.001   
ref|XP_002884886.1|  hypothetical protein ARALYDRAFT_478573           49.3    0.001   
ref|XP_011037910.1|  PREDICTED: uncharacterized protein LOC105134...  49.3    0.001   
ref|XP_004306498.1|  PREDICTED: uncharacterized protein LOC101309664  49.3    0.001   
ref|XP_007142622.1|  hypothetical protein PHAVU_007G003300g           49.3    0.001   



>ref|XP_009594666.1| PREDICTED: uncharacterized protein LOC104091099 isoform X1 [Nicotiana 
tomentosiformis]
Length=414

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 112/170 (66%), Gaps = 4/170 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PR TLGEKY+H S N+ SNG NE+  E L GV       + E SDSDS +       V++
Sbjct  242  PRGTLGEKYVHTSINIRSNGFNELEREDLGGVIGFFPRRSLEPSDSDSDACSVDSCSVTS  301

Query  466  SPINPGLHFVP-VHRKVSDALVSDAESVC---PLGDEDSSHSPLPDDGLGETIHRLELRA  299
               N  L  +P V R+VS  L SDAESVC   P G ++ SH+  P++ L  ++HRLEL A
Sbjct  302  ERPNELLGHLPRVSRRVSGGLCSDAESVCGSGPSGYKEKSHNNPPEEELATSVHRLELHA  361

Query  298  YRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASY  149
            Y CTL ALYA GPLTWEKEALLT+L   LHIS+DEHL ELK+LIS+K SY
Sbjct  362  YHCTLVALYAYGPLTWEKEALLTDLRITLHISNDEHLMELKNLISSKGSY  411



>ref|XP_009773989.1| PREDICTED: uncharacterized protein LOC104224106 [Nicotiana sylvestris]
Length=414

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 112/170 (66%), Gaps = 4/170 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PR TLGEKY+H S N+ SNG NE+  E L GV   S   + E SDSDS +       V++
Sbjct  242  PRGTLGEKYVHTSINIRSNGFNELEREDLGGVIGFSPRRSLEPSDSDSDACSVGSCSVTS  301

Query  466  SPINPGL-HFVPVHRKVSDALVSDAESVC---PLGDEDSSHSPLPDDGLGETIHRLELRA  299
               N  L H + V  +VS  L SDAES C   P G ++ SH+  P++ L  ++HRLEL A
Sbjct  302  ERPNELLGHLLRVSHRVSGCLCSDAESFCGSGPSGYKEKSHNNPPEEELATSVHRLELHA  361

Query  298  YRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASY  149
            YRCTL ALYA GPLTWEKEALLT+L   LHIS+DEHL ELK+LIS+K SY
Sbjct  362  YRCTLVALYAYGPLTWEKEALLTDLRITLHISNDEHLMELKNLISSKGSY  411



>ref|XP_009788702.1| PREDICTED: uncharacterized protein LOC104236480 isoform X1 [Nicotiana 
sylvestris]
Length=414

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PR TLGEKY+H S N+ SNG NE+  E L GV       + E SDSDS +       V++
Sbjct  242  PRGTLGEKYVHTSVNIRSNGFNELEREDLGGVIGFFPRRSLELSDSDSDACSVGSCSVTS  301

Query  466  SPINPGLHFVP-VHRKVSDALVSDAESVC---PLGDEDSSHSPLPDDGLGETIHRLELRA  299
               N  L  +P + R+VS  L SDAESVC   P G ++ S +  P + L  ++HRLEL A
Sbjct  302  ERPNELLGHLPQISRRVSGGLCSDAESVCGSGPSGYKEKSLNNPPGEELATSVHRLELHA  361

Query  298  YRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASY  149
            Y CTL ALYA GPLTWEKEALLT+L   LHIS+DEHL ELK+LIS+K SY
Sbjct  362  YHCTLVALYAYGPLTWEKEALLTDLRITLHISNDEHLMELKNLISSKGSY  411



>ref|XP_011081930.1| PREDICTED: uncharacterized protein LOC105164835 isoform X1 [Sesamum 
indicum]
Length=417

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 104/169 (62%), Gaps = 1/169 (1%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgsc-svvs  470
            PRE LG K MHAS  +IS G N M   KL GV   S    SE + S++ +      SV  
Sbjct  248  PREVLGGKNMHASIKIISTGYNHMERAKLSGVLGSSGIRNSELNSSETDACSVGSCSVTD  307

Query  469  nSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRC  290
             SP N  + F+ +  + +D   SDAES    G E  S S  P + +  +I RLELRAYR 
Sbjct  308  QSPNNFFVPFISLACQDTDTFCSDAESCYGSGSERKSSSLPPKEEVAVSIRRLELRAYRR  367

Query  289  TLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASYDT  143
            TL+ALYASGPL+WE+EALLTNL   LHIS+DEHL ELKHLISAK + + 
Sbjct  368  TLEALYASGPLSWEQEALLTNLRIMLHISNDEHLMELKHLISAKTAINV  416



>gb|EYU29234.1| hypothetical protein MIMGU_mgv1a018882mg [Erythranthe guttata]
Length=350

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 103/165 (62%), Gaps = 4/165 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            P+E  GEK MH SFN+ISNG N     K + VF    ++    +     SSVGSCSV + 
Sbjct  187  PKEISGEKNMHTSFNIISNGYNRTKMGKQNDVF--GVASPELSTCDSDASSVGSCSVTNR  244

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCT  287
             P N     +P+H + +D L SDAES    G     +   P + L  TI +LEL AYR T
Sbjct  245  IPENYCSQSIPMHCQDTDNLCSDAES--SYGKRKKIYFFPPKEELEATIRKLELHAYRST  302

Query  286  LQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            L+ALYASGPL+WE+EA+LTNL   L+IS+DEHL+ELKHLIS K +
Sbjct  303  LEALYASGPLSWEQEAMLTNLRIMLYISNDEHLKELKHLISTKTA  347



>ref|XP_010254324.1| PREDICTED: uncharacterized protein LOC104595328 [Nelumbo nucifera]
Length=404

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 106/166 (64%), Gaps = 16/166 (10%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLH---GVFCHsssttsefsdsdsgssvgscsv  476
            PRE +GEKYMHASFN  + G +EM  +K      + C  + + +     +S  SVGSCSV
Sbjct  246  PREMMGEKYMHASFNNRTTGFSEMDLKKGKPSGNIRCFIAGSLASNDVENSTCSVGSCSV  305

Query  475  vsnSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAY  296
             S S      H +P H        +DAES C  G +  S  P+ ++ L   +H+LEL AY
Sbjct  306  NSIS-----FHELPNHS-------TDAESSCGWGYDKKSSLPMKEE-LTAEVHKLELHAY  352

Query  295  RCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            RCT++ALYASGPL+WE+EALLTNL   LHIS+DEHLREL++L+SA+
Sbjct  353  RCTVEALYASGPLSWEQEALLTNLRLMLHISNDEHLRELRNLVSAE  398



>ref|XP_010249984.1| PREDICTED: uncharacterized protein LOC104592353 [Nelumbo nucifera]
Length=421

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 16/175 (9%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLH---GVFCHsssttsefsdsdsgssvgscsv  476
            P+E +GEKYMHASFN  + G +EM  +K     GV C    +        S  SVGSCS 
Sbjct  251  PQELMGEKYMHASFNNRTTGFSEMELQKGKQNGGVKCFLQRSLESNDAESSACSVGSCSA  310

Query  475  vsnSPINPGLHFVPVHRKVSD------ALVSDAESVCPLGDEDSSHSPLPDDGLGETIHR  314
             S SP      +   H+  +D      +   DA+S C  G E     P+ ++   E +H+
Sbjct  311  NSISP------YTLYHQSFTDPSEDRESHSGDAQSSCGWGYEKKYSLPMKEEMTAE-VHK  363

Query  313  LELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASY  149
            LEL AYRCT++ALYASG L+WE+EALLTNL   LHIS+DEHL+EL+ L+S++A++
Sbjct  364  LELHAYRCTMEALYASGSLSWEQEALLTNLRLMLHISNDEHLKELRSLVSSEANF  418



>ref|XP_008365180.1| PREDICTED: uncharacterized protein LOC103428840 isoform X1 [Malus 
domestica]
Length=394

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 104/169 (62%), Gaps = 3/169 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASF-NVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvs  470
            PRE LGEKYMHASF N  + GC E   EKL+GV       +SEF+DS++ +       V 
Sbjct  225  PRENLGEKYMHASFMNCCTTGCFEKEREKLNGVISCFVERSSEFNDSNNDACSVGSCSVI  284

Query  469  nSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYR  293
            +S  N     +    + +D L SDAE+ C   D   + S PL +D +   IHRLEL AYR
Sbjct  285  SSSSNKLSGHLSGTSQDADTLSSDAETFCCREDXQENFSRPLKED-VAAGIHRLELNAYR  343

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASYD  146
              L A++ASG L+WE+EALLTNL   LHIS+DEHL E+++L+S   +++
Sbjct  344  SILVAMHASGSLSWEQEALLTNLRISLHISNDEHLMEVRNLLSPGTNFN  392



>ref|XP_011019768.1| PREDICTED: uncharacterized protein LOC105122390 isoform X1 [Populus 
euphratica]
Length=414

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PRE LGE YMHAS N  + G  EM     + V      +           S+GSCSV S+
Sbjct  246  PRECLGEIYMHASSNNQTIGSCEMQRGTPNYVVDSCGRSLEPNDSDSDACSIGSCSVTSD  305

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGD-EDSSHSPLPDDGLGETIHRLELRAYRC  290
            SP     H V  +  V+D L SDAES    GD E++   PL +D +   + RLEL AYRC
Sbjct  306  SPNRLFNHVVAGNSPVADTLSSDAESFYGHGDGEENCSFPLEED-VTARVRRLELHAYRC  364

Query  289  TLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            TL A YASGPL+WE+EALLTNL   L+IS+DEHL EL++LISA+ S
Sbjct  365  TLGAFYASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAETS  410



>ref|XP_003550833.1| PREDICTED: uncharacterized protein LOC100795963 isoform X1 [Glycine 
max]
Length=404

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D+  SDAESVC   DE+   SP   + L   IHRLEL AYRCT++AL+ASGPL+WE+EAL
Sbjct  313  DSSFSDAESVCQRSDEEGDCSPPTQEELAAEIHRLELHAYRCTIEALHASGPLSWEQEAL  372

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL EL++LIS++ S
Sbjct  373  MTNLRLSLHISNDEHLMELRNLISSENS  400



>ref|XP_002285023.2| PREDICTED: uncharacterized protein LOC100267997 [Vitis vinifera]
Length=415

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 95/167 (57%), Gaps = 3/167 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PRE LGE YMHASFN    G +EM  E+         S       +D+ S   S    S 
Sbjct  246  PREMLGENYMHASFNSRPTGYSEMDVERAKTNGAVGGSHAVSLGHNDADSVTCSVGSCSI  305

Query  466  SPINPG--LHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYR  293
            +  NP   LH        +D   SDAES C LG E+ +      + L   IHRLEL AYR
Sbjct  306  TSNNPYKLLHHFSTGPSENDD-CSDAESFCRLGYEEGNCLLPTKEELAAEIHRLELHAYR  364

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            CT++AL+ASGPL+WE+E L+TNL   LHIS+DEHL EL++L+SA  S
Sbjct  365  CTIEALHASGPLSWEQETLVTNLRLSLHISNDEHLMELRNLVSADIS  411



>gb|KHN15124.1| hypothetical protein glysoja_011742 [Glycine soja]
Length=404

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D+  SDAESVC   DE+   SP   + L   IHRLEL AYRCT++AL+ASGPL+WE+EAL
Sbjct  313  DSSFSDAESVCQRSDEEGDCSPPTQEELAAEIHRLELHAYRCTIEALHASGPLSWEQEAL  372

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LH+S+DEHL EL++LIS++ S
Sbjct  373  MTNLRLSLHVSNDEHLMELRNLISSENS  400



>ref|XP_002309608.1| agenet domain-containing family protein [Populus trichocarpa]
 gb|EEE93131.1| agenet domain-containing family protein [Populus trichocarpa]
Length=397

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 98/166 (59%), Gaps = 2/166 (1%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PRE LGE YMHAS N  + G  EM     + V      +           S+GSCSV S+
Sbjct  229  PRECLGEIYMHASSNNQTIGSYEMQRGTPNYVVDSCGRSLEPNDSDSDACSIGSCSVTSD  288

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGD-EDSSHSPLPDDGLGETIHRLELRAYRC  290
             P     H V  +   +D L SDAES    GD E++   PL +D +   + RLEL AYRC
Sbjct  289  CPNRLFNHVVAGNSPDADTLSSDAESFYGHGDGEENCSFPLEED-VTARVRRLELHAYRC  347

Query  289  TLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            TL A YASGPL+WE+EALLTNL   L+IS+DEHL EL++LISA+ S
Sbjct  348  TLGAFYASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAETS  393



>ref|XP_006450493.1| hypothetical protein CICLE_v10010442mg, partial [Citrus clementina]
 gb|ESR63733.1| hypothetical protein CICLE_v10010442mg, partial [Citrus clementina]
Length=406

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 100/164 (61%), Gaps = 3/164 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVF-CHsssttsefsdsdsgssvgscsvvs  470
            PRE+LGE  M+ S N  ++G  E    K + V  C    ++          SVGSCS++S
Sbjct  236  PRESLGETCMYTSSNYQTSGFYETERRKPYCVVECSYGRSSEASDSDSDICSVGSCSIIS  295

Query  469  nSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYR  293
            +S  +     +    K +D L SDAES    GDE+    PLP  + +   IHRLEL AYR
Sbjct  296  DSTSDLSSRLLAGCSKDADPLNSDAESFSCRGDEEEKM-PLPLGEDVAARIHRLELHAYR  354

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            CTL+ALYASGPL+WE+EALLTNL   LHI++DEHL EL++LIS 
Sbjct  355  CTLEALYASGPLSWEQEALLTNLRITLHITNDEHLMELRNLISG  398



>gb|KHN27405.1| hypothetical protein glysoja_022114 [Glycine soja]
Length=397

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D+  SDAESVC   DE+ + SP   + L   IHRLEL AY CT++AL+ASGPL+WE+EAL
Sbjct  306  DSSFSDAESVCQRSDEEGNCSPPTQEELAAEIHRLELHAYHCTIEALHASGPLSWEQEAL  365

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL EL++LIS++ S
Sbjct  366  MTNLRLSLHISNDEHLMELRNLISSENS  393



>ref|XP_006483315.1| PREDICTED: uncharacterized protein LOC102609023 isoform X1 [Citrus 
sinensis]
 ref|XP_006483316.1| PREDICTED: uncharacterized protein LOC102609023 isoform X2 [Citrus 
sinensis]
Length=461

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 100/164 (61%), Gaps = 3/164 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVF-CHsssttsefsdsdsgssvgscsvvs  470
            PRE+LGE  M+ S N  ++G  E    K + V  C    ++          SVGSCS++S
Sbjct  231  PRESLGETCMYTSSNYQTSGFYETERRKPYCVVECSYGRSSEASDSDSDICSVGSCSIIS  290

Query  469  nSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYR  293
            +S  +     +    K +D L SDAES    GDE+    PLP  + +   IHRLEL AYR
Sbjct  291  DSTSDLSSRLLAGCSKDADPLNSDAESFSCRGDEEEKM-PLPLGEDVAARIHRLELHAYR  349

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            CTL+ALYASGPL+WE+EALLTNL   LHI++DEHL EL++LIS 
Sbjct  350  CTLEALYASGPLSWEQEALLTNLRITLHITNDEHLMELRNLISG  393



>ref|XP_007013344.1| RNA binding protein, putative isoform 4 [Theobroma cacao]
 gb|EOY30963.1| RNA binding protein, putative isoform 4 [Theobroma cacao]
Length=381

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 98/165 (59%), Gaps = 4/165 (2%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLH---GVFCHsssttsefsdsdsgssvgscsv  476
            PR+ LGEKY+HAS +    G +E+  E+      V C+ +             SVGSCSV
Sbjct  211  PRDMLGEKYIHASIDN-RTGLSEVDAERRKPNGAVGCYIAEHLETNDTERVTCSVGSCSV  269

Query  475  vsnSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAY  296
             SN+     L       +  D   SDAES CP GDE  +      + L   IHR+EL AY
Sbjct  270  SSNNLYKLPLRVSAGPIEDVDGQCSDAESFCPRGDEVGNCLLPTKEELAAEIHRIELHAY  329

Query  295  RCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            RCT++AL+ASGPL+WE+EAL+TNL   LHIS+DEHL EL++LISA
Sbjct  330  RCTMEALHASGPLSWEQEALVTNLRLSLHISNDEHLMELRNLISA  374



>ref|XP_007223007.1| hypothetical protein PRUPE_ppa006810mg [Prunus persica]
 gb|EMJ24206.1| hypothetical protein PRUPE_ppa006810mg [Prunus persica]
Length=394

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PRE LGEKY+ ASF   + GC E   E+L+G    S   +SE  D DS +       V +
Sbjct  227  PRENLGEKYVQASFINRTTGCFEKEREELNGAISLSVERSSELDDCDSDACSVGSCSVIS  286

Query  466  SPINP-GLHFVPVHRKVSDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYR  293
            S  N    H +    + SD L SDA+S C  GD     S PL +D +   IHRLEL AY 
Sbjct  287  SNSNKFSSHNLAGTSQDSDTLSSDADSFC--GDAQEKFSVPLEED-VPAGIHRLELNAYH  343

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
             TL A++ASG LTWE+EALLTNL   LHIS+DEHL E+++LISA
Sbjct  344  STLVAMHASGSLTWEQEALLTNLRISLHISNDEHLIEVRNLISA  387



>ref|XP_010047789.1| PREDICTED: uncharacterized protein LOC104436647 [Eucalyptus grandis]
 ref|XP_010047790.1| PREDICTED: uncharacterized protein LOC104436647 [Eucalyptus grandis]
 gb|KCW79773.1| hypothetical protein EUGRSUZ_C01115 [Eucalyptus grandis]
Length=418

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  412  ALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALL  233
            A + DA+S C    E  S+ PLP + L + IH+LEL+AYRCT++AL+ASGPL+WE+EAL+
Sbjct  331  ACIGDAQSTCHGEHEGGSNLPLPKENLEDEIHKLELQAYRCTMEALHASGPLSWEQEALV  390

Query  232  TNLLTELHISDDEHLRELKHLIS  164
            TNL   LHIS+DEHL ELK L+S
Sbjct  391  TNLRISLHISNDEHLTELKKLVS  413



>ref|XP_011026479.1| PREDICTED: uncharacterized protein LOC105127067 isoform X1 [Populus 
euphratica]
Length=425

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 97/172 (56%), Gaps = 13/172 (8%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGV---FCHsssttsefsdsdsgssvgscsv  476
            PRE LGE YMHAS N  + G  EM     +     FC  SS +++           S + 
Sbjct  256  PRECLGEIYMHASSNNQTIGSCEMERRTPNNFVTSFCGRSSESNDSDSDACSVGSCSVNS  315

Query  475  vsnSPINPGLHF---VPVHRKVSDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLE  308
                  +P   F   V  +   +D L SDAES    GD++ + S PL +D +   IH LE
Sbjct  316  D-----SPNRLFNCVVAGNSPDADTLSSDAESFYGHGDKEENCSLPLGED-VRVRIHSLE  369

Query  307  LRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            L AYRCTL A YASGPL+WE+EALLTNL   L+IS+DEHL EL++LISA  S
Sbjct  370  LHAYRCTLGAFYASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAGTS  421



>ref|XP_011019769.1| PREDICTED: uncharacterized protein LOC105122390 isoform X2 [Populus 
euphratica]
Length=383

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  445  HFVPVHRKVSDALVSDAESVCPLGD-EDSSHSPLPDDGLGETIHRLELRAYRCTLQALYA  269
            H V  +  V+D L SDAES    GD E++   PL +D +   + RLEL AYRCTL A YA
Sbjct  282  HVVAGNSPVADTLSSDAESFYGHGDGEENCSFPLEED-VTARVRRLELHAYRCTLGAFYA  340

Query  268  SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            SGPL+WE+EALLTNL   L+IS+DEHL EL++LISA+ S
Sbjct  341  SGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAETS  379



>ref|XP_009610690.1| PREDICTED: uncharacterized protein LOC104104335 [Nicotiana tomentosiformis]
Length=273

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 91/165 (55%), Gaps = 20/165 (12%)
 Frame = -2

Query  637  TLGEKYMHASFNVISNGCNEMYEEKLH---GVFCHsssttsefsdsdsgssvgscsvvsn  467
            T  EKY+H S N++S+G   + + K     G F                +S  S   V +
Sbjct  105  TTDEKYVHNSLNIVSDGYCALRQTKRSDYVGYF--------------ITTSTESSDSVGS  150

Query  466  SPINPGLHF---VPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAY  296
              IN        V V+ + ++ L SDAES     D++  H     + +  +IH LEL AY
Sbjct  151  CSINDKFSNCSPVEVYCQGTELLCSDAESFRNSADKEERHPLSSPEKIAASIHSLELHAY  210

Query  295  RCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            RCTL+ALYASGPL+W++EALLTNL   LHIS+DEHL EL+ LISA
Sbjct  211  RCTLEALYASGPLSWDQEALLTNLRISLHISNDEHLAELRTLISA  255



>ref|XP_006451000.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
 ref|XP_006451002.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
 gb|ESR64240.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
 gb|ESR64242.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
Length=415

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -2

Query  418  SDALVSDAESVCPLG-DEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            S+   SDAES C L  DE + H P  +D L   IHRLEL AYRCT++AL+ASGPL+WE+E
Sbjct  323  SNGNFSDAESFCHLAYDEGNCHLPRKED-LAAEIHRLELHAYRCTMEALHASGPLSWEQE  381

Query  241  ALLTNLLTELHISDDEHLRELKHLISAKAS  152
            AL+TNL   LHIS+DEHL EL+ L+SA  S
Sbjct  382  ALVTNLRLSLHISNDEHLMELRSLVSADNS  411



>gb|KDO80339.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
 gb|KDO80340.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
Length=415

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -2

Query  418  SDALVSDAESVCPLG-DEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            S+   SDAES C L  DE + H P  +D L   IHRLEL AYRCT++AL+ASGPL+WE+E
Sbjct  323  SNGNFSDAESFCHLAYDEGNCHLPRKED-LAAEIHRLELHAYRCTMEALHASGPLSWEQE  381

Query  241  ALLTNLLTELHISDDEHLRELKHLISAKAS  152
            AL+TNL   LHIS+DEHL EL+ L+SA  S
Sbjct  382  ALVTNLRLSLHISNDEHLMELRSLVSADNS  411



>ref|XP_006345863.1| PREDICTED: uncharacterized protein LOC102579948 isoform X2 [Solanum 
tuberosum]
Length=434

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 94/161 (58%), Gaps = 12/161 (7%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsnSPIN  455
            + EKY+H S N +S+G   + + K  G   +  + ++E SD+ S  S           IN
Sbjct  243  MAEKYVHDSLNDVSDGYCALEQTKRSGSVGYFLTRSTESSDACSVGSC---------SIN  293

Query  454  PGLHFVP---VHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTL  284
                 +    V+ + ++ L SDAES     D++  HS      +  +IH LEL AYRCTL
Sbjct  294  EKFSNLSPEEVYCQGTELLCSDAESFYDSADKEERHSLSSPVKIAASIHSLELHAYRCTL  353

Query  283  QALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            +ALYASGPL+W++EALLTNL   LHIS+DEHL ELK LISA
Sbjct  354  EALYASGPLSWDQEALLTNLRISLHISNDEHLAELKTLISA  394



>ref|XP_006345862.1| PREDICTED: uncharacterized protein LOC102579948 isoform X1 [Solanum 
tuberosum]
Length=451

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 94/161 (58%), Gaps = 12/161 (7%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsnSPIN  455
            + EKY+H S N +S+G   + + K  G   +  + ++E SD+ S  S           IN
Sbjct  243  MAEKYVHDSLNDVSDGYCALEQTKRSGSVGYFLTRSTESSDACSVGSC---------SIN  293

Query  454  PGLHFVP---VHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTL  284
                 +    V+ + ++ L SDAES     D++  HS      +  +IH LEL AYRCTL
Sbjct  294  EKFSNLSPEEVYCQGTELLCSDAESFYDSADKEERHSLSSPVKIAASIHSLELHAYRCTL  353

Query  283  QALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            +ALYASGPL+W++EALLTNL   LHIS+DEHL ELK LISA
Sbjct  354  EALYASGPLSWDQEALLTNLRISLHISNDEHLAELKTLISA  394



>gb|KDO80331.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
Length=455

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -2

Query  418  SDALVSDAESVCPLG-DEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            S+   SDAES C L  DE + H P  +D L   IHRLEL AYRCT++AL+ASGPL+WE+E
Sbjct  363  SNGNFSDAESFCHLAYDEGNCHLPRKED-LAAEIHRLELHAYRCTMEALHASGPLSWEQE  421

Query  241  ALLTNLLTELHISDDEHLRELKHLISAKAS  152
            AL+TNL   LHIS+DEHL EL+ L+SA  S
Sbjct  422  ALVTNLRLSLHISNDEHLMELRSLVSADNS  451



>emb|CDP03409.1| unnamed protein product [Coffea canephora]
Length=413

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D   SDAESVCPL  E+ ++    ++ L   IHRLEL AYRCTL ALYA GPL+WE+E 
Sbjct  321  ADDHSSDAESVCPLNKEEDNYLQPSEEELAVEIHRLELHAYRCTLGALYALGPLSWEQET  380

Query  238  LLTNLLTELHISDDEHLRELKHLISA  161
            L+TNL   LHIS+DEHL EL++L S+
Sbjct  381  LMTNLRISLHISNDEHLMELRNLTSS  406



>ref|XP_002524440.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF37880.1| RNA binding protein, putative [Ricinus communis]
Length=383

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D   SDAES C  G E+ ++    ++ L   +HRLEL AYRCT++ALYASGP +WE+E +
Sbjct  292  DGNFSDAESFCHRGYEEGTNCFPTNEELAAEVHRLELHAYRCTMEALYASGPFSWEQEEM  351

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL E+++L+SA  S
Sbjct  352  VTNLRLSLHISNDEHLMEVRNLVSADNS  379



>ref|XP_009334812.1| PREDICTED: uncharacterized protein LOC103927597 [Pyrus x bretschneideri]
Length=401

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 90/157 (57%), Gaps = 2/157 (1%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVF-CHsssttsefsdsdsgssvgscsvvs  470
            PRE   E+YMH SF   + GC E   EKL+GV  C    ++          SVGSCSV+S
Sbjct  230  PRENPVEEYMHTSFINRTTGCVEKEREKLNGVISCFVERSSELNDSDSDACSVGSCSVIS  289

Query  469  nSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYR  293
            +S      H +    +  D L SDAES C   D     S PL +D     IHRLEL AYR
Sbjct  290  SSSNKLSGHNLSGTSQDVDTLSSDAESFCCCEDAQEKFSLPLKEDVAAGRIHRLELNAYR  349

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRE  182
             TL A++ASG L+WE+EALLTNL   LHIS+DEHL E
Sbjct  350  STLVAMHASGSLSWEQEALLTNLRISLHISNDEHLME  386



>gb|KDP32359.1| hypothetical protein JCGZ_13284 [Jatropha curcas]
Length=411

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTN  227
            SDAES C  G E+  H  LP  + L   IHRLEL AYRCT++ALYA+GPL+WE+EAL+TN
Sbjct  324  SDAESSCWWGYEEG-HISLPTKEELATEIHRLELHAYRCTMEALYAAGPLSWEQEALVTN  382

Query  226  LLTELHISDDEHLRELKHLISAKAS  152
            L   LHIS+DEHL E+++L+SA  S
Sbjct  383  LRLSLHISNDEHLMEVRNLVSADNS  407



>emb|CDP04795.1| unnamed protein product [Coffea canephora]
Length=417

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = -2

Query  424  KVSDALVSDAESVCPLGDEDSSHS-PLP-DDGLGETIHRLELRAYRCTLQALYASGPLTW  251
            +V+D++ SDAES C   D++ S S  LP ++ +  +IH LEL AYRCTL+AL+ASGPL+W
Sbjct  321  QVTDSVCSDAESFCGSTDKEESCSLSLPLEEEVATSIHNLELHAYRCTLEALHASGPLSW  380

Query  250  EKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            ++E LLTNL   LHIS+DEHL EL++L+S K 
Sbjct  381  DQETLLTNLRMMLHISNDEHLMELRNLLSGKT  412



>ref|XP_004287366.1| PREDICTED: uncharacterized protein LOC101310150 [Fragaria vesca 
subsp. vesca]
Length=386

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDG-LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            DAESVC LG E+  +S LP    L   IHRLEL+AYRCT++AL+ASGPL+WE+E L+TNL
Sbjct  300  DAESVCHLGYEEG-NSVLPTKKELAAEIHRLELQAYRCTIEALHASGPLSWEQEELVTNL  358

Query  223  LTELHISDDEHLRELKHLISA  161
               LHIS+DEHL EL++LISA
Sbjct  359  RLSLHISNDEHLMELRNLISA  379



>ref|XP_009623057.1| PREDICTED: uncharacterized protein LOC104114339 isoform X1 [Nicotiana 
tomentosiformis]
Length=402

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 2/93 (2%)
 Frame = -2

Query  433  VHRKVSDALVSDAESVCPLGD--EDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGP  260
            VH +V D L SDAES     +  E+ S     +D +  +IH LEL AYRCTL+ALYASGP
Sbjct  303  VHCQVPDLLCSDAESFQGSAEAHEEESCRLSSEDNVAASIHELELHAYRCTLEALYASGP  362

Query  259  LTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            L+W++EALLTNL   LHIS+DEHL EL+ LISA
Sbjct  363  LSWDQEALLTNLRIALHISNDEHLTELRTLISA  395



>ref|XP_006578160.1| PREDICTED: uncharacterized protein LOC100812171 isoform X6 [Glycine 
max]
Length=391

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 90/172 (52%), Gaps = 12/172 (7%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEE------KLHGVFCHsssttsefsdsdsgssvgs  485
            P+  +GEK MH SF   +NG N+ YE        +   F              S     S
Sbjct  226  PQNIMGEKCMHTSF---TNGTNQCYETGKVNPCNVSTHFFERIEEPDYSCSDLSSVGSCS  282

Query  484  csvvsnSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLEL  305
                +++  +      P   +  D L SDAES+  +GD D   S  P + + E IHRLEL
Sbjct  283  VISSNSNKFSSDTLAGPCQEE--DTLYSDAESL-DVGDVDKGGSTSPKEVVAEIIHRLEL  339

Query  304  RAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASY  149
             AY  TL+ LYASGPL+WE E LLTNL   LHIS+DEHL E+K+L+S+  ++
Sbjct  340  HAYHSTLEVLYASGPLSWEHEELLTNLRISLHISNDEHLMEIKNLVSSGQNF  391



>ref|XP_002324847.2| hypothetical protein POPTR_0018s01440g [Populus trichocarpa]
 gb|EEF03412.2| hypothetical protein POPTR_0018s01440g [Populus trichocarpa]
Length=425

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 97/169 (57%), Gaps = 7/169 (4%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PRE LGE YMH S N  + G  EM E +    F +S    S  S+     +    S   N
Sbjct  256  PRECLGEIYMHGSSNNQTIGSCEM-ERRTPNNFVNSFCGRSSESNDSDSDACSVGSCSVN  314

Query  466  SPINPGLHF---VPVHRKVSDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRA  299
            S  +P   F   V  +   +D L SDAES    GD++ + S PL +D +   IH LEL A
Sbjct  315  SD-SPDRLFNCVVAGNSPDADTLSSDAESFYGHGDKEENCSLPLGED-VTVRIHSLELHA  372

Query  298  YRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            YRCTL   YASGPL+WE+EALLTNL   L+IS+DEHL EL++LISA  S
Sbjct  373  YRCTLGVFYASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAGTS  421



>ref|XP_007202060.1| hypothetical protein PRUPE_ppa006804mg [Prunus persica]
 gb|EMJ03259.1| hypothetical protein PRUPE_ppa006804mg [Prunus persica]
Length=394

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D  +SDAES+C LG E+ +      + L   IHRLEL AYRCT+ AL+ASGPL+WE+E L
Sbjct  303  DDQLSDAESICQLGYEEGNSLLPAKEELAAEIHRLELHAYRCTIGALHASGPLSWEQEEL  362

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL EL++L+S   S
Sbjct  363  VTNLRLSLHISNDEHLMELRNLVSGDNS  390



>ref|XP_009775015.1| PREDICTED: uncharacterized protein LOC104224976 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 66/93 (71%), Gaps = 2/93 (2%)
 Frame = -2

Query  433  VHRKVSDALVSDAESVCPLGD--EDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGP  260
            +H +V + L SDAES     +  E+ S     +D +  +IH LEL AYRCTL+ALYASGP
Sbjct  303  IHCQVPNLLCSDAESFQGSAEAHEEESCRLSSEDNVAASIHELELHAYRCTLEALYASGP  362

Query  259  LTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            L+WE+EALLTNL   LHIS+DEHL EL+ LISA
Sbjct  363  LSWEQEALLTNLRIALHISNDEHLTELRTLISA  395



>gb|KEH32112.1| plant tudor-like RNA-binding protein [Medicago truncatula]
Length=403

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D+  SDAES C  G  +++ S      L   IHRLEL AYRCT++AL+ASGPL+WE+EAL
Sbjct  312  DSSYSDAESTCKRGYMEATCSRPTRKELAMKIHRLELHAYRCTIEALFASGPLSWEQEAL  371

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   L+IS+DEHL EL++LIS++ S
Sbjct  372  MTNLRLSLNISNDEHLTELRNLISSEHS  399



>gb|EYU21950.1| hypothetical protein MIMGU_mgv1a019248mg, partial [Erythranthe 
guttata]
Length=270

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = -2

Query  463  PINPGLHFVPVHRKVSDALVSDAESVCP------LGDEDSSHSPLPDDGLGETIHRLELR  302
            P NP +  VP   + S+ + SDAES  P        +  SS      + L  +I RLE++
Sbjct  158  PKNP-IPSVPFQWQESETVCSDAESCYPSEYERKRTERKSSEQKSRKEKLEASIRRLEVQ  216

Query  301  AYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            AYR TL+ALYASGPL+WE+EA+LTNL   LHIS+DEHL E+K LISAK +
Sbjct  217  AYRRTLKALYASGPLSWEQEAMLTNLRIMLHISNDEHLMEVKCLISAKTA  266



>ref|XP_008802277.1| PREDICTED: uncharacterized protein LOC103716167 isoform X1 [Phoenix 
dactylifera]
Length=398

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  421  VSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            + D+L  DA S CP      +H P+ +D L  +IH LEL AY+ T+QA YASGPL+WE+E
Sbjct  313  IPDSLFDDAMSSCPSKTGKKNH-PVSEDELAASIHELELHAYQSTVQAFYASGPLSWEQE  371

Query  241  ALLTNLLTELHISDDEHLRELKHLISA  161
            +LLTNL   LHIS++EHL +L+HL+SA
Sbjct  372  SLLTNLRLSLHISNEEHLHQLRHLLSA  398



>gb|KDP33621.1| hypothetical protein JCGZ_07192 [Jatropha curcas]
Length=865

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            DAL SDAES    GDE+   S    + +   IHRLEL AYRCTL+ALYASGPL WE+E L
Sbjct  774  DALSSDAESFHDCGDEEEKCSIPLGESVAIRIHRLELHAYRCTLEALYASGPLNWEQEVL  833

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            LTNL   L+IS+DEHL EL++LIS   S
Sbjct  834  LTNLRISLNISNDEHLLELRNLISTGTS  861



>gb|EPS73371.1| hypothetical protein M569_01385, partial [Genlisea aurea]
Length=173

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  346  PDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLI  167
            P+  L  +IH LEL AYR TL+ALY SGPLTW+ E LLTNL T LHIS+DEH+RELKHLI
Sbjct  102  PNRELEVSIHWLELDAYRSTLEALYVSGPLTWDLETLLTNLRTMLHISNDEHMRELKHLI  161

Query  166  SAKASY  149
            SAK SY
Sbjct  162  SAKKSY  167



>ref|XP_008337334.1| PREDICTED: uncharacterized protein LOC103400461 [Malus domestica]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D   SDAES+C LG E+        + L   IHRLEL AYRCT+ AL+ASGPL+WE+E L
Sbjct  302  DDQFSDAESICQLGYEEGISLLPAKEELAAEIHRLELHAYRCTIGALHASGPLSWEQEEL  361

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL EL++LIS   S
Sbjct  362  VTNLRLSLHISNDEHLMELRNLISGDTS  389



>ref|XP_008242720.1| PREDICTED: uncharacterized protein LOC103341019 [Prunus mume]
Length=392

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D   SDAES+C LG E+ +      + L   IHRLEL AYRCT+ AL+ASGPL+WE+E L
Sbjct  301  DDRSSDAESICQLGYEEGNSLLPAKEELAAEIHRLELHAYRCTIGALHASGPLSWEQEEL  360

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL EL++L+S   S
Sbjct  361  VTNLRLSLHISNDEHLMELRNLVSGDNS  388



>ref|XP_004240187.1| PREDICTED: uncharacterized protein LOC101262920 isoform X2 [Solanum 
lycopersicum]
Length=434

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  409  LVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLT  230
            L SDAES     D++  HS      +  +IH LEL AYRCTL+ALYASGPL+W++E+LLT
Sbjct  309  LCSDAESFHDSADKEERHSLSSPVKIAASIHSLELHAYRCTLEALYASGPLSWDQESLLT  368

Query  229  NLLTELHISDDEHLRELKHLISA  161
            NL   LHIS+DEHL ELK LISA
Sbjct  369  NLRISLHISNDEHLAELKTLISA  391



>ref|XP_003609252.1| RNA binding protein [Medicago truncatula]
Length=468

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D+  SDAES C  G  +++ S      L   IHRLEL AYRCT++AL+ASGPL+WE+EAL
Sbjct  294  DSSYSDAESTCKRGYMEATCSRPTRKELAMKIHRLELHAYRCTIEALFASGPLSWEQEAL  353

Query  235  LTNLLTELHISDDEHLRELKHLISAK  158
            +TNL   L+IS+DEHL EL++LIS++
Sbjct  354  MTNLRLSLNISNDEHLTELRNLISSE  379



>ref|XP_010321342.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321343.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321344.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321345.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321346.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
Length=463

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  412  ALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALL  233
             L SDAES     D++  HS      +  +IH LEL AYRCTL+ALYASGPL+W++E+LL
Sbjct  308  VLCSDAESFHDSADKEERHSLSSPVKIAASIHSLELHAYRCTLEALYASGPLSWDQESLL  367

Query  232  TNLLTELHISDDEHLRELKHLISA  161
            TNL   LHIS+DEHL ELK LISA
Sbjct  368  TNLRISLHISNDEHLAELKTLISA  391



>ref|XP_010648620.1| PREDICTED: uncharacterized protein LOC100264564 isoform X3 [Vitis 
vinifera]
 ref|XP_010648621.1| PREDICTED: uncharacterized protein LOC100264564 isoform X3 [Vitis 
vinifera]
 ref|XP_010648622.1| PREDICTED: uncharacterized protein LOC100264564 isoform X3 [Vitis 
vinifera]
Length=285

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 97/196 (49%), Gaps = 30/196 (15%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PR  LGEKYMHASFN  S    EM   K +GV C  + ++          SVGSCS+ +N
Sbjct  88   PRLNLGEKYMHASFNDRSTKYCEMERGKPNGVDCFLARSSESNDSDSMSCSVGSCSINNN  147

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPL---------------------------GDE  368
             P       +   R+ +D L SDAES                               GD 
Sbjct  148  GPNKFSSCILAHPRQDTDDLCSDAESFYHWGDEGDEEDEEDERDERDEGDEEDERYEGDV  207

Query  367  DSSHSPLP---DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDD  197
                   P   +  L  +IH LEL AYR TL AL+ASGPL+WE+  +LTNL   LHIS+D
Sbjct  208  RDEEEKCPISLEKELAASIHSLELHAYRRTLAALHASGPLSWEQSTMLTNLRCSLHISND  267

Query  196  EHLRELKHLISAKASY  149
            EHL ELK+LISA  ++
Sbjct  268  EHLMELKNLISAGINF  283



>ref|XP_010648619.1| PREDICTED: uncharacterized protein LOC100264564 isoform X2 [Vitis 
vinifera]
Length=375

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 97/196 (49%), Gaps = 30/196 (15%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PR  LGEKYMHASFN  S    EM   K +GV C  + ++          SVGSCS+ +N
Sbjct  178  PRLNLGEKYMHASFNDRSTKYCEMERGKPNGVDCFLARSSESNDSDSMSCSVGSCSINNN  237

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPL---------------------------GDE  368
             P       +   R+ +D L SDAES                               GD 
Sbjct  238  GPNKFSSCILAHPRQDTDDLCSDAESFYHWGDEGDEEDEEDERDERDEGDEEDERYEGDV  297

Query  367  DSSHSPLP---DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDD  197
                   P   +  L  +IH LEL AYR TL AL+ASGPL+WE+  +LTNL   LHIS+D
Sbjct  298  RDEEEKCPISLEKELAASIHSLELHAYRRTLAALHASGPLSWEQSTMLTNLRCSLHISND  357

Query  196  EHLRELKHLISAKASY  149
            EHL ELK+LISA  ++
Sbjct  358  EHLMELKNLISAGINF  373



>ref|XP_010688085.1| PREDICTED: uncharacterized protein LOC104902102 [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 96/166 (58%), Gaps = 3/166 (2%)
 Frame = -2

Query  643  RETLGEKYMHASFNVISNGCNEMY--EEKLHG-VFCHsssttsefsdsdsgssvgscsvv  473
            RE L EK MH SF     GC+E+    EK  G V C  S +     D+   SSV SCSV 
Sbjct  243  RELLHEKCMHRSFINRVTGCSELILEREKTDGAVGCSRSISLESDDDNSVSSSVASCSVY  302

Query  472  snSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYR  293
             N        F     + +D+  SDAES C L  E+ +        L E IHRLEL AYR
Sbjct  303  GNYSHKLHRIFATGPFEDNDSQHSDAESSCQLRPEERNSFLSAKKELSEEIHRLELHAYR  362

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            CT+ AL+ASGPL+WE+E LLTNL   LHIS DEHL+E+K+L+S++ 
Sbjct  363  CTIGALHASGPLSWEQELLLTNLRHSLHISIDEHLKEIKNLVSSRT  408



>ref|XP_010087113.1| hypothetical protein L484_012544 [Morus notabilis]
 gb|EXB26553.1| hypothetical protein L484_012544 [Morus notabilis]
Length=333

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDAES  P      +    P   L   IH LEL+AY+ T+QALYASGPL+WE+E+LLTNL
Sbjct  250  SDAESAFPTVSSKRNKVSSPGHKLEVDIHNLELQAYKSTVQALYASGPLSWEQESLLTNL  309

Query  223  LTELHISDDEHLRELKHLISAKA  155
               LHIS+DEHL +LKHL+SA+ 
Sbjct  310  RLSLHISNDEHLHQLKHLLSAQV  332



>ref|XP_002282448.1| PREDICTED: uncharacterized protein LOC100264564 isoform X1 [Vitis 
vinifera]
 ref|XP_010648618.1| PREDICTED: uncharacterized protein LOC100264564 isoform X1 [Vitis 
vinifera]
Length=440

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 97/196 (49%), Gaps = 30/196 (15%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PR  LGEKYMHASFN  S    EM   K +GV C  + ++          SVGSCS+ +N
Sbjct  243  PRLNLGEKYMHASFNDRSTKYCEMERGKPNGVDCFLARSSESNDSDSMSCSVGSCSINNN  302

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPL---------------------------GDE  368
             P       +   R+ +D L SDAES                               GD 
Sbjct  303  GPNKFSSCILAHPRQDTDDLCSDAESFYHWGDEGDEEDEEDERDERDEGDEEDERYEGDV  362

Query  367  DSSHSPLP---DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDD  197
                   P   +  L  +IH LEL AYR TL AL+ASGPL+WE+  +LTNL   LHIS+D
Sbjct  363  RDEEEKCPISLEKELAASIHSLELHAYRRTLAALHASGPLSWEQSTMLTNLRCSLHISND  422

Query  196  EHLRELKHLISAKASY  149
            EHL ELK+LISA  ++
Sbjct  423  EHLMELKNLISAGINF  438



>emb|CBI21002.3| unnamed protein product [Vitis vinifera]
Length=386

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 90/166 (54%), Gaps = 24/166 (14%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PR  LGEKYMHASFN  S    EM   K +GV C  + ++          SVGSCS+ +N
Sbjct  243  PRLNLGEKYMHASFNDRSTKYCEMERGKPNGVDCFLARSSESNDSDSMSCSVGSCSINNN  302

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCT  287
             P            K S  +++      P  D         DD    +IH LEL AYR T
Sbjct  303  GP-----------NKFSSCILAH-----PRQD--------TDDLCTASIHSLELHAYRRT  338

Query  286  LQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASY  149
            L AL+ASGPL+WE+  +LTNL   LHIS+DEHL ELK+LISA  ++
Sbjct  339  LAALHASGPLSWEQSTMLTNLRCSLHISNDEHLMELKNLISAGINF  384



>ref|XP_010935823.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935830.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935838.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935847.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935856.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
Length=398

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLL  221
            DA S CP      +H P  +D L   IH LEL AY+ T+QA YASGPL+WE+E+LLTNL 
Sbjct  320  DAMSSCPSRTGKKNH-PFSEDELAANIHELELHAYQSTVQAFYASGPLSWEQESLLTNLR  378

Query  220  TELHISDDEHLRELKHLISA  161
              LHIS++EHL +L+HL+SA
Sbjct  379  LSLHISNEEHLHQLRHLLSA  398



>ref|XP_006475784.1| PREDICTED: uncharacterized protein LOC102613557 [Citrus sinensis]
 gb|KDO80334.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
 gb|KDO80335.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
 gb|KDO80336.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
Length=416

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = -2

Query  418  SDALVSDAESVCPLG-DEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            S+   SDAES C L  DE + H P  +D L   IHRLEL AYRCT++AL+ASGPL+WE+E
Sbjct  323  SNGNFSDAESFCHLAYDEGNCHLPRKED-LAAEIHRLELHAYRCTMEALHASGPLSWEQE  381

Query  241  ALLTNLLTELHISDDEHLRE  182
            AL+TNL   LHIS+DEHL E
Sbjct  382  ALVTNLRLSLHISNDEHLME  401



>ref|XP_010906704.1| PREDICTED: uncharacterized protein LOC105033538 isoform X2 [Elaeis 
guineensis]
Length=401

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 94/167 (56%), Gaps = 8/167 (5%)
 Frame = -2

Query  646  PRETLGEKYMHASFN--VISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvv  473
            P + LGEK+MHA  N  V   G   M  +K H    +    +   +D++S SS       
Sbjct  239  PCKVLGEKHMHAFLNDKVSEMG---MDNQKPHAGGGYHFIESINPNDAESVSSSVGSCSP  295

Query  472  snSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYR  293
            SNS   P L+ V     V D    DAES C  G E + H+   ++ L   IHRLEL AY 
Sbjct  296  SNSSYRPFLYPVTSPTHVLDGNHDDAESPCASGRELTLHT---EEALEAEIHRLELHAYH  352

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
             TL AL ASGPL+WEKEAL+TNL   LHIS+DEH+ EL+HL SAK S
Sbjct  353  STLLALCASGPLSWEKEALITNLRIMLHISNDEHILELRHLPSAKIS  399



>ref|XP_004501301.1| PREDICTED: uncharacterized protein LOC101515344 isoform X1 [Cicer 
arietinum]
Length=423

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            +   SDAES+  + D D   + LP + + + IHRLEL AY CTL+A+YASGPL+WEKE L
Sbjct  336  ETCCSDAESL-DVEDVDEGCTILPKEVVTKRIHRLELNAYHCTLEAMYASGPLSWEKEEL  394

Query  235  LTNLLTELHISDDEHLRELKHLISAKASY  149
            LTNL   L+IS+DEHL  +K+L+S   ++
Sbjct  395  LTNLRISLNISNDEHLTGIKNLVSGGQNF  423



>ref|XP_010906703.1| PREDICTED: uncharacterized protein LOC105033538 isoform X1 [Elaeis 
guineensis]
Length=431

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 94/167 (56%), Gaps = 8/167 (5%)
 Frame = -2

Query  646  PRETLGEKYMHASFN--VISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvv  473
            P + LGEK+MHA  N  V   G   M  +K H    +    +   +D++S SS       
Sbjct  269  PCKVLGEKHMHAFLNDKVSEMG---MDNQKPHAGGGYHFIESINPNDAESVSSSVGSCSP  325

Query  472  snSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYR  293
            SNS   P L+ V     V D    DAES C  G E + H+   ++ L   IHRLEL AY 
Sbjct  326  SNSSYRPFLYPVTSPTHVLDGNHDDAESPCASGRELTLHT---EEALEAEIHRLELHAYH  382

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
             TL AL ASGPL+WEKEAL+TNL   LHIS+DEH+ EL+HL SAK S
Sbjct  383  STLLALCASGPLSWEKEALITNLRIMLHISNDEHILELRHLPSAKIS  429



>ref|XP_008385858.1| PREDICTED: uncharacterized protein LOC103448379 isoform X1 [Malus 
domestica]
 ref|XP_008385866.1| PREDICTED: uncharacterized protein LOC103448379 isoform X1 [Malus 
domestica]
Length=393

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D   SDAES   L  E+ +      + L + IHRLEL AYRCT+ AL+ASGPL+WE+E L
Sbjct  302  DDQFSDAESSFQLRYEEGNSLLPAKEELADEIHRLELHAYRCTIGALHASGPLSWEQEEL  361

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL EL++LIS   S
Sbjct  362  VTNLRLSLHISNDEHLMELRNLISGDTS  389



>ref|XP_009348186.1| PREDICTED: uncharacterized protein LOC103939799 [Pyrus x bretschneideri]
Length=393

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D   SDAES   L  E+ +      + L + IHRLEL AYRCT+ AL+ASGPL+WE+E L
Sbjct  302  DDQFSDAESSFQLRYEEGNSLLPAKEELADEIHRLELHAYRCTIGALHASGPLSWEQEEL  361

Query  235  LTNLLTELHISDDEHLRELKHLISAKAS  152
            +TNL   LHIS+DEHL EL++LIS   S
Sbjct  362  VTNLRLSLHISNDEHLMELRNLISGDTS  389



>ref|XP_006361441.1| PREDICTED: uncharacterized protein LOC102595390 isoform X2 [Solanum 
tuberosum]
Length=411

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 92/170 (54%), Gaps = 21/170 (12%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsnSPIN  455
            + EKY+ ASFN  S+G   +   K  G   +S +   E +DSDS +       +++   N
Sbjct  235  MDEKYVSASFNNWSDGYYGLNPAKRSGTNSYSPARIGESNDSDSDACSVGSCSINHESPN  294

Query  454  PGLHF-VPVHRKVSDALVSDAESV-----------CPLGDEDSSHSPLPDDGLGETIHRL  311
                F   VH +V D L SDAES            C L  E +         +   I  L
Sbjct  295  KISSFSAEVHCEVPDLLCSDAESFQSSAEEHEEESCRLSLEKN---------VAGNIRDL  345

Query  310  ELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            EL AYRCTL+ALYASGPL+WE+EALLTNL   LHIS+DEHL EL+ LIS+
Sbjct  346  ELHAYRCTLEALYASGPLSWEQEALLTNLRIALHISNDEHLTELRTLISS  395



>ref|XP_010048245.1| PREDICTED: uncharacterized protein LOC104437066 [Eucalyptus grandis]
 ref|XP_010048246.1| PREDICTED: uncharacterized protein LOC104437066 [Eucalyptus grandis]
 gb|KCW80447.1| hypothetical protein EUGRSUZ_C01790 [Eucalyptus grandis]
Length=239

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D L S AES     DE+     LP ++ +   +H LEL AYR  L ALYASGP++WE+E
Sbjct  146  ADTLCSSAESFQGRDDEEDVTFSLPHEEAVATRVHSLELHAYRSILVALYASGPMSWEQE  205

Query  241  ALLTNLLTELHISDDEHLRELKHLISAKAS  152
            ALLTNL   L+IS+DEHL EL++LIS++ S
Sbjct  206  ALLTNLRLSLNISNDEHLIELRNLISSRRS  235



>ref|XP_006361440.1| PREDICTED: uncharacterized protein LOC102595390 isoform X1 [Solanum 
tuberosum]
Length=434

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 98/185 (53%), Gaps = 26/185 (14%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsnSPIN  455
            + EKY+ ASFN  S+G   +   K  G   +S +   E +DSDS +       +++   N
Sbjct  235  MDEKYVSASFNNWSDGYYGLNPAKRSGTNSYSPARIGESNDSDSDACSVGSCSINHESPN  294

Query  454  PGLHF-VPVHRKVSDALVSDAESV-----------CPLGDEDSSHSPLPDDGLGETIHRL  311
                F   VH +V D L SDAES            C L  E +         +   I  L
Sbjct  295  KISSFSAEVHCEVPDLLCSDAESFQSSAEEHEEESCRLSLEKN---------VAGNIRDL  345

Query  310  ELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS--YDT*G  137
            EL AYRCTL+ALYASGPL+WE+EALLTNL   LHIS+DEHL EL+ LIS+     +D   
Sbjct  346  ELHAYRCTLEALYASGPLSWEQEALLTNLRIALHISNDEHLTELRTLISSGTGRHWD---  402

Query  136  SCLFC  122
            +C+ C
Sbjct  403  ACILC  407



>gb|KDP21387.1| hypothetical protein JCGZ_21858 [Jatropha curcas]
Length=385

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = -2

Query  421  VSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            VSD   SDAES  P    +   +P  +      IH LE  AYR T+QALYASGPL+WE+E
Sbjct  297  VSD--TSDAESSFPSSSVNERLTPYFEQKFEADIHELEFHAYRSTVQALYASGPLSWEQE  354

Query  241  ALLTNLLTELHISDDEHLRELKHLISAKA  155
            +LLTNL   L+ISD+EHL +L+HL+S + 
Sbjct  355  SLLTNLRLSLNISDEEHLLQLRHLLSTRV  383



>ref|XP_004249991.2| PREDICTED: uncharacterized protein LOC101249876 [Solanum lycopersicum]
Length=434

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 97/185 (52%), Gaps = 26/185 (14%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsnSPIN  455
            + EKY+ ASFN  S+G       K  G   +S +   E +DSDS +       +++   N
Sbjct  235  MDEKYVSASFNNWSDGYYGSNPAKRSGTNGYSPARIGESNDSDSDACSVGSCSINHESPN  294

Query  454  PGLHF-VPVHRKVSDALVSDAESV-----------CPLGDEDSSHSPLPDDGLGETIHRL  311
                F   VH +V D L SDAES            C +  E +         +   I  L
Sbjct  295  KISSFSAEVHCQVPDLLCSDAESFQSSAEEHEEESCRVSSEKN---------IAGNIRDL  345

Query  310  ELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS--YDT*G  137
            EL AYRCTL+ALYASGPL+WE+EALLTNL   LHIS+DEHL EL+ LIS+     +D   
Sbjct  346  ELHAYRCTLEALYASGPLSWEQEALLTNLRIALHISNDEHLTELRTLISSGTGRHWD---  402

Query  136  SCLFC  122
            +C+ C
Sbjct  403  ACILC  407



>ref|XP_010923509.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
 ref|XP_010923510.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
 ref|XP_010923511.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
 ref|XP_010923512.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
Length=403

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = -2

Query  427  RKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            R ++ +   DA S CP  + +  +  + +D L   +H LEL AY+ T++A YA GPL+WE
Sbjct  313  RDIASSFFGDAMSSCP-SEAEKKYRCVSEDELAANVHELELHAYQSTVKAFYALGPLSWE  371

Query  247  KEALLTNLLTELHISDDEHLRELKHLISAK  158
            +E+LLTNL   LHIS++EHL +L+HL+SA+
Sbjct  372  QESLLTNLRLALHISNEEHLHQLRHLLSAQ  401



>ref|XP_008785020.1| PREDICTED: uncharacterized protein LOC103703809 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008785021.1| PREDICTED: uncharacterized protein LOC103703809 isoform X1 [Phoenix 
dactylifera]
Length=408

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 92/167 (55%), Gaps = 8/167 (5%)
 Frame = -2

Query  646  PRETLGEKYMHASFN--VISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvv  473
            P + LGEK+MHA  N  V   G   M  +K H    +    + + +D++S SS       
Sbjct  239  PCQVLGEKHMHAFLNNKVCETG---MDNQKPHAGVGYHFIESIDPNDAESVSSSVGSCSP  295

Query  472  snSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYR  293
            SN P    L+ V       D+   DAES C  G E S H+   ++     IH LEL AYR
Sbjct  296  SNRPYRSFLYPVTSPTHDLDSNHDDAESPCASGTELSLHT---EEAHEAEIHHLELHAYR  352

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
             TL ALY+SGPL+WEKE LLTNL   L IS+DEH+ EL+HL SAK S
Sbjct  353  STLLALYSSGPLSWEKEVLLTNLRLMLRISNDEHILELRHLASAKTS  399



>ref|XP_008775033.1| PREDICTED: uncharacterized protein LOC103695472 [Phoenix dactylifera]
Length=410

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLL  221
            DA+S C LG + S H+      L E IH LEL AYR T+ ALYASGPL+WE+EAL+T+L 
Sbjct  318  DADSSCALGRDCSLHA---KKALEEEIHHLELHAYRSTMLALYASGPLSWEREALMTDLR  374

Query  220  TELHISDDEHLRELKHLIS  164
              LHIS+DEHL EL+HL S
Sbjct  375  LMLHISNDEHLLELRHLAS  393



>ref|XP_008786060.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786061.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786063.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786064.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
Length=400

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = -2

Query  427  RKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            R ++ +   DA S CP  + +  +  + +D L   IH LEL AY+ T++A YA GPL+WE
Sbjct  313  RDIASSFFDDAMSSCP-SEAEKKYRCVSEDELAANIHELELHAYQSTVKAFYALGPLSWE  371

Query  247  KEALLTNLLTELHISDDEHLRELKHLISA  161
            +E+LLTNL   LHIS++EHL +L+HL+SA
Sbjct  372  QESLLTNLRLSLHISNEEHLHQLRHLLSA  400



>dbj|BAJ53247.1| JHL25H03.10 [Jatropha curcas]
Length=399

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 88/165 (53%), Gaps = 2/165 (1%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            P E LGE ++H+S N+ +   + M  +++ G       ++      D  SSV S S +SN
Sbjct  230  PNELLGENHVHSSHNIPTAQFSRM--DEIRGTDSSLVESSLYLHTDDCASSVASSSSMSN  287

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCT  287
               N    F   H K  +   SDAES    G E    S  PD+  G   HR EL  Y C 
Sbjct  288  GGHNSAFRFSRQHSKNLEDYYSDAESSSGEGYEKEGCSLSPDEQSGVEFHRSELLKYFCA  347

Query  286  LQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            ++ LYASGPLTWE EA LTNL   LHISDDEHL  L++LI A ++
Sbjct  348  IEDLYASGPLTWEDEARLTNLRHMLHISDDEHLMVLRNLIPANST  392



>ref|XP_008457864.1| PREDICTED: uncharacterized protein LOC103497445 [Cucumis melo]
 ref|XP_008457872.1| PREDICTED: uncharacterized protein LOC103497445 [Cucumis melo]
Length=390

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D   SDAES CP G          +  L   +HRLEL AYRCT++ALYASGPL+WEKE 
Sbjct  300  TDGSTSDAESFCPSGYGIDDFLLSREKPLEAEVHRLELHAYRCTMEALYASGPLSWEKEL  359

Query  238  LLTNLLTELHISDDEHLRELKHLISAKAS  152
            LLT+L   LHIS+DEHL E+K+L+SA  S
Sbjct  360  LLTDLRLSLHISNDEHLMEIKNLVSASIS  388



>gb|KGN60658.1| hypothetical protein Csa_2G006040 [Cucumis sativus]
Length=390

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D   SDAES CP G          D  L   +HRLEL AYRCT++ALYASGPL+WEKE 
Sbjct  300  TDGSTSDAESFCPSGYGIDDFLLSRDKPLEAEVHRLELHAYRCTMEALYASGPLSWEKEL  359

Query  238  LLTNLLTELHISDDEHLRELKHLISAKAS  152
            LLT+L   LHIS+DEHL E+K+L+S   S
Sbjct  360  LLTDLRLSLHISNDEHLMEIKNLVSTSIS  388



>ref|XP_002520966.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF41383.1| RNA binding protein, putative [Ricinus communis]
Length=383

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -2

Query  403  SDAESVC-PLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTN  227
            SDAES   P    + S +P  +  L   IH LE +AY+ T++ALYASGPL+WE+E+LLTN
Sbjct  302  SDAESSSFPCSSVNISSTPYFEQKLEANIHELEFQAYKSTVRALYASGPLSWEQESLLTN  361

Query  226  LLTELHISDDEHLRELKHLISA  161
            L   LHISD+EHL +LKHL+S 
Sbjct  362  LRLSLHISDEEHLLQLKHLLST  383



>ref|XP_010049963.1| PREDICTED: uncharacterized protein LOC104438501 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049964.1| PREDICTED: uncharacterized protein LOC104438501 isoform X1 [Eucalyptus 
grandis]
 gb|KCW82797.1| hypothetical protein EUGRSUZ_C04172 [Eucalyptus grandis]
Length=401

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLI  167
            L   IHRLEL AYRCTL+ALYASGPL+WE+EAL++NL   LHISDDEHL EL++L+
Sbjct  335  LKAEIHRLELHAYRCTLEALYASGPLSWEQEALISNLRLSLHISDDEHLLELRNLV  390



>ref|XP_010546572.1| PREDICTED: uncharacterized protein LOC104818626 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546574.1| PREDICTED: uncharacterized protein LOC104818626 isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 88/161 (55%), Gaps = 3/161 (2%)
 Frame = -2

Query  640  ETLGEKYMHASFNVISNGCNEMYEEKLHGVF-CHsssttsefsdsdsgssvgscsvvsnS  464
            E LG+K    SF    NGC EM   + +G+  C  +  T          SVGSCSVVS +
Sbjct  222  ENLGKKRAQGSFKNDKNGCCEMVRVRSNGLNECVRAGNTEANGYDSDACSVGSCSVVSYN  281

Query  463  PINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTL  284
              N     +    + +D   SDAES    G+E    + L DD   E  HR EL  YR TL
Sbjct  282  ESNMPTCMLDGANQDADPASSDAESSSGHGEE--RQNSLADDEAAERSHRSELYTYRSTL  339

Query  283  QALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
              L+ASGPL+WE+EA LT+L   L+ISD EHL EL++LISA
Sbjct  340  GELFASGPLSWEQEASLTDLRLSLNISDAEHLTELRNLISA  380



>ref|XP_010526204.1| PREDICTED: uncharacterized protein LOC104803830 isoform X1 [Tarenaya 
hassleriana]
Length=383

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 92/162 (57%), Gaps = 8/162 (5%)
 Frame = -2

Query  640  ETLGEKYMHASFNVISNGCNEMYEEKLHGV--FCHsssttsefsdsdsgssvgscsvvsn  467
            E LG+ +   SF    NGC EM   + +G     H+ +T +   DSD+ S+    +   +
Sbjct  222  ENLGKIHSQGSFKYHKNGCCEMVRVRSNGFNELAHAGTTEASAYDSDASSTGSCSAGSYD  281

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCT  287
               N   + +    + +D+  SD ES C  G+  +S   L +D   E  HR EL +YR T
Sbjct  282  KS-NMSAYMLDGASQDADSASSDTESSCGRGEGQNS---LAEDV--EAAHRSELYSYRST  335

Query  286  LQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            L+ L+ASGPL+WE+EA LT+L   L+ISDDEHL EL++LISA
Sbjct  336  LEELFASGPLSWEQEASLTDLRLSLNISDDEHLMELRNLISA  377



>ref|XP_010546575.1| PREDICTED: uncharacterized protein LOC104818626 isoform X2 [Tarenaya 
hassleriana]
Length=386

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 88/161 (55%), Gaps = 3/161 (2%)
 Frame = -2

Query  640  ETLGEKYMHASFNVISNGCNEMYEEKLHGVF-CHsssttsefsdsdsgssvgscsvvsnS  464
            E LG+K    SF    NGC EM   + +G+  C  +  T          SVGSCSVVS +
Sbjct  222  ENLGKKRAQGSFKNDKNGCCEMVRVRSNGLNECVRAGNTEANGYDSDACSVGSCSVVSYN  281

Query  463  PINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTL  284
              N     +    + +D   SDAES    G+E    + L DD   E  HR EL  YR TL
Sbjct  282  ESNMPTCMLDGANQDADPASSDAESSSGHGEE--RQNSLADDEAAERSHRSELYTYRSTL  339

Query  283  QALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
              L+ASGPL+WE+EA LT+L   L+ISD EHL EL++LISA
Sbjct  340  GELFASGPLSWEQEASLTDLRLSLNISDAEHLTELRNLISA  380



>ref|XP_010535876.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535877.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535878.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535880.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535881.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
Length=398

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 4/98 (4%)
 Frame = -2

Query  442  FVPVHRKVSDALVSDAESVCPLGDEDSSHSPL-PDDGLGETIHRLELRAYRCTLQALYAS  266
            FVP+   +++   SDAESVC  G E      + P       +HRLEL AYRCT++ L+AS
Sbjct  300  FVPIE-DINENTSSDAESVC--GSESHRRKTIRPGKHSEGELHRLELDAYRCTIERLHAS  356

Query  265  GPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            GP+TWE+E  +TNL   L+IS+DEHL ++++L+SA  S
Sbjct  357  GPITWEQEVWITNLRAALNISNDEHLVQIRNLVSADNS  394



>ref|XP_004139421.1| PREDICTED: uncharacterized protein LOC101208549 [Cucumis sativus]
 ref|XP_004169315.1| PREDICTED: uncharacterized protein LOC101223903 [Cucumis sativus]
Length=493

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D   SDAES CP G          D  L   +HRLEL AYRCT++ALYASGPL+WEKE 
Sbjct  300  TDGSTSDAESFCPSGYGIDDFLLSRDKPLEAEVHRLELHAYRCTMEALYASGPLSWEKEL  359

Query  238  LLTNLLTELHISDDEHLRELKHLISA  161
            LLT+L   LHIS+DEHL E+K+L+S 
Sbjct  360  LLTDLRLSLHISNDEHLMEIKNLVST  385



>gb|KGN65299.1| hypothetical protein Csa_1G305720 [Cucumis sativus]
Length=407

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            L   IHRLEL+AYRCT++AL+ASGPL+W++E L+TNL   L+IS+DEHL +LK+LISA  
Sbjct  343  LAAEIHRLELQAYRCTIEALHASGPLSWDQEVLITNLRLSLNISNDEHLMQLKYLISADT  402

Query  154  S  152
            S
Sbjct  403  S  403



>gb|KHG19300.1| Protein EMSY [Gossypium arboreum]
Length=383

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 5/83 (6%)
 Frame = -2

Query  403  SDAESVCP--LGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLT  230
            SDA+S  P   G  D   SP+        IH LELRAY+ T++ALYASGPLTWE+EALLT
Sbjct  301  SDAKSSFPSLCGKRDLPSSPVEK---VINIHELELRAYKSTVEALYASGPLTWEQEALLT  357

Query  229  NLLTELHISDDEHLRELKHLISA  161
            NL   L+ISD EHL +L+HL+SA
Sbjct  358  NLRLSLNISDGEHLLQLRHLLSA  380



>ref|XP_010279295.1| PREDICTED: uncharacterized protein LOC104613259 [Nelumbo nucifera]
 ref|XP_010279296.1| PREDICTED: uncharacterized protein LOC104613259 [Nelumbo nucifera]
 ref|XP_010279297.1| PREDICTED: uncharacterized protein LOC104613259 [Nelumbo nucifera]
Length=392

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = -2

Query  427  RKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            RK+     SDA S CP            ++ L   IHRLEL AY+ T+QALYASGPL+WE
Sbjct  305  RKIPIISFSDAGSSCPSISGLKDLHSCAEEELEANIHRLELHAYKSTVQALYASGPLSWE  364

Query  247  KEALLTNLLTELHISDDEHLRELKHLIS  164
            +E+LLTNL   L+IS++EHL +L+HL+S
Sbjct  365  QESLLTNLRLSLNISNEEHLLQLRHLLS  392



>ref|NP_001172846.1| Os02g0204500 [Oryza sativa Japonica Group]
 dbj|BAH91575.1| Os02g0204500, partial [Oryza sativa Japonica Group]
Length=126

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = -2

Query  406  VSDAESVCPLGDEDSS----HSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            VS  ES     D ++S     SP P +DGL E  H LEL AYR TL ALYASG ++WE+E
Sbjct  35   VSGRESFSRTDDAEASVSGRESPAPVNDGLKEKTHLLELHAYRATLMALYASGSISWEQE  94

Query  241  ALLTNLLTELHISDDEHLRELKHLISAK  158
            A++TNL   L+IS DEHL EL+ L+S++
Sbjct  95   AMMTNLRLTLNISTDEHLSELRSLVSSE  122



>ref|XP_010919219.1| PREDICTED: uncharacterized protein LOC105043194 isoform X2 [Elaeis 
guineensis]
Length=411

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLL  221
            DA+S C  G +   H+      L E IH LEL AY  T+ ALYASGPL+WEKEAL+TNL 
Sbjct  319  DADSSCVSGRDFPLHAK---KALEEEIHHLELHAYHSTMLALYASGPLSWEKEALMTNLR  375

Query  220  TELHISDDEHLRELKHLISAKA  155
              LHIS+DEHL EL++L SAK 
Sbjct  376  LMLHISNDEHLLELRYLASAKT  397



>gb|KHG04820.1| Protein EMSY [Gossypium arboreum]
Length=400

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 5/90 (6%)
 Frame = -2

Query  418  SDALVSDAESVCPL--GDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEK  245
            S A  SDAES  P   G  D   SP   D + + IH LELRAY+ T++ALYASGPLTWE+
Sbjct  312  STADNSDAESSFPYSCGKRDLQLSPA--DKVVD-IHELELRAYKSTVEALYASGPLTWEQ  368

Query  244  EALLTNLLTELHISDDEHLRELKHLISAKA  155
            E LLTNL   L+ISD+EHL +L+HL+SA+ 
Sbjct  369  EFLLTNLRLSLNISDEEHLLQLRHLLSAQV  398



>ref|XP_007137045.1| hypothetical protein PHAVU_009G095200g [Phaseolus vulgaris]
 gb|ESW09039.1| hypothetical protein PHAVU_009G095200g [Phaseolus vulgaris]
Length=395

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D L SDAES+  +GD D   S  P +   E IH LEL AY  TL+ +YASG L+WE+E L
Sbjct  308  DTLCSDAESL-DVGDVDEGCSTSPSEVAAERIHSLELHAYHSTLEVMYASGSLSWEQEEL  366

Query  235  LTNLLTELHISDDEHLRELKHLISAKASY  149
            LTNL   L+IS+DEHL E+K+L S   ++
Sbjct  367  LTNLRISLNISNDEHLMEIKNLGSCGQNF  395



>gb|EAY84934.1| hypothetical protein OsI_06301 [Oryza sativa Indica Group]
Length=410

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 5/92 (5%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSS----HSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLT  254
            ++A VS +ES     D ++S     SP P +DGL E  H LEL AYR TL ALYASG ++
Sbjct  315  AEASVSGSESFSRTDDAEASVSGRESPAPVNDGLKEKTHLLELHAYRATLMALYASGSIS  374

Query  253  WEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            WE+EA++TNL   L+IS DEHL EL+ L+S++
Sbjct  375  WEQEAMMTNLRLTLNISTDEHLSELRSLVSSE  406



>ref|XP_009403411.1| PREDICTED: uncharacterized protein LOC103986974 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = -2

Query  397  AESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLT  218
            AE+ C L +E S    LP   L E IH+LEL AYR TL ALYASGP++WE EA +TNL  
Sbjct  324  AETYCGLENESS----LPRKDLQEEIHQLELNAYRSTLIALYASGPISWEWEAFMTNLRL  379

Query  217  ELHISDDEHLRELKHLISAK  158
             L+IS+DEHL E+++LI ++
Sbjct  380  MLNISNDEHLMEIRNLIRSE  399



>ref|XP_006657502.1| PREDICTED: uncharacterized protein LOC102722972 [Oryza brachyantha]
Length=355

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D    DA S CP      S S    D      HRLEL+AY+ T++ALYASGPLTWE+E+
Sbjct  271  ADCFPDDAMSACPSMPRQESDSVYSCD-FRTDFHRLELQAYQSTVRALYASGPLTWEQES  329

Query  238  LLTNLLTELHISDDEHLRELKHLISA  161
            LLTNL   L+I+++EHL +L+HL+S+
Sbjct  330  LLTNLRLSLNITNEEHLLQLRHLLSS  355



>gb|KDO68598.1| hypothetical protein CISIN_1g016251mg [Citrus sinensis]
 gb|KDO68599.1| hypothetical protein CISIN_1g016251mg [Citrus sinensis]
 gb|KDO68600.1| hypothetical protein CISIN_1g016251mg [Citrus sinensis]
Length=392

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDAES  P         P     L   IH LEL AY  T+QALYASGPL+WE+E+LLTNL
Sbjct  309  SDAESSFPSLSGKKHEFPSSRHKLEVDIHELELHAYESTVQALYASGPLSWEQESLLTNL  368

Query  223  LTELHISDDEHLRELKHLISAKAS  152
               L+ISD+EHL +L+HL+SA+ +
Sbjct  369  RLSLNISDEEHLLQLRHLLSAQVA  392



>ref|XP_006443952.1| hypothetical protein CICLE_v10020513mg [Citrus clementina]
 ref|XP_006479621.1| PREDICTED: uncharacterized protein LOC102613084 isoform X2 [Citrus 
sinensis]
 ref|XP_006479622.1| PREDICTED: uncharacterized protein LOC102613084 isoform X3 [Citrus 
sinensis]
 ref|XP_006479623.1| PREDICTED: uncharacterized protein LOC102613084 isoform X4 [Citrus 
sinensis]
 gb|ESR57192.1| hypothetical protein CICLE_v10020513mg [Citrus clementina]
Length=392

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDAES  P         P     L   IH LEL AY  T+QALYASGPL+WE+E+LLTNL
Sbjct  309  SDAESSFPSLSGKKHEFPSSRHKLEVDIHELELHAYESTVQALYASGPLSWEQESLLTNL  368

Query  223  LTELHISDDEHLRELKHLISAKAS  152
               L+ISD+EHL +L+HL+SA+ +
Sbjct  369  RLSLNISDEEHLLQLRHLLSAQVA  392



>ref|XP_006479620.1| PREDICTED: uncharacterized protein LOC102613084 isoform X1 [Citrus 
sinensis]
Length=419

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDAES  P         P     L   IH LEL AY  T+QALYASGPL+WE+E+LLTNL
Sbjct  336  SDAESSFPSLSGKKHEFPSSRHKLEVDIHELELHAYESTVQALYASGPLSWEQESLLTNL  395

Query  223  LTELHISDDEHLRELKHLISAKAS  152
               L+ISD+EHL +L+HL+SA+ +
Sbjct  396  RLSLNISDEEHLLQLRHLLSAQVA  419



>ref|XP_004291486.1| PREDICTED: uncharacterized protein LOC101295485 [Fragaria vesca 
subsp. vesca]
Length=384

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 91/174 (52%), Gaps = 21/174 (12%)
 Frame = -2

Query  646  PRETLGEKYMHASF-----------NVISNGCNEMYEEKLHGVFCHsssttsefsdsdsg  500
            PR  L EKYM ASF           N+ISNG N   E       C + + + E   S S 
Sbjct  211  PRAKLDEKYMRASFLYPTTRYFEKENIISNGANSCCERSSEVSDCDTDACSIESVGSCSV  270

Query  499  ssvgscsvvsnSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHS-PLPDDGLGET  323
            +   S  +          + +  + + +D L SDA+S     D   + S PL  D +  T
Sbjct  271  NGNHSSKMAG--------YDLAGNCEEADTLSSDADSFSSGADLVENVSLPLKLD-IAAT  321

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLEL AYR TL  ++ASG L+WE++ LLT L   LHIS+DEHL E+++LISA
Sbjct  322  IHRLELDAYRRTLMVMHASGSLSWEQQDLLTTLRMSLHISNDEHLMEVRNLISA  375



>ref|XP_007050457.1| Uncharacterized protein TCM_004243 [Theobroma cacao]
 gb|EOX94614.1| Uncharacterized protein TCM_004243 [Theobroma cacao]
Length=195

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 62/85 (73%), Gaps = 5/85 (6%)
 Frame = -2

Query  403  SDAESVCP--LGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLT  230
            SDAES  P   G ++   SPL D+ +   +H LELRAY+ T++ALYASGPLTWE+E+LLT
Sbjct  113  SDAESSFPSLCGKKNLPLSPL-DEAVD--VHELELRAYKSTVEALYASGPLTWEQESLLT  169

Query  229  NLLTELHISDDEHLRELKHLISAKA  155
            NL   L+ISD+E+L  L+HL+S + 
Sbjct  170  NLRLSLNISDEEYLLHLRHLLSPQV  194



>ref|XP_002517573.1| hypothetical protein RCOM_0897890 [Ricinus communis]
 gb|EEF44737.1| hypothetical protein RCOM_0897890 [Ricinus communis]
Length=473

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  448  LHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYA  269
              F P H        SDAES   +  E    S    D LG   HR EL+ Y  T++ LYA
Sbjct  371  FRFSPQHSDNIGDYCSDAESSSGVEYEKGGRSLSSHDQLGVEFHRSELQMYYSTVEDLYA  430

Query  268  SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            SGPL+WE EA LTNL   LHISDDEHL+ L+ LISA +
Sbjct  431  SGPLSWEDEAKLTNLRDMLHISDDEHLKVLRILISANS  468



>dbj|BAD16008.1| putative agenet domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD38428.1| putative agenet domain-containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ22156.1| hypothetical protein OsJ_05817 [Oryza sativa Japonica Group]
 dbj|BAG91727.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00119.1| unnamed protein product [Oryza sativa Japonica Group]
Length=410

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = -2

Query  406  VSDAESVCPLGDEDSS----HSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            VS  ES     D ++S     SP P +DGL E  H LEL AYR TL ALYASG ++WE+E
Sbjct  319  VSGRESFSRTDDAEASVSGRESPAPVNDGLKEKTHLLELHAYRATLMALYASGSISWEQE  378

Query  241  ALLTNLLTELHISDDEHLRELKHLISAK  158
            A++TNL   L+IS DEHL EL+ L+S++
Sbjct  379  AMMTNLRLTLNISTDEHLSELRSLVSSE  406



>ref|XP_008785237.1| PREDICTED: uncharacterized protein LOC103703932 isoform X2 [Phoenix 
dactylifera]
Length=415

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 9/107 (8%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            DAE  C  G E S    LP ++ L    H+LEL AYR T+ ALYASGP++WE+EAL+TNL
Sbjct  309  DAEISCGSGRESS----LPTEEVLPTETHQLELHAYRSTMMALYASGPISWEQEALMTNL  364

Query  223  LTELHISDDEHLRELKHLISAKAS----YDT*GSCLFCSSWVIFIPL  95
               L+IS+DEHL ELK+L+S++           +C  C  W + + L
Sbjct  365  RLMLNISNDEHLLELKNLVSSEIGTIPLRSMLEACKACFRWSLMMTL  411



>ref|XP_006647055.1| PREDICTED: uncharacterized protein LOC102712500 isoform X1 [Oryza 
brachyantha]
Length=410

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 11/87 (13%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            ++A VS  ES  P+           +DGL E  H LEL AYR TL ALYASG ++WE+EA
Sbjct  331  AEASVSGRESAVPV-----------NDGLEEKTHLLELHAYRATLMALYASGSISWEQEA  379

Query  238  LLTNLLTELHISDDEHLRELKHLISAK  158
            L+TNL   L+IS DEHL EL++LIS++
Sbjct  380  LMTNLRLTLNISTDEHLSELRNLISSE  406



>ref|XP_010918089.1| PREDICTED: uncharacterized protein LOC105042529 [Elaeis guineensis]
Length=415

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 90/166 (54%), Gaps = 12/166 (7%)
 Frame = -2

Query  646  PRETLGEKYMHASFN--VISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvv  473
            PR+ LGEKYMHA  N  V   G   M  +K H    +    + E +D++S SS       
Sbjct  238  PRKLLGEKYMHAFLNHKVCERG---MGNQKPHAGAGYCFIESIESNDAESVSSSVGSCSP  294

Query  472  snSPINPGLH--FVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRA  299
            S+SP    L+  + P H    D   +DAE  C  G E S +     +GL   IH LEL A
Sbjct  295  SDSPYRSILYPIYSPTHD--LDGNCNDAEHPCASGRELSFYI---KEGLEAEIHCLELHA  349

Query  298  YRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            YR TL ALYA+GPL+W+KE L+TNL   L IS+DEHL EL+  +  
Sbjct  350  YRSTLLALYAAGPLSWDKEVLITNLRFMLRISNDEHLSELRAKVGG  395



>ref|XP_006841934.1| hypothetical protein AMTR_s00042p00209060 [Amborella trichopoda]
 gb|ERN03609.1| hypothetical protein AMTR_s00042p00209060 [Amborella trichopoda]
Length=290

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  349  LPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHL  170
            L  + L   IH LELRAYR  ++ALYASGPLTWE EAL+T L   LHIS DEHL EL+HL
Sbjct  227  LEKEELTNVIHELELRAYRSIMEALYASGPLTWEHEALMTTLRLNLHISIDEHLAELRHL  286

Query  169  ISA  161
             S+
Sbjct  287  ASS  289



>ref|XP_002307616.1| hypothetical protein POPTR_0005s23770g [Populus trichocarpa]
 gb|EEE94612.1| hypothetical protein POPTR_0005s23770g [Populus trichocarpa]
Length=379

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDAES           +P  +  L   IH LE  AYR T+QALYASGPL+WE+E+LLTNL
Sbjct  296  SDAESSFVSFSFIKRLTPYFEQKLEAEIHELEFHAYRSTVQALYASGPLSWEQESLLTNL  355

Query  223  LTELHISDDEHLRELKHLISAKA  155
               LHISD+EHL  L+ L+S + 
Sbjct  356  RLSLHISDEEHLLHLRQLLSTQV  378



>ref|XP_008785245.1| PREDICTED: uncharacterized protein LOC103703932 isoform X3 [Phoenix 
dactylifera]
Length=412

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 5/81 (6%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            DAE  C  G E S    LP ++ L    H+LEL AYR T+ ALYASGP++WE+EAL+TNL
Sbjct  309  DAEISCGSGRESS----LPTEEVLPTETHQLELHAYRSTMMALYASGPISWEQEALMTNL  364

Query  223  LTELHISDDEHLRELKHLISA  161
               L+IS+DEHL ELK+L+S+
Sbjct  365  RLMLNISNDEHLLELKNLVSS  385



>gb|EMT01979.1| hypothetical protein F775_26969 [Aegilops tauschii]
Length=386

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 6/86 (7%)
 Frame = -2

Query  400  DAESVCPLGDED-----SSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            D+  +C   D+D      + SPLP   GLGE  H LEL AYR T+ ALYA G ++WE+EA
Sbjct  296  DSGDICSRTDDDEASVSGTESPLPIKGGLGEETHLLELHAYRATMMALYAYGSISWEQEA  355

Query  238  LLTNLLTELHISDDEHLRELKHLISA  161
            L+TNL   L+IS DEHL EL++L ++
Sbjct  356  LMTNLRLTLNISTDEHLSELRNLANS  381



>ref|XP_011032621.1| PREDICTED: uncharacterized protein LOC105131379 [Populus euphratica]
 ref|XP_011032622.1| PREDICTED: uncharacterized protein LOC105131379 [Populus euphratica]
Length=382

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDAES           +P  +  L   IH LE  AYR T+QALYASGPL+WE+E+LLTNL
Sbjct  299  SDAESSFVSFSFIKRLTPYFEQKLEAEIHELEFHAYRSTVQALYASGPLSWEQESLLTNL  358

Query  223  LTELHISDDEHLRELKHLISAKA  155
               LHISD+EHL  L+ L+S + 
Sbjct  359  RLSLHISDEEHLLHLRQLLSTQV  381



>ref|XP_008790188.1| PREDICTED: uncharacterized protein LOC103707469 [Phoenix dactylifera]
Length=236

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            DAES C  G E S    LP  + L   IH+LEL AY  T++A YASGP++W++EAL+T+L
Sbjct  154  DAESCCGSGRESS----LPTKEVLAAEIHQLELHAYCSTMRAFYASGPISWDQEALMTDL  209

Query  223  LTELHISDDEHLRELKHLISAK  158
               L+IS+DEHL ELK+L+S++
Sbjct  210  RLMLNISNDEHLLELKNLVSSE  231



>ref|XP_008785228.1| PREDICTED: uncharacterized protein LOC103703932 isoform X1 [Phoenix 
dactylifera]
Length=434

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            DAE  C  G E S    LP ++ L    H+LEL AYR T+ ALYASGP++WE+EAL+TNL
Sbjct  309  DAEISCGSGRESS----LPTEEVLPTETHQLELHAYRSTMMALYASGPISWEQEALMTNL  364

Query  223  LTELHISDDEHLRELKHLISAK  158
               L+IS+DEHL ELK+L+S++
Sbjct  365  RLMLNISNDEHLLELKNLVSSE  386



>ref|XP_003603435.1| RNA binding protein [Medicago truncatula]
 gb|AES73686.1| agenet domain protein [Medicago truncatula]
Length=417

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLL  221
            DAES+    D D   +  P   + E IHRLEL AY  TL A+YASGPL+WEKE LLTNL 
Sbjct  335  DAESI-DAEDVDEGCTFFPKQVVVERIHRLELIAYHRTLGAMYASGPLSWEKEELLTNLR  393

Query  220  TELHISDDEHLRELKHLISAKASY  149
              L+IS+DEHL  +K+L+S+  ++
Sbjct  394  ISLNISNDEHLMGIKNLVSSSHNF  417



>gb|AFK44933.1| unknown [Medicago truncatula]
Length=417

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLL  221
            DAES+    D D   +  P   + E IHRLEL AY  TL A+YASGPL+WEKE LLTNL 
Sbjct  335  DAESI-DAEDVDEGCTFFPKQVVVERIHRLELIAYHRTLGAMYASGPLSWEKEELLTNLR  393

Query  220  TELHISDDEHLRELKHLISAKASY  149
              L+IS+DEHL  +K+L+S+  ++
Sbjct  394  ISLNISNDEHLMGIKNLVSSSHNF  417



>gb|EMS47996.1| hypothetical protein TRIUR3_08002 [Triticum urartu]
Length=387

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 7/87 (8%)
 Frame = -2

Query  400  DAESVCPLGDED------SSHSPLP-DDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            D+  +C   D+D       + SPLP   GLGE  H LEL AYR T+ ALYA G ++WE+E
Sbjct  296  DSGDICSRTDDDDEASVSGTESPLPIKGGLGEETHLLELHAYRATMMALYAYGSISWEQE  355

Query  241  ALLTNLLTELHISDDEHLRELKHLISA  161
            AL+TNL   L+IS DEHL EL++L ++
Sbjct  356  ALMTNLRLTLNISTDEHLSELRNLANS  382



>ref|XP_009108874.1| PREDICTED: uncharacterized protein LOC103834559 isoform X1 [Brassica 
rapa]
Length=343

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  SDAES C +G+E++     L  DG   +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  251  ADSCSSDAESYCGVGEEEARRKHSLGGDGARRSC-RSELYTYRSTLGDLFASGPLSWEQE  309

Query  241  ALLTNLLTELHISDDEHLRELKHLISA  161
              LT+L   L+ISDDEHL E+++LISA
Sbjct  310  TSLTDLRLSLNISDDEHLMEVRNLISA  336



>emb|CDY23326.1| BnaA08g12200D [Brassica napus]
Length=343

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  SDAES C +G+E++     L  DG   +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  251  ADSCSSDAESYCGVGEEEARRKHSLGGDGARRSC-RSELYTYRSTLGDLFASGPLSWEQE  309

Query  241  ALLTNLLTELHISDDEHLRELKHLISA  161
              LT+L   L+ISDDEHL E+++LISA
Sbjct  310  TSLTDLRLSLNISDDEHLMEVRNLISA  336



>ref|XP_003603436.1| ABC transporter G family member [Medicago truncatula]
Length=469

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  349  LPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHL  170
            L  + + E IHRLEL AY CTL  +YASGPL+WEKE LLTNL   L+IS+DEHL  +K+L
Sbjct  403  LSKEAVAERIHRLELNAYLCTLGVMYASGPLSWEKEELLTNLRISLNISNDEHLMGIKNL  462

Query  169  ISAKASY  149
            + +  ++
Sbjct  463  VFSGQNF  469


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  349  LPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHL  170
            L ++ + E  HRLEL AY  TLQA+YA+GPLTW+KE +LTNL   L+IS DEHL+ +K+L
Sbjct  108  LSEEVVAERTHRLELEAYLRTLQAMYAAGPLTWKKEEVLTNLRLLLNISIDEHLKGIKNL  167

Query  169  ISAKAS  152
            +S+  S
Sbjct  168  VSSVTS  173



>ref|XP_004981435.1| PREDICTED: uncharacterized protein LOC101770262 [Setaria italica]
Length=292

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
 Frame = -2

Query  427  RKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            R  +  L  DA S CP     S  +P  +      +H LEL AYR T++ALYASGPLTWE
Sbjct  208  RPGAGCLPDDAMSACPC----SPGAPEEEHEGAVDVHGLELAAYRSTMRALYASGPLTWE  263

Query  247  KEALLTNLLTELHISDDEHLRELKHLISA  161
            +EALLTNL   L+IS++EHL +L+ L+S+
Sbjct  264  QEALLTNLRLSLNISNEEHLLQLRRLMSS  292



>ref|XP_010447388.1| PREDICTED: uncharacterized protein LOC104730029 isoform X2 [Camelina 
sativa]
Length=387

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -2

Query  397  AESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLT  218
            AES C LG+E     P   DG G +  R EL  YR TL  L++SGPL+WE+EA LT+L  
Sbjct  303  AESSCGLGEEARREHPSARDGAGRSC-RSELYTYRSTLGELFSSGPLSWEQEASLTDLRL  361

Query  217  ELHISDDEHLRELKHLIS  164
             L+ISDDEHL E+++LIS
Sbjct  362  SLNISDDEHLMEVRNLIS  379



>ref|XP_009408508.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408510.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408511.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408512.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408513.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
Length=374

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = -2

Query  427  RKVSDALVSDAESVCP-LGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTW  251
            R ++      A S+CP  G  +S    +  D L  +IH LEL AY+ T+QALYASGPL+W
Sbjct  284  RDIARNTFDHAMSLCPHEGGRESQR--ISGDKLAASIHELELHAYQSTMQALYASGPLSW  341

Query  250  EKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            E+E+LLTNL   L+IS++EHL  L+ L+S + 
Sbjct  342  EQESLLTNLRLSLNISNEEHLLHLRQLLSTEV  373



>ref|XP_010274252.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274253.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274254.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274255.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274256.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274257.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274258.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274259.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
Length=379

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            L   IH+LEL AY+ T+QALYASGPL+WE+E LLTNL   LHIS++EHL +L++L+S
Sbjct  323  LEANIHKLELHAYKSTMQALYASGPLSWEQEYLLTNLRLSLHISNEEHLNQLRYLLS  379



>emb|CDY39887.1| BnaC03g67300D [Brassica napus]
Length=350

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSS-HSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  SDAES C LG+E++     L  DG   +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  258  ADSCSSDAESHCCLGEEEARWKDSLAGDGARSSC-RSELYTYRSTLGNLFASGPLSWEQE  316

Query  241  ALLTNLLTELHISDDEHLRELKHLISA  161
              LT+L   L+ISDDEHL E+++LISA
Sbjct  317  TSLTDLRLSLNISDDEHLMEVRNLISA  343



>ref|XP_002300812.2| hypothetical protein POPTR_0002s04760g [Populus trichocarpa]
 gb|EEE80085.2| hypothetical protein POPTR_0002s04760g [Populus trichocarpa]
Length=394

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDAES           +P  +   G  IH LE  AYR T+QALYASGPL+WE+E+LLTNL
Sbjct  300  SDAESSFLSFSVIKRLTPCFEQKQGAEIHELEFHAYRSTVQALYASGPLSWEQESLLTNL  359

Query  223  LTELHISDDEHLRELKHLISAKA  155
               L+ISD+EHL  L+ L+S + 
Sbjct  360  RLSLNISDEEHLLHLRQLLSTQV  382



>ref|XP_010918992.1| PREDICTED: uncharacterized protein LOC105043194 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919066.1| PREDICTED: uncharacterized protein LOC105043194 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919142.1| PREDICTED: uncharacterized protein LOC105043194 isoform X1 [Elaeis 
guineensis]
Length=412

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLL  221
            DA+S C  G +   H+      L E IH LEL AY  T+ ALYASGPL+WEKEAL+TNL 
Sbjct  319  DADSSCVSGRDFPLHAK---KALEEEIHHLELHAYHSTMLALYASGPLSWEKEALMTNLR  375

Query  220  TELHISDDEHLRELKHLI  167
              LHIS+DEHL EL+  I
Sbjct  376  LMLHISNDEHLLELRRSI  393



>ref|XP_009781192.1| PREDICTED: uncharacterized protein LOC104230153 [Nicotiana sylvestris]
Length=337

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -2

Query  439  VPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGP  260
            V V+ + ++ L SDAES     D+   HS    + +  +IH LEL AYR TL+ALYASGP
Sbjct  232  VQVYCQGTELLCSDAESFRNSADKVERHSLSSPEKIAASIHSLELHAYRSTLEALYASGP  291

Query  259  LTWEKEALLTNLLTELHISDDEHLREL  179
            L+W++EALLTNL   LH   DEH+ EL
Sbjct  292  LSWDQEALLTNLRISLH---DEHVAEL  315



>ref|NP_194970.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
 emb|CAA22571.1| putative protein [Arabidopsis thaliana]
 emb|CAB79961.1| putative protein [Arabidopsis thaliana]
 gb|AAO23651.1| At4g32440 [Arabidopsis thaliana]
 dbj|BAE99365.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86059.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
Length=377

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D+  SDAES C LG+E         DG   +  R EL +YR TL  L++SGPL+WE+EA
Sbjct  286  ADSCSSDAESSCGLGEEPRWKHSSVGDGARNSC-RSELYSYRSTLGELFSSGPLSWEQEA  344

Query  238  LLTNLLTELHISDDEHLRELKHLISA  161
             LT+L   L+ISDDEHL E+++LIS 
Sbjct  345  SLTDLRLSLNISDDEHLMEVRNLIST  370



>ref|XP_010670685.1| PREDICTED: uncharacterized protein LOC104887681 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=378

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDED--SSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEK  245
            S +L SDAES   LG+E+  S      DD L    H L+L  YRC L++LYASGPL+W++
Sbjct  285  SASLSSDAESHSYLGEEEEVSQGQFERDDAL--QTHELDLYGYRCVLESLYASGPLSWQQ  342

Query  244  EALLTNLLTELHISDDEHLRELKHLIS  164
            E  LTNL  +L++S+DEHL EL+ L S
Sbjct  343  ETALTNLRLKLYVSNDEHLTELRRLRS  369



>ref|XP_009381265.1| PREDICTED: uncharacterized protein LOC103969462 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=401

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = -2

Query  397  AESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLT  218
            AE+ C L   D   S    D L   IH LEL AYR TL ALYASGP++WE+EAL+TNL  
Sbjct  319  AETSCDL---DREPSISWKDELQAEIHELELNAYRSTLIALYASGPISWEQEALMTNLRL  375

Query  217  ELHISDDEHLRELKHLI  167
             L+IS+DEHL EL++LI
Sbjct  376  MLNISNDEHLVELRNLI  392



>ref|XP_004292586.1| PREDICTED: uncharacterized protein LOC101309999 [Fragaria vesca 
subsp. vesca]
Length=350

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLP--DDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLT  230
            SDAES  P        +PLP  D  L   IH+LEL+AY+ TLQ LYASGPL+WE+E+LLT
Sbjct  265  SDAESSFPALTRKKFSAPLPEPDHMLDVDIHKLELQAYKSTLQVLYASGPLSWEQESLLT  324

Query  229  NLLTELHISDDE  194
            NL   LHI+++E
Sbjct  325  NLRLSLHITNEE  336



>gb|KHG21627.1| Calpain-A [Gossypium arboreum]
Length=335

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            SDA+S C               G G   HR EL  Y+  L+ALY SGPLTWE+EA +TNL
Sbjct  246  SDADSYCERRCRKEGSFGYTSGGSGTNFHRSELHVYQQALEALYMSGPLTWEEEAKVTNL  305

Query  223  LTELHISDDEHLRELKHL  170
               L+IS+DEHLREL+ L
Sbjct  306  RCTLNISNDEHLRELRKL  323



>tpg|DAA42551.1| TPA: hypothetical protein ZEAMMB73_650642 [Zea mays]
Length=75

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -2

Query  391  SVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTEL  212
            S C  G E          GL + +H LELRAYR T++AL+A+GPLTWE+E+LLTNL   L
Sbjct  2    SACEYGQETE---DAYGSGLFQNVHELELRAYRSTVRALHAAGPLTWEQESLLTNLRLSL  58

Query  211  HISDDEH  191
            +IS++EH
Sbjct  59   NISNEEH  65



>ref|NP_001148982.1| RNA binding protein [Zea mays]
 gb|ACG33716.1| RNA binding protein [Zea mays]
Length=309

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  409  LVSDAESVCPL--GDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            L  DA S CP   G  D          L    H L+L AYR T++ALYASGPLTW +EAL
Sbjct  229  LPDDAMSACPCTPGARDGEGEEEAAAAL----HGLQLEAYRSTMRALYASGPLTWAQEAL  284

Query  235  LTNLLTELHISDDEHLRELKHLISA  161
            LTNL   L+IS++EHL +LK L+S+
Sbjct  285  LTNLRLSLNISNEEHLLQLKRLLSS  309



>ref|XP_008676588.1| PREDICTED: RNA binding protein isoform X1 [Zea mays]
 ref|XP_008676593.1| PREDICTED: RNA binding protein isoform X1 [Zea mays]
 tpg|DAA51919.1| TPA: RNA binding protein isoform 1 [Zea mays]
 tpg|DAA51920.1| TPA: RNA binding protein isoform 2 [Zea mays]
Length=309

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  409  LVSDAESVCPL--GDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            L  DA S CP   G  D          L    H L+L AYR T++ALYASGPLTW +EAL
Sbjct  229  LPDDAMSACPCTPGARDGEGEEEAAAAL----HGLQLEAYRSTMRALYASGPLTWAQEAL  284

Query  235  LTNLLTELHISDDEHLRELKHLISA  161
            LTNL   L+IS++EHL +LK L+S+
Sbjct  285  LTNLRLSLNISNEEHLLQLKRLLSS  309



>ref|XP_006838905.1| hypothetical protein AMTR_s00002p00269570 [Amborella trichopoda]
 gb|ERN01474.1| hypothetical protein AMTR_s00002p00269570 [Amborella trichopoda]
Length=367

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHL  170
            L   +H LEL AY  T+QAL+ASGPL+WE+EALLTNL   LHI+++EHL EL+HL
Sbjct  307  LATNVHMLELNAYHHTVQALHASGPLSWEQEALLTNLRLSLHITNEEHLFELRHL  361



>gb|EAZ02975.1| hypothetical protein OsI_25115 [Oryza sativa Indica Group]
Length=362

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  421  VSDALVSDAESVCP---LGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTW  251
            V ++   DA S CP     + D+ H           +H LEL+AY+ T++A YA GPLTW
Sbjct  277  VRNSFPDDAMSSCPSMLRQESDNVHGC----DFKMDVHELELQAYQSTVRAFYALGPLTW  332

Query  250  EKEALLTNLLTELHISDDEHLRELKHLISA  161
            E+E+LLTNL   L+I+++EHL +L+HL+S+
Sbjct  333  EQESLLTNLRLSLNITNEEHLLQLRHLLSS  362



>ref|XP_006284938.1| hypothetical protein CARUB_v10006237mg [Capsella rubella]
 gb|EOA17836.1| hypothetical protein CARUB_v10006237mg [Capsella rubella]
Length=390

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D+  SDAES C LG+E         DG   +  R EL  YR TL  L++SGPL+WE+EA
Sbjct  299  ADSFSSDAESSCGLGEEARRKHSSARDGERRSC-RFELYTYRSTLGELFSSGPLSWEQEA  357

Query  238  LLTNLLTELHISDDEHLRE  182
             LT+L   L+ISDDEHL E
Sbjct  358  SLTDLRLSLNISDDEHLME  376



>dbj|BAC83034.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ38899.1| hypothetical protein OsJ_23318 [Oryza sativa Japonica Group]
Length=362

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  421  VSDALVSDAESVCP---LGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTW  251
            V ++   DA S CP     + D+ H           +H LEL+AY+ T++A YA GPLTW
Sbjct  277  VRNSFPDDAMSSCPSMLRQESDNVHGC----DFKMDVHELELQAYQSTVRAFYALGPLTW  332

Query  250  EKEALLTNLLTELHISDDEHLRELKHLISA  161
            E+E+LLTNL   L+I+++EHL +L+HL+S+
Sbjct  333  EQESLLTNLRLSLNITNEEHLLQLRHLLSS  362



>ref|XP_009108875.1| PREDICTED: uncharacterized protein LOC103834559 isoform X2 [Brassica 
rapa]
Length=338

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  SDAES C +G+E++     L  DG   +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  251  ADSCSSDAESYCGVGEEEARRKHSLGGDGARRSC-RSELYTYRSTLGDLFASGPLSWEQE  309

Query  241  ALLTNLLTELHISDDEHLREL  179
              LT+L   L+ISDDEHL EL
Sbjct  310  TSLTDLRLSLNISDDEHLMEL  330



>ref|XP_002869273.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45532.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D+  SDAES C LG+E         DG   +  R EL +YR TL  L++SGPL+WE+EA
Sbjct  287  ADSCSSDAESSCGLGEEPRRKHSSAGDGARRSC-RSELYSYRSTLGELFSSGPLSWEQEA  345

Query  238  LLTNLLTELHISDDEHLRE  182
             LT+L   L+ISDDEHL E
Sbjct  346  SLTDLRLSLNISDDEHLME  364



>ref|XP_010447385.1| PREDICTED: uncharacterized protein LOC104730029 isoform X1 [Camelina 
sativa]
 ref|XP_010447386.1| PREDICTED: uncharacterized protein LOC104730029 isoform X1 [Camelina 
sativa]
Length=387

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  397  AESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLT  218
            AES C LG+E     P   DG G +  R EL  YR TL  L++SGPL+WE+EA LT+L  
Sbjct  303  AESSCGLGEEARREHPSARDGAGRSC-RSELYTYRSTLGELFSSGPLSWEQEASLTDLRL  361

Query  217  ELHISDDEHLRE  182
             L+ISDDEHL E
Sbjct  362  SLNISDDEHLME  373



>ref|XP_010447389.1| PREDICTED: uncharacterized protein LOC104730029 isoform X3 [Camelina 
sativa]
Length=385

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  397  AESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLT  218
            AES C LG+E     P   DG G +  R EL  YR TL  L++SGPL+WE+EA LT+L  
Sbjct  303  AESSCGLGEEARREHPSARDGAGRSC-RSELYTYRSTLGELFSSGPLSWEQEASLTDLRL  361

Query  217  ELHISDDEHLRE  182
             L+ISDDEHL E
Sbjct  362  SLNISDDEHLME  373



>ref|XP_008797067.1| PREDICTED: uncharacterized protein LOC103712348 [Phoenix dactylifera]
Length=266

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 48/79 (61%), Gaps = 13/79 (16%)
 Frame = -2

Query  391  SVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTEL  212
            + CP  D+       PD       H LEL AY CT  ALY+S  LTWE+EA LT L  +L
Sbjct  195  TTCPTQDKS------PD-------HHLELHAYHCTKMALYSSEHLTWEQEAFLTQLRLQL  241

Query  211  HISDDEHLRELKHLISAKA  155
             IS+DEHL ELKHL SA++
Sbjct  242  RISNDEHLAELKHLASAQS  260



>ref|XP_008461067.1| PREDICTED: uncharacterized protein LOC103499769 isoform X1 [Cucumis 
melo]
Length=366

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = -2

Query  442  FVPVHR---KVSDA-LVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQAL  275
            FVPV R   KV D    SDAES    GDE+       +  +    HR EL  +R  ++AL
Sbjct  265  FVPVARCVKKVEDTDYCSDAESSTGRGDEEEEPCSYEEVLVRS--HRSELSVFRSFIRAL  322

Query  274  YASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            YASGPL+WE E  ++N+   LHIS+DE+L EL++L+SA
Sbjct  323  YASGPLSWEDEGQVSNIRASLHISNDEYLMELRNLMSA  360



>ref|XP_002298112.2| hypothetical protein POPTR_0001s17380g [Populus trichocarpa]
 gb|EEE82917.2| hypothetical protein POPTR_0001s17380g [Populus trichocarpa]
Length=394

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -2

Query  403  SDAESVCPLGDE-DSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTN  227
            SDAES    G E +   SP  D+  G  +HR +L AY  T++ALY++GPL+WE E  LT+
Sbjct  308  SDAES--SNGSEYEIKDSPSYDEKFGVEVHRSKLHAYCSTVEALYSAGPLSWEDEENLTS  365

Query  226  LLTELHISDDEHLRELKHLISAKA  155
            L  ELHISDDEHL  L++L S  +
Sbjct  366  LRDELHISDDEHLMVLRNLTSVNS  389



>ref|XP_009407652.1| PREDICTED: uncharacterized protein LOC103990296 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=409

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  340  DGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            D L   IH+LEL AYR +L AL+A GP++WE+EAL+TNL   L+IS+DEHL EL++L+ +
Sbjct  343  DELQAEIHQLELNAYRSSLIALHALGPISWEREALMTNLRLMLNISNDEHLMELRNLMHS  402

Query  160  KASYDT  143
            + +  T
Sbjct  403  EMTTTT  408



>ref|XP_009108876.1| PREDICTED: uncharacterized protein LOC103834559 isoform X3 [Brassica 
rapa]
Length=335

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  SDAES C +G+E++     L  DG   +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  251  ADSCSSDAESYCGVGEEEARRKHSLGGDGARRSC-RSELYTYRSTLGDLFASGPLSWEQE  309

Query  241  ALLTNLLTELHISDDEHLRE  182
              LT+L   L+ISDDEHL E
Sbjct  310  TSLTDLRLSLNISDDEHLME  329



>ref|XP_011035647.1| PREDICTED: uncharacterized protein LOC105133379 isoform X1 [Populus 
euphratica]
Length=394

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  355  SPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELK  176
            SP  D+  G  +HR +L AY  T++ALY+SGPL+WE E  LT++  +LHISDDEHL  L+
Sbjct  323  SPSYDEKFGVEVHRSKLHAYCSTVEALYSSGPLSWEDEENLTSIRDKLHISDDEHLMVLR  382

Query  175  HLISAKA  155
            +L S  +
Sbjct  383  NLTSVNS  389



>gb|KGN45306.1| hypothetical protein Csa_7G433350 [Cucumis sativus]
Length=366

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = -2

Query  442  FVPVHRKVSDA----LVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQAL  275
            FV V R+V         SDAES    GDE+       +  +    HR EL  +R  ++AL
Sbjct  265  FVSVARRVKKVEDTDYCSDAESTTGRGDEEEEPCSYEEVLVRS--HRSELSVFRSFIRAL  322

Query  274  YASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            YASGPL+WE E  ++N+   LHIS+DE+L EL++L+SA
Sbjct  323  YASGPLSWEDEGQVSNIRASLHISNDEYLMELRNLMSA  360



>ref|NP_001131239.1| uncharacterized protein LOC100192548 [Zea mays]
 ref|XP_008681053.1| PREDICTED: uncharacterized protein LOC100192548 isoform X1 [Zea 
mays]
 gb|ACF79564.1| unknown [Zea mays]
 gb|ACL54797.1| unknown [Zea mays]
 gb|AFW67363.1| hypothetical protein ZEAMMB73_925620 [Zea mays]
 gb|AFW67364.1| hypothetical protein ZEAMMB73_925620 [Zea mays]
 gb|AFW67365.1| hypothetical protein ZEAMMB73_925620 [Zea mays]
Length=304

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 10/76 (13%)
 Frame = -2

Query  409  LVSDAESVCPLGDEDSSHSPLPDDGLGE---TIHRLELRAYRCTLQALYASGPLTWEKEA  239
            L  DA S CP        +P   DG  E    +H LEL AY  T++ALYASGPLTWE+EA
Sbjct  226  LPDDAMSACPC-------TPGARDGEDEDAAGVHGLELEAYGSTMRALYASGPLTWEQEA  278

Query  238  LLTNLLTELHISDDEH  191
            LLTNL   L+IS++EH
Sbjct  279  LLTNLRLSLNISNEEH  294



>ref|XP_004135835.1| PREDICTED: uncharacterized protein LOC101203701 [Cucumis sativus]
 ref|XP_004166618.1| PREDICTED: uncharacterized protein LOC101230291 [Cucumis sativus]
Length=377

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = -2

Query  442  FVPVHRKVSDA----LVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQAL  275
            FV V R+V         SDAES    GDE+       +  +    HR EL  +R  ++AL
Sbjct  276  FVSVARRVKKVEDTDYCSDAESTTGRGDEEEEPCSYEEVLVRS--HRSELSVFRSFIRAL  333

Query  274  YASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            YASGPL+WE E  ++N+   LHIS+DE+L EL++L+SA
Sbjct  334  YASGPLSWEDEGQVSNIRASLHISNDEYLMELRNLMSA  371



>ref|XP_009381129.1| PREDICTED: uncharacterized protein LOC103969354 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            LG  IH+LEL A+R  + A YASG ++WE+E+LLTNL   L+IS+DE+L EL++L+S
Sbjct  341  LGAEIHQLELHAFRSMMTAFYASGAISWEQESLLTNLRLMLNISNDEYLSELRNLMS  397



>ref|XP_010454295.1| PREDICTED: uncharacterized protein LOC104736072 [Camelina sativa]
Length=322

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = -2

Query  406  VSDAESV-CPLGDEDSSHSPLPDDGL-GETIHRLELRAYRCTLQALYASGPL-TWEKEAL  236
             SD ES  C  G        +P  G     +HRLEL AYRC+++ L+ASGP+ TWE+E  
Sbjct  231  TSDTESSSCGYGSMKMKKLDIPRKGSEAADVHRLELDAYRCSIERLHASGPIITWEQETW  290

Query  235  LTNLLTELHISDDEHLRELKHLIS  164
            +TNL   L+IS++EHL ++++LIS
Sbjct  291  ITNLRLRLNISNEEHLMQIRNLIS  314



>ref|NP_974660.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
 dbj|BAF01084.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86060.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
Length=393

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            +D+  SDAES C LG+E         DG   +  R EL +YR TL  L++SGPL+WE+EA
Sbjct  286  ADSCSSDAESSCGLGEEPRWKHSSVGDGARNSC-RSELYSYRSTLGELFSSGPLSWEQEA  344

Query  238  LLTNLLTELHISDDEHLRE  182
             LT+L   L+ISDDEHL E
Sbjct  345  SLTDLRLSLNISDDEHLME  363



>ref|XP_009412489.1| PREDICTED: uncharacterized protein LOC103993966 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412490.1| PREDICTED: uncharacterized protein LOC103993966 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412491.1| PREDICTED: uncharacterized protein LOC103993966 [Musa acuminata 
subsp. malaccensis]
Length=397

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = -2

Query  400  DAESVCPL-GDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNL  224
            DA S CP+ G E  S S    D L   +H LEL+AY+ T+QAL+ASGPL+WE+E+LLTNL
Sbjct  320  DAVSSCPIEGKEYQSKS---GDELAANVHELELQAYQYTMQALHASGPLSWEQESLLTNL  376

Query  223  LTELHISDDE  194
               L+IS++E
Sbjct  377  RLSLNISNEE  386



>ref|XP_006650728.1| PREDICTED: uncharacterized protein LOC102711242 [Oryza brachyantha]
Length=299

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLGE----TIHRLELRAYRCTLQALYASGPLTWEKEALL  233
            DA S CP          +     GE     +H LEL AY+ T++ALYASGPLTWE+E+LL
Sbjct  215  DAMSSCPCTSSMEDAGGVSSSAGGEPPAIAVHELELEAYQSTMRALYASGPLTWEQESLL  274

Query  232  TNLLTELHISDDEH  191
            TNL   L+IS++EH
Sbjct  275  TNLRLSLNISNEEH  288



>gb|KDO80332.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
 gb|KDO80333.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
Length=409

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -2

Query  418  SDALVSDAESVCPLG-DEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            S+   SDAES C L  DE + H P  +D L   IHRLEL AYRCT++AL+ASGPL+WE+E
Sbjct  323  SNGNFSDAESFCHLAYDEGNCHLPRKED-LAAEIHRLELHAYRCTMEALHASGPLSWEQE  381

Query  241  AL  236
            AL
Sbjct  382  AL  383



>ref|XP_010432715.1| PREDICTED: uncharacterized protein LOC104716934 [Camelina sativa]
Length=387

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -2

Query  397  AESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLT  218
            AES C L +E         DG   +  R EL  YR TL  L++SGPL+WE+EA LT+L  
Sbjct  303  AESSCGLEEEARREHSSARDGARRSC-RSELYTYRSTLGELFSSGPLSWEQEASLTDLRL  361

Query  217  ELHISDDEHLRELKHLIS  164
             L+ISDDEHL E+++LIS
Sbjct  362  SLNISDDEHLMEVRNLIS  379



>ref|XP_002463742.1| hypothetical protein SORBIDRAFT_01g005220 [Sorghum bicolor]
 gb|EER90740.1| hypothetical protein SORBIDRAFT_01g005220 [Sorghum bicolor]
Length=307

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            +H LEL AYR T++ALYASGPLTWE+EALLTNL   L+IS++EH
Sbjct  254  VHGLELEAYRSTMRALYASGPLTWEQEALLTNLRLSLNISNEEH  297



>ref|XP_008219898.1| PREDICTED: uncharacterized protein LOC103320063 [Prunus mume]
Length=377

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 80/157 (51%), Gaps = 23/157 (15%)
 Frame = -2

Query  646  PRETLGEKYMHASFNVISNGCNEMYEEKLHGVFCHsssttsefsdsdsgssvgscsvvsn  467
            PRE LGEKY+ ASF   + GC E   E+L+G    S   +SE  D DS +       V +
Sbjct  227  PRENLGEKYVQASFINRTTGCFEKEREELNGAISLSVERSSELDDCDSDACSVGSCSVIS  286

Query  466  SPINP-GLHFVPVHRKVSDALVSDAESVCPLGDEDSSHS-PLPDDGLGETIHRLELRAYR  293
            S  N    H +    + SD L SDA+S C  GD   + S PL +                
Sbjct  287  SNSNKFSSHNLAGTSQDSDTLSSDADSFC--GDAQENFSVPLEE----------------  328

Query  292  CTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRE  182
                A++ASG LTWE+EALLTNL   LHIS+DEHL E
Sbjct  329  ---VAMHASGSLTWEQEALLTNLRISLHISNDEHLIE  362



>ref|XP_006400568.1| hypothetical protein EUTSA_v10014035mg [Eutrema salsugineum]
 gb|ESQ42021.1| hypothetical protein EUTSA_v10014035mg [Eutrema salsugineum]
Length=338

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  331  GETIHRLELRAYRCTLQALYASGPL-TWEKEALLTNLLTELHISDDEHLRELKHLIS  164
             + +HRLEL AYRC+++ L+ASGP+ TWE+E  +TNL   L+IS++EHL ++++LIS
Sbjct  274  ADDVHRLELDAYRCSIERLHASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  330



>ref|XP_006289073.1| hypothetical protein CARUB_v10002476mg [Capsella rubella]
 gb|EOA21971.1| hypothetical protein CARUB_v10002476mg [Capsella rubella]
Length=326

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPL-TWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            +HRLEL AYRC+++ L+ASGP+ TWE+E  +TNL   L+IS++EHL ++++LIS
Sbjct  265  VHRLELDAYRCSIERLHASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  318



>ref|XP_002873978.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50237.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPL-TWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            +HRLEL AYRC+++ L+ASGP+ TWE+E  +TNL   L+IS++EHL ++++LIS
Sbjct  264  VHRLELDAYRCSIERLHASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  317



>ref|XP_009420672.1| PREDICTED: uncharacterized protein LOC104000372 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420673.1| PREDICTED: uncharacterized protein LOC104000372 [Musa acuminata 
subsp. malaccensis]
Length=397

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -2

Query  406  VSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTN  227
            + DA S CPLG      +   D+ L   +H LEL AY+ T++AL+ASGPL+WE+E+LLTN
Sbjct  317  LGDAMSSCPLGGGKEYETEFGDE-LTANVHELELYAYQSTVKALHASGPLSWEQESLLTN  375

Query  226  LLTELHISDDE  194
            L   L+IS++E
Sbjct  376  LRLSLNISNEE  386



>gb|EAY92179.1| hypothetical protein OsI_13894 [Oryza sativa Indica Group]
Length=817

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            +H LEL AY+ T++ALYASGPLTWE+E+LLTNL   L+IS++EH
Sbjct  763  VHELELEAYQSTMRALYASGPLTWEQESLLTNLRLSLNISNEEH  806



>tpg|DAA59766.1| TPA: hypothetical protein ZEAMMB73_643406 [Zea mays]
Length=73

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  340  DGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLREL  179
             GL   +H LEL+AY+ T++A +A+GPLTWE+E+LLTNL   L+IS++EHL + 
Sbjct  16   SGLFLNVHELELQAYQSTVRAFHAAGPLTWEQESLLTNLRLSLNISNEEHLLQF  69



>dbj|BAK08257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -2

Query  361  SHSPLPDDG-LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            S   L D G  G  +H LEL AYR T++AL+ASGPLTWE+E+LLTNL   L+IS++EH
Sbjct  210  SEGALSDGGPAGVDVHELELEAYRSTVRALHASGPLTWEQESLLTNLRLSLNISNEEH  267



>ref|XP_009125972.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103850924 
[Brassica rapa]
Length=402

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDE-DSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  S+AES C L +E    HS    DG+  +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  265  ADSCSSEAESFCGLREEARRKHSVAGGDGVRRSC-RSELYTYRSTLGDLFASGPLSWEQE  323

Query  241  ALLTNLLTELHISDDEHLRE  182
              LT+L   L+ISDDEHL E
Sbjct  324  TSLTDLRLSLNISDDEHLME  343



>emb|CDX75245.1| BnaA01g04570D [Brassica napus]
Length=361

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDE-DSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  S+AES C L +E    HS    DG+  +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  266  ADSCSSEAESFCGLREEARRKHSVAGGDGVRRSC-RSELYTYRSTLGDLFASGPLSWEQE  324

Query  241  ALLTNLLTELHISDDEHLRE  182
              LT+L   L+ISDDEHL E
Sbjct  325  TSLTDLRLSLNISDDEHLME  344



>ref|XP_010493095.1| PREDICTED: uncharacterized protein LOC104770379 [Camelina sativa]
Length=326

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = -2

Query  406  VSDAES-VCPLGDEDSSHSPLPDDGL-GETIHRLELRAYRCTLQALYASGPL-TWEKEAL  236
             SD ES  C  G  +     +P  G     +HRLEL AYR +++ L+ASGP+ TWE+E  
Sbjct  235  TSDTESSFCGYGSMEMKKLEIPRKGSEAADVHRLELDAYRSSIERLHASGPIITWEQETW  294

Query  235  LTNLLTELHISDDEHLRELKHLIS  164
            +TNL   L+IS++EHL ++++LIS
Sbjct  295  ITNLRLRLNISNEEHLMQIRNLIS  318



>emb|CDX68847.1| BnaC01g06060D [Brassica napus]
Length=360

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -2

Query  418  SDALVSDAESVCPLGDE-DSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  S+AES C L +E    HS    DG+  +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  265  ADSCSSEAESFCGLREEARRKHSLAGGDGVRRSC-RSELYTYRSTLGDLFASGPLSWEQE  323

Query  241  ALLTNLLTELHISDDEHLRE  182
              LT+L   L+ISDDEHL E
Sbjct  324  TSLTDLRLSLNISDDEHLME  343



>ref|XP_010670878.1| PREDICTED: uncharacterized protein LOC104887824 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -2

Query  412  ALVSDAESVC-PLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            +L SD ES    LG+E+   S     G     H L+L  YR  L+ LY+SGPL+WE+E  
Sbjct  181  SLSSDGESYSHDLGEEEEVSSAQFQRGDALKAHELKLHGYRGVLELLYSSGPLSWEQEIE  240

Query  235  LTNLLTELHISDDEHLRELKHLISAK  158
            LT L  +L +S+DEHL EL+ L S++
Sbjct  241  LTKLRLKLSVSNDEHLTELRRLKSSR  266



>gb|ACN27195.1| unknown [Zea mays]
Length=75

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  340  DGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
             GL   +H LEL+AY+ T++A +A+GPLTWE+E+LLTNL   L+IS++EH
Sbjct  16   SGLFLNVHELELQAYQSTVRAFHAAGPLTWEQESLLTNLRLSLNISNEEH  65



>ref|NP_001051555.1| Os03g0796400 [Oryza sativa Japonica Group]
 gb|AAT76412.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99343.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13469.1| Os03g0796400 [Oryza sativa Japonica Group]
 gb|EEE60092.1| hypothetical protein OsJ_12949 [Oryza sativa Japonica Group]
Length=298

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            +H LEL AY+ T++ALYASGPLTWE+E+LLTNL   L+IS++EH
Sbjct  244  VHELELEAYQSTMRALYASGPLTWEQESLLTNLRLSLNISNEEH  287



>emb|CDY69656.1| BnaA03g56010D [Brassica napus]
 emb|CDX88864.1| BnaA03g07850D [Brassica napus]
Length=304

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = -2

Query  355  SPLPDDGLGETIHRLELRAYRCTLQALYASGP-LTWEKEALLTNLLTELHISDDEHLREL  179
            SP  D   G+ +HRLEL  YR +++ L+ASGP +TWE+E  +TNL   L+IS++EHL ++
Sbjct  233  SPAKDSEAGD-VHRLELDEYRSSIERLHASGPNITWEQETWITNLRLRLNISNEEHLMQI  291

Query  178  KHLIS  164
            K+LIS
Sbjct  292  KNLIS  296



>ref|XP_009126409.1| PREDICTED: uncharacterized protein LOC103851318 [Brassica rapa]
Length=313

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -2

Query  346  PDDGLGETIHRLELRAYRCTLQALYASGP-LTWEKEALLTNLLTELHISDDEHLRELKHL  170
            P       +HRLEL  YRC+++ L+ASGP +TWE+E  +TNL   L+IS++EHL ++++L
Sbjct  244  PKGSEAADVHRLELDEYRCSIERLHASGPNITWEQETWITNLRLRLNISNEEHLMQIRNL  303

Query  169  IS  164
            IS
Sbjct  304  IS  305



>gb|ADE77810.1| unknown [Picea sitchensis]
Length=162

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = -2

Query  460  INPGLHFVPVHRKVSDALVSDAESV--CPLGDEDSSHSPLPDDGLGETIHRLELRAYRCT  287
            I+  +  +   + VS + V DA+S   C  G  D   S   ++ +    H  +L  Y   
Sbjct  61   IDMSVDRMSPRQTVSSSHVDDAQSSHECANGSYDGFSS---EEEVATEAHEKKLYTYFSV  117

Query  286  LQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            L+ L+ASGPL+W++EALLTNL   L++S+DEHL EL+ L S +A+
Sbjct  118  LRDLHASGPLSWDQEALLTNLRLSLNVSNDEHLFELRRLCSTQAT  162



>ref|XP_004955643.1| PREDICTED: uncharacterized protein LOC101762906 isoform X1 [Setaria 
italica]
 ref|XP_004955644.1| PREDICTED: uncharacterized protein LOC101762906 isoform X2 [Setaria 
italica]
 ref|XP_004955645.1| PREDICTED: uncharacterized protein LOC101762906 isoform X3 [Setaria 
italica]
Length=362

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 5/72 (7%)
 Frame = -2

Query  400  DAESVCPLGDEDSSHSPLPDDGLG--ETIHRLELRAYRCTLQALYASGPLTWEKEALLTN  227
            DA S CP     S+     D+G G    IH LEL+AY+ T++A +A+GPLTWE+E+LLTN
Sbjct  284  DAMSACP---SMSAQENNDDNGSGLHMNIHELELQAYQSTVRAFHAAGPLTWEQESLLTN  340

Query  226  LLTELHISDDEH  191
            L   L+IS++EH
Sbjct  341  LRLSLNISNEEH  352



>ref|XP_006412474.1| hypothetical protein EUTSA_v10025566mg [Eutrema salsugineum]
 gb|ESQ53927.1| hypothetical protein EUTSA_v10025566mg [Eutrema salsugineum]
Length=356

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = -2

Query  418  SDALVSDAESVCPL-GDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKE  242
            +D+  SDAES C L G+    HS    DG+  +  R EL  YR TL  L+ASGPL+WE+E
Sbjct  266  ADSCNSDAESSCGLAGEVRRKHSS--GDGVRRSC-RSELYTYRSTLGDLFASGPLSWEQE  322

Query  241  ALLTNLLTELHISDDEHLRE  182
              LT+L   L+ISDDEHL E
Sbjct  323  TSLTDLRLSLNISDDEHLME  342



>ref|XP_010667644.1| PREDICTED: uncharacterized protein LOC104884659 [Beta vulgaris 
subsp. vulgaris]
Length=261

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -2

Query  370  EDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            ED   S     G     H+L+L  YRC L+ LY+SGPL+W +E  LT+L  +L +S+DEH
Sbjct  183  EDEVSSAQFQRGDALEAHKLDLYGYRCVLELLYSSGPLSWRQEIALTDLRLKLSVSNDEH  242

Query  190  LRELKHLISAK  158
            L EL+ L S +
Sbjct  243  LTELRRLKSGR  253



>ref|XP_010670102.1| PREDICTED: uncharacterized protein LOC104887204 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 11/86 (13%)
 Frame = -2

Query  412  ALVSDAESVC-PLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            +L SDAES    LG+E+   S           H L+L  YRC L+ LY SGPL+W++E  
Sbjct  190  SLSSDAESYSLDLGEEEEVSSD----------HELKLHGYRCVLELLYKSGPLSWQQEIE  239

Query  235  LTNLLTELHISDDEHLRELKHLISAK  158
            LT L  +L +S+DEHL EL+ L S++
Sbjct  240  LTKLRLKLSVSNDEHLAELRRLKSSR  265



>ref|XP_002878866.1| hypothetical protein ARALYDRAFT_344161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55125.1| hypothetical protein ARALYDRAFT_344161 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -2

Query  418  SDALVSDAESVC-PLGDEDSSHSPLPDDGLGETIH--RLELRAYRCTLQALYASGPLTWE  248
            +D+  SDAES     G  + +       G G  +   R EL  YR TL+ L+ASGPL+W+
Sbjct  285  ADSCSSDAESSKEAFGCREEARRKHSLSGNGAVVRSCRPELYTYRSTLRKLFASGPLSWD  344

Query  247  KEALLTNLLTELHISDDEHLRELKHLISA  161
            +EA LT+L   L+IS+DEHL EL++L SA
Sbjct  345  QEASLTDLRLSLNISNDEHLMELRNLKSA  373



>ref|XP_010670861.1| PREDICTED: uncharacterized protein LOC104887807 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 11/86 (13%)
 Frame = -2

Query  412  ALVSDAESVC-PLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            +L SDAES    LG+E+   S           H L+L  YRC L+ LY SGPL+W++E  
Sbjct  190  SLSSDAESYSLDLGEEEEVSSD----------HELKLHGYRCVLELLYKSGPLSWQQEIE  239

Query  235  LTNLLTELHISDDEHLRELKHLISAK  158
            LT L  +L +S+DEHL EL+ L S++
Sbjct  240  LTKLRLKLSVSNDEHLAELRRLKSSR  265



>ref|XP_008656642.1| PREDICTED: uncharacterized protein LOC103636063 [Zea mays]
 gb|AFW83226.1| hypothetical protein ZEAMMB73_917839 [Zea mays]
Length=396

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -2

Query  346  PDDGLG----ETIHRLELRAYRCTLQALYASG-PLTWEKEALLTNLLTELHISDDEHLRE  182
            P D +G    E IHRLEL AY   ++A +ASG PL+WEKE LL++L   LHIS+DEHL+ 
Sbjct  325  PKDEMGATAREQIHRLELEAYAALMKAFHASGNPLSWEKEGLLSDLRVHLHISNDEHLKA  384

Query  181  LKHLISAKA  155
            +  +++ K 
Sbjct  385  INVILNRKG  393



>gb|ADE77621.1| unknown [Picea sitchensis]
Length=317

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  325  TIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            T+H+LE  AYR  LQA +A G L WE+EALLTNL  +LHI+ +EH  EL+ L+S
Sbjct  258  TMHKLEANAYRSVLQAFHAQGSLNWEREALLTNLRLKLHITCEEHRLELEKLVS  311



>ref|XP_010228418.1| PREDICTED: uncharacterized protein LOC100837427 isoform X2 [Brachypodium 
distachyon]
Length=291

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            +H LEL AYR T++AL+ASGPLTWE+E+LLTNL   L+IS++EH
Sbjct  238  VHELELEAYRSTVRALHASGPLTWEQESLLTNLRLSLNISNEEH  281



>ref|XP_010228411.1| PREDICTED: uncharacterized protein LOC100837427 isoform X1 [Brachypodium 
distachyon]
Length=295

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            +H LEL AYR T++AL+ASGPLTWE+E+LLTNL   L+IS++EH
Sbjct  242  VHELELEAYRSTVRALHASGPLTWEQESLLTNLRLSLNISNEEH  285



>emb|CDY42325.1| BnaC02g09310D [Brassica napus]
Length=307

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPL-TWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            +H+LEL  YRC+++ L+ASGP+ TWE+E  +TNL   L+IS++EHL ++++LIS
Sbjct  246  VHKLELDEYRCSIERLHASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  299



>ref|XP_011026079.1| PREDICTED: uncharacterized protein LOC105126795 [Populus euphratica]
 ref|XP_011026080.1| PREDICTED: uncharacterized protein LOC105126795 [Populus euphratica]
 ref|XP_011026081.1| PREDICTED: uncharacterized protein LOC105126795 [Populus euphratica]
 ref|XP_011026082.1| PREDICTED: uncharacterized protein LOC105126795 [Populus euphratica]
 ref|XP_011026083.1| PREDICTED: uncharacterized protein LOC105126795 [Populus euphratica]
 ref|XP_011026084.1| PREDICTED: uncharacterized protein LOC105126795 [Populus euphratica]
Length=383

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  355  SPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISD  200
            +P  +   G  IH LE  AYR T++ALYASGPL+WE+E+LLTNL   L+ISD
Sbjct  316  TPCFEQKQGAEIHELEFHAYRSTVRALYASGPLSWEQESLLTNLRLSLNISD  367



>ref|NP_197503.1| plant Tudor-like RNA-binding protein [Arabidopsis thaliana]
 gb|AAM62492.1| unknown [Arabidopsis thaliana]
 gb|AAO24570.1| At5g20030 [Arabidopsis thaliana]
 gb|AED92781.1| plant Tudor-like RNA-binding protein [Arabidopsis thaliana]
Length=326

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPL-TWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            +HRLEL AYR +++ L+ASGP+ TWE+E  +TNL  +L+IS++EHL ++++LIS
Sbjct  265  VHRLELDAYRSSIERLHASGPIITWEQETWITNLRLKLNISNEEHLMQIRNLIS  318



>emb|CDY44959.1| BnaA02g04640D [Brassica napus]
Length=313

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -2

Query  346  PDDGLGETIHRLELRAYRCTLQALYASGP-LTWEKEALLTNLLTELHISDDEHLRELKHL  170
            P       +H+LEL  YRC+++ L+ASGP +TWE+E  +TNL   L+IS++EHL ++++L
Sbjct  244  PKASEAADVHKLELDEYRCSIERLHASGPNITWEQETWITNLRLRLNISNEEHLMQIRNL  303

Query  169  IS  164
            IS
Sbjct  304  IS  305



>ref|NP_001145054.1| uncharacterized protein LOC100278243 [Zea mays]
 gb|ACG44670.1| hypothetical protein [Zea mays]
Length=229

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  337  GLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            GL   +H LEL+AY+ T++A +A+GPLTWE+E+LLTNL   L+IS++EH
Sbjct  171  GLFLNVHELELQAYQSTVRAFHAAGPLTWEQESLLTNLRLSLNISNEEH  219



>ref|XP_010942488.1| PREDICTED: uncharacterized protein LOC105060469 [Elaeis guineensis]
Length=332

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 52/97 (54%), Gaps = 15/97 (15%)
 Frame = -2

Query  391  SVCPLGDEDSS--------------HSPLPDDGLGETIHRLELRAYRCTLQALYASGPLT  254
            + CP  D DSS              +S   D+  G+  H LEL AY  TL  L +SG LT
Sbjct  235  AACPTQDTDSSLSTVDAYRRAIKKLYSAKKDEWAGK-FHHLELHAYHLTLMKLNSSGTLT  293

Query  253  WEKEALLTNLLTELHISDDEHLRELKHLISAKASYDT  143
            W++E  LTNL   LHIS+DEH  ELK L S ++  ++
Sbjct  294  WKQEGYLTNLRLGLHISNDEHQSELKRLASTQSDRES  330



>ref|XP_008651255.1| PREDICTED: uncharacterized protein LOC100278243 isoform X1 [Zea 
mays]
 ref|XP_008651256.1| PREDICTED: uncharacterized protein LOC100278243 isoform X1 [Zea 
mays]
 ref|XP_008651257.1| PREDICTED: uncharacterized protein LOC100278243 isoform X1 [Zea 
mays]
 tpg|DAA59767.1| TPA: hypothetical protein ZEAMMB73_643406 [Zea mays]
Length=229

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  337  GLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            GL   +H LEL+AY+ T++A +A+GPLTWE+E+LLTNL   L+IS++EH
Sbjct  171  GLFLNVHELELQAYQSTVRAFHAAGPLTWEQESLLTNLRLSLNISNEEH  219



>ref|XP_008651258.1| PREDICTED: uncharacterized protein LOC100278243 isoform X2 [Zea 
mays]
Length=228

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  337  GLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            GL   +H LEL+AY+ T++A +A+GPLTWE+E+LLTNL   L+IS++EH
Sbjct  170  GLFLNVHELELQAYQSTVRAFHAAGPLTWEQESLLTNLRLSLNISNEEH  218



>gb|EAY74934.1| hypothetical protein OsI_02828 [Oryza sativa Indica Group]
Length=468

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            +GE IHRLE+ AY   ++  +A+G LTWEKE LLT L  +LH+S DEHL+ ++ L   +
Sbjct  402  VGEQIHRLEVDAYGALMRVFHATGALTWEKEELLTQLRLQLHVSSDEHLQLIRALNGGR  460



>ref|XP_010942486.1| PREDICTED: uncharacterized protein LOC105060465 [Elaeis guineensis]
Length=277

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  319  HRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASYDT  143
            H LEL  Y CT+ ALY+    TWE+EA +T+L   LHIS DEH  ELKHL S ++  ++
Sbjct  217  HHLELHTYHCTMMALYSPEHFTWEQEAFMTDLRLHLHISTDEHREELKHLASTQSDRES  275



>dbj|BAD61500.1| hypothetical protein [Oryza sativa Japonica Group]
Length=429

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHL  170
            +GE IHRLE+ AY   ++  +A+G LTWEKE LLT L  +LH+S DEHL+ ++ L
Sbjct  363  VGEQIHRLEVDAYGALMRVFHATGALTWEKEELLTQLRLQLHVSSDEHLQLIRAL  417



>gb|EEE54973.1| hypothetical protein OsJ_02576 [Oryza sativa Japonica Group]
Length=361

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHL  170
            +GE IHRLE+ AY   ++  +A+G LTWEKE LLT L  +LH+S DEHL+ ++ L
Sbjct  295  VGEQIHRLEVDAYGALMRVFHATGALTWEKEELLTQLRLQLHVSSDEHLQLIRAL  349



>ref|XP_010437909.1| PREDICTED: uncharacterized protein LOC104721588 isoform X1 [Camelina 
sativa]
Length=379

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -2

Query  397  AESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLT  218
            AES C L +E         DG G +  R EL  YR TL  L++SGPL+WE+E  LT+L  
Sbjct  307  AESSCGLEEEARRTLSSARDGAGRSC-RSELYTYRSTLGELFSSGPLSWEQEVSLTDLRL  365

Query  217  ELHISDDEHLRE  182
             L+ISDDEHL E
Sbjct  366  SLNISDDEHLME  377



>ref|XP_006294433.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
 ref|XP_006294434.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
 gb|EOA27331.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
 gb|EOA27332.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
Length=376

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = -2

Query  442  FVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIH--RLELRAYRCTLQALYA  269
            F+    + +D+  SDAES             L ++  G  +   R EL  YR TL  L+A
Sbjct  284  FLDGSSRGADSCSSDAES-------SKETFGLREEAGGGAVRSCRQELYTYRRTLGKLFA  336

Query  268  SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            SGPL W++EA LT+L   L+IS+DEHL EL++L SA
Sbjct  337  SGPLNWDQEASLTDLRLSLNISNDEHLTELRNLKSA  372



>ref|XP_008461071.1| PREDICTED: uncharacterized protein LOC103499772 [Cucumis melo]
Length=201

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -2

Query  403  SDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPL-TWEKEALLTN  227
            SDAES     +++   S   ++ L E  HR EL  +R  + ALYASGPL +WE E  ++N
Sbjct  115  SDAESSSIGREQEEEDSCSYEEVLAE-FHRSELSVFRSFIGALYASGPLLSWEDEGEVSN  173

Query  226  LLTELHISDDEHLRELKHLISA  161
            +   LH+S+DE+L ELK+LIS 
Sbjct  174  IRALLHVSNDEYLLELKNLIST  195



>ref|XP_006392332.1| hypothetical protein EUTSA_v10023523mg [Eutrema salsugineum]
 gb|ESQ29618.1| hypothetical protein EUTSA_v10023523mg [Eutrema salsugineum]
Length=384

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 5/93 (5%)
 Frame = -2

Query  442  FVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASG  263
            F+    + SD+  SDAES      +++        G G    R EL  YR TL  L+ASG
Sbjct  289  FLDGSSQESDSCGSDAES-----SKEAFGYVGEASGGGARSCRPELYTYRSTLGKLFASG  343

Query  262  PLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            PL W++EA LT+L   L+IS DEHL EL++L S
Sbjct  344  PLNWDQEASLTDLRLSLNISTDEHLMELRNLKS  376



>ref|XP_010472563.1| PREDICTED: uncharacterized protein LOC104752191 isoform X4 [Camelina 
sativa]
 ref|XP_010472564.1| PREDICTED: uncharacterized protein LOC104752191 isoform X4 [Camelina 
sativa]
 ref|XP_010472565.1| PREDICTED: uncharacterized protein LOC104752191 isoform X4 [Camelina 
sativa]
Length=411

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = -2

Query  418  SDALVSDAES---VCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            +D+  SDAES      L +E S    L   G   +  R EL  Y  TL  L+ASGPL W+
Sbjct  297  ADSFSSDAESSEEAFGLREEASWKHSLASGGAVRS-SRPELYTYCRTLGKLFASGPLNWD  355

Query  247  KEALLTNLLTELHISDDEHLRELKHLISA  161
            +EA LT+L   LHIS DEHL EL++L SA
Sbjct  356  QEASLTDLRLSLHISVDEHLMELRNLKSA  384



>gb|AFW83227.1| hypothetical protein ZEAMMB73_750073 [Zea mays]
Length=295

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  328  ETIHRLELRAYRCTLQALYASG-PLTWEKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            E IHRLEL AY   ++A +A G  L+WEKE LL++L T LHIS+DEHL+ +  +++ K 
Sbjct  234  EQIHRLELEAYAALMKAFHACGNALSWEKEELLSDLRTNLHISNDEHLKAINVILNRKG  292



>ref|XP_010423760.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423761.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423762.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423763.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423764.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423765.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423766.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423767.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423768.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423769.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
Length=408

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = -2

Query  418  SDALVSDAES---VCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            +D+  SDAES      L +E S    L   G   +  R EL  Y  TL  L+ASGPL W+
Sbjct  294  ADSFSSDAESSEEAFGLREEASWKHSLASGGAVRS-SRPELYTYCRTLGKLFASGPLNWD  352

Query  247  KEALLTNLLTELHISDDEHLRELKHLISA  161
            +EA LT+L   L+IS DEHL EL+HL SA
Sbjct  353  QEASLTDLRLSLNISVDEHLMELRHLKSA  381



>ref|XP_010670872.1| PREDICTED: uncharacterized protein LOC104887818 [Beta vulgaris 
subsp. vulgaris]
Length=285

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -2

Query  412  ALVSDAESVC-PLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            +L S AES    LG+E+   S     G     H L+L  YR  L+ L++SGPL+W++E  
Sbjct  188  SLSSYAESYSHDLGEEEEVSSAQFQKGDALEAHELKLHGYRYVLELLFSSGPLSWQQEIE  247

Query  235  LTNLLTELHISDDEHLRELKHL  170
            LT L  +L +S+DEHL+EL+ L
Sbjct  248  LTKLRLKLSVSNDEHLKELRRL  269



>emb|CDX70905.1| BnaC03g09890D [Brassica napus]
Length=312

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -2

Query  361  SHSPLPDDGLGETIHRLELRAYRCTLQALYASGP-LTWEKEALLTNLLTELHISDDEHLR  185
            S+ P       + +H LEL  YR +++ L+ASGP +TWE+E  +TNL   L+IS++EHL 
Sbjct  238  SNFPANSSEAADVVHMLELDEYRSSIERLHASGPNITWEQETWITNLRLRLNISNEEHLM  297

Query  184  ELKHLISA  161
            ++++LIS 
Sbjct  298  QIRNLISV  305



>emb|CDY35351.1| BnaA04g14960D [Brassica napus]
Length=350

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 65/136 (48%), Gaps = 17/136 (13%)
 Frame = -2

Query  451  GLHFVPVHRKVSDALVSDAESVCPL--GDEDSSHSPLPD---------DGLGETIHRL--  311
            GL   P  R V    + D    C L    ED   S   D          G  + + R   
Sbjct  130  GLIEKPRERSVVSIRLIDGRRCCYLLSNGEDGGSSQDADSYTSDAESSKGCRQEVRRFCR  189

Query  310  -ELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAKASYDT*G-  137
             EL  YR TL  L+A GPL W++EA LT+L   L+IS+DEHL E+++L S+  +    G 
Sbjct  190  PELSTYRSTLGKLFAQGPLNWDQEASLTDLRLSLNISNDEHLMEIRNLTSSAGTSLQCGI  249

Query  136  SC--LFCSSWVIFIPL  95
            SC  LF S  V+ + +
Sbjct  250  SCYILFFSKRVLIVMI  265



>ref|XP_004136079.1| PREDICTED: uncharacterized protein LOC101221277 [Cucumis sativus]
 ref|XP_004158806.1| PREDICTED: uncharacterized LOC101221277 [Cucumis sativus]
 gb|KGN45303.1| hypothetical protein Csa_7G433320 [Cucumis sativus]
Length=252

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPL-TWEKEALLTNLLTELHISDDEHLRELKHLISA  161
             HR EL  +R  ++ALYASGPL +WE E  ++N+   LH+S+DE+L ELK+LIS 
Sbjct  192  FHRSELSVFRSFIRALYASGPLLSWEDEGEVSNIRALLHVSNDEYLLELKNLIST  246



>gb|EMT23141.1| hypothetical protein F775_02552 [Aegilops tauschii]
Length=401

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            +H LEL AY   ++A Y +GPLTW KE LL++L  +LH+S DEHL+ +  L   K
Sbjct  347  VHGLELEAYVSVMKAFYFTGPLTWAKEELLSDLRLQLHVSSDEHLQAIWRLKGKK  401



>ref|XP_010417324.1| PREDICTED: uncharacterized protein LOC104703086 isoform X1 [Camelina 
sativa]
 ref|XP_010417326.1| PREDICTED: uncharacterized protein LOC104703086 isoform X1 [Camelina 
sativa]
Length=408

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = -2

Query  418  SDALVSDAES---VCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            +D+  SDAES      L +E S    L   G   +  R EL  Y   L  L+ASGPL W+
Sbjct  294  ADSFSSDAESSEEAFGLREEASWKHSLASGGAVRS-SRPELYTYCRKLGKLFASGPLNWD  352

Query  247  KEALLTNLLTELHISDDEHLRELKHLISA  161
            +EA LT+L   L+IS DEHL EL+HL SA
Sbjct  353  QEASLTDLRLSLNISVDEHLMELRHLKSA  381



>emb|CDX76748.1| BnaC08g33340D [Brassica napus]
Length=281

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = -2

Query  361  SHSPLPDDGLGETIHRL---ELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEH  191
            S   + ++  G T+ R    EL  YR TL  L+ASGPL W +EA LT+L   L+IS DEH
Sbjct  207  SSKGVREEATGGTVRRSCRPELYTYRSTLGKLFASGPLDWNQEASLTDLRLSLNISTDEH  266

Query  190  LRELKHLISAKASY  149
            L E+++L S  + +
Sbjct  267  LMEIRNLKSTHSKF  280



>ref|XP_010472558.1| PREDICTED: uncharacterized protein LOC104752191 isoform X1 [Camelina 
sativa]
Length=436

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = -2

Query  418  SDALVSDAES---VCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            +D+  SDAES      L +E S    L   G   +  R EL  Y  TL  L+ASGPL W+
Sbjct  297  ADSFSSDAESSEEAFGLREEASWKHSLASGGAVRS-SRPELYTYCRTLGKLFASGPLNWD  355

Query  247  KEALLTNLLTELHISDDEHLRELKHL  170
            +EA LT+L   LHIS DEHL EL++L
Sbjct  356  QEASLTDLRLSLHISVDEHLMELRNL  381



>ref|XP_009413910.1| PREDICTED: uncharacterized protein LOC103995118 [Musa acuminata 
subsp. malaccensis]
Length=378

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  340  DGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDE  194
            D L   +H LEL AY  T++A +ASGPL+WE+E+LLTNL   L+IS++E
Sbjct  319  DELAANVHELELHAYHSTVEAFHASGPLSWEQESLLTNLRLSLNISNEE  367



>ref|XP_010472562.1| PREDICTED: uncharacterized protein LOC104752191 isoform X3 [Camelina 
sativa]
Length=417

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = -2

Query  418  SDALVSDAES---VCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            +D+  SDAES      L +E S    L   G   +  R EL  Y  TL  L+ASGPL W+
Sbjct  297  ADSFSSDAESSEEAFGLREEASWKHSLASGGAVRS-SRPELYTYCRTLGKLFASGPLNWD  355

Query  247  KEALLTNLLTELHISDDEHLRELKHL  170
            +EA LT+L   LHIS DEHL EL++L
Sbjct  356  QEASLTDLRLSLHISVDEHLMELRNL  381



>ref|XP_010472559.1| PREDICTED: uncharacterized protein LOC104752191 isoform X2 [Camelina 
sativa]
 ref|XP_010472560.1| PREDICTED: uncharacterized protein LOC104752191 isoform X2 [Camelina 
sativa]
 ref|XP_010472561.1| PREDICTED: uncharacterized protein LOC104752191 isoform X2 [Camelina 
sativa]
Length=430

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = -2

Query  418  SDALVSDAES---VCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWE  248
            +D+  SDAES      L +E S    L   G   +  R EL  Y  TL  L+ASGPL W+
Sbjct  297  ADSFSSDAESSEEAFGLREEASWKHSLASGGAVRS-SRPELYTYCRTLGKLFASGPLNWD  355

Query  247  KEALLTNLLTELHISDDEHLRELKHL  170
            +EA LT+L   LHIS DEHL EL++L
Sbjct  356  QEASLTDLRLSLHISVDEHLMELRNL  381



>ref|XP_010233454.1| PREDICTED: uncharacterized protein LOC104583298 [Brachypodium 
distachyon]
Length=468

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -2

Query  382  PLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHIS  203
            P  D+ ++ +   ++   E +H LEL AY   + A +A+G LTWEKE LL+NL   LHIS
Sbjct  381  PANDQAAAVTKQEEEQDYERVHDLELDAYVSVMAAFHATGSLTWEKEELLSNLRLHLHIS  440

Query  202  DDEHLRELKHL  170
             DEHL+ +  L
Sbjct  441  SDEHLQVIWRL  451



>ref|XP_008385872.1| PREDICTED: uncharacterized protein LOC103448379 isoform X2 [Malus 
domestica]
Length=376

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 5/74 (7%)
 Frame = -2

Query  415  DALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCTLQALYASGPLTWEKEAL  236
            D   SDAES   L  E+ +      + L + IHRLEL AYRCT+ AL+ASGPL+WE+E L
Sbjct  302  DDQFSDAESSFQLRYEEGNSLLPAKEELADEIHRLELHAYRCTIGALHASGPLSWEQEEL  361

Query  235  -----LTNLLTELH  209
                 L  LL+ L 
Sbjct  362  GQSRRLVXLLSSLQ  375



>ref|NP_001132464.1| hypothetical protein [Zea mays]
 ref|XP_008658130.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81313.1| unknown [Zea mays]
 gb|ACN25818.1| unknown [Zea mays]
 gb|AFW87078.1| hypothetical protein ZEAMMB73_964578 [Zea mays]
 gb|AFW87079.1| hypothetical protein ZEAMMB73_964578 [Zea mays]
Length=379

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 55/95 (58%), Gaps = 6/95 (6%)
 Frame = -2

Query  430  HRKVSDALVSDAESVCPLGDEDSSH------SPLPDDGLGETIHRLELRAYRCTLQALYA  269
            HR     LV+ +  +C   D D +       S   +DG     H LEL AYR T+ ALYA
Sbjct  279  HRSQYYNLVNQSGDICSRTDGDEAFTFERETSEHGNDGSRGETHLLELHAYRATMLALYA  338

Query  268  SGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
             G ++WE+EALLTNL   L+IS DEHL EL+ L++
Sbjct  339  CGSISWEQEALLTNLRLTLNISTDEHLAELRSLVT  373



>ref|XP_010911315.1| PREDICTED: uncharacterized protein LOC105037337 [Elaeis guineensis]
Length=335

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 48/94 (51%), Gaps = 17/94 (18%)
 Frame = -2

Query  388  VCPLGDEDS--------------SHSPLPDDGLGETIHRLELRAYRCT--LQALYASGPL  257
             CP  D DS              S+S   D+  G+  H LEL AYR T  +     S  L
Sbjct  233  ACPTQDMDSLLNNADAYRHAIRKSYSAKKDEQKGK-FHPLELHAYRLTSMMNTWKQSRAL  291

Query  256  TWEKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            TW++EA LTNL   LHIS+DEH  ELK L S ++
Sbjct  292  TWKQEAHLTNLRLRLHISNDEHQSELKRLASTQS  325



>emb|CDM81154.1| unnamed protein product [Triticum aestivum]
 emb|CDM81163.1| unnamed protein product [Triticum aestivum]
Length=447

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHL  170
            +H LEL AY   ++A  A+GPL+W KE LL++L   LH+S DEHL+ ++ L
Sbjct  387  VHGLELEAYVSVMKAFRATGPLSWAKEELLSDLRLHLHVSGDEHLQLIRSL  437



>dbj|BAD32839.1| agenet domain-containing protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD35446.1| agenet domain-containing protein-like [Oryza sativa Japonica 
Group]
Length=402

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGVFCHssst----tsefsdsdsgssvgscsvvsn  467
            LGEKYMHAS N   NG   ++   L GV   + +     TS +       S    S   +
Sbjct  242  LGEKYMHASLNKRKNG---VHTTNLAGVNVDTENKFRPLTSAYPSDTESISSSVGSCSPS  298

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCT  287
            S      HF   ++       +D         E S H  +      E  H LEL AYR T
Sbjct  299  SSPCSSRHFYSAYQTGDICSRTDGAEAAVSERETSQHDKIIPK---EDTHLLELHAYRAT  355

Query  286  LQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            + ALY  G ++WE+EALLTNL   L+IS DEHL EL+ ++S+
Sbjct  356  MLALYVCGSISWEQEALLTNLRLTLNISTDEHLAELRSMVSS  397



>ref|XP_002458148.1| hypothetical protein SORBIDRAFT_03g027680 [Sorghum bicolor]
 gb|EES03268.1| hypothetical protein SORBIDRAFT_03g027680 [Sorghum bicolor]
Length=435

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -2

Query  328  ETIHRLELRAYRCTLQALYASG-PLTWEKEALLTNLLTELHISDDEHLRELKHLISAKA  155
            E IH LEL AY   ++A +A G  L+WEKE LL++L   LHIS+DEHL+ L  +++ K+
Sbjct  371  EHIHSLELEAYAALMKAFHACGDALSWEKEGLLSDLRVHLHISNDEHLQVLNVILNRKS  429



>ref|XP_004969142.1| PREDICTED: uncharacterized protein LOC101756780 [Setaria italica]
Length=332

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -2

Query  328  ETIHRLELRAYRCTLQALYASGP-LTWEKEALLTNLLTELHISDDEHLRELKHLISAKAS  152
            E IHRLEL AY+  ++A +A G  L+W+K  LL++L   LHI++DEHL+ L  +++ K  
Sbjct  267  EHIHRLELEAYQNLMKAFHACGKVLSWQKMELLSDLRVHLHITNDEHLQVLNVILNRKGR  326

Query  151  Y  149
            +
Sbjct  327  F  327



>ref|XP_009376121.1| PREDICTED: uncharacterized protein LOC103964857 isoform X3 [Pyrus 
x bretschneideri]
Length=352

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            IH LE  AYR  L+A  A S  +TWEKE L+T L  EL +SDDEH REL  +++++
Sbjct  53   IHHLEQEAYRAVLRAFKAQSNAITWEKEGLITELRKELRVSDDEH-RELLTMVNSE  107



>ref|XP_009376118.1| PREDICTED: uncharacterized protein LOC103964857 isoform X1 [Pyrus 
x bretschneideri]
Length=374

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            IH LE  AYR  L+A  A S  +TWEKE L+T L  EL +SDDEH REL  +++++
Sbjct  53   IHHLEQEAYRAVLRAFKAQSNAITWEKEGLITELRKELRVSDDEH-RELLTMVNSE  107



>ref|XP_009376120.1| PREDICTED: uncharacterized protein LOC103964857 isoform X2 [Pyrus 
x bretschneideri]
Length=373

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            IH LE  AYR  L+A  A S  +TWEKE L+T L  EL +SDDEH REL  +++++
Sbjct  53   IHHLEQEAYRAVLRAFKAQSNAITWEKEGLITELRKELRVSDDEH-RELLTMVNSE  107



>ref|XP_009376122.1| PREDICTED: uncharacterized protein LOC103964857 isoform X4 [Pyrus 
x bretschneideri]
Length=330

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISAK  158
            IH LE  AYR  L+A  A S  +TWEKE L+T L  EL +SDDEH REL  +++++
Sbjct  9    IHHLEQEAYRAVLRAFKAQSNAITWEKEGLITELRKELRVSDDEH-RELLTMVNSE  63



>ref|XP_008465006.1| PREDICTED: uncharacterized protein LOC103502731 isoform X2 [Cucumis 
melo]
Length=374

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  334  LGETIHRLELRAYRCTLQALYASGPLTWEKEA  239
            L   IHRLEL+AYRCT++AL+ASGPL+W++EA
Sbjct  342  LAAEIHRLELQAYRCTIEALHASGPLSWDQEA  373



>ref|XP_008649109.1| PREDICTED: uncharacterized protein LOC103629786 isoform X1 [Zea 
mays]
 ref|XP_008649110.1| PREDICTED: uncharacterized protein LOC103629786 isoform X1 [Zea 
mays]
 ref|XP_008649111.1| PREDICTED: uncharacterized protein LOC103629786 isoform X1 [Zea 
mays]
 gb|AFW76427.1| hypothetical protein ZEAMMB73_873227 [Zea mays]
Length=370

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 6/95 (6%)
 Frame = -2

Query  430  HRKVSDALVSDAESVCPLGDEDSSH------SPLPDDGLGETIHRLELRAYRCTLQALYA  269
            HR     LV  +   C   D+D +       S   ++G  E  H LEL AYR T+ AL+A
Sbjct  270  HRSQHYNLVYQSGDSCSRTDDDEASTSERETSEHDNNGSREETHVLELHAYRATMLALHA  329

Query  268  SGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
             G ++WE+EALLTNL   L+IS DEHL EL+ L++
Sbjct  330  CGSISWEQEALLTNLRLTLNISIDEHLAELRSLVT  364



>gb|EEC80923.1| hypothetical protein OsI_23601 [Oryza sativa Indica Group]
Length=632

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 79/171 (46%), Gaps = 18/171 (11%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGV-------FCHsssttsefsdsdsgssvgscsv  476
            LGEKYMHAS N   NG   ++   L GV       FC  +S     ++S S S       
Sbjct  242  LGEKYMHASLNKRKNG---VHTTNLAGVNVDTENKFCPLTSAYPSDTESISSSVGSCSPS  298

Query  475  vsnSPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAY  296
             S        HF   ++       +D         E S H  +      E  H LEL AY
Sbjct  299  SSPCSSR---HFYSAYQTGDICSRTDGAEAAVSERETSQHDKIIPK---EDTHLLELHAY  352

Query  295  RCTLQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS--AKASY  149
            R T+ ALY  G ++WE+EALLTNL   L+IS DEHL EL+   S   KAS+
Sbjct  353  RATMLALYVCGSISWEQEALLTNLRLTLNISTDEHLAELRRPKSEACKASF  403



>ref|XP_008658132.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=360

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -2

Query  430  HRKVSDALVSDAESVCPLGDEDSSH------SPLPDDGLGETIHRLELRAYRCTLQALYA  269
            HR     LV+ +  +C   D D +       S   +DG     H LEL AYR T+ ALYA
Sbjct  279  HRSQYYNLVNQSGDICSRTDGDEAFTFERETSEHGNDGSRGETHLLELHAYRATMLALYA  338

Query  268  SGPLTWEKEALLTNLLTEL  212
             G ++WE+EALLTNL  ++
Sbjct  339  CGSISWEQEALLTNLRAKV  357



>ref|XP_009407886.1| PREDICTED: uncharacterized protein LOC103990463 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=472

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  53   IHRLEQEAYSSVLRAFKAQSDAITWEKESLITELRKELRVSDEEH-RELLSRVNA  106



>ref|XP_007203122.1| hypothetical protein PRUPE_ppa024006mg [Prunus persica]
 gb|EMJ04321.1| hypothetical protein PRUPE_ppa024006mg [Prunus persica]
Length=175

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEH  191
            IHR+E +AY   L+A  A S  LTW +EAL+T L  EL+ISDDEH
Sbjct  19   IHRMEAKAYHAVLRAFSAQSNNLTWGREALMTELRKELNISDDEH  63



>ref|XP_009407885.1| PREDICTED: uncharacterized protein LOC103990463 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  53   IHRLEQEAYSSVLRAFKAQSDAITWEKESLITELRKELRVSDEEH-RELLSRVNA  106



>ref|XP_009407887.1| PREDICTED: uncharacterized protein LOC103990463 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=471

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  53   IHRLEQEAYSSVLRAFKAQSDAITWEKESLITELRKELRVSDEEH-RELLSRVNA  106



>ref|XP_008658131.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACG42836.1| RNA binding protein [Zea mays]
 gb|AFW87077.1| RNA binding protein [Zea mays]
Length=376

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 6/75 (8%)
 Frame = -2

Query  430  HRKVSDALVSDAESVCPLGDEDSSH------SPLPDDGLGETIHRLELRAYRCTLQALYA  269
            HR     LV+ +  +C   D D +       S   +DG     H LEL AYR T+ ALYA
Sbjct  279  HRSQYYNLVNQSGDICSRTDGDEAFTFERETSEHGNDGSRGETHLLELHAYRATMLALYA  338

Query  268  SGPLTWEKEALLTNL  224
             G ++WE+EALLTNL
Sbjct  339  CGSISWEQEALLTNL  353



>ref|XP_008244157.1| PREDICTED: uncharacterized protein LOC103342319 isoform X2 [Prunus 
mume]
Length=339

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEH  191
            IHR+E +AY   L+A  A S  LTW +EAL+T L  EL+ISDDEH
Sbjct  33   IHRMEAKAYHAVLRAFSAQSNNLTWGREALMTELRKELNISDDEH  77



>ref|XP_008244158.1| PREDICTED: uncharacterized protein LOC103342319 isoform X3 [Prunus 
mume]
Length=325

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEH  191
            IHR+E +AY   L+A  A S  LTW +EAL+T L  EL+ISDDEH
Sbjct  19   IHRMEAKAYHAVLRAFSAQSNNLTWGREALMTELRKELNISDDEH  63



>gb|KHG07775.1| Protein EMSY [Gossypium arboreum]
Length=420

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = -2

Query  388  VCPLGDEDSSHSPLPD-DGLGET-IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLT  218
            V  +G+  S+ +PLP   G  ET IH +E  AY   L+A  A S  LTWEKE+L+T L  
Sbjct  39   VGSMGNGRSAVAPLPRIHGDMETQIHLIEQEAYSSVLRAFKAQSDALTWEKESLITELRK  98

Query  217  ELHISDDEHLRELKHLISA  161
            EL +SD+EH REL   ++A
Sbjct  99   ELRVSDEEH-RELLSRVNA  116



>ref|XP_008244156.1| PREDICTED: uncharacterized protein LOC103342319 isoform X1 [Prunus 
mume]
Length=351

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEH  191
            IHR+E +AY   L+A  A S  LTW +EAL+T L  EL+ISDDEH
Sbjct  45   IHRMEAKAYHAVLRAFSAQSNNLTWGREALMTELRKELNISDDEH  89



>ref|XP_009396314.1| PREDICTED: uncharacterized protein LOC103981338 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=489

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD EH REL   ++A
Sbjct  53   IHRLEQEAYTSVLRAFKAQSDAITWEKESLITELRKELRVSDKEH-RELLSRVNA  106



>ref|XP_010913906.1| PREDICTED: uncharacterized protein LOC105039453 isoform X1 [Elaeis 
guineensis]
Length=484

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  53   IHRLEQEAYSSVLRAFKAQSDAITWEKESLITELRKELRLSDEEH-RELLSRVNA  106



>ref|XP_009396315.1| PREDICTED: uncharacterized protein LOC103981338 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=478

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD EH REL   ++A
Sbjct  53   IHRLEQEAYTSVLRAFKAQSDAITWEKESLITELRKELRVSDKEH-RELLSRVNA  106



>ref|XP_004497901.1| PREDICTED: uncharacterized protein LOC101491037 [Cicer arietinum]
Length=369

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLREL  179
            IH+LE  AY   L+A  A S  LTWEKE L+T L  EL +SDDEH REL
Sbjct  54   IHQLEQEAYSAVLRAFKAQSDALTWEKEGLITELRKELRVSDDEH-REL  101



>ref|XP_007145678.1| hypothetical protein PHAVU_007G259000g [Phaseolus vulgaris]
 gb|ESW17672.1| hypothetical protein PHAVU_007G259000g [Phaseolus vulgaris]
Length=323

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLREL  179
            IH+LE  AY   L+A  A S  LTWEKE L+T L  EL +SDDEH REL
Sbjct  5    IHQLEQEAYSAVLRAFKAQSDALTWEKEGLITELRKELRVSDDEH-REL  52



>ref|XP_010913907.1| PREDICTED: uncharacterized protein LOC105039453 isoform X2 [Elaeis 
guineensis]
Length=483

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  53   IHRLEQEAYSSVLRAFKAQSDAITWEKESLITELRKELRLSDEEH-RELLSRVNA  106



>gb|EEE65974.1| hypothetical protein OsJ_21886 [Oryza sativa Japonica Group]
Length=518

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 78/168 (46%), Gaps = 12/168 (7%)
 Frame = -2

Query  634  LGEKYMHASFNVISNGCNEMYEEKLHGVFCHssst----tsefsdsdsgssvgscsvvsn  467
            LGEKYMHAS N   NG   ++   L GV   + +     TS +       S    S   +
Sbjct  242  LGEKYMHASLNKRKNG---VHTTNLAGVNVDTENKFRPLTSAYPSDTESISSSVGSCSPS  298

Query  466  SPINPGLHFVPVHRKVSDALVSDAESVCPLGDEDSSHSPLPDDGLGETIHRLELRAYRCT  287
            S      HF   ++       +D         E S H  +      E  H LEL AYR T
Sbjct  299  SSPCSSRHFYSAYQTGDICSRTDGAEAAVSERETSQHDKIIPK---EDTHLLELHAYRAT  355

Query  286  LQALYASGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS--AKASY  149
            + ALY  G ++WE+EALLTNL   L+IS DEHL EL+   S   KAS+
Sbjct  356  MLALYVCGSISWEQEALLTNLRLTLNISTDEHLAELRRPKSEACKASF  403



>ref|XP_009391876.1| PREDICTED: uncharacterized protein LOC103977936 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=431

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHR+E  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  52   IHRIEQEAYSSILRAFKAQSDAITWEKESLITELRKELRVSDEEH-RELLSRVNA  105



>ref|XP_010913908.1| PREDICTED: uncharacterized protein LOC105039453 isoform X3 [Elaeis 
guineensis]
Length=465

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  53   IHRLEQEAYSSVLRAFKAQSDAITWEKESLITELRKELRLSDEEH-RELLSRVNA  106



>ref|XP_006373760.1| hypothetical protein POPTR_0016s04800g [Populus trichocarpa]
 gb|ERP51557.1| hypothetical protein POPTR_0016s04800g [Populus trichocarpa]
Length=363

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            IH LE  AYR  L+A  A S  L+W+KE L+T L  EL +SDDEH RE+  L++
Sbjct  53   IHHLEQEAYRAVLRAFKAQSDQLSWDKEGLITELRKELRVSDDEH-REILTLVN  105



>ref|XP_011004823.1| PREDICTED: uncharacterized protein LOC105111214 [Populus euphratica]
Length=364

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLIS  164
            IH LE  AYR  L+A  A S  L+W+KE L+T L  EL +SDDEH RE+  L++
Sbjct  53   IHHLEQEAYRAVLRAFKAQSDQLSWDKEGLITELRKELRVSDDEH-REILTLVN  105



>ref|XP_009391875.1| PREDICTED: uncharacterized protein LOC103977936 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=492

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHR+E  AY   L+A  A S  +TWEKE+L+T L  EL +SD+EH REL   ++A
Sbjct  52   IHRIEQEAYSSILRAFKAQSDAITWEKESLITELRKELRVSDEEH-RELLSRVNA  105



>ref|XP_008808092.1| PREDICTED: uncharacterized protein LOC103720257 [Phoenix dactylifera]
Length=450

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  322  IHRLELRAYRCTLQALYA-SGPLTWEKEALLTNLLTELHISDDEHLRELKHLISA  161
            IHRLE  AY   L+A  A S  +TWEKE+++T L  EL +SD+EH REL   ++A
Sbjct  53   IHRLEQEAYSSVLRAFKAQSDAITWEKESMITELRKELRVSDEEH-RELLSKVNA  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897646128048