BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25950_g3_i1 len=160 path=[2811:0-20 2832:21-33 12503:34-159]

Length=160
                                                                      Score     E

ref|XP_004246938.1|  PREDICTED: putative disease resistance prote...  50.4    2e-05   
ref|XP_009796828.1|  PREDICTED: putative disease resistance prote...  49.3    6e-05   
ref|XP_009614610.1|  PREDICTED: putative disease resistance prote...  47.4    2e-04   



>ref|XP_004246938.1| PREDICTED: putative disease resistance protein RGA3 [Solanum 
lycopersicum]
 ref|XP_010326078.1| PREDICTED: putative disease resistance protein RGA3 [Solanum 
lycopersicum]
 ref|XP_010326079.1| PREDICTED: putative disease resistance protein RGA3 [Solanum 
lycopersicum]
 ref|XP_010326080.1| PREDICTED: putative disease resistance protein RGA3 [Solanum 
lycopersicum]
Length=936

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -1

Query  142  EVNMGV-DVLKPPLQLQTLELSEYRGTHFSSWITLSLHNLRILNIDGC  2
            EV+M V + L PP  L+ L ++ YRGT F +WITLSL+NLR+L +  C
Sbjct  759  EVSMDVMEALVPPPNLRFLTINGYRGTQFPTWITLSLNNLRVLTLSEC  806



>ref|XP_009796828.1| PREDICTED: putative disease resistance protein RGA3 [Nicotiana 
sylvestris]
Length=929

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -1

Query  142  EVNMGV-DVLKPPLQLQTLELSEYRGTHFSSWITLSLHNLRILNIDGC  2
            EV M V + L PP  L++L ++ YRGT   +WITLSL+NLR+L +  C
Sbjct  752  EVRMDVIEALTPPPNLRSLTINGYRGTQLPTWITLSLNNLRVLTLSEC  799



>ref|XP_009614610.1| PREDICTED: putative disease resistance protein RGA3 [Nicotiana 
tomentosiformis]
Length=929

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -1

Query  142  EVNMGV-DVLKPPLQLQTLELSEYRGTHFSSWITLSLHNLRILNIDGC  2
            EV M V + L PP  L+ L ++ YRGT   +WITLSL+NLR+L +  C
Sbjct  752  EVRMDVIEALIPPPNLRFLTINGYRGTQLPTWITLSLNNLRVLTLSEC  799



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519368764968