BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25949_g3_i3 len=1761 path=[4262:0-5 17788:6-14 17797:15-80
2065:81-112 2097:113-183 1997:184-192 2006:193-247 8956:248-274
8983:275-286 8995:287-314 17940:315-324 17950:325-396 744:397-513
18063:514-522 18072:523-526 18076:527-588 16641:589-601 9301:602-636
18138:637-657 9355:658-660 207:661-725 9421:726-756 18189:757-772
9466:773-795 18210:796-820 9512:821-870 18280:871-875 18285:876-888
9579:889-914 9604:915-932 2742:933-968 9656:969-980 4057:981-991
3778:992-995 2953:996-1021 18390:1022-1040 9724:1041-1050
3372:1051-1501 3610:1502-1533 10215:1534-1703 10384:1704-1710
10391:1711-1736 10417:1737-1760]

Length=1761
                                                                      Score     E

ref|XP_006347879.1|  PREDICTED: nitrate transporter 1.5-like            429   3e-139   
ref|XP_010325672.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       426   6e-138   
ref|XP_009792173.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       426   9e-138   
ref|XP_011094557.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       410   1e-131   
emb|CDO97706.1|  unnamed protein product                                394   1e-125   
ref|XP_009628684.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       391   2e-124   
gb|EYU31977.1|  hypothetical protein MIMGU_mgv1a019257mg                385   2e-122   
ref|XP_010692216.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       373   3e-117   
ref|XP_006491456.1|  PREDICTED: nitrate transporter 1.5-like            372   3e-117   
ref|XP_006445280.1|  hypothetical protein CICLE_v10024592mg             372   6e-117   
ref|XP_007219218.1|  hypothetical protein PRUPE_ppa017670mg             370   2e-116   
ref|XP_008232637.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       370   3e-116   
ref|XP_004506528.1|  PREDICTED: nitrate transporter 1.5-like            367   2e-115   
ref|XP_010098931.1|  Nitrate transporter 1.5                            363   2e-113   
gb|KGN46251.1|  hypothetical protein Csa_6G077970                       352   2e-109   
ref|XP_008460105.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    352   2e-109   
ref|XP_008460104.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    352   4e-109   
gb|EPS65056.1|  hypothetical protein M569_09720                         343   7e-107   
ref|XP_004308457.1|  PREDICTED: nitrate transporter 1.5-like            345   2e-106   
ref|XP_003605166.1|  Peptide transporter                                340   1e-104   
ref|XP_007052096.1|  Nitrate transporter 1.5                            333   5e-102   
gb|KDO85793.1|  hypothetical protein CISIN_1g035554mg                   320   1e-97    
ref|XP_004506506.1|  PREDICTED: nitrate transporter 1.5-like            304   3e-91    
gb|AFK43494.1|  unknown                                                 292   3e-90    
ref|XP_003525604.1|  PREDICTED: nitrate transporter 1.5-like isof...    301   4e-90    
ref|XP_006579680.1|  PREDICTED: nitrate transporter 1.5-like isof...    301   5e-90    
gb|KHN21024.1|  Nitrate transporter 1.5                                 301   7e-90    
ref|XP_011011752.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    300   2e-89    
gb|KHN01673.1|  Nitrate transporter 1.5                                 300   2e-89    
ref|XP_011011753.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    300   2e-89    
ref|XP_002320578.1|  hypothetical protein POPTR_0014s17750g             300   2e-89    Populus trichocarpa [western balsam poplar]
ref|XP_006436768.1|  hypothetical protein CICLE_v10031017mg             300   2e-89    
ref|XP_011011755.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    300   2e-89    
ref|XP_003550941.1|  PREDICTED: nitrate transporter 1.5-like            300   2e-89    
ref|XP_011011754.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    300   2e-89    
ref|XP_008465942.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       298   1e-88    
ref|XP_004148494.1|  PREDICTED: nitrate transporter 1.5-like            296   4e-88    
ref|XP_007008714.1|  Nitrate transporter 1.5                            296   4e-88    
gb|AES87363.2|  peptide/nitrate transporter                             295   4e-88    
ref|XP_004150179.1|  PREDICTED: nitrate transporter 1.5-like            295   7e-88    
ref|XP_008448722.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       295   1e-87    
ref|XP_010104361.1|  Nitrate transporter 1.5                            294   1e-87    
ref|XP_004163981.1|  PREDICTED: nitrate transporter 1.5-like            295   2e-87    
ref|XP_007155757.1|  hypothetical protein PHAVU_003G229000g             294   2e-87    
ref|XP_010538507.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2            293   4e-87    
ref|XP_010269969.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       294   4e-87    
ref|XP_010096008.1|  Nitrate transporter 1.5                            293   4e-87    
ref|XP_002519847.1|  Peptide transporter, putative                      293   5e-87    Ricinus communis
ref|XP_002526521.1|  Peptide transporter, putative                      293   5e-87    Ricinus communis
ref|XP_011018609.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            293   5e-87    
ref|XP_006354610.1|  PREDICTED: nitrate transporter 1.5-like            293   7e-87    
ref|XP_009607049.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       293   7e-87    
ref|XP_003516639.1|  PREDICTED: nitrate transporter 1.5-like            293   1e-86    
ref|XP_006368434.1|  proton-dependent oligopeptide transport fami...    292   2e-86    
ref|XP_010275292.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       292   2e-86    
ref|XP_006341336.1|  PREDICTED: nitrate transporter 1.5-like            292   2e-86    
gb|KHN34858.1|  Nitrate transporter 1.5                                 291   2e-86    
emb|CDY72659.1|  BnaCnng78690D                                          285   2e-86    
gb|KHN42621.1|  Nitrate transporter 1.5                                 291   2e-86    
gb|AES90846.2|  peptide transporter                                     291   3e-86    
ref|XP_008439356.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       290   3e-86    
ref|XP_009347591.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       291   3e-86    
ref|XP_008232241.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       291   4e-86    
ref|XP_007156651.1|  hypothetical protein PHAVU_002G005700g             291   4e-86    
ref|XP_003611453.1|  Peptide transporter PTR1                           291   5e-86    
ref|XP_010919867.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    290   6e-86    
ref|XP_008341111.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       289   7e-86    
ref|XP_010919866.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    291   8e-86    
ref|XP_010919865.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    291   9e-86    
gb|KEH31554.1|  peptide transporter                                     291   1e-85    
ref|XP_003608649.1|  Peptide transporter PTR1                           291   2e-85    
ref|XP_007210875.1|  hypothetical protein PRUPE_ppa003158mg             289   2e-85    
ref|XP_010461068.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            290   2e-85    
ref|XP_010478666.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       289   3e-85    
ref|XP_010499794.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       289   4e-85    
ref|XP_004307313.1|  PREDICTED: nitrate transporter 1.5-like            288   4e-85    
ref|XP_009373444.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       288   5e-85    
ref|XP_010327292.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       288   5e-85    
emb|CDX94047.1|  BnaC07g36810D                                          288   5e-85    
gb|AAF81343.1|AC007767_23  Contains similarity to a peptide trans...    288   6e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008238336.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            288   6e-85    
emb|CDX98697.1|  BnaA03g44820D                                          288   6e-85    
ref|NP_174523.2|  nitrate transporter 1.5                               288   7e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395136.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       288   8e-85    
ref|XP_007220198.1|  hypothetical protein PRUPE_ppa003058mg             288   8e-85    
ref|XP_006385620.1|  proton-dependent oligopeptide transport fami...    288   8e-85    
ref|XP_009137205.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2            287   9e-85    
emb|CDX79084.1|  BnaA01g11510D                                          287   9e-85    
ref|XP_007039561.1|  Nitrate transporter 1.5                            287   9e-85    
ref|XP_009135044.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       287   1e-84    
ref|XP_006307023.1|  hypothetical protein CARUB_v10008608mg             287   1e-84    
ref|XP_004301700.1|  PREDICTED: nitrate transporter 1.5-like            291   1e-84    
ref|XP_004229506.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       289   1e-84    
ref|XP_009629801.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    287   2e-84    
ref|XP_009629800.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    286   2e-84    
gb|KHG17535.1|  Nitrate transporter 1.5 -like protein                   286   2e-84    
ref|XP_009377057.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       286   3e-84    
ref|XP_008353085.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    296   3e-84    
ref|XP_011085074.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       286   3e-84    
ref|XP_004133948.1|  PREDICTED: nitrate transporter 1.5-like            286   3e-84    
ref|XP_009629799.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    287   4e-84    
gb|KDP39505.1|  hypothetical protein JCGZ_05071                         286   4e-84    
gb|KHG12170.1|  Nitrate transporter 1.5 -like protein                   286   4e-84    
ref|XP_008373542.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            286   4e-84    
ref|XP_002893724.1|  proton-dependent oligopeptide transport fami...    286   4e-84    
gb|EYU44105.1|  hypothetical protein MIMGU_mgv1a006704mg                281   5e-84    
ref|XP_009114885.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       285   1e-83    
emb|CDP09345.1|  unnamed protein product                                285   1e-83    
ref|XP_009757592.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       283   3e-83    
ref|XP_011028221.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    283   3e-83    
emb|CDY48871.1|  BnaA05g35790D                                          284   3e-83    
emb|CDY32284.1|  BnaC05g28620D                                          284   3e-83    
ref|XP_011028220.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    283   4e-83    
ref|XP_009151431.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            283   4e-83    
emb|CDX93833.1|  BnaA09g24330D                                          283   5e-83    
ref|XP_009378974.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    283   5e-83    
ref|XP_011070229.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            283   5e-83    
ref|XP_011081326.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       282   1e-82    
ref|XP_006415196.1|  hypothetical protein EUTSA_v10007088mg             282   1e-82    
emb|CDY01274.1|  BnaC05g24580D                                          281   3e-82    
ref|XP_009802258.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    281   3e-82    
ref|XP_009802257.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    281   3e-82    
ref|XP_009802255.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    280   3e-82    
ref|XP_009802256.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    280   4e-82    
ref|XP_010053584.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            280   6e-82    
ref|XP_010677273.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            280   8e-82    
ref|XP_008808100.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2            279   1e-81    
ref|XP_010934996.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    278   2e-81    
ref|XP_010934995.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    279   2e-81    
gb|KHG24156.1|  Nitrate transporter 1.5 -like protein                   278   3e-81    
ref|XP_008243685.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       278   3e-81    
ref|XP_006413747.1|  hypothetical protein EUTSA_v10024762mg             277   6e-81    
ref|XP_006358632.1|  PREDICTED: nitrate transporter 1.5-like            277   6e-81    
ref|XP_006853963.1|  hypothetical protein AMTR_s00036p00217430          273   8e-81    
ref|XP_007207539.1|  hypothetical protein PRUPE_ppa015854mg             276   1e-80    
ref|XP_003599761.1|  Peptide transporter PTR2                           286   1e-80    
ref|XP_003599760.1|  Peptide transporter PTR2                           286   2e-80    
ref|XP_009792819.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    274   2e-80    
ref|XP_003551735.1|  PREDICTED: nitrate transporter 1.5-like            276   2e-80    
ref|XP_004497408.1|  PREDICTED: putative peptide/nitrate transpor...    274   2e-80    
ref|XP_008799424.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       276   3e-80    
ref|XP_009593650.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    274   3e-80    
ref|XP_010518871.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       276   4e-80    
ref|XP_003605102.1|  Peptide transporter PTR2                           285   4e-80    
ref|XP_006464342.1|  PREDICTED: nitrate transporter 1.5-like            275   4e-80    
ref|XP_006445510.1|  hypothetical protein CICLE_v10023644mg             275   5e-80    
ref|XP_004497406.1|  PREDICTED: putative peptide/nitrate transpor...    275   5e-80    
gb|KFK28750.1|  hypothetical protein AALP_AA7G041900                    275   6e-80    
ref|XP_009593649.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3 isof...    274   6e-80    
ref|XP_009378973.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    275   6e-80    
ref|XP_007139566.1|  hypothetical protein PHAVU_008G040500g             275   7e-80    
ref|XP_009418231.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       275   7e-80    
ref|XP_009792818.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    274   9e-80    
ref|XP_008338492.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       275   1e-79    
ref|XP_010265895.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       273   2e-79    
ref|XP_009364152.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       273   3e-79    
ref|XP_002299155.2|  hypothetical protein POPTR_0001s05090g             269   3e-79    Populus trichocarpa [western balsam poplar]
gb|EYU40300.1|  hypothetical protein MIMGU_mgv1a025093mg                272   4e-79    
ref|XP_008788684.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       272   9e-79    
gb|KHN13615.1|  Nitrate transporter 1.5                                 277   9e-79    
ref|XP_004244546.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            271   9e-79    
ref|XP_010097732.1|  Nitrate transporter 1.5                            272   1e-78    
ref|XP_010943514.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    271   1e-78    
ref|XP_011037917.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       271   2e-78    
ref|XP_010943513.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    271   2e-78    
ref|XP_010943512.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    271   2e-78    
ref|XP_009595682.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       270   2e-78    
ref|XP_004245877.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            270   2e-78    
ref|XP_006847685.1|  hypothetical protein AMTR_s00149p00049280          270   3e-78    
gb|KHN11611.1|  Nitrate transporter 1.5                                 270   4e-78    
ref|XP_006587754.1|  PREDICTED: nitrate transporter 1.5-like            270   5e-78    
ref|XP_007014834.1|  Major facilitator superfamily protein              271   5e-78    
ref|XP_009761241.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       269   1e-77    
ref|XP_006589795.1|  PREDICTED: putative peptide/nitrate transpor...    268   1e-77    
ref|XP_006283396.1|  hypothetical protein CARUB_v10004438mg             268   1e-77    
ref|XP_006589794.1|  PREDICTED: putative peptide/nitrate transpor...    268   1e-77    
gb|KHN27133.1|  Putative peptide/nitrate transporter                    268   2e-77    
gb|KHN24967.1|  Putative peptide/nitrate transporter                    268   2e-77    
ref|XP_009384121.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       268   2e-77    
ref|XP_006606590.1|  PREDICTED: putative peptide/nitrate transpor...    268   2e-77    
ref|XP_008352702.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       268   3e-77    
ref|XP_003555644.2|  PREDICTED: putative peptide/nitrate transpor...    268   3e-77    
ref|XP_006586602.1|  PREDICTED: putative peptide/nitrate transpor...    268   3e-77    
ref|XP_009376599.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       268   3e-77    
ref|XP_010257465.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like...    267   4e-77    
ref|XP_006647794.1|  PREDICTED: nitrate transporter 1.5-like            267   4e-77    
ref|XP_010257463.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like...    267   5e-77    
ref|XP_002283281.3|  PREDICTED: protein NRT1/ PTR FAMILY 7.1 isof...    266   5e-77    Vitis vinifera
emb|CAN77230.1|  hypothetical protein VITISV_005961                     266   6e-77    Vitis vinifera
ref|XP_011080231.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       267   6e-77    
ref|NP_001047928.1|  Os02g0716800                                       266   6e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010434145.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...    266   7e-77    
gb|KDP30601.1|  hypothetical protein JCGZ_16932                         266   7e-77    
ref|XP_002452648.1|  hypothetical protein SORBIDRAFT_04g029890          266   8e-77    Sorghum bicolor [broomcorn]
emb|CDP12983.1|  unnamed protein product                                266   1e-76    
ref|XP_009595683.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       266   1e-76    
ref|XP_007139109.1|  hypothetical protein PHAVU_008G002100g             265   1e-76    
ref|XP_006492658.1|  PREDICTED: putative peptide/nitrate transpor...    266   2e-76    
gb|KDO56443.1|  hypothetical protein CISIN_1g039271mg                   266   2e-76    
ref|XP_010651313.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1 isof...    266   2e-76    
ref|XP_009376620.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       266   2e-76    
ref|XP_010439444.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       265   2e-76    
ref|XP_002265725.3|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       265   2e-76    Vitis vinifera
ref|XP_010449021.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       265   3e-76    
ref|XP_009393946.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    263   3e-76    
ref|XP_003621431.1|  Peptide transporter PTR1                           266   3e-76    
ref|XP_002867832.1|  proton-dependent oligopeptide transport fami...    264   4e-76    
ref|XP_006445924.1|  hypothetical protein CICLE_v10018037mg             266   6e-76    
gb|EMT20726.1|  Peptide transporter PTR1                                264   6e-76    
ref|XP_009761242.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       264   7e-76    
ref|XP_010540767.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    263   1e-75    
ref|XP_007207679.1|  hypothetical protein PRUPE_ppa023462mg             264   1e-75    
ref|XP_010540766.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    263   1e-75    
gb|KHN12584.1|  Putative peptide/nitrate transporter                    263   1e-75    
ref|XP_008243619.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       263   1e-75    
ref|XP_006603076.1|  PREDICTED: putative peptide/nitrate transpor...    263   1e-75    
ref|XP_009393944.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    263   1e-75    
ref|XP_011025229.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       263   2e-75    
gb|KCW73263.1|  hypothetical protein EUGRSUZ_E01723                     261   2e-75    
ref|XP_010046454.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       263   2e-75    
emb|CAB36812.1|  peptide transporter-like protein                       262   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528132.1|  Peptide transporter, putative                      259   3e-75    Ricinus communis
ref|NP_193899.2|  nitrate transporter 1.8                               262   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003592858.1|  Peptide transporter PTR1                           261   4e-75    
ref|XP_003621236.1|  Peptide transporter PTR1                           261   4e-75    
gb|ABD32535.1|  TGF-beta receptor, type I/II extracellular region       261   4e-75    Medicago truncatula
ref|XP_008352266.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       262   5e-75    
ref|XP_006362495.1|  PREDICTED: nitrate transporter 1.5-like            261   5e-75    
ref|XP_004953690.1|  PREDICTED: nitrate transporter 1.5-like isof...    261   6e-75    
ref|XP_010691959.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       261   7e-75    
ref|XP_004296304.1|  PREDICTED: putative peptide/nitrate transpor...    263   8e-75    
ref|XP_004296302.1|  PREDICTED: putative peptide/nitrate transpor...    261   9e-75    
ref|XP_010056493.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       261   9e-75    
dbj|BAC42767.1|  putative peptide transporter                           261   9e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008679035.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    260   1e-74    
ref|XP_002304892.1|  hypothetical protein POPTR_0003s21800g             261   1e-74    Populus trichocarpa [western balsam poplar]
ref|XP_003570234.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       259   2e-74    
ref|XP_004228926.2|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            260   2e-74    
ref|XP_008679033.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    260   2e-74    
ref|XP_006354232.1|  PREDICTED: putative peptide/nitrate transpor...    259   3e-74    
ref|XP_008679034.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    260   3e-74    
gb|AES77223.2|  peptide/nitrate transporter                             258   6e-74    
ref|XP_010046691.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       258   6e-74    
gb|KCW87117.1|  hypothetical protein EUGRSUZ_B03643                     258   7e-74    
ref|XP_007139567.1|  hypothetical protein PHAVU_008G040600g             258   9e-74    
gb|AGT17043.1|  Proton-dependent oligopeptide transporter family        258   1e-73    
ref|XP_010087388.1|  Putative peptide/nitrate transporter               259   1e-73    
ref|XP_007142617.1|  hypothetical protein PHAVU_007G002800g             259   2e-73    
gb|KHN11612.1|  Nitrate transporter 1.5                                 256   2e-73    
gb|ABN09773.1|  TGF-beta receptor, type I/II extracellular region       258   2e-73    Medicago truncatula
ref|XP_007139336.1|  hypothetical protein PHAVU_008G020800g             256   3e-73    
ref|XP_003621005.1|  Peptide transporter PTR1                           258   3e-73    
gb|KHN13614.1|  Nitrate transporter 1.5                                 256   4e-73    
ref|XP_006602907.1|  PREDICTED: nitrate transporter 1.5-like            256   4e-73    
emb|CAN83927.1|  hypothetical protein VITISV_031037                     256   6e-73    Vitis vinifera
ref|XP_003534448.1|  PREDICTED: nitrate transporter 1.5-like            256   6e-73    
ref|XP_009409943.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...    254   2e-72    
ref|XP_004491684.1|  PREDICTED: putative peptide/nitrate transpor...    254   2e-72    
ref|XP_009409941.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    255   2e-72    
ref|XP_010691958.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       254   2e-72    
ref|XP_009409940.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like...    255   3e-72    
gb|EPS61277.1|  hypothetical protein M569_13519                         253   2e-71    
ref|XP_010919864.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       251   5e-71    
gb|EYU46323.1|  hypothetical protein MIMGU_mgv1a022341mg                250   7e-71    
ref|XP_010673538.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            250   2e-70    
ref|XP_011083321.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       249   2e-70    
gb|EEC73893.1|  hypothetical protein OsI_08696                          248   3e-70    Oryza sativa Indica Group [Indian rice]
emb|CDP17506.1|  unnamed protein product                                249   4e-70    
ref|XP_009618337.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            248   6e-70    
ref|XP_010692434.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       248   7e-70    
emb|CAN77707.1|  hypothetical protein VITISV_026382                     248   8e-70    Vitis vinifera
emb|CBI16743.3|  unnamed protein product                                248   1e-69    
ref|XP_009791514.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            246   2e-69    
ref|XP_002278374.2|  PREDICTED: protein NRT1/ PTR FAMILY 7.3            246   5e-69    Vitis vinifera
ref|NP_001047787.1|  Os02g0689900                                       245   1e-68    Oryza sativa Japonica Group [Japonica rice]
gb|EEC73815.1|  hypothetical protein OsI_08532                          244   1e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_002871897.1|  proton-dependent oligopeptide transport fami...    244   2e-68    
ref|XP_006648949.1|  PREDICTED: nitrate transporter 1.5-like            244   3e-68    
ref|XP_010519721.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            242   8e-68    
ref|XP_004987231.1|  PREDICTED: nitrate transporter 1.5-like            235   2e-67    
ref|XP_008451167.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            241   3e-67    
gb|KGN66437.1|  hypothetical protein Csa_1G605660                       240   6e-67    
gb|EMT07614.1|  Peptide transporter PTR2                                231   7e-67    
ref|NP_197465.1|  putative peptide/nitrate transporter                  239   8e-67    
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein          239   9e-67    
ref|NP_001136757.1|  hypothetical protein                               234   1e-66    
ref|XP_004953503.1|  PREDICTED: nitrate transporter 1.5-like isof...    239   1e-66    
ref|XP_004953502.1|  PREDICTED: nitrate transporter 1.5-like isof...    239   2e-66    
ref|XP_004149033.1|  PREDICTED: putative peptide/nitrate transpor...    239   2e-66    
ref|XP_002452718.1|  hypothetical protein SORBIDRAFT_04g031320          238   2e-66    
ref|XP_004161579.1|  PREDICTED: LOW QUALITY PROTEIN: putative pep...    239   2e-66    
ref|XP_010493040.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            238   2e-66    
dbj|BAK07083.1|  predicted protein                                      237   8e-66    
gb|ACG41138.1|  peptide transporter PTR2                                236   2e-65    
ref|XP_008646076.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       236   2e-65    
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...    234   2e-65    
emb|CDX92513.1|  BnaA10g15520D                                          235   4e-65    
ref|XP_006286439.1|  hypothetical protein CARUB_v10003886mg             234   6e-65    
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1         234   6e-65    
ref|XP_006400525.1|  hypothetical protein EUTSA_v10015614mg             234   6e-65    
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...    234   7e-65    
ref|XP_009120868.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1            234   7e-65    
emb|CDY58969.1|  BnaC09g38060D                                          234   7e-65    
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       233   1e-64    
ref|XP_008651039.1|  PREDICTED: uncharacterized protein LOC100272...    234   2e-64    
ref|XP_010420775.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       233   2e-64    
ref|XP_002459620.1|  hypothetical protein SORBIDRAFT_02g007605          233   2e-64    
ref|XP_004985084.1|  PREDICTED: peptide transporter PTR2-like iso...    232   4e-64    
ref|XP_004985083.1|  PREDICTED: peptide transporter PTR2-like iso...    232   5e-64    
ref|XP_010454248.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like       231   6e-64    
ref|XP_002521890.1|  peptide transporter, putative                      231   7e-64    
gb|ABR32183.1|  peptide transporter                                     231   1e-63    
ref|XP_007222294.1|  hypothetical protein PRUPE_ppa003339mg             227   1e-63    
ref|XP_010235838.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like       231   1e-63    
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       230   1e-63    
ref|XP_010228918.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    229   2e-63    
ref|XP_003558415.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    230   2e-63    
ref|XP_006649696.1|  PREDICTED: peptide transporter PTR2-like           230   2e-63    
ref|XP_010228917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    230   2e-63    
dbj|BAJ85008.1|  predicted protein                                      229   5e-63    
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       228   7e-63    
gb|EMS68576.1|  Nitrate transporter 1.5                                 229   1e-62    
ref|XP_010230308.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like       224   1e-62    
ref|XP_009591011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       227   2e-62    
gb|AFK36303.1|  unknown                                                 225   2e-62    
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             227   2e-62    
gb|KDP28923.1|  hypothetical protein JCGZ_14694                         217   2e-62    
gb|EMT17042.1|  Peptide transporter PTR1                                227   3e-62    
ref|XP_009624506.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       224   3e-62    
ref|XP_010939959.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       226   4e-62    
gb|EAY89168.1|  hypothetical protein OsI_10664                          226   6e-62    
gb|EMS66305.1|  Peptide transporter PTR2                                229   9e-62    
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       224   2e-61    
gb|AIL30501.1|  oligopeptide transporter 1                              224   3e-61    
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       224   3e-61    
ref|XP_006448045.1|  hypothetical protein CICLE_v10014643mg             221   3e-61    
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       224   3e-61    
ref|XP_006365835.1|  PREDICTED: peptide transporter PTR2-like           224   3e-61    
gb|ABF94834.1|  Peptide transporter PTR2, putative, expressed           223   4e-61    
ref|XP_002436958.1|  hypothetical protein SORBIDRAFT_10g012270          223   5e-61    
ref|XP_009803584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    223   5e-61    
ref|XP_009405084.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       223   5e-61    
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       222   1e-60    
gb|ABF94833.1|  Peptide transporter PTR2, putative, expressed           223   1e-60    
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       222   1e-60    
ref|XP_007045396.1|  Peptide transporter 2 isoform 2                    219   2e-60    
ref|XP_002965429.1|  hypothetical protein SELMODRAFT_84173              222   2e-60    
gb|ABK24723.1|  unknown                                                 222   2e-60    
ref|XP_004985077.1|  PREDICTED: peptide transporter PTR2-like           222   2e-60    
ref|XP_002994164.1|  hypothetical protein SELMODRAFT_138285             222   2e-60    
ref|XP_004297798.1|  PREDICTED: peptide transporter PTR2-like           221   3e-60    
ref|XP_010939960.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       221   3e-60    
gb|AAM47310.1|AF377946_12  putative peptide transporter protein         216   4e-60    
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like           221   5e-60    
ref|XP_010314236.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    218   5e-60    
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       221   5e-60    
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           221   6e-60    
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg             221   6e-60    
ref|XP_008787879.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       220   6e-60    
ref|XP_010246838.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       220   7e-60    
gb|KDP38200.1|  hypothetical protein JCGZ_04843                         220   7e-60    
ref|XP_010105518.1|  Peptide transporter                                226   9e-60    
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    220   1e-59    
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like           219   1e-59    
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    219   1e-59    
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790          219   2e-59    
ref|XP_007045395.1|  Peptide transporter 2 isoform 1                    219   2e-59    
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    219   2e-59    
ref|XP_011029471.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       219   2e-59    
gb|KHG06441.1|  Peptide transporter PTR2 -like protein                  219   2e-59    
ref|XP_010276263.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       219   2e-59    
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like           219   2e-59    
ref|XP_007158832.1|  hypothetical protein PHAVU_002G185700g             219   2e-59    
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           219   3e-59    
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like           218   3e-59    
ref|XP_004252286.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    218   4e-59    
ref|NP_001233998.1|  oligopeptide transporter 1                         218   4e-59    
ref|XP_003558412.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       218   6e-59    
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like           218   6e-59    
ref|XP_010276258.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    217   1e-58    
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            216   2e-58    
gb|EMT06499.1|  Peptide transporter PTR2                                215   2e-58    
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg                216   2e-58    
ref|XP_002463972.1|  hypothetical protein SORBIDRAFT_01g009890          216   2e-58    
ref|XP_006580083.1|  PREDICTED: peptide transporter PTR2-like iso...    213   2e-58    
gb|KEH34180.1|  proton-dependent oligopeptide transport family pr...    213   2e-58    
ref|XP_001774221.1|  predicted protein                                  216   3e-58    
gb|KHG27963.1|  Peptide transporter PTR2 -like protein                  216   3e-58    
ref|NP_001051098.1|  Os03g0719900                                       216   4e-58    
gb|EEE59822.1|  hypothetical protein OsJ_12376                          216   4e-58    
emb|CBI16454.3|  unnamed protein product                                214   4e-58    
ref|XP_010228915.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    215   4e-58    
ref|XP_006350821.1|  PREDICTED: peptide transporter PTR1-like           215   4e-58    
ref|XP_010243098.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       212   5e-58    
ref|XP_003561849.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    215   6e-58    
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900          215   6e-58    
ref|XP_004985079.1|  PREDICTED: peptide transporter PTR2-like iso...    214   9e-58    
ref|NP_190982.1|  peptide transporter PTR1                              214   1e-57    
ref|XP_004985080.1|  PREDICTED: peptide transporter PTR2-like           214   1e-57    
ref|NP_001146682.1|  hypothetical protein                               214   1e-57    
gb|ACL52627.1|  unknown                                                 214   1e-57    
gb|EMT07615.1|  Peptide transporter PTR2                                214   1e-57    
ref|XP_010680054.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       214   1e-57    
ref|XP_004241180.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       215   2e-57    
gb|EMS66306.1|  Peptide transporter PTR2                                213   3e-57    
ref|XP_004966956.1|  PREDICTED: nitrate transporter 1.5-like            213   3e-57    
ref|XP_006580082.1|  PREDICTED: peptide transporter PTR2-like iso...    212   3e-57    
ref|XP_004500227.1|  PREDICTED: peptide transporter PTR5-like iso...    213   3e-57    
ref|XP_010105517.1|  Peptide transporter                                213   3e-57    
dbj|BAJ97468.1|  predicted protein                                      211   4e-57    
gb|KEH34179.1|  proton-dependent oligopeptide transport family pr...    212   4e-57    
ref|XP_003524135.1|  PREDICTED: peptide transporter PTR2-like iso...    213   4e-57    
ref|XP_006580079.1|  PREDICTED: peptide transporter PTR2-like iso...    213   4e-57    
emb|CDP09151.1|  unnamed protein product                                212   5e-57    
emb|CDX76167.1|  BnaA04g04310D                                          213   6e-57    
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       212   6e-57    
ref|XP_004504618.1|  PREDICTED: peptide transporter PTR2-like           212   7e-57    
ref|XP_009139262.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            211   8e-57    
ref|XP_009591017.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       211   8e-57    
ref|XP_010109735.1|  Peptide transporter                                211   8e-57    
ref|XP_009779291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       211   9e-57    
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    212   9e-57    
ref|XP_006346629.1|  PREDICTED: peptide transporter PTR2-like           211   1e-56    
ref|XP_010105516.1|  Peptide transporter                                211   1e-56    
dbj|BAJ91595.1|  predicted protein                                      207   1e-56    
ref|XP_002877959.1|  proton-dependent oligopeptide transport fami...    211   1e-56    
gb|KDP38199.1|  hypothetical protein JCGZ_04842                         211   2e-56    
gb|EMS68423.1|  Peptide transporter PTR2                                211   2e-56    
ref|XP_004985078.1|  PREDICTED: peptide transporter PTR2-like iso...    210   2e-56    
dbj|BAJ95092.1|  predicted protein                                      211   2e-56    
ref|XP_010504206.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       210   2e-56    
ref|XP_002465589.1|  hypothetical protein SORBIDRAFT_01g041720          207   2e-56    
emb|CDY13185.1|  BnaC04g26500D                                          210   3e-56    
gb|KHN25958.1|  Peptide transporter PTR2                                210   3e-56    
gb|EEC74828.1|  hypothetical protein OsI_10667                          210   3e-56    
gb|KHN06246.1|  Peptide transporter PTR1                                209   3e-56    
ref|XP_001774033.1|  predicted protein                                  210   3e-56    
dbj|BAJ97409.1|  predicted protein                                      210   3e-56    
ref|XP_002317503.2|  Peptide transporter PTR2-B family protein          210   4e-56    
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            210   4e-56    
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       214   4e-56    
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    210   4e-56    
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             209   4e-56    
gb|EEE58658.1|  hypothetical protein OsJ_10061                          210   4e-56    
ref|NP_001049489.1|  Os03g0235900                                       210   4e-56    
ref|XP_006292488.1|  hypothetical protein CARUB_v10018717mg             209   4e-56    
gb|AAF07875.1|  nitrate transporter                                     210   4e-56    
ref|XP_010937010.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       210   4e-56    
ref|XP_010515930.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       209   4e-56    
ref|XP_010937012.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       209   5e-56    
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       209   5e-56    
ref|XP_006591201.1|  PREDICTED: peptide transporter PTR1-like iso...    209   9e-56    
ref|XP_010427083.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            209   9e-56    
gb|KHN02576.1|  Peptide transporter PTR1                                209   1e-55    
gb|EMT28633.1|  Peptide transporter PTR5                                207   1e-55    
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       209   1e-55    
ref|XP_007158831.1|  hypothetical protein PHAVU_002G185600g             209   1e-55    
ref|XP_003551296.1|  PREDICTED: peptide transporter PTR1                208   1e-55    
emb|CDP05420.1|  unnamed protein product                                209   1e-55    
ref|XP_007016184.1|  Peptide transporter 1                              208   2e-55    
ref|XP_007140383.1|  hypothetical protein PHAVU_008G107200g             208   2e-55    
ref|XP_010528782.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            207   3e-55    
ref|XP_003529142.1|  PREDICTED: peptide transporter PTR1-like iso...    207   3e-55    
ref|XP_003531411.1|  PREDICTED: peptide transporter PTR2-like           207   4e-55    
emb|CDM81075.1|  unnamed protein product                                206   4e-55    
dbj|BAJ87974.1|  predicted protein                                      206   4e-55    
ref|XP_006850009.1|  hypothetical protein AMTR_s00022p00178680          207   4e-55    
gb|EEC74827.1|  hypothetical protein OsI_10666                          207   4e-55    
ref|NP_001049488.1|  Os03g0235700                                       207   5e-55    
dbj|BAJ95903.1|  predicted protein                                      207   5e-55    
gb|AAC32034.1|  peptide transporter                                     206   6e-55    
ref|XP_010654192.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       206   6e-55    
gb|EMT07041.1|  Peptide transporter PTR2                                210   6e-55    
ref|XP_010066525.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       206   6e-55    
ref|XP_004506789.1|  PREDICTED: peptide transporter PTR1-like iso...    206   8e-55    
ref|XP_004492413.1|  PREDICTED: peptide transporter PTR1-like iso...    206   8e-55    
gb|ABF94835.1|  Peptide transporter PTR2, putative, expressed           207   9e-55    
ref|XP_003524136.1|  PREDICTED: peptide transporter PTR2-like           208   9e-55    
ref|NP_178313.1|  peptide transporter PTR2                              206   9e-55    
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260          206   9e-55    
ref|XP_006649697.1|  PREDICTED: peptide transporter PTR2-like           206   1e-54    
ref|XP_009116102.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            206   1e-54    
ref|XP_004983460.1|  PREDICTED: probable peptide/nitrate transpor...    202   1e-54    
dbj|BAJ96095.1|  predicted protein                                      205   1e-54    
ref|XP_002875108.1|  ATPTR2-B                                           206   1e-54    
dbj|BAJ86984.1|  predicted protein                                      206   1e-54    
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...    205   2e-54    
ref|XP_006849521.1|  hypothetical protein AMTR_s00024p00149600          205   2e-54    
ref|XP_008220970.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       205   2e-54    
gb|AAP44102.1|  peptide transporter 1                                   205   2e-54    
ref|XP_008466771.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    205   2e-54    
ref|XP_006649698.1|  PREDICTED: peptide transporter PTR2-like           204   3e-54    
ref|XP_003558411.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       204   4e-54    
gb|KDP24486.1|  hypothetical protein JCGZ_25050                         204   4e-54    
ref|XP_009405847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       204   4e-54    
ref|XP_004504617.1|  PREDICTED: peptide transporter PTR2-like           204   4e-54    
ref|XP_007134767.1|  hypothetical protein PHAVU_010G0742001g            202   4e-54    
ref|XP_004504619.1|  PREDICTED: peptide transporter PTR2-like           204   4e-54    
dbj|BAK03852.1|  predicted protein                                      205   4e-54    
ref|XP_008798033.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       204   5e-54    



>ref|XP_006347879.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=591

 Score =   429 bits (1103),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 225/280 (80%), Positives = 255/280 (91%), Gaps = 3/280 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++  S+M +LPDKS++PN WR+CTVTQVEEVKCVLRLLPIW CTILASIVFVQ
Sbjct  303  KFLDRAAVITPSDMLILPDKSEIPNRWRLCTVTQVEEVKCVLRLLPIWFCTILASIVFVQ  362

Query  248  VFSLFVEQGAAMNTK--IADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPK  421
            V SLFVEQG+AMNT   I+ FH+PPASMT+ DIIS+STFIICYE I++PLYVKL K +PK
Sbjct  363  VLSLFVEQGSAMNTSTMISGFHIPPASMTAFDIISTSTFIICYEKILIPLYVKLTKSKPK  422

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEA  598
            LP+ELQRIGIG+VIS + M+IAGLVEQHRLR+AN G EETSSLSIFWQ PQYVLVGV EA
Sbjct  423  LPSELQRIGIGLVISTVAMVIAGLVEQHRLRFANGGGEETSSLSIFWQTPQYVLVGVGEA  482

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            FIYVAQWEFFASQ+PDSLKS+GLGLSMSSSALGSYLCSIIL++VMKI+T+HGKPGWVP N
Sbjct  483  FIYVAQWEFFASQIPDSLKSMGLGLSMSSSALGSYLCSIILTVVMKISTRHGKPGWVPAN  542

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            LNDGHLDRFFFLSAA+ ALDLV+FV CAKRYK+I LEK E
Sbjct  543  LNDGHLDRFFFLSAALTALDLVLFVMCAKRYKSIALEKRE  582



>ref|XP_010325672.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Solanum lycopersicum]
Length=607

 Score =   426 bits (1096),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 224/280 (80%), Positives = 253/280 (90%), Gaps = 3/280 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++  S+M +LPDKS++PN WR+CTVTQVEEVKCVLRLLPIW CTILASIVFVQ
Sbjct  319  KFLDRAAVITPSDMLILPDKSEIPNRWRLCTVTQVEEVKCVLRLLPIWFCTILASIVFVQ  378

Query  248  VFSLFVEQGAAMNTK--IADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPK  421
            V SLFVEQG+AMNT   I+ FH+PPASMT+ DIIS+STFIICYE I++PLYVKL K +PK
Sbjct  379  VLSLFVEQGSAMNTSTMISGFHIPPASMTAFDIISTSTFIICYEKILIPLYVKLTKSKPK  438

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEA  598
            LP+ELQRIGIG+VIS + M+IAG VEQ RLR+AN G EETSSLSIFWQ PQYVLVGV EA
Sbjct  439  LPSELQRIGIGLVISTVAMVIAGFVEQQRLRFANEGGEETSSLSIFWQTPQYVLVGVGEA  498

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            FIYVAQWEFFASQ+PDSLKS+GLGLSMSSSALGSYLCSIIL++VMKITT+HGKPGWVP N
Sbjct  499  FIYVAQWEFFASQIPDSLKSMGLGLSMSSSALGSYLCSIILTVVMKITTRHGKPGWVPAN  558

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            LNDGHLDRFFFLSAA+ ALDLV+FV CAKRYK+I LEK E
Sbjct  559  LNDGHLDRFFFLSAALTALDLVLFVMCAKRYKSIALEKRE  598



>ref|XP_009792173.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Nicotiana sylvestris]
Length=607

 Score =   426 bits (1095),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 225/280 (80%), Positives = 253/280 (90%), Gaps = 3/280 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++  S+M +LPDKS+  N WR+CTVTQVEEVKCVLRLLPIW CTILASIVFVQ
Sbjct  319  KFLDRAAVVTPSDMLILPDKSETHNQWRLCTVTQVEEVKCVLRLLPIWFCTILASIVFVQ  378

Query  248  VFSLFVEQGAAMNTK--IADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPK  421
            V SLFVEQG+AMNT   I+ FH+PPASMTS DIIS+STFIICYE II+PLYVKL K +PK
Sbjct  379  VLSLFVEQGSAMNTSTMISGFHIPPASMTSFDIISTSTFIICYEKIIIPLYVKLTKSKPK  438

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEA  598
            LP+ELQRIGIG+VIS + M+IAGLVEQHRLR+AN G EETSSLSIFWQ PQYVLVGV EA
Sbjct  439  LPSELQRIGIGLVISTVAMVIAGLVEQHRLRFANEGGEETSSLSIFWQTPQYVLVGVGEA  498

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            FIYVAQWEFFASQ+PD+LKS+GLGLSMSSSALGSYLCSIILS+VMKITT+HGKPGW+P N
Sbjct  499  FIYVAQWEFFASQIPDNLKSMGLGLSMSSSALGSYLCSIILSVVMKITTRHGKPGWIPAN  558

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            LN+GHLDRFFFLSAA+ ALDLV+FV CAKRYK+I LEK E
Sbjct  559  LNNGHLDRFFFLSAALTALDLVLFVVCAKRYKSIALEKRE  598



>ref|XP_011094557.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Sesamum indicum]
Length=603

 Score =   410 bits (1054),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 207/278 (74%), Positives = 250/278 (90%), Gaps = 1/278 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            + LDRAA+M  S+  LL  K Q PNPW +CTVTQVEEVKCVLRLLPIW C+I+AS+VFVQ
Sbjct  319  KCLDRAAVMTPSDKILLSSKGQTPNPWHLCTVTQVEEVKCVLRLLPIWFCSIMASVVFVQ  378

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            V SLFVEQGA MNT+I++FH+PPASMT+ DIIS+STFIICYE +I+PLY+KL K+EPK+P
Sbjct  379  VLSLFVEQGATMNTQISNFHIPPASMTAFDIISTSTFIICYEKVIVPLYIKLTKKEPKMP  438

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIGMVISII M++AGLVEQ RL+YAN E E SSLSIFWQIPQYVLVGV+EAFIY
Sbjct  439  SELQRMGIGMVISIIAMIVAGLVEQCRLKYAN-EREISSLSIFWQIPQYVLVGVSEAFIY  497

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            VAQWEFFA+Q+PD LKS+G+GLSMSSSALGSYLC+IIL++VMK+T+KHGKPGW+PPNLN+
Sbjct  498  VAQWEFFATQIPDRLKSLGIGLSMSSSALGSYLCTIILTLVMKVTSKHGKPGWIPPNLNE  557

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRFFFLSAA++A DLV+F+ CA R+K I +EK ++
Sbjct  558  GHLDRFFFLSAALIAFDLVLFITCANRFKCIEIEKRDD  595



>emb|CDO97706.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   394 bits (1011),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/279 (76%), Positives = 241/279 (86%), Gaps = 2/279 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEM-TLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +M T+LP KSQ PNPWR+CTV+QVEEVKCVLRLLPIW CTI+ASIVFV
Sbjct  300  KFLDRAAFVTAPDMITILPGKSQAPNPWRLCTVSQVEEVKCVLRLLPIWFCTIVASIVFV  359

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            QV SLFVEQGAAM++ I  FH+PPASMT+ DIIS+STFIICYE  I+P YVKL KR+PK 
Sbjct  360  QVLSLFVEQGAAMDSVILGFHIPPASMTAFDIISTSTFIICYEKFIVPFYVKLTKRKPKT  419

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAF  601
             +ELQRIGIG+VISI+ M+IAG VE HRLR+A    +ETSSLSIFWQ PQYVLVGVAEAF
Sbjct  420  LSELQRIGIGLVISIVAMIIAGFVELHRLRHAIQKGQETSSLSIFWQTPQYVLVGVAEAF  479

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            + VAQWEFFASQ PD LKS+GLGLSMSSSALGSYLCSI L++VM IT++HGKPGWVP NL
Sbjct  480  VIVAQWEFFASQTPDRLKSLGLGLSMSSSALGSYLCSIALTVVMNITSRHGKPGWVPANL  539

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            NDGHLDRFFFLSAA++ALDL MFV  AKRYK I LEK E
Sbjct  540  NDGHLDRFFFLSAALIALDLAMFVVVAKRYKCITLEKRE  578



>ref|XP_009628684.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Nicotiana tomentosiformis]
Length=607

 Score =   391 bits (1005),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 223/280 (80%), Positives = 253/280 (90%), Gaps = 3/280 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++  S+M +LPDKS+  N WR+CTVTQVEEVKCVLRLLPIW CTILASIVFVQ
Sbjct  319  KFLDRAAVVTPSDMLILPDKSETHNQWRLCTVTQVEEVKCVLRLLPIWFCTILASIVFVQ  378

Query  248  VFSLFVEQGAAMNTK--IADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPK  421
            V SLFVEQG+AMNT   I+ FH+PPASMTS DIIS+S+FIICYE II+PLYVKL K +PK
Sbjct  379  VLSLFVEQGSAMNTSTMISGFHIPPASMTSFDIISTSSFIICYEKIIIPLYVKLTKSKPK  438

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEA  598
            LP+ELQRIGIG+VIS + M+IAGLVEQHRLR+AN G EETSSLSIFWQ PQYVLVGV EA
Sbjct  439  LPSELQRIGIGLVISTVAMVIAGLVEQHRLRFANEGGEETSSLSIFWQTPQYVLVGVGEA  498

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            FIYVAQWEFFASQ+PD+LKS+GLGLSMSSSALGSYLCSIILS+V+KITT+HGKPGW+P N
Sbjct  499  FIYVAQWEFFASQIPDNLKSMGLGLSMSSSALGSYLCSIILSVVIKITTRHGKPGWIPAN  558

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            LNDGHLDRFFFLSAA+ ALDLV+F+ CAKRYK+I LEK E
Sbjct  559  LNDGHLDRFFFLSAALAALDLVLFIVCAKRYKSIALEKRE  598



>gb|EYU31977.1| hypothetical protein MIMGU_mgv1a019257mg, partial [Erythranthe 
guttata]
Length=579

 Score =   385 bits (989),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 244/279 (87%), Gaps = 2/279 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            ++LDRAA+M +S+  LL  K Q PNPW +CTVTQVEEVKCVLRLLPIW CT +AS+VFVQ
Sbjct  292  KYLDRAAVMTNSDKILLSTKGQSPNPWHLCTVTQVEEVKCVLRLLPIWFCTTVASMVFVQ  351

Query  248  VFSLFVEQGAAMNTKIA-DFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            V SLFVEQG+AMNTKI+ +FH+ PASMT+ DIIS+STFII YE II+PLY+KL+K+EPK+
Sbjct  352  VLSLFVEQGSAMNTKISKNFHIAPASMTAFDIISTSTFIISYEKIIVPLYIKLVKKEPKI  411

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            P+ELQRIGIGM IS+I+M+ AGLVEQ RLRYA+ E ETS LSI WQIPQYVLVGV+EAFI
Sbjct  412  PSELQRIGIGMGISVISMVAAGLVEQFRLRYAD-EGETSDLSILWQIPQYVLVGVSEAFI  470

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YVAQWEFFASQ+PD LKS+GLGLSMSSSALGS+LC+II+++VMK T+K+G+ GW+P NLN
Sbjct  471  YVAQWEFFASQIPDGLKSLGLGLSMSSSALGSFLCTIIVAVVMKFTSKNGEKGWIPANLN  530

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            +GH+DRFFFLSA +VA DLV+FV CA R+K I  EK E+
Sbjct  531  EGHMDRFFFLSAVLVAFDLVLFVTCAHRFKCIKQEKREQ  569



>ref|XP_010692216.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Beta vulgaris subsp. 
vulgaris]
Length=614

 Score =   373 bits (957),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 241/285 (85%), Gaps = 4/285 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+ S + +   +K+   NPWR+CTVTQVEEVKC+LRLLPIW+CTIL+S+VF+Q
Sbjct  327  KFLDRAAIITSEDTSFTLEKTSPTNPWRLCTVTQVEEVKCILRLLPIWLCTILSSVVFIQ  386

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLF+EQGA MNT I  FH PPASMT+ DIIS+STFII Y+ +I+PLYVKL KR+PK P
Sbjct  387  MMSLFIEQGATMNTAIGAFHFPPASMTAFDIISTSTFIIFYDKLIVPLYVKLTKRKPKPP  446

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA--NGEEETSSLSIFWQIPQYVLVGVAEAF  601
            +ELQRIGIG+ I++I +++AGL+EQ R +YA  +G E+ S LSIFWQ PQYVLVG+AEAF
Sbjct  447  SELQRIGIGLSIAVIAIIVAGLLEQQRRKYAILSG-EDISPLSIFWQTPQYVLVGIAEAF  505

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YVAQWEFF+SQ PD +KSIGLGLSMSSSA+GSYLCS ILS+VM  T+K+GKPGWVPPNL
Sbjct  506  VYVAQWEFFSSQTPDGIKSIGLGLSMSSSAMGSYLCSFILSVVMHFTSKNGKPGWVPPNL  565

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVEL  916
            NDGHLDRFFFLSAA+  ++L  +VFCA+RYK I LEK  E+D E+
Sbjct  566  NDGHLDRFFFLSAALTTVNLGFYVFCARRYKCISLEK-RESDREM  609



>ref|XP_006491456.1| PREDICTED: nitrate transporter 1.5-like [Citrus sinensis]
Length=600

 Score =   372 bits (956),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 245/286 (86%), Gaps = 3/286 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAIM S+++T   ++ Q PN WR+CTVTQVEEVKCVLRLLP+W+CTIL+S+ ++Q
Sbjct  317  KFLDRAAIMTSADIT--TNEDQNPNQWRLCTVTQVEEVKCVLRLLPVWLCTILSSMAYIQ  374

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAMNT +++F +PPASMT+ DI+S++ FI+ Y+ +I+PLY+K+ KR PK P
Sbjct  375  MLSLFVEQGAAMNTGVSNFQIPPASMTAFDIVSTTAFILLYDKLIVPLYLKVAKRRPKTP  434

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQR+GIG+ I+ + M+IAG+VEQ RL+YA+ G EETSSLSIFWQ PQYVL+GV+EAF+
Sbjct  435  SELQRVGIGLAIATVAMIIAGIVEQRRLKYASFGGEETSSLSIFWQTPQYVLLGVSEAFV  494

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YVAQ EFFASQ+P+ LKS+G+ LSMSS+A+G+Y+CS+ILS+VM +TTK+GKPGWVPPNLN
Sbjct  495  YVAQMEFFASQIPNGLKSLGIALSMSSTAIGTYVCSMILSVVMVLTTKNGKPGWVPPNLN  554

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            DGHLDRFFFLSA + A++L +FV CA+RYK+I L+K E      V+
Sbjct  555  DGHLDRFFFLSATVTAMNLGVFVVCARRYKSISLQKQEGESAAGVQ  600



>ref|XP_006445280.1| hypothetical protein CICLE_v10024592mg, partial [Citrus clementina]
 gb|ESR58520.1| hypothetical protein CICLE_v10024592mg, partial [Citrus clementina]
Length=622

 Score =   372 bits (956),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 245/286 (86%), Gaps = 3/286 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAIM S+++T   ++ Q PN WR+CTVTQVEEVKCVLRLLP+W+CTIL+S+ ++Q
Sbjct  339  KFLDRAAIMTSADIT--TNEDQNPNQWRLCTVTQVEEVKCVLRLLPVWLCTILSSMAYIQ  396

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAMNT +++F +PPASMT+ DI+S++ FI+ Y+ +I+PLY+K+ KR PK P
Sbjct  397  MLSLFVEQGAAMNTGVSNFQIPPASMTAFDIVSTTAFILLYDKLIVPLYLKVAKRRPKTP  456

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQR+GIG+ I+ + M+IAG+VEQ RL+YA+ G EETSSLSIFWQ PQYVL+GV+EAF+
Sbjct  457  SELQRVGIGLAIATVAMIIAGIVEQRRLKYASFGGEETSSLSIFWQTPQYVLLGVSEAFV  516

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YVAQ EFFASQ+P+ LKS+G+ LSMSS+A+G+Y+CS+ILS+VM +TTK+GKPGWVPPNLN
Sbjct  517  YVAQMEFFASQIPNGLKSLGIALSMSSTAIGTYVCSMILSVVMVLTTKNGKPGWVPPNLN  576

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            DGHLDRFFFLSA + A++L +FV CA+RYK+I L+K E      V+
Sbjct  577  DGHLDRFFFLSATVTAMNLGVFVVCARRYKSISLQKQEGESAAGVQ  622



>ref|XP_007219218.1| hypothetical protein PRUPE_ppa017670mg, partial [Prunus persica]
 gb|EMJ20417.1| hypothetical protein PRUPE_ppa017670mg, partial [Prunus persica]
Length=583

 Score =   370 bits (949),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/276 (65%), Positives = 237/276 (86%), Gaps = 1/276 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA +   +++L+ ++ Q PNPW +CTVTQVEEVKC+LRLLP+W+CT+L+S+VF+Q
Sbjct  307  KFLDRAAFITCDDISLMSNQGQTPNPWHLCTVTQVEEVKCILRLLPVWLCTVLSSMVFIQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            V SLFVEQGAAM+ ++++F +PPASMT+ DI+S+S FII Y+ +I+PLY K+ KREPK P
Sbjct  367  VLSLFVEQGAAMDRRVSNFQIPPASMTAFDIVSTSLFIILYDKLIVPLYTKVTKREPKPP  426

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            + LQRIGIG+ I I+ ++IAG VE+ RL+YA N  EETSSLSIFWQ PQYVLVGV+EAF+
Sbjct  427  SALQRIGIGLTIGIVGLVIAGFVERKRLKYASNSGEETSSLSIFWQTPQYVLVGVSEAFV  486

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV+Q EF++SQ PD LKS+G+ L M+SSA+GSY+ S+IL++VM+ITTK+G+PGWVPPNLN
Sbjct  487  YVSQMEFYSSQTPDGLKSLGIALWMTSSAMGSYVASMILTVVMEITTKNGQPGWVPPNLN  546

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            DGHLDRFFFLSA + AL+L +++ CAKRYK+I LEK
Sbjct  547  DGHLDRFFFLSAGLTALNLALYIVCAKRYKSISLEK  582



>ref|XP_008232637.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Prunus mume]
Length=606

 Score =   370 bits (951),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 179/281 (64%), Positives = 239/281 (85%), Gaps = 1/281 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA +   +++L+ ++ Q PN W +CTVTQVEEVKC+LRLLP+W+CT+L+S+VF+Q
Sbjct  326  KFLDRAAFITRDDISLMSNQGQTPNTWHLCTVTQVEEVKCILRLLPVWLCTVLSSMVFIQ  385

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            V SLFVEQGAAM+ ++++FH+PPASMT+ DI+S+S FII Y+ +I+PLY K+ KREPK P
Sbjct  386  VLSLFVEQGAAMDRRVSNFHIPPASMTAFDIVSTSLFIILYDKLIVPLYTKVTKREPKPP  445

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            + L+RIGIG+ I I+ ++IAG VE+ RL+YA N  EETSSLSIFWQ PQYVLVGV+EAF+
Sbjct  446  SALRRIGIGLTIGIVGLIIAGFVERKRLKYASNSGEETSSLSIFWQTPQYVLVGVSEAFV  505

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV+Q EF++SQ PD LKS+G+ L M+SSA+GSY+ S+IL++VM+ITTK+G+PGWVPPNLN
Sbjct  506  YVSQMEFYSSQTPDGLKSLGIALWMTSSAMGSYVASMILTVVMEITTKNGQPGWVPPNLN  565

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            DGHLDRFFFLSA + AL+L +++ CAKRYK+I LEK E  +
Sbjct  566  DGHLDRFFFLSAGLSALNLALYIVCAKRYKSISLEKRESIN  606



>ref|XP_004506528.1| PREDICTED: nitrate transporter 1.5-like [Cicer arietinum]
Length=592

 Score =   367 bits (943),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/285 (66%), Positives = 240/285 (84%), Gaps = 1/285 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI++ +E   L DKSQ+PNPW++CTVTQVEEVKC+LRLLP+W CTI +S+VF+Q
Sbjct  306  RFLDRAAIISINEKNKLQDKSQIPNPWQLCTVTQVEEVKCILRLLPVWFCTIFSSVVFIQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+ MN K   F +PPASMT+ DIIS+S FI+ ++ +I+P+YVK+MKR PKLP
Sbjct  366  MLSLFVEQGSTMNRKFYKFQIPPASMTAFDIISTSAFIMLFDVLIVPIYVKVMKRSPKLP  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE-EETSSLSIFWQIPQYVLVGVAEAFI  604
            +EL+RIGIG+  +II +++AGLVE+ RL +A+ + +ETSSLSIFWQIPQYVLVGVAEAF+
Sbjct  426  SELKRIGIGLAFTIIALVVAGLVERKRLEFASKDGKETSSLSIFWQIPQYVLVGVAEAFV  485

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YVAQ  FF SQ PD LKS+G+GLSMSSSALGSY+ + IL +VMKITT++G+PGWV PNLN
Sbjct  486  YVAQMNFFTSQAPDGLKSLGMGLSMSSSALGSYVANTILIVVMKITTRNGQPGWVSPNLN  545

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELV  919
            +GHLDRFFFLSA++ A++LV +V CA+RYK I  EK EE + E V
Sbjct  546  EGHLDRFFFLSASLTAINLVFYVVCARRYKVIEFEKREEGNNEEV  590



>ref|XP_010098931.1| Nitrate transporter 1.5 [Morus notabilis]
 gb|EXB76233.1| Nitrate transporter 1.5 [Morus notabilis]
Length=612

 Score =   363 bits (932),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 239/279 (86%), Gaps = 2/279 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+   +M L+ ++++ PNPW +CTVTQVEEVKCVLRLLP+W+CTI +S+VF+Q
Sbjct  325  KFLDRAAIIMPEDMKLIRNEARTPNPWHLCTVTQVEEVKCVLRLLPVWLCTIFSSVVFIQ  384

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAMN  +++FH+PPASMT  DI+S+S FI+ Y+ II+PLY+KL KREPK+P
Sbjct  385  MLSLFVEQGAAMNRTVSNFHIPPASMTVFDIVSTSVFIMLYDKIIVPLYIKLTKREPKIP  444

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANG--EEETSSLSIFWQIPQYVLVGVAEAF  601
            + LQRIGIG+ I+++ M+IAG+VEQ RLRY      +E SSLSI WQ PQYVLVGV+EAF
Sbjct  445  SPLQRIGIGLTIAVLAMIIAGIVEQQRLRYTTNFVRKEISSLSILWQTPQYVLVGVSEAF  504

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YVAQ EFFASQ PD LKS+G+GLSMSSSA+GSY+ S IL+IVMKIT+K+GKPGWVPPNL
Sbjct  505  VYVAQMEFFASQTPDGLKSLGIGLSMSSSAMGSYVASTILTIVMKITSKNGKPGWVPPNL  564

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            NDGHLDRFFF+SAA+ AL+ +++V CAKRYK+I LEK +
Sbjct  565  NDGHLDRFFFVSAALAALNFLLYVVCAKRYKSISLEKRD  603



>gb|KGN46251.1| hypothetical protein Csa_6G077970 [Cucumis sativus]
Length=599

 Score =   352 bits (904),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/284 (62%), Positives = 236/284 (83%), Gaps = 3/284 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+ + E  L+ +  Q PNPW++C VTQVEEVKC+LRLLP+W+CTI +S+VF+Q
Sbjct  309  KFLDRAAILTAEEANLICNHGQTPNPWKICPVTQVEEVKCILRLLPVWLCTIFSSVVFIQ  368

Query  248  VFSLFVEQGAAMNTK-IADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            + SLFVEQGAAM+T  +++FH+PPASMT+ DI+S++ FI+ Y+ +++PLYV++ KR+PK 
Sbjct  369  MISLFVEQGAAMDTLVVSNFHIPPASMTAFDIVSTTMFIMLYDRLLVPLYVRIAKRKPKA  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEAF  601
            PNELQRIGIG+ I+I+ ++IAG VEQ RL++A    +E SS SIFWQ PQYVLVGVAEAF
Sbjct  429  PNELQRIGIGLAIAIVALVIAGFVEQKRLKHAGVSGKEISSFSIFWQTPQYVLVGVAEAF  488

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YVAQ +FF SQ+P+ LKS+G+GLSMSS+A+GSY+ S+IL+ VM IT  +G PGWVPPNL
Sbjct  489  VYVAQMDFFTSQIPEGLKSLGMGLSMSSTAMGSYVASLILTTVMAITKTNGNPGWVPPNL  548

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NDGHLDRFFFLSAA+ A +L +++ CAK+YK  ++EK ++ D E
Sbjct  549  NDGHLDRFFFLSAALTAFNLALYIVCAKQYKGSIIEK-QDGDQE  591



>ref|XP_008460105.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Cucumis 
melo]
Length=605

 Score =   352 bits (904),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 240/290 (83%), Gaps = 7/290 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+ + E  L+ +++Q PNPW++C VTQVEEVKC+LRLLP+W+CTI +S+VF+Q
Sbjct  315  KFLDRAAILTAEEANLICNQAQTPNPWQLCPVTQVEEVKCILRLLPVWLCTIFSSVVFIQ  374

Query  248  VFSLFVEQGAAMNTK-IADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            + SLFVEQGAAM+T  +++FH+PPASMT+ DI+S++ FI+ Y+ +++PLYV++ KR+PK 
Sbjct  375  MISLFVEQGAAMDTLVVSNFHIPPASMTAFDIVSTTMFIMLYDRLLVPLYVRIAKRKPKP  434

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEAF  601
            PNELQRIGIG+ I+I+ ++IAG VEQ RL++A    +E SSLSIFWQ PQYVLVGVAEAF
Sbjct  435  PNELQRIGIGLAIAIVALVIAGFVEQKRLKHAGVSGKEISSLSIFWQTPQYVLVGVAEAF  494

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            ++VAQ +FF SQ+P+ LKS+G+GLSMSS+A+GSY+ S+IL+ VM IT  +G PGWVPPNL
Sbjct  495  VFVAQMDFFTSQIPEGLKSLGMGLSMSSTAMGSYVASLILTTVMAITKTNGHPGWVPPNL  554

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKL-----EETDVEL  916
            NDGHLDRFFFLSAA+ A +L +++ CAK+YK  ++EK      EE+D E 
Sbjct  555  NDGHLDRFFFLSAALTAFNLALYIVCAKQYKGSIIEKQDGDQEEESDREF  604



>ref|XP_008460104.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Cucumis 
melo]
Length=624

 Score =   352 bits (904),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 240/290 (83%), Gaps = 7/290 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+ + E  L+ +++Q PNPW++C VTQVEEVKC+LRLLP+W+CTI +S+VF+Q
Sbjct  334  KFLDRAAILTAEEANLICNQAQTPNPWQLCPVTQVEEVKCILRLLPVWLCTIFSSVVFIQ  393

Query  248  VFSLFVEQGAAMNTK-IADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            + SLFVEQGAAM+T  +++FH+PPASMT+ DI+S++ FI+ Y+ +++PLYV++ KR+PK 
Sbjct  394  MISLFVEQGAAMDTLVVSNFHIPPASMTAFDIVSTTMFIMLYDRLLVPLYVRIAKRKPKP  453

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEAF  601
            PNELQRIGIG+ I+I+ ++IAG VEQ RL++A    +E SSLSIFWQ PQYVLVGVAEAF
Sbjct  454  PNELQRIGIGLAIAIVALVIAGFVEQKRLKHAGVSGKEISSLSIFWQTPQYVLVGVAEAF  513

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            ++VAQ +FF SQ+P+ LKS+G+GLSMSS+A+GSY+ S+IL+ VM IT  +G PGWVPPNL
Sbjct  514  VFVAQMDFFTSQIPEGLKSLGMGLSMSSTAMGSYVASLILTTVMAITKTNGHPGWVPPNL  573

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKL-----EETDVEL  916
            NDGHLDRFFFLSAA+ A +L +++ CAK+YK  ++EK      EE+D E 
Sbjct  574  NDGHLDRFFFLSAALTAFNLALYIVCAKQYKGSIIEKQDGDQEEESDREF  623



>gb|EPS65056.1| hypothetical protein M569_09720, partial [Genlisea aurea]
Length=527

 Score =   343 bits (880),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 181/278 (65%), Positives = 228/278 (82%), Gaps = 6/278 (2%)
 Frame = +2

Query  74   LDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQVF  253
            LDRAA+M  SE T+L  K Q P+PW +CTVTQVEEVKCVLRL+PIW+C I+AS+ F QV 
Sbjct  255  LDRAAMMTPSEKTMLSLKGQTPSPWHLCTVTQVEEVKCVLRLIPIWLCIIVASVAFAQVL  314

Query  254  SLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPNE  433
            SLFVEQG  MNTKI  F +PPASM   DII+ STFIICY+ I+        KR+ + P+E
Sbjct  315  SLFVEQGTTMNTKIRSFEIPPASMIIFDIITISTFIICYKKIL------SRKRQIESPSE  368

Query  434  LQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYVA  613
            LQRIG+GM +SI+ M++AGLVE++RL++A+  EETSSLSIFWQ+PQYVLVG++EA I VA
Sbjct  369  LQRIGVGMAVSILAMIVAGLVERNRLKHADRGEETSSLSIFWQVPQYVLVGISEALINVA  428

Query  614  QWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDGH  793
            QWEFF SQ+ D LKS+GLGLSMSS+ALGSYLCSII+S+VMK+++++GK GW+PPNLN+GH
Sbjct  429  QWEFFTSQISDGLKSLGLGLSMSSTALGSYLCSIIVSLVMKVSSRNGKAGWIPPNLNEGH  488

Query  794  LDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            LDRFFFLS A++A DLV+FV CAKR+K I + K + T+
Sbjct  489  LDRFFFLSGALIACDLVLFVACAKRFKCIQVLKKDNTE  526



>ref|XP_004308457.1| PREDICTED: nitrate transporter 1.5-like [Fragaria vesca subsp. 
vesca]
Length=596

 Score =   345 bits (884),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/261 (66%), Positives = 222/261 (85%), Gaps = 1/261 (0%)
 Frame = +2

Query  122  DKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQVFSLFVEQGAAMNTKIAD  301
            ++ Q PNPW +CTVTQVEEVKCVLR+LPIW+CTI +S+VF+Q+ SLFVEQGAAMN +++ 
Sbjct  333  NEGQTPNPWYLCTVTQVEEVKCVLRILPIWLCTIFSSVVFIQMLSLFVEQGAAMNRRVSK  392

Query  302  -FHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPNELQRIGIGMVISIITM  478
             FH+PPASMT+ DI+S++ FI+ Y+ +++PL +K+ KREPK P+ELQRIGIG+ I+++ +
Sbjct  393  TFHIPPASMTAFDIVSTTLFIVLYDKLVVPLCIKITKREPKPPSELQRIGIGLAIAVLAL  452

Query  479  LIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYVAQWEFFASQVPDslks  658
            +IAG VE+ RL++A+  EETSSLSIFWQ PQYVLVGV+EAF+Y+A+ EFF SQ PD LKS
Sbjct  453  VIAGFVERLRLKHASITEETSSLSIFWQTPQYVLVGVSEAFVYIAKMEFFTSQTPDGLKS  512

Query  659  iglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDGHLDRFFFLSAAIVALD  838
            +G+ LSM SSA+GSY+ S+IL++VMKITT+ G+PGWVPPNLNDGHLDRFFFLSA + AL+
Sbjct  513  LGMALSMFSSAIGSYVASMILTVVMKITTRKGEPGWVPPNLNDGHLDRFFFLSAGLTALN  572

Query  839  LVMFVFCAKRYKAIVLEKLEE  901
            L  +V CAKRYK I L K EE
Sbjct  573  LAFYVVCAKRYKFISLGKREE  593



>ref|XP_003605166.1| Peptide transporter [Medicago truncatula]
Length=622

 Score =   340 bits (873),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/272 (64%), Positives = 227/272 (83%), Gaps = 1/272 (0%)
 Frame = +2

Query  125  KSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQVFSLFVEQGAAMNTKIADF  304
            K + PNPW++CTVTQVEEVKC+LRLLP+W+CTI +S+VF+Q+ SLFVEQG+ MN K   F
Sbjct  308  KLKNPNPWKLCTVTQVEEVKCILRLLPVWLCTIFSSVVFIQMLSLFVEQGSTMNRKFYKF  367

Query  305  HMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPNELQRIGIGMVISIITMLI  484
             +PPASMT+ DIIS+S FI+ ++ +I+PLYVK++KR+PKLP+ELQRIGIG+ I+I+ +++
Sbjct  368  EIPPASMTAFDIISTSAFIMLFDILIVPLYVKVIKRDPKLPSELQRIGIGLSITILALIV  427

Query  485  AGLVEQHRLRYANGE-EETSSLSIFWQIPQYVLVGVAEAFIYVAQWEFFASQVPDslksi  661
            AGLVE+ RL +A+ + +ETSSLSIFWQIPQYVLVGVAEAF+YVAQ  FF +Q PD LKS+
Sbjct  428  AGLVERKRLEFASKDGKETSSLSIFWQIPQYVLVGVAEAFVYVAQMNFFTAQAPDGLKSL  487

Query  662  glglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDGHLDRFFFLSAAIVALDL  841
            G+GLSMSSSA+GSY+ + IL++VMKIT+ HG+PGWV PNLNDGHLD FFFLSA +  ++L
Sbjct  488  GMGLSMSSSAVGSYVANTILTVVMKITSTHGRPGWVSPNLNDGHLDWFFFLSACLTGINL  547

Query  842  VMFVFCAKRYKAIVLEKLEETDVELVEGTPLS  937
            + ++ CA+RYK I LEK EE   +LV    +S
Sbjct  548  IFYIVCARRYKLIELEKREEILKDLVSSLRIS  579



>ref|XP_007052096.1| Nitrate transporter 1.5 [Theobroma cacao]
 gb|EOX96253.1| Nitrate transporter 1.5 [Theobroma cacao]
Length=616

 Score =   333 bits (855),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 234/279 (84%), Gaps = 1/279 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+   ++ LL +K +  NPW +CT+TQVEEVKC+LRLLPIW+C+IL+S+VFVQ
Sbjct  325  KFLDRAAIITPQDIFLLTNKGETANPWYLCTITQVEEVKCILRLLPIWLCSILSSVVFVQ  384

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM+T I++FH+PPASM + DI+S+S FI+ Y+ +++PLYV+L KREPK P
Sbjct  385  MLSLFVEQGAAMDTTISNFHIPPASMFAFDIVSTSAFILLYDKLMVPLYVRLTKREPKPP  444

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEAFI  604
            + LQRIGIG+ I++++M+IAG VEQ RL+YAN    ETS+LSIFWQ PQYVLVGV+EA I
Sbjct  445  SGLQRIGIGIAIAMVSMIIAGTVEQQRLKYANHNGAETSALSIFWQTPQYVLVGVSEALI  504

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YVAQ EFFASQ PD LKS+G+GLSM SSA+GSY+CSIIL+ VM IT+K+GKPGWVPP+LN
Sbjct  505  YVAQMEFFASQTPDGLKSLGIGLSMYSSAMGSYICSIILAAVMAITSKNGKPGWVPPDLN  564

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             GHLDR+FFL AA+ AL+L +FV CAKRY  +  EK  E
Sbjct  565  AGHLDRYFFLLAALAALNLALFVACAKRYNPVSFEKRAE  603



>gb|KDO85793.1| hypothetical protein CISIN_1g035554mg, partial [Citrus sinensis]
Length=562

 Score =   320 bits (821),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 223/286 (78%), Gaps = 26/286 (9%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAIM S+++T   ++ Q PN WR+CTVTQVEE+                      
Sbjct  302  KFLDRAAIMTSADIT--TNEDQNPNQWRLCTVTQVEEM----------------------  337

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
              SLFVEQGAAMNT +++F +PPASMT+ DI+S++ FI+ Y+ +I+PLY+K+ KR PK P
Sbjct  338  -LSLFVEQGAAMNTGVSNFQIPPASMTAFDIVSTTAFILLYDKLIVPLYLKVAKRRPKTP  396

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYAN-GEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQR+GIG+ I+ + M+IAG+VEQ RL+YA+ G EETSSLSIFWQ PQYVL+GV+EAF+
Sbjct  397  SELQRVGIGLAIATVAMIIAGIVEQRRLKYASFGGEETSSLSIFWQTPQYVLLGVSEAFV  456

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YVAQ EFFASQ+P+ LKS+G+ LSMSS+A+G+Y+CS+ILS+VM +TTK+GKPGWVPPNLN
Sbjct  457  YVAQMEFFASQIPNGLKSLGIALSMSSTAIGTYVCSMILSVVMVLTTKNGKPGWVPPNLN  516

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            DGHLDRFFFLSA + A++L +FV CA+RYK+I L+K E      V+
Sbjct  517  DGHLDRFFFLSATVTAMNLGVFVVCARRYKSISLQKQEGESAAGVQ  562



>ref|XP_004506506.1| PREDICTED: nitrate transporter 1.5-like [Cicer arietinum]
Length=582

 Score =   304 bits (778),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 210/272 (77%), Gaps = 1/272 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI++     +L  K Q    W  C++TQ E +K +LR+LPIW CTI +S VF+Q
Sbjct  311  RFLDRAAIVSHEANEMLLGKGQKSYKWNFCSITQNERMKYILRVLPIWFCTIFSSSVFIQ  370

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+ M+T    F +PPASMT+ DII++STFII ++ +I+PLYVK+MKR PKLP
Sbjct  371  MLSLFVEQGSTMDTTFLKFQIPPASMTAFDIINTSTFIILFDVLIIPLYVKVMKRSPKLP  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQ IGIG  I+ IT+++AG VE+ RL +A +  EETSSLSIFW IPQY+L+GVAEAF+
Sbjct  431  SELQSIGIGFAIATITLIVAGFVEKKRLIFASDNGEETSSLSIFWLIPQYMLLGVAEAFV  490

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
             VAQ  FF SQ PD L+S+G+GLSM SSALG Y+ +IIL++V KIT+  G+ GWV PNLN
Sbjct  491  SVAQMNFFTSQTPDGLESLGMGLSMFSSALGCYVGNIILTVVNKITSSQGQHGWVSPNLN  550

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
            DGHLDR++FL A ++ + L++++ CAKRYK I
Sbjct  551  DGHLDRYYFLIAFLIVIVLMLYIVCAKRYKGI  582



>gb|AFK43494.1| unknown [Medicago truncatula]
Length=306

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 155/273 (57%), Positives = 206/273 (75%), Gaps = 2/273 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF DRA I++     +L  K Q    W   ++TQ E V  +LR+LPIW+CTI +S VF+Q
Sbjct  34   RFFDRAGIVSDEATEMLLGKGQKSYKWNFNSLTQSEAVTYILRVLPIWICTIFSSSVFIQ  93

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+ M+     F +PP+SMT+ DIIS+STFII  + +I+PLY+K+MKR PKLP
Sbjct  94   LLSLFVEQGSTMDRTFFKFQIPPSSMTAFDIISTSTFIILLDVLIIPLYIKVMKRPPKLP  153

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQ IGIG+ I+IIT+++AG VEQ RL +A N  +E SSLSIFW IPQY+L+G+AEAF+
Sbjct  154  SELQSIGIGLCITIITLIVAGFVEQRRLSFASNDGKEMSSLSIFWLIPQYMLLGIAEAFV  213

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTK-HGKPGWVPPNL  781
            YVAQ  FF SQ PD L+S+G+GLSM SSALG Y+ +  L++V KIT+   G+ GWV PNL
Sbjct  214  YVAQMNFFTSQTPDGLESLGMGLSMFSSALGCYVGNFFLTVVNKITSSGQGQHGWVSPNL  273

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
            ND HL RFFFL+A ++A+DL++++ CAKRYK I
Sbjct  274  NDDHLYRFFFLTAFLIAIDLIVYIVCAKRYKGI  306



>ref|XP_003525604.1| PREDICTED: nitrate transporter 1.5-like isoform X1 [Glycine max]
Length=597

 Score =   301 bits (772),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 214/286 (75%), Gaps = 7/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++  +  L   KS V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  308  KFLDRAAFISPRD--LEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I++F +PPASM+S DI+S + FI  Y  +I PL  +L K+  +  
Sbjct  366  MASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKKKSSRGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ M+ AG+VE +RL+YAN        TSSLSIFWQIPQY L+G +E
Sbjct  426  TELQRMGIGLVIAVMAMVSAGIVECYRLKYANSGCPHCSGTSSLSIFWQIPQYALIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ SI++SIVMKI+T+   PGW+P 
Sbjct  486  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSILVSIVMKISTEDHMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDV  910
            NLN GHLDRF+FL A + ++DLV+++ CAK +K+I LE K EE D+
Sbjct  546  NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGKYEENDM  591



>ref|XP_006579680.1| PREDICTED: nitrate transporter 1.5-like isoform X2 [Glycine max]
Length=598

 Score =   301 bits (771),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 214/286 (75%), Gaps = 7/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++  +  L   KS V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  309  KFLDRAAFISPRD--LEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I++F +PPASM+S DI+S + FI  Y  +I PL  +L K+  +  
Sbjct  367  MASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKKKSSRGL  426

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ M+ AG+VE +RL+YAN        TSSLSIFWQIPQY L+G +E
Sbjct  427  TELQRMGIGLVIAVMAMVSAGIVECYRLKYANSGCPHCSGTSSLSIFWQIPQYALIGASE  486

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ SI++SIVMKI+T+   PGW+P 
Sbjct  487  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSILVSIVMKISTEDHMPGWIPG  546

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDV  910
            NLN GHLDRF+FL A + ++DLV+++ CAK +K+I LE K EE D+
Sbjct  547  NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGKYEENDM  592



>gb|KHN21024.1| Nitrate transporter 1.5, partial [Glycine soja]
Length=606

 Score =   301 bits (771),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 214/286 (75%), Gaps = 7/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++  +  L   KS V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  317  KFLDRAAFISPRD--LEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  374

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I++F +PPASM+S DI+S + FI  Y  +I PL  +L K+  +  
Sbjct  375  MASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKKKSSRGL  434

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ M+ AG+VE +RL+YAN        TSSLSIFWQIPQY L+G +E
Sbjct  435  TELQRMGIGLVIAVMAMVSAGIVECYRLKYANSGCPHCSGTSSLSIFWQIPQYALIGASE  494

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ SI++SIVMKI+T+   PGW+P 
Sbjct  495  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSILVSIVMKISTEDHMPGWIPG  554

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDV  910
            NLN GHLDRF+FL A + ++DLV+++ CAK +K+I LE K EE D+
Sbjct  555  NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGKYEENDM  600



>ref|XP_011011752.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X1 [Populus 
euphratica]
Length=616

 Score =   300 bits (769),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 210/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+ S + T    ++++ +PWRVCTVTQVEE KC+LRLLPIW+CTIL S+VF Q
Sbjct  326  RFLDRAAIITSKDYT----ENRIHDPWRVCTVTQVEEFKCILRLLPIWLCTILYSVVFTQ  381

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M T I+ FH+PPASM+S DI+S + FI  Y  ++ PL V  ++++PK  
Sbjct  382  MASLFVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPL-VARIRKDPKGL  440

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+II M+ AG+VE  RL+YA  +    E  SSLSI WQIPQYVL+G +E
Sbjct  441  TELQRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLSILWQIPQYVLIGASE  500

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  501  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPG  560

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL A +   DLV+++ CA+ YK I  E+ +E D
Sbjct  561  NLNKGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEAD  604



>gb|KHN01673.1| Nitrate transporter 1.5 [Glycine soja]
Length=597

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 215/286 (75%), Gaps = 7/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI++S ++     KS V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  308  KFLDRAAIISSRDLE--DQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ F +PPASM+S DI+S + FI  Y  +I PL  +L K+  K  
Sbjct  366  MASLFVEQGAAMKTTISHFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKKKSSKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYAN----GEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ M+ AG+VE +RL+YA+        TSSL+IFWQIPQY L+G +E
Sbjct  426  TELQRMGIGLVIAVMAMVSAGIVECYRLKYADPVCPHCSGTSSLTIFWQIPQYTLIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P 
Sbjct  486  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTEDHMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDV  910
            NLN GHLDRF+FL A + ++DLV+++ CAK +K+I LE K EE D+
Sbjct  546  NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGKYEENDM  591



>ref|XP_011011753.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X2 [Populus 
euphratica]
Length=611

 Score =   300 bits (768),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 210/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+ S + T    ++++ +PWRVCTVTQVEE KC+LRLLPIW+CTIL S+VF Q
Sbjct  321  RFLDRAAIITSKDYT----ENRIHDPWRVCTVTQVEEFKCILRLLPIWLCTILYSVVFTQ  376

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M T I+ FH+PPASM+S DI+S + FI  Y  ++ PL V  ++++PK  
Sbjct  377  MASLFVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPL-VARIRKDPKGL  435

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+II M+ AG+VE  RL+YA  +    E  SSLSI WQIPQYVL+G +E
Sbjct  436  TELQRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLSILWQIPQYVLIGASE  495

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  496  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPG  555

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL A +   DLV+++ CA+ YK I  E+ +E D
Sbjct  556  NLNKGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEAD  599



>ref|XP_002320578.1| hypothetical protein POPTR_0014s17750g [Populus trichocarpa]
 gb|EEE98893.1| hypothetical protein POPTR_0014s17750g [Populus trichocarpa]
Length=606

 Score =   300 bits (768),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 209/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+ S + T    ++++ +PWRVCTV QVEE KC+LRLLPIW+CTIL S+VF Q
Sbjct  316  RFLDRAAIITSKDYT----ENRIHDPWRVCTVNQVEEFKCILRLLPIWLCTILYSVVFTQ  371

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M T I+ FH+PPASM+S DI+S + FI  Y  ++ PL V  ++++PK  
Sbjct  372  MASLFVEQGADMKTTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPL-VARIRKDPKGL  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+II M+ AG+VE  RL+YA  +    E  SSLSI WQIPQYVL+G +E
Sbjct  431  TELQRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPRCESASSLSILWQIPQYVLIGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  491  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPG  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRFFFL A +   DLV+++ CA+ YK I  E+ +E D
Sbjct  551  NLNKGHLDRFFFLLAVLTTADLVLYIICARWYKYIKFERQQEAD  594



>ref|XP_006436768.1| hypothetical protein CICLE_v10031017mg [Citrus clementina]
 ref|XP_006485423.1| PREDICTED: nitrate transporter 1.5-like [Citrus sinensis]
 gb|ESR50008.1| hypothetical protein CICLE_v10031017mg [Citrus clementina]
 gb|KDO53845.1| hypothetical protein CISIN_1g007612mg [Citrus sinensis]
Length=596

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 210/287 (73%), Gaps = 7/287 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K    NPWR+C VTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  308  KFLDRAAYISSRDLD--EQKQGCSNPWRLCPVTQVEEVKCILRLLPIWLCTILYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  +I PL   + K+  K  
Sbjct  366  MASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVAAFIFLYRRVIEPLAGGIRKKNSKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I+ ML AG+VE +RL+YA  E    E  SSLSIFWQ+PQY L+G +E
Sbjct  426  TELQRMGIGLVIAIVAMLAAGIVECYRLKYAKTECKHCEGASSLSIFWQVPQYALIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YVAQ EFF +Q PD LKS G  L M+S +LG+Y+ S++L++VMKI+T+   PGWVP 
Sbjct  486  VFMYVAQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLLTMVMKISTEDHMPGWVPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDVE  913
            NLN GHLDRF+FL A +  +D V+++ CAK YK I LE K  E++ +
Sbjct  546  NLNKGHLDRFYFLLAGLTTVDFVVYIACAKWYKCIELEAKCAESNQD  592



>ref|XP_011011755.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X4 [Populus 
euphratica]
Length=601

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 210/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+ S + T    ++++ +PWRVCTVTQVEE KC+LRLLPIW+CTIL S+VF Q
Sbjct  311  RFLDRAAIITSKDYT----ENRIHDPWRVCTVTQVEEFKCILRLLPIWLCTILYSVVFTQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M T I+ FH+PPASM+S DI+S + FI  Y  ++ PL V  ++++PK  
Sbjct  367  MASLFVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPL-VARIRKDPKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+II M+ AG+VE  RL+YA  +    E  SSLSI WQIPQYVL+G +E
Sbjct  426  TELQRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLSILWQIPQYVLIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  486  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL A +   DLV+++ CA+ YK I  E+ +E D
Sbjct  546  NLNKGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEAD  589



>ref|XP_003550941.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=597

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 215/286 (75%), Gaps = 7/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI++S +  L   KS V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  308  KFLDRAAIISSRD--LEDQKSGVYNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ F +PPASM+S DI+S + FI  Y  +I PL  +L K+  K  
Sbjct  366  MASLFVEQGAAMKTTISHFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKKKSSKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYAN----GEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ M+ AG+VE +RL+YA+        TSSL+IFWQIPQY L+G +E
Sbjct  426  TELQRMGIGLVIAVMAMVSAGIVECYRLKYADPVCPHCSGTSSLTIFWQIPQYTLIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P 
Sbjct  486  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTEDHMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDV  910
            NLN GHLDRF+FL A + ++DLV+++ CAK +K+I LE K EE D+
Sbjct  546  NLNRGHLDRFYFLLAILTSIDLVLYIACAKWFKSIQLEGKYEENDM  591



>ref|XP_011011754.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X3 [Populus 
euphratica]
Length=606

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 210/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+ S + T    ++++ +PWRVCTVTQVEE KC+LRLLPIW+CTIL S+VF Q
Sbjct  316  RFLDRAAIITSKDYT----ENRIHDPWRVCTVTQVEEFKCILRLLPIWLCTILYSVVFTQ  371

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M T I+ FH+PPASM+S DI+S + FI  Y  ++ PL V  ++++PK  
Sbjct  372  MASLFVEQGADMETTISKFHIPPASMSSFDILSVAAFIFIYRRVLDPL-VARIRKDPKGL  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+II M+ AG+VE  RL+YA  +    E  SSLSI WQIPQYVL+G +E
Sbjct  431  TELQRMGIGLVIAIIAMVSAGIVELFRLKYARKDCPSCESASSLSILWQIPQYVLIGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  491  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGWIPG  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL A +   DLV+++ CA+ YK I  E+ +E D
Sbjct  551  NLNKGHLDRFYFLLAVLTTADLVVYIICARWYKYIRFERQQEAD  594



>ref|XP_008465942.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Cucumis melo]
Length=601

 Score =   298 bits (763),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 211/285 (74%), Gaps = 7/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++        + NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  312  KFLDRAAYISSRDLD--NQGRGIDNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  369

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I++FH+PPASM+S DI+S + FI  Y  ++ PL  KL K + K  
Sbjct  370  MASLFVEQGAAMKTVISNFHIPPASMSSFDILSVAVFIFLYRRVLEPLAGKLRKSDSKGL  429

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG++I+++ M+ AG+VE +RL+YA G+    E +SSLSIFWQ+PQY  +G +E
Sbjct  430  TELQRMGIGLIIAVMAMVSAGIVECYRLKYAKGDCTHCEGSSSLSIFWQVPQYAFIGASE  489

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  490  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPG  549

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            NLN GHLDRF+FL A + A+D  +++ CA+ YK I LE K EE +
Sbjct  550  NLNRGHLDRFYFLLAGLTAIDFAVYILCARWYKCIKLEGKCEENE  594



>ref|XP_004148494.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 ref|XP_004168597.1| PREDICTED: LOW QUALITY PROTEIN: nitrate transporter 1.5-like 
[Cucumis sativus]
 gb|KGN60418.1| hypothetical protein Csa_3G904070 [Cucumis sativus]
Length=602

 Score =   296 bits (759),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/285 (53%), Positives = 211/285 (74%), Gaps = 7/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++        + NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  313  KFLDRAAYISSRDLD--NQGRGIGNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  370

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++FH+PPASM+S DI+S + FI  Y  ++ PL  KL K + K  
Sbjct  371  MASLFVEQGAAMKTVVSNFHIPPASMSSFDILSVAVFIFLYRRVLDPLAGKLRKSDSKGL  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG++I+++ M+ AG+VE +RL+YA G+    E +SSLSIFWQ+PQY  +G +E
Sbjct  431  TELQRMGIGLIIAVMAMVSAGIVECYRLKYAKGDCTHCEGSSSLSIFWQVPQYAFIGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  491  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPG  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            NLN GHLDRF+FL A + A+D  +++ CA+ YK I LE K EE +
Sbjct  551  NLNRGHLDRFYFLLAGLTAIDFAVYIMCARWYKCIKLEGKCEENE  595



>ref|XP_007008714.1| Nitrate transporter 1.5 [Theobroma cacao]
 gb|EOY17524.1| Nitrate transporter 1.5 [Theobroma cacao]
Length=609

 Score =   296 bits (759),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/285 (56%), Positives = 208/285 (73%), Gaps = 6/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKS-QVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            RFLDRAAIM   +     +K+    NPW +CTVTQVEEVKC+LRLLPIW+CTIL S+VF 
Sbjct  313  RFLDRAAIMTPRDYADGQEKNIDGRNPWSLCTVTQVEEVKCILRLLPIWLCTILYSVVFT  372

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAM T I++FH+P ASM+S DI+S +TFI  Y  ++ P+ V  +K +PK 
Sbjct  373  QMASLFVEQGAAMKTTISNFHIPAASMSSFDILSVATFIFIYRRVLDPI-VARIKTKPKG  431

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              ELQR+GIG+VI+I+ M+ AG+VE  RL+YA+ +    E  SSLSIFWQ+PQY+L+G +
Sbjct  432  LTELQRMGIGLVIAILAMVSAGIVELFRLKYADKDCPSCENASSLSIFWQVPQYMLIGAS  491

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+T+   PGW+P
Sbjct  492  EVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKISTRDDMPGWIP  551

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
             NLN GHLDRF+FL AA+   DLV+++ CAK YK I  E     D
Sbjct  552  GNLNRGHLDRFYFLLAALTTADLVVYIICAKWYKYIKFEGRSGED  596



>gb|AES87363.2| peptide/nitrate transporter [Medicago truncatula]
Length=570

 Score =   295 bits (756),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 213/272 (78%), Gaps = 13/272 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+++ E   L +K++            +E + C      IW+CTI +S+VF+Q
Sbjct  296  RFLDRAAIISTKEKNQLLEKAEKSK--------SLETLHCD----TIWLCTIFSSVVFIQ  343

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+ MN K   F +PPASMT+ DIIS+S FI+ ++ +I+PLYVK++KR+PKLP
Sbjct  344  MLSLFVEQGSTMNRKFYKFEIPPASMTAFDIISTSAFIMLFDILIVPLYVKVIKRDPKLP  403

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE-EETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQRIGIG+ I+I+ +++AGLVE+ RL +A+ + +ETSSLSIFWQIPQYVLVGVAEAF+
Sbjct  404  SELQRIGIGLSITILALIVAGLVERKRLEFASKDGKETSSLSIFWQIPQYVLVGVAEAFV  463

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YVAQ  FF +Q PD LKS+G+GLSMSSSA+GSY+ + IL++VMKIT+ HG+PGWV PNLN
Sbjct  464  YVAQMNFFTAQAPDGLKSLGMGLSMSSSAVGSYVANTILTVVMKITSTHGRPGWVSPNLN  523

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
            DGHLD FFFLSA +  ++L+ ++ CA+RYK I
Sbjct  524  DGHLDWFFFLSACLTGINLIFYIVCARRYKLI  555



>ref|XP_004150179.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
Length=587

 Score =   295 bits (756),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/286 (54%), Positives = 213/286 (74%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA ++S +   L DK Q V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF 
Sbjct  298  KFLDKAAYISSRD---LSDKEQGVNNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFT  354

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAM T +++FH+PPASM+S DI+S + FI  Y  ++ P   KL K     
Sbjct  355  QMASLFVEQGAAMKTTVSNFHIPPASMSSFDILSVALFIFLYRRVLDPFVGKLKKSSSTG  414

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              ELQR+G+G++I+++ M+ AG+VE +RL+YA  +    E +SSLSIFWQ+PQY L+G +
Sbjct  415  LTELQRMGVGLIIAVMAMVSAGIVECYRLKYAQADCTHCEGSSSLSIFWQVPQYALIGAS  474

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T    PGW+P
Sbjct  475  EVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTVDRMPGWIP  534

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETD  907
             NLN GHLDRF+FL AA+  +D V+++ CAK YK+I L EK E+T+
Sbjct  535  GNLNKGHLDRFYFLLAALTVVDFVIYIVCAKWYKSIKLEEKYEQTE  580



>ref|XP_008448722.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Cucumis melo]
Length=601

 Score =   295 bits (756),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 213/286 (74%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA ++S +   L DK Q V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF 
Sbjct  312  KFLDKAAYISSRD---LSDKEQGVNNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAM T I++FH+PPASM+S DI+S + FI  Y  ++ P   KL K     
Sbjct  369  QMASLFVEQGAAMKTTISNFHIPPASMSSFDILSVALFIFLYRRVLDPFVGKLKKSSSTG  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              ELQR+G+G++I+++ M+ AG+VE +RL+YA  +    E +SSLSIFWQ+PQY L+G +
Sbjct  429  LTELQRMGVGLIIAVMAMVSAGIVECYRLKYAQADCTHCEGSSSLSIFWQVPQYALIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T    PGW+P
Sbjct  489  EVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTVDRMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETD  907
             NLN GHLDRF+FL AA+  +D V+++ CAK YK+I L EK E+T+
Sbjct  549  GNLNKGHLDRFYFLLAALTVVDFVIYIVCAKWYKSIKLEEKYEQTE  594



>ref|XP_010104361.1| Nitrate transporter 1.5 [Morus notabilis]
 gb|EXB99781.1| Nitrate transporter 1.5 [Morus notabilis]
Length=562

 Score =   294 bits (752),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/285 (54%), Positives = 212/285 (74%), Gaps = 7/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S EM +     +  NPWR+C+VTQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  265  KFLDRAAYISSREMEVQQQGHR--NPWRLCSVTQVEEVKCILRLLPIWLCTIIYSVVFTQ  322

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+AM T +++F +PPASM+S DI+S + FI     I+ PL  +L K  P+  
Sbjct  323  MASLFVEQGSAMKTTVSNFRIPPASMSSFDILSVALFIFINRRILDPLVGRLRKTSPRGL  382

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
            +ELQR+G+G+VI+++ M+ AG+VE +RL YA  +    E +SSLSIFWQ+PQY  +G +E
Sbjct  383  SELQRMGVGLVIAVMAMVSAGIVECYRLEYARKDCTHCEGSSSLSIFWQVPQYAFIGASE  442

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P 
Sbjct  443  VFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSMVMKISTEDHMPGWIPG  502

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            NLN GHLDRF+FL AA+ ++DLV+++ CAK YK I LE K  E D
Sbjct  503  NLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKCIKLEGKCGEND  547



>ref|XP_004163981.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 gb|KGN55790.1| hypothetical protein Csa_3G015860 [Cucumis sativus]
Length=601

 Score =   295 bits (755),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/286 (54%), Positives = 213/286 (74%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA ++S +   L DK Q V NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF 
Sbjct  312  KFLDKAAYISSRD---LSDKEQGVNNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAM T +++FH+PPASM+S DI+S + FI  Y  ++ P   KL K     
Sbjct  369  QMASLFVEQGAAMKTTVSNFHIPPASMSSFDILSVALFIFLYRRVLDPFVGKLKKSSSTG  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              ELQR+G+G++I+++ M+ AG+VE +RL+YA  +    E +SSLSIFWQ+PQY L+G +
Sbjct  429  LTELQRMGVGLIIAVMAMVSAGIVECYRLKYAQADCTHCEGSSSLSIFWQVPQYALIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T    PGW+P
Sbjct  489  EVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTVDRMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETD  907
             NLN GHLDRF+FL AA+  +D V+++ CAK YK+I L EK E+T+
Sbjct  549  GNLNKGHLDRFYFLLAALTVVDFVIYIVCAKWYKSIKLEEKYEQTE  594



>ref|XP_007155757.1| hypothetical protein PHAVU_003G229000g [Phaseolus vulgaris]
 gb|ESW27751.1| hypothetical protein PHAVU_003G229000g [Phaseolus vulgaris]
Length=597

 Score =   294 bits (753),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 212/286 (74%), Gaps = 7/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA +++ ++     K  + NPWR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  308  KFLDRAAFISTRDLE--DQKRGLHNPWRLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ F +PPASM+S DI+S + FI  Y  +I PL  +L K   K  
Sbjct  366  MASLFVEQGAAMKTTISHFRIPPASMSSFDILSVAVFIFFYRRVIDPLVGRLKKTSSKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ M+ AG+VE +RL+YA         TSSLSIFWQIPQY L+G +E
Sbjct  426  TELQRMGIGLVIAVMAMVSAGIVECYRLKYAKVGCPHCSGTSSLSIFWQIPQYALIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P 
Sbjct  486  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTEDQMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDV  910
            NLN GHLDRF+FL AA+ ++DL++++ CAK +K+I LE K E+ D+
Sbjct  546  NLNRGHLDRFYFLLAALTSIDLIVYILCAKWFKSIQLEGKYEDNDM  591



>ref|XP_010538507.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Tarenaya hassleriana]
Length=581

 Score =   293 bits (750),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 209/286 (73%), Gaps = 11/286 (4%)
 Frame = +2

Query  68   RFLDRAA-IMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            RFLDRAA +M   E+    DK    +PW++CTVTQVEEVKCVLRLLPIW+CTIL S+VF 
Sbjct  305  RFLDRAATVMPDDEI----DKESSYDPWKLCTVTQVEEVKCVLRLLPIWLCTILYSVVFT  360

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-K  421
            Q+ SLFVEQGA M T IADFH+PPASM+S DI+S + FI  Y  ++ P++ +L K EP K
Sbjct  361  QMASLFVEQGAVMKTTIADFHIPPASMSSFDILSVAFFIFVYRRVLDPIFSRLNKTEPNK  420

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               ELQR+GIG+VI+++ M+ AG+VE  RL++ N  E  SSLSIFWQ+PQYVL+G +E F
Sbjct  421  GLTELQRMGIGLVIAVMAMIAAGVVEIFRLKHKNTSE--SSLSIFWQVPQYVLIGASEVF  478

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q P  LKS G  L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P NL
Sbjct  479  MYVGQLEFFNGQAPSGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTRDEMPGWIPGNL  538

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELV  919
            N GHL+RFFFL AA+   D V+++ CAK YK I   K E T +E V
Sbjct  539  NKGHLERFFFLLAALTTADFVVYLICAKWYKYI---KSEPTFIEAV  581



>ref|XP_010269969.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nelumbo nucifera]
Length=612

 Score =   294 bits (752),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/278 (56%), Positives = 203/278 (73%), Gaps = 6/278 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+ S + T  P      +PW +CT+TQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  319  RFLDRAAIITSKDTT--PHNKGCHSPWNLCTITQVEEVKCILRLLPIWLCTILYSVVFTQ  376

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I++F +PPASM+S DI+S + FI  Y  I+ P    L K   K  
Sbjct  377  MASLFVEQGAAMKTTISNFRIPPASMSSFDILSVAAFIFIYRRILDPFVSTLKKASGKGL  436

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+II M+ AG+VE +RL+YA  +    E +SSLSIFWQIPQYVL+G +E
Sbjct  437  TELQRMGVGLIIAIIAMVSAGIVECYRLKYAKQDCKHCEGSSSLSIFWQIPQYVLIGASE  496

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  497  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDNMPGWIPG  556

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            NLN GHLDRF+FL A +  LD +++V CAK YK + LE
Sbjct  557  NLNKGHLDRFYFLLAVLTTLDFLVYVACAKWYKYMKLE  594



>ref|XP_010096008.1| Nitrate transporter 1.5 [Morus notabilis]
 gb|EXB62701.1| Nitrate transporter 1.5 [Morus notabilis]
Length=591

 Score =   293 bits (751),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 216/296 (73%), Gaps = 4/296 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD AAI+   ++ L+ D  + P+ W +CTVTQVEEVKC+LRLLPIW+C++  ++V+ Q
Sbjct  297  KFLDSAAIITPEDVKLI-DGGRSPSSWHLCTVTQVEEVKCILRLLPIWLCSVFFAVVYTQ  355

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLF EQG AMN  + +F +PP S+ + +II +S FI+ Y+++++P+YVKL K EP++P
Sbjct  356  MLSLFTEQGDAMNKSVFNFSVPPGSIYAFNIIGTSVFILSYDSVVIPIYVKLNK-EPRVP  414

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANG--EEETSSLSIFWQIPQYVLVGVAEAF  601
            + LQR+GIG+ IS++ M+IAG+VEQ RL+ A     EE S L+I WQIPQYVLVG+AEAF
Sbjct  415  STLQRMGIGLAISVLPMVIAGVVEQQRLKCARNLLVEEQSCLNILWQIPQYVLVGLAEAF  474

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
             YV Q EFF  Q P  LKS+G+ L MS  A+GSY+ S IL++V KIT+K GKPGWVP NL
Sbjct  475  FYVGQIEFFVEQTPGGLKSLGISLCMSCLAVGSYVASAILTVVTKITSKDGKPGWVPRNL  534

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVEGTPLS*SYD  949
            NDGHLDRFFF+ A +  ++ +++V CAK YK+I  E   +++    EG  L  + D
Sbjct  535  NDGHLDRFFFVLAPMAVVNFILYVVCAKCYKSISWEMRSDSEACQEEGFGLRRNSD  590



>ref|XP_002519847.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF42451.1| Peptide transporter, putative [Ricinus communis]
Length=598

 Score =   293 bits (751),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 152/278 (55%), Positives = 208/278 (75%), Gaps = 6/278 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S +M      SQ  NPWR+C +TQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  308  KFLDRAAFISSRDMDEQKQGSQ--NPWRLCPITQVEEVKCILRLLPIWLCTILYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  ++ PL  ++   + K  
Sbjct  366  MASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVALFIFLYRRVLDPLISRIRNSKSKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I+ M+ AG+VE +RL+YAN +    E +SSLSIFWQ+PQY L+G +E
Sbjct  426  TELQRMGIGLVIAIMAMVSAGIVECYRLKYANKDCTRCEGSSSLSIFWQVPQYALIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  486  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            NLN GHLDRF+FL A +  +DLV+++ CA+ YK I LE
Sbjct  546  NLNKGHLDRFYFLLAGLTTIDLVVYMACARWYKCIKLE  583



>ref|XP_002526521.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF35912.1| Peptide transporter, putative [Ricinus communis]
Length=601

 Score =   293 bits (751),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 207/281 (74%), Gaps = 12/281 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAA++ S +       + + NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  314  RFLDRAALITSEDNV----NADIRNPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  369

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ FH+PPASM+S DI+S + FI  Y  I+ PL V  ++++P+  
Sbjct  370  MASLFVEQGAAMKTTISSFHIPPASMSSFDIVSVAVFIFMYRRILDPL-VARIRKDPRGL  428

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE-------EETSSLSIFWQIPQYVLVG  586
             ELQR+GIG+VI+I+ M+ AG+VE  RL+Y N +       E  SSLSIFWQIPQYVL+G
Sbjct  429  TELQRMGIGLVIAILAMVSAGVVELFRLKYKNTQKAVCADCESESSLSIFWQIPQYVLIG  488

Query  587  VAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGW  766
             +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW
Sbjct  489  ASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDEMPGW  548

Query  767  VPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            +P NLN GHLDRF+FL AA+   DL++++  AK YK I  +
Sbjct  549  IPGNLNKGHLDRFYFLLAALTTADLIIYILTAKWYKYIKFQ  589



>ref|XP_011018609.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Populus euphratica]
Length=598

 Score =   293 bits (751),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/302 (53%), Positives = 214/302 (71%), Gaps = 16/302 (5%)
 Frame = +2

Query  50   CFMPTNR---------FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLL  202
            C M  NR         FLDRAA ++S ++     K    NPWR+C +TQVEEVKC+LRLL
Sbjct  294  CSMNGNRKILHTDGFKFLDRAAFISSRDID--DQKRGCRNPWRLCPITQVEEVKCILRLL  351

Query  203  PIWVCTILASIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENII  382
            PIW+CTI+ S+VF Q+ SLFVEQGAAM T +A+F +PPASM+S DI+S + FI  Y  ++
Sbjct  352  PIWLCTIIYSVVFTQMASLFVEQGAAMKTTVANFKIPPASMSSFDILSVAFFIFLYRRVL  411

Query  383  LPLYVKLMKREPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLS  550
             PL  ++ K   K   ELQR+G+G+VI+I+ M+ AGLVE +RLRYA  +    E +SSLS
Sbjct  412  DPLVSRVKKTGSKGLTELQRMGVGLVIAIVAMISAGLVECYRLRYARKDCTHCEGSSSLS  471

Query  551  IFWQIPQYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIV  730
            IFWQ+PQY L+G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++V
Sbjct  472  IFWQVPQYALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMV  531

Query  731  MKITTKHGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            MKI+T+   PGW+P NLN GHLDRF+FL A +  +DLV+++ CA+ YK+I LE K E  D
Sbjct  532  MKISTEDHMPGWIPGNLNKGHLDRFYFLLATLTTIDLVVYMACARWYKSIQLEGKCELND  591

Query  908  VE  913
             E
Sbjct  592  QE  593



>ref|XP_006354610.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=596

 Score =   293 bits (750),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 201/279 (72%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AAI+ S E        ++ NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  310  RFLDKAAIITSKE--------RLDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  361

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ PL   L K  P+  
Sbjct  362  MASLFVEQGDAMKTMVSGFHIPPASMSSFDILSVAAFIFIYRRVLDPLVASLKKSSPRGL  421

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+++ ML AG+VE  RL+YAN +      +SSLSIFWQ+PQYVL+G +E
Sbjct  422  TELQRMGVGLIIAVMAMLAAGIVEHFRLKYANKDCSQCTNSSSLSIFWQVPQYVLIGASE  481

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIV+KI+T    PGW+P 
Sbjct  482  VFMYVGQLEFFNGQTPDGLKSFGSALCMTSISLGNYVSSLLVSIVIKISTNDKMPGWIPG  541

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+   D V+++ CAK YK I  E+
Sbjct  542  NLNKGHLDRFYFLLAALTIADFVVYLICAKWYKYIEFEQ  580



>ref|XP_009607049.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana tomentosiformis]
Length=595

 Score =   293 bits (750),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 206/291 (71%), Gaps = 15/291 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AAI+ S        K    NPWR+C V+Q+EEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  309  KFLDKAAIITS--------KDGENNPWRLCAVSQIEEVKCILRLLPIWLCTILYSVVFTQ  360

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T ++ FH+PPASM+S DI+S + FI  Y  ++ PL  +L K  PK  
Sbjct  361  MASLFVEQGAAMKTTVSGFHIPPASMSSFDILSVAAFIFIYRRVLDPLVARLKKSAPKGL  420

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+ A+ +      + SLSIFWQ+PQYVL+G +E
Sbjct  421  TELQRMGVGLIIAIMAMVAAGIVEHFRLKSADKDCSSCTNSRSLSIFWQVPQYVLIGASE  480

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T    PGW+P 
Sbjct  481  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTTDKMPGWIPG  540

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVEGT  928
            NLN GHLDRF+FL AA+ A D ++++ CAK YK I   K EE  +E + G 
Sbjct  541  NLNKGHLDRFYFLLAALTAADFLVYLICAKWYKYI---KFEERSIEKLNGN  588



>ref|XP_003516639.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=596

 Score =   293 bits (749),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 207/278 (74%), Gaps = 6/278 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K    NPWR+C V+QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  310  KFLDRAAFISSRDLG--DQKGLGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQ  367

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM TK+++F +PPASM+S DI+S + FI  Y  ++ P   KL K + K  
Sbjct  368  MASLFVEQGAAMKTKVSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKTDSKGL  427

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+++ M+ AGLVE +RL+YA        ++S+LSIFWQIPQY  +G +E
Sbjct  428  TELQRMGVGLVIAVLAMVSAGLVECYRLKYAKQGCIHCNDSSTLSIFWQIPQYAFIGASE  487

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P 
Sbjct  488  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTEDHMPGWIPG  547

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            NLN GHLDRF+FL AA+ ++DL+ ++ CAK YK+I LE
Sbjct  548  NLNKGHLDRFYFLLAALTSIDLIAYIACAKWYKSIQLE  585



>ref|XP_006368434.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP65003.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=598

 Score =   292 bits (748),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/302 (52%), Positives = 214/302 (71%), Gaps = 16/302 (5%)
 Frame = +2

Query  50   CFMPTNR---------FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLL  202
            C M  NR         FLDRAA ++S ++     K    NPWR+C +TQVEEVKC+LRLL
Sbjct  294  CSMNGNRKILHTDGFKFLDRAAFISSRDID--DQKRGCRNPWRLCPITQVEEVKCILRLL  351

Query  203  PIWVCTILASIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENII  382
            PIW+CTI+ S+VF Q+ SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  ++
Sbjct  352  PIWLCTIIYSVVFTQMASLFVEQGAAMKTTVSNFKIPPASMSSFDILSVAFFIFLYRRVL  411

Query  383  LPLYVKLMKREPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLS  550
             PL  ++ K   K   ELQR+G+G+VI+I+ M+ AGLVE +RLRYA  +    E +SS+S
Sbjct  412  DPLVSRVKKTGSKGLTELQRMGVGLVIAIVAMISAGLVECYRLRYARKDCTHCEGSSSMS  471

Query  551  IFWQIPQYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIV  730
            IFWQ+PQY L+G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++V
Sbjct  472  IFWQVPQYALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMV  531

Query  731  MKITTKHGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            MKI+T+   PGW+P NLN GHLDRF+FL A +  +DLV+++ CA+ YK+I LE K E  D
Sbjct  532  MKISTEDHMPGWIPGNLNKGHLDRFYFLLATLTTIDLVVYIACARWYKSIQLEGKCELND  591

Query  908  VE  913
             E
Sbjct  592  QE  593



>ref|XP_010275292.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nelumbo nucifera]
Length=612

 Score =   292 bits (748),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 206/287 (72%), Gaps = 7/287 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+ S +  L      +  PW +CT+TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  319  RFLDRAAIITSKDTAL--QNQGLSTPWNLCTITQVEEVKCILRLLPIWLCTIIYSVVFTQ  376

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T IA+F +PPASM+S DI+S + FI  Y  I+ PL  +L K   K  
Sbjct  377  MASLFVEQGAAMKTTIANFRIPPASMSSFDILSVAAFIFIYRRILDPLVCRLRKTTGKGL  436

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+I+ M+ AG+VE +RL+YA  +    E +SSLSIFWQIPQYVL+G +E
Sbjct  437  TELQRMGVGLVIAIMAMISAGIVECYRLKYAKKDCTHCEGSSSLSIFWQIPQYVLIGASE  496

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q  FF  Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P 
Sbjct  497  VFMYVGQLVFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTEDDMPGWIPG  556

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDVE  913
            NLN GHLDRF+FL A +   D +++V CAK YK I LE K  + D E
Sbjct  557  NLNKGHLDRFYFLLAVLTTADFIVYVACAKWYKYIKLEGKFVDMDDE  603



>ref|XP_006341336.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=597

 Score =   292 bits (747),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 206/291 (71%), Gaps = 15/291 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+ S E           +PWR+C V+QVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  309  KFLDRAAIITSKE-------GGGNSPWRLCAVSQVEEVKCILRLLPIWLCTILYSVVFTQ  361

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T ++ FH+PPASM+S DI+S ++FI  Y  ++ PL  +L K  P+  
Sbjct  362  MASLFVEQGAAMKTTLSGFHIPPASMSSFDILSVASFIFIYRRVLDPLVARLKKSSPRGL  421

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE-----EETSSLSIFWQIPQYVLVGVA  592
             ELQR+G+G++I+I+ M+ AG+VE  RL+ A  +       +SSLSIFWQ+PQYVL+G +
Sbjct  422  TELQRMGVGLIIAIMAMVAAGIVEHFRLKSAEKDCSHDCSNSSSLSIFWQVPQYVLIGAS  481

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T    PGW+P
Sbjct  482  EVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNMPGWIP  541

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVEG  925
             NLN GHLDRF+FL AA+ + D ++++ CAK YK I   K EE  +E   G
Sbjct  542  GNLNKGHLDRFYFLLAALTSADFLVYLICAKWYKYI---KFEERSIEKQNG  589



>gb|KHN34858.1| Nitrate transporter 1.5 [Glycine soja]
Length=596

 Score =   291 bits (746),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 213/289 (74%), Gaps = 10/289 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K    NPWR+C V+QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  310  KFLDRAAFISSRDLG--DQKGLGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQ  367

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM TK+++F +PPASM+S DI+S + FI  Y  ++ P   KL K + K  
Sbjct  368  MASLFVEQGAAMKTKVSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKTDSKGL  427

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+++ M+ AGLVE +RL+YA        ++S+LSIFWQIPQY  +G +E
Sbjct  428  TELQRMGVGLVIAVLAMVSAGLVECYRLKYAKQGCLHCNDSSTLSIFWQIPQYAFIGASE  487

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P 
Sbjct  488  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTEDHMPGWIPG  547

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE----KLEETDV  910
            +LN GHLDRF+FL AA+ ++DL+ ++ CAK YK+I LE    +++ET V
Sbjct  548  HLNKGHLDRFYFLLAALTSIDLIAYIACAKWYKSIQLEAKTGEIDETQV  596



>emb|CDY72659.1| BnaCnng78690D, partial [Brassica napus]
Length=388

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 196/272 (72%), Gaps = 1/272 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     NPWR+C+VTQVEEVKCV RL+PIW+CTIL S+VF Q
Sbjct  102  RFLDRAAIVTPDDDAEKVESGSTYNPWRLCSVTQVEEVKCVFRLIPIWLCTILYSVVFTQ  161

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFVEQGAAM T I DF +P +SM+S DI+S + F+  Y   + PL+ +L K EP K 
Sbjct  162  MASLFVEQGAAMKTNIKDFKIPASSMSSFDILSVAFFVFAYRRFLDPLFARLNKTEPNKG  221

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              ELQR+GIG+VI+I+ M+ AG+VE +RL++      +SSLSIFWQ+PQY+++G +E F+
Sbjct  222  LTELQRMGIGLVIAIMAMISAGIVEIYRLKHKETASNSSSLSIFWQVPQYMMIGASEVFM  281

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVM I+T+   PGW+P NLN
Sbjct  282  YVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMSISTRDDLPGWIPGNLN  341

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
             GHLDRF+FL A + A D V+++ CAK YK I
Sbjct  342  KGHLDRFYFLLAGLTAADFVVYLVCAKWYKYI  373



>gb|KHN42621.1| Nitrate transporter 1.5 [Glycine soja]
Length=596

 Score =   291 bits (746),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 206/278 (74%), Gaps = 6/278 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K    NPWR+C V+QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  310  KFLDRAAFISSRDLG--DQKGLGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQ  367

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM TK+++F +PPASM+S DI+S + FI  Y  ++ P   KL K + K  
Sbjct  368  MASLFVEQGAAMKTKLSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKTDSKGL  427

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+++ M+ AGLVE +RL+YA        ++S+LSIFWQIPQY  +G +E
Sbjct  428  TELQRMGVGLVIAVLAMVSAGLVECYRLKYAKQGCIHCNDSSTLSIFWQIPQYAFIGASE  487

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P 
Sbjct  488  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTEDHMPGWIPG  547

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            NLN GHLDRF+FL AA+ ++DL+ ++ CAK YK I LE
Sbjct  548  NLNKGHLDRFYFLLAALTSIDLIAYIACAKWYKCIQLE  585



>gb|AES90846.2| peptide transporter [Medicago truncatula]
Length=592

 Score =   291 bits (745),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/281 (56%), Positives = 206/281 (73%), Gaps = 4/281 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + S ++ +   K    NPW +C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  308  KFLDRAAYITSRDLEV--QKGGQHNPWYLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ F +PPASM+S DI+S + FI  Y  ++ PL  KL K   K  
Sbjct  366  MASLFVEQGAAMKTTISSFKIPPASMSSFDILSVAIFIFFYRRVLDPLVGKLKKSSSKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG+VI+II M+ AG+VE +RL+YA  + +TSSLSIFWQIPQY L+G +E F+Y
Sbjct  426  TELQRMGIGLVIAIIAMVTAGIVECYRLKYAK-QGDTSSLSIFWQIPQYALIGASEVFMY  484

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF +Q PD LKS G  L M+S +LG+Y+ S+I+SIVMKI+T+   PGW+P NLN 
Sbjct  485  VGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDHMPGWIPGNLNR  544

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            GHLDRFFFL A + +LDL+ ++ CAK ++ I +  K +  D
Sbjct  545  GHLDRFFFLLAVLTSLDLIAYIACAKWFQNIQMACKYDNND  585



>ref|XP_008439356.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like, partial [Cucumis 
melo]
Length=549

 Score =   290 bits (742),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 160/281 (57%), Positives = 207/281 (74%), Gaps = 9/281 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA++ SSE   L D ++  NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  267  RFLDKAAVITSSECDKLDDGAR--NPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  324

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ FH+PPASM+S DI+S + FI  Y  +I P++ +L K      
Sbjct  325  MASLFVEQGAAMRTNISTFHIPPASMSSFDILSVAAFIFIYRRVIDPVFARLTKSS---L  381

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I  M+ AG VE  RL++AN +    +++SSLSIFWQIPQYVL+G +E
Sbjct  382  TELQRMGIGLVIAICAMVSAGTVEIFRLKHANKDCLHCDDSSSLSIFWQIPQYVLIGASE  441

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF SQ PD LKS G  L M+S + G+Y+ S++++IVMKI+     PGW+P 
Sbjct  442  VFMYVGQLEFFNSQAPDGLKSFGSALCMTSISFGNYVSSLLVTIVMKISATDNMPGWIPG  501

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            NLN GHLDRF+FL AA+ A DL +++ CAK YK I  E  E
Sbjct  502  NLNKGHLDRFYFLLAALTAADLAVYILCAKWYKYIKFESRE  542



>ref|XP_009347591.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Pyrus x bretschneideri]
Length=604

 Score =   291 bits (746),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 205/285 (72%), Gaps = 10/285 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AAI+ S EM  +   +Q  NPWR+C+VTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  314  KFLDKAAIITSKEMNQMGKGAQ--NPWRLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQ  371

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ FH+PPA M+S DI+S + FI  Y  ++ PL  +L K   K  
Sbjct  372  MASLFVEQGAAMKTTISSFHIPPAGMSSFDILSVAAFIFFYRRVLDPLVARLWK---KGL  428

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE-----EETSSLSIFWQIPQYVLVGVA  592
             ELQR+GIG+VI+I+ M+ AG+VE  RL+YA  +     E  SSLSIFWQ+PQY+L+G +
Sbjct  429  TELQRMGIGIVIAIMAMISAGVVELFRLKYAIKDCNIDCENPSSLSIFWQVPQYMLIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+ +   PGW+P
Sbjct  489  EVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISAREDMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
             NLN GHLDRF+FL AA+   DL+++V CAK YK I  E     D
Sbjct  549  GNLNKGHLDRFYFLLAALTTADLLVYVLCAKWYKYIKFEGKGGND  593



>ref|XP_008232241.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Prunus mume]
Length=607

 Score =   291 bits (746),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 207/284 (73%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++ S EM  +   +   NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  316  KFLDRAAVITSKEMNEMDKGAH--NPWRLCTVTQVEEVKCLLRLLPIWLCTILYSVVFTQ  373

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA+M T ++ FH+PPASM+S DI+S + FI      + PL+ +L  R+ KL 
Sbjct  374  MASLFVEQGASMKTTVSGFHIPPASMSSFDILSVAAFIFISRRFLDPLFGRL--RKKKL-  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I+ M+ AG+VE  RL+YA    N  E  SSLSIFWQ+PQ+VLVG +E
Sbjct  431  TELQRMGIGLVIAIMAMVSAGVVEVFRLKYAVKECNNCENPSSLSIFWQVPQFVLVGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMK++T+   PGW+P 
Sbjct  491  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKVSTRDEMPGWIPG  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL AA+   DL++++ CAK YK I  E     D
Sbjct  551  NLNKGHLDRFYFLLAALTTADLLVYILCAKWYKYIEFEAKGGND  594



>ref|XP_007156651.1| hypothetical protein PHAVU_002G005700g [Phaseolus vulgaris]
 gb|ESW28645.1| hypothetical protein PHAVU_002G005700g [Phaseolus vulgaris]
Length=596

 Score =   291 bits (744),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 207/286 (72%), Gaps = 6/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K    NPWR+C V+QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  310  KFLDRAAFISSRDLD--DQKETGYNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQ  367

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  ++ P   KL K + K  
Sbjct  368  MASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVAVFIFFYRRVLDPFVGKLKKTDSKGL  427

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+++ M+ AGLVE +RL+YA        +TS+LSIFWQIPQY  +G +E
Sbjct  428  TELQRMGVGLVIAVLAMVSAGLVECYRLKYAKQGCIHCNDTSTLSIFWQIPQYAFIGASE  487

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P 
Sbjct  488  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSMVMKISTEDHMPGWIPG  547

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL AA+ ++DL+ ++ CAK YK I LE     + E
Sbjct  548  NLNKGHLDRFYFLLAALTSIDLIAYIACAKWYKCIQLEGKTGENNE  593



>ref|XP_003611453.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES94411.1| peptide transporter [Medicago truncatula]
Length=605

 Score =   291 bits (744),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 153/285 (54%), Positives = 210/285 (74%), Gaps = 7/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI++S +      K    NPWR+C V+QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  316  KFLDRAAIISSRDHD--NQKGTCSNPWRLCPVSQVEEVKCILRLLPIWLCTIIYSVVFTQ  373

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T + +F +PPASM+  DIIS + FI  Y  I+ P   KL K + K  
Sbjct  374  MASLFVEQGDAMKTTVYNFRVPPASMSCFDIISVAVFIFFYRRILDPFVGKLKKSDSKGL  433

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI++I M+ AG+VE +RL++A+ +    + +S+LSIFWQIPQY L+G +E
Sbjct  434  TELQRMGVGLVIAVIAMVSAGIVESYRLKHADQDCRHCKGSSTLSIFWQIPQYALIGASE  493

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P 
Sbjct  494  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTEDHMPGWIPV  553

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETD  907
            NLN GHLDRF+FL AA+ ++DL+ ++ CAK YK+I L EK +E D
Sbjct  554  NLNKGHLDRFYFLLAALTSMDLIAYIACAKWYKSIQLGEKRKEND  598



>ref|XP_010919867.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Elaeis 
guineensis]
Length=593

 Score =   290 bits (743),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 205/274 (75%), Gaps = 2/274 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLDRAA + S++ T+  ++S + +PWR+CT+TQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  310  NFLDRAAYVDSNDFTIQGERSILRDPWRLCTITQVEEVKCVLRLLPIWLCTILYSVVFTQ  369

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAMNT +  F +PPASM++ DI+S +T I     ++ P+  +L K+ P+  
Sbjct  370  MASLFVEQGAAMNTNVHGFRIPPASMSAFDILSVATVIFFNRRLLNPVICRL-KKSPRGL  428

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI+++ M+ A  VE  RL++A G    SSLSI WQ+PQYVL+G +E F+Y
Sbjct  429  TELQRMGVGLVIAVMAMVSACAVEHFRLKHAGG-NAGSSLSILWQVPQYVLIGASEVFMY  487

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD LKS G  L M+S +LG+Y+  ++++IVM+IT K G+PGW+P NLN+
Sbjct  488  VGQLEFFNGQAPDGLKSFGSALCMTSMSLGNYVSDVLVTIVMEITAKGGRPGWIPGNLNN  547

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            GH+DRF+FL A + ++D V++V CAK YK I LE
Sbjct  548  GHMDRFYFLLAVLTSVDFVVYVACAKWYKCIKLE  581



>ref|XP_008341111.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Malus domestica]
Length=563

 Score =   289 bits (740),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 206/286 (72%), Gaps = 6/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  275  KFLDRAAYISSRDLDY--QKQGIRSPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  332

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I +F +PPASM+S DIIS + FI  Y  II P   ++ K + K  
Sbjct  333  MASLFVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKSDAKGL  392

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ ML AG+VE +RL+YA+ E    + +SSLSIFWQIPQY  +G +E
Sbjct  393  TELQRMGIGLVIAVMAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASE  452

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  + ++S+VMK +T    PGW+P 
Sbjct  453  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTVDHMPGWIPG  512

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL A + ++DL++++ CAK YK I LE   E D E
Sbjct  513  NLNRGHLDRFYFLLAVLTSIDLIVYIACAKWYKNIKLEGRFEVDDE  558



>ref|XP_010919866.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Elaeis 
guineensis]
Length=615

 Score =   291 bits (744),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 205/274 (75%), Gaps = 2/274 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLDRAA + S++ T+  ++S + +PWR+CT+TQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  332  NFLDRAAYVDSNDFTIQGERSILRDPWRLCTITQVEEVKCVLRLLPIWLCTILYSVVFTQ  391

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAMNT +  F +PPASM++ DI+S +T I     ++ P+  +L K+ P+  
Sbjct  392  MASLFVEQGAAMNTNVHGFRIPPASMSAFDILSVATVIFFNRRLLNPVICRL-KKSPRGL  450

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI+++ M+ A  VE  RL++A G    SSLSI WQ+PQYVL+G +E F+Y
Sbjct  451  TELQRMGVGLVIAVMAMVSACAVEHFRLKHAGG-NAGSSLSILWQVPQYVLIGASEVFMY  509

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD LKS G  L M+S +LG+Y+  ++++IVM+IT K G+PGW+P NLN+
Sbjct  510  VGQLEFFNGQAPDGLKSFGSALCMTSMSLGNYVSDVLVTIVMEITAKGGRPGWIPGNLNN  569

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            GH+DRF+FL A + ++D V++V CAK YK I LE
Sbjct  570  GHMDRFYFLLAVLTSVDFVVYVACAKWYKCIKLE  603



>ref|XP_010919865.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Elaeis 
guineensis]
Length=619

 Score =   291 bits (744),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 205/274 (75%), Gaps = 2/274 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLDRAA + S++ T+  ++S + +PWR+CT+TQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  336  NFLDRAAYVDSNDFTIQGERSILRDPWRLCTITQVEEVKCVLRLLPIWLCTILYSVVFTQ  395

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAMNT +  F +PPASM++ DI+S +T I     ++ P+  +L K+ P+  
Sbjct  396  MASLFVEQGAAMNTNVHGFRIPPASMSAFDILSVATVIFFNRRLLNPVICRL-KKSPRGL  454

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI+++ M+ A  VE  RL++A G    SSLSI WQ+PQYVL+G +E F+Y
Sbjct  455  TELQRMGVGLVIAVMAMVSACAVEHFRLKHAGG-NAGSSLSILWQVPQYVLIGASEVFMY  513

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD LKS G  L M+S +LG+Y+  ++++IVM+IT K G+PGW+P NLN+
Sbjct  514  VGQLEFFNGQAPDGLKSFGSALCMTSMSLGNYVSDVLVTIVMEITAKGGRPGWIPGNLNN  573

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            GH+DRF+FL A + ++D V++V CAK YK I LE
Sbjct  574  GHMDRFYFLLAVLTSVDFVVYVACAKWYKCIKLE  607



>gb|KEH31554.1| peptide transporter [Medicago truncatula]
Length=657

 Score =   291 bits (745),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 156/281 (56%), Positives = 206/281 (73%), Gaps = 4/281 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + S ++ +   K    NPW +C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  373  KFLDRAAYITSRDLEV--QKGGQHNPWYLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  430

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ F +PPASM+S DI+S + FI  Y  ++ PL  KL K   K  
Sbjct  431  MASLFVEQGAAMKTTISSFKIPPASMSSFDILSVAIFIFFYRRVLDPLVGKLKKSSSKGL  490

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG+VI+II M+ AG+VE +RL+YA  + +TSSLSIFWQIPQY L+G +E F+Y
Sbjct  491  TELQRMGIGLVIAIIAMVTAGIVECYRLKYAK-QGDTSSLSIFWQIPQYALIGASEVFMY  549

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF +Q PD LKS G  L M+S +LG+Y+ S+I+SIVMKI+T+   PGW+P NLN 
Sbjct  550  VGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDHMPGWIPGNLNR  609

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            GHLDRFFFL A + +LDL+ ++ CAK ++ I +  K +  D
Sbjct  610  GHLDRFFFLLAVLTSLDLIAYIACAKWFQNIQMACKYDNND  650



>ref|XP_003608649.1| Peptide transporter PTR1 [Medicago truncatula]
Length=668

 Score =   291 bits (745),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/281 (56%), Positives = 206/281 (73%), Gaps = 4/281 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + S ++ +   K    NPW +C +TQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  384  KFLDRAAYITSRDLEV--QKGGQHNPWYLCPITQVEEVKCILRLLPIWLCTIIYSVVFTQ  441

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I+ F +PPASM+S DI+S + FI  Y  ++ PL  KL K   K  
Sbjct  442  MASLFVEQGAAMKTTISSFKIPPASMSSFDILSVAIFIFFYRRVLDPLVGKLKKSSSKGL  501

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG+VI+II M+ AG+VE +RL+YA  + +TSSLSIFWQIPQY L+G +E F+Y
Sbjct  502  TELQRMGIGLVIAIIAMVTAGIVECYRLKYAK-QGDTSSLSIFWQIPQYALIGASEVFMY  560

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF +Q PD LKS G  L M+S +LG+Y+ S+I+SIVMKI+T+   PGW+P NLN 
Sbjct  561  VGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDHMPGWIPGNLNR  620

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            GHLDRFFFL A + +LDL+ ++ CAK ++ I +  K +  D
Sbjct  621  GHLDRFFFLLAVLTSLDLIAYIACAKWFQNIQMACKYDNND  661



>ref|XP_007210875.1| hypothetical protein PRUPE_ppa003158mg [Prunus persica]
 gb|EMJ12074.1| hypothetical protein PRUPE_ppa003158mg [Prunus persica]
Length=597

 Score =   289 bits (740),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 210/287 (73%), Gaps = 7/287 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PWR+C ++QVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  307  KFLDRAAYISSRDLD--HQKQGICSPWRLCPISQVEEVKCILRLLPIWLCTILYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  I+ P+  ++ K + K  
Sbjct  365  MASLFVEQGAAMKTTVSNFKIPPASMSSFDILSVAVFIFFYRRILDPVVARIRKSDAKGL  424

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ ML AG+VE +RL+YA+ E    E +SSLSIFWQIPQY  +G +E
Sbjct  425  TELQRMGIGLVIAVLAMLSAGIVECYRLKYADKECPHCEGSSSLSIFWQIPQYACIGASE  484

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  S ++S+VMKI+T+   PGW+P 
Sbjct  485  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSSFLVSVVMKISTEDDMPGWIPG  544

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDVE  913
            NLN GHLDRF+FL A + ++DL++++  AK YK+I  E + E  D E
Sbjct  545  NLNKGHLDRFYFLLAVLTSIDLIVYIASAKWYKSIKFEGRFEANDDE  591



>ref|XP_010461068.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Camelina sativa]
Length=615

 Score =   290 bits (741),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/283 (53%), Positives = 208/283 (73%), Gaps = 8/283 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDKAAYITARD---LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT I+DF +PPASM+S DI+S + FI  Y  ++ P+  +  K   K 
Sbjct  369  QMASLFVEQGAAMNTNISDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKNGSKG  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              EL R+GIG+VI+II M+ AG+VE +RL+YA+      + +SSLSIFWQ PQY L+G +
Sbjct  429  ITELHRMGIGLVIAIIAMVAAGVVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+P
Sbjct  489  EVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             NLN GHLDRF+FL AA+ ++DLV+++ CAK YK+I LE   E
Sbjct  549  RNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKSIQLEGKNE  591



>ref|XP_010478666.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Camelina sativa]
Length=615

 Score =   289 bits (740),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 208/283 (73%), Gaps = 8/283 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDKAAYITARD---LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT I+DF +PPASM+S DI+S + FI  Y  ++ P+  +  K   K 
Sbjct  369  QMASLFVEQGAAMNTNISDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKNGSKG  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              EL R+GIG+VI++I M+ AG+VE +RL+YA+      + +SSLSIFWQ PQY L+G +
Sbjct  429  ITELHRMGIGLVIAVIAMVAAGVVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+P
Sbjct  489  EVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             NLN GHLDRF+FL AA+ ++DLV+++ CAK YK+I LE   E
Sbjct  549  RNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKSIQLEGKNE  591



>ref|XP_010499794.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Camelina sativa]
Length=615

 Score =   289 bits (739),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 208/283 (73%), Gaps = 8/283 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDKAAYITARD---LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT I+DF +PPASM+S DI+S + FI  Y  ++ P+  +  K   K 
Sbjct  369  QMASLFVEQGAAMNTNISDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKNGSKG  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              EL R+GIG+VI++I M+ AG+VE +RL+YA+      + +SSLSIFWQ PQY L+G +
Sbjct  429  ITELHRMGIGLVIAVIAMVAAGVVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+P
Sbjct  489  EVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             NLN GHLDRF+FL AA+ ++DLV+++ CAK YK+I LE   E
Sbjct  549  RNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKSIQLEGKNE  591



>ref|XP_004307313.1| PREDICTED: nitrate transporter 1.5-like [Fragaria vesca subsp. 
vesca]
Length=608

 Score =   288 bits (738),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 205/286 (72%), Gaps = 11/286 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+ S E   +   +Q  NPWR+CTVTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  316  KFLDRAAIITSKESNHVDKYAQ--NPWRLCTVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  373

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M T +++FH+PPASM+S DI+S + FI  Y  ++ PL  KL KR     
Sbjct  374  MASLFVEQGAVMKTTVSNFHIPPASMSSFDILSVALFIFIYRRVLDPLVAKLRKRG---L  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE------EETSSLSIFWQIPQYVLVGV  589
             ELQR+GIG+VI+I+ M+ AG+VE  RL+YA  +      E  SSLSIFWQ+PQY+LVG 
Sbjct  431  TELQRMGIGLVIAIMAMISAGVVECFRLKYARTDCASTDCESPSSLSIFWQVPQYMLVGA  490

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF SQ PD LKS G  L M+S +LG+Y+ S++++IVM+ +++    GW+
Sbjct  491  SEVFMYVGQLEFFNSQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMRFSSRDDMSGWI  550

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            P NLN GHLDRF+FL AA+   DL++++ CAK YK I  E     D
Sbjct  551  PGNLNRGHLDRFYFLLAALTTADLMVYIVCAKWYKYIKFEAKGGDD  596



>ref|XP_009373444.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Pyrus x bretschneideri]
Length=596

 Score =   288 bits (737),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 205/284 (72%), Gaps = 6/284 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  307  KFLDRAAYISSRDLDY--QKQGIRSPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I +F +PPASM+S DIIS + FI  Y  II P   ++ K + K  
Sbjct  365  MASLFVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKSDAKGL  424

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+++ ML AG+VE +RL+YA+ E    + +SSLSIFWQIPQY  +G +E
Sbjct  425  TELQRMGVGLVIAVLAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASE  484

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  + ++S+VMK +T+   PGW+P 
Sbjct  485  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTEDHMPGWIPG  544

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL A +  +DL++++ CAK YK I LE   E D
Sbjct  545  NLNRGHLDRFYFLLAGLTLIDLIVYIACAKWYKNIKLEGRFEVD  588



>ref|XP_010327292.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Solanum lycopersicum]
Length=594

 Score =   288 bits (737),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 203/291 (70%), Gaps = 15/291 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAAI+ S +           N WR+C V+QVEEVKC+LRLLPIW CTIL S+VF Q
Sbjct  306  KFLDRAAIITSKD-------GGGNNQWRLCAVSQVEEVKCILRLLPIWFCTILYSVVFTQ  358

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T ++ FH+PPASM+S DI+  ++FI  Y  ++ PL  +L K  P+  
Sbjct  359  MASLFVEQGAAMKTALSGFHIPPASMSSFDILGVASFIFIYRRLLDPLVARLKKSSPRGL  418

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE-----EETSSLSIFWQIPQYVLVGVA  592
             ELQR+G+G+VI+I+ M+ AG+VE  RL+ A  +       +SSLSIFWQ+PQYVL+G +
Sbjct  419  TELQRMGVGLVIAIMAMVAAGIVEHFRLKSAEKDCSHDCSNSSSLSIFWQVPQYVLIGAS  478

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T    PGW+P
Sbjct  479  EVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNVPGWIP  538

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVEG  925
             NLN GHLDRF+FL AA+ + D ++++ CAK YK I   K EE  VE   G
Sbjct  539  GNLNKGHLDRFYFLLAALTSADFLVYLICAKWYKYI---KFEERSVEKKNG  586



>emb|CDX94047.1| BnaC07g36810D [Brassica napus]
Length=583

 Score =   288 bits (736),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 198/275 (72%), Gaps = 1/275 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I DF +P +SM++ DI+S + FI  Y   + PL+ +L KREP K 
Sbjct  357  MASLFVVQGAAMKTNIKDFRIPASSMSTFDILSVAFFIFAYRRFLDPLFARLNKREPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              ELQR+GIG+VI+I  M+ AG+VE +RL++      +SSLSIFWQ+PQY+++G +E F+
Sbjct  417  LTELQRMGIGLVIAITAMISAGIVEIYRLKHKETASNSSSLSIFWQVPQYMMIGASEVFM  476

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P NLN
Sbjct  477  YVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTRDDLPGWIPGNLN  536

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             GHLDRF+FL A + A D ++++ CAK YK I  E
Sbjct  537  KGHLDRFYFLLAGLTAADFLVYLVCAKWYKYIKSE  571



>gb|AAF81343.1|AC007767_23 Contains similarity to a peptide transport protein homolog F17L22.140 
gi|7488004 from Arabidopsis thaliana BAC F17L22 gb|AL035527. 
It contains a POT family domain PF|00854. ESTs gb|BE038248, 
gb|T22680, gb|T04498, gb|R89961, gb|R30626, gb|R30389, 
gb|AA713063 and gb|AA585801 come from this gene [Arabidopsis 
thaliana]
Length=606

 Score =   288 bits (737),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 208/283 (73%), Gaps = 8/283 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  304  KFLDKAAYITARD---LDDKKQDSVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  360

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT ++DF +PPASM+S DI+S + FI  Y  ++ P+  +  K   K 
Sbjct  361  QMASLFVEQGAAMNTSVSDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKNGSKG  420

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              EL R+GIG+VI++I M+ AG+VE +RL+YA+      + +SSLSIFWQ PQY L+G +
Sbjct  421  ITELHRMGIGLVIAVIAMIAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGAS  480

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+P
Sbjct  481  EVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIP  540

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             NLN GHLDRF+FL AA+ ++DLV+++ CAK YK I LE  +E
Sbjct  541  RNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKPIQLEGKDE  583



>ref|XP_008238336.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Prunus mume]
Length=597

 Score =   288 bits (737),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 209/287 (73%), Gaps = 7/287 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PWR+C ++QVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  307  KFLDRAAYISSRDLD--HQKQGILSPWRLCPISQVEEVKCILRLLPIWLCTILYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  I+ P+  ++ K + K  
Sbjct  365  MASLFVEQGAAMKTTVSNFKIPPASMSSFDILSVAVFIFFYRRILDPVVARIRKSDAKGL  424

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+V++++    AG+VE +RL+YA+ E    E +SSLSIFWQIPQY  +G +E
Sbjct  425  TELQRMGIGLVVAVLXXXXAGIVECYRLKYADKECPHCEGSSSLSIFWQIPQYACIGASE  484

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  S ++S+VMKI+T    PGW+P 
Sbjct  485  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSSFLVSVVMKISTADDMPGWIPG  544

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDVE  913
            NLN GHLDRF+FL A + ++DL++++ CAK YK+I LE + E  D E
Sbjct  545  NLNKGHLDRFYFLLAVLTSIDLIVYIACAKWYKSIKLEGRFEVNDDE  591



>emb|CDX98697.1| BnaA03g44820D [Brassica napus]
Length=583

 Score =   288 bits (736),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 198/275 (72%), Gaps = 1/275 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I DF +P +SM++ DI+S + FI  Y   + PL+ +L KREP K 
Sbjct  357  MASLFVVQGAAMKTNIKDFRIPASSMSTFDILSVAFFIFAYRRFLDPLFARLNKREPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              ELQR+GIG+VI+I  M+ AG+VE +RL++      +SSLSIFWQ+PQY+++G +E F+
Sbjct  417  LTELQRMGIGLVIAITAMISAGIVEIYRLKHKETASNSSSLSIFWQVPQYMMIGASEVFM  476

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P NLN
Sbjct  477  YVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTRDDLPGWIPGNLN  536

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             GHLDRF+FL A + A D ++++ CAK YK I  E
Sbjct  537  KGHLDRFYFLLAGLTAADFLVYLVCAKWYKYIKSE  571



>ref|NP_174523.2| nitrate transporter 1.5 [Arabidopsis thaliana]
 sp|Q9LQL2.2|PTR14_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 7.3; Short=AtNPF7.3; AltName: 
Full=Nitrate transporter 1.5 [Arabidopsis thaliana]
 gb|AEE31488.1| nitrate transporter 1.5 [Arabidopsis thaliana]
Length=614

 Score =   288 bits (737),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 208/283 (73%), Gaps = 8/283 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDKAAYITARD---LDDKKQDSVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT ++DF +PPASM+S DI+S + FI  Y  ++ P+  +  K   K 
Sbjct  369  QMASLFVEQGAAMNTSVSDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKNGSKG  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              EL R+GIG+VI++I M+ AG+VE +RL+YA+      + +SSLSIFWQ PQY L+G +
Sbjct  429  ITELHRMGIGLVIAVIAMIAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+P
Sbjct  489  EVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             NLN GHLDRF+FL AA+ ++DLV+++ CAK YK I LE  +E
Sbjct  549  RNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKPIQLEGKDE  591



>ref|XP_009395136.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Musa acuminata 
subsp. malaccensis]
Length=619

 Score =   288 bits (737),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 208/282 (74%), Gaps = 3/282 (1%)
 Frame = +2

Query  68   RFLDRAAIMA-SSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAAI+   ++  +  D S   +PWR+C +TQVEE+KCVLRLLPIW+ TI+ S+VF 
Sbjct  332  KFLDRAAIVDPGNDFVIREDMSSARDPWRLCPITQVEELKCVLRLLPIWLTTIIYSVVFT  391

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT +A F +PPASM++ DI+S + FI  Y  ++ PL V  ++R P+ 
Sbjct  392  QMASLFVEQGAAMNTTVAGFRIPPASMSAFDIVSVALFIFFYRRLLSPL-VSRLRRNPRG  450

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRY-ANGEEETSSLSIFWQIPQYVLVGVAEAF  601
              ELQR+G+G+VI+++ M+ AG VE +RL++  +G ++ SSLSI WQIPQY+L+G +E F
Sbjct  451  LTELQRMGVGLVIAVLAMISAGTVEVYRLKHVCSGCDDDSSLSILWQIPQYMLIGASEVF  510

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF SQ PD LKS G  L M+S + G+Y+ S++++IVM+IT +  +PGW+P NL
Sbjct  511  MYVGQLEFFNSQAPDGLKSFGSALCMTSISFGNYVSSLLVTIVMEITARGERPGWIPVNL  570

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            N GH+DRF+FL A++ A DLV FV CA+ YK I LE   + D
Sbjct  571  NKGHMDRFYFLLASLTAADLVAFVACARWYKCIKLEGRHDDD  612



>ref|XP_007220198.1| hypothetical protein PRUPE_ppa003058mg [Prunus persica]
 gb|EMJ21397.1| hypothetical protein PRUPE_ppa003058mg [Prunus persica]
Length=607

 Score =   288 bits (736),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 204/284 (72%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++ S E   +   +   NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  316  KFLDRAAVITSKEKNEMDKGAH--NPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  373

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA+M T ++ FH+PPASM+S DI+S + FI      + PL+ +L K   K  
Sbjct  374  MASLFVEQGASMKTTVSGFHIPPASMSSFDILSVAAFIFICRRFLDPLFGRLRK---KRL  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I+ M+ AG+VE  RL+YA    N  E  SSLSIFWQ+PQ+VLVG +E
Sbjct  431  TELQRMGIGLVIAIMAMVSAGVVEVFRLKYAVKECNNCESPSSLSIFWQVPQFVLVGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMK++T+   PGW+P 
Sbjct  491  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKVSTRDEMPGWIPG  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL AA+   DL++++ CAK YK I  E     D
Sbjct  551  NLNKGHLDRFYFLLAALTTADLLVYILCAKWYKYIKFEAKVGND  594



>ref|XP_006385620.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP63417.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=598

 Score =   288 bits (736),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 156/302 (52%), Positives = 212/302 (70%), Gaps = 16/302 (5%)
 Frame = +2

Query  50   CFMPTNR---------FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLL  202
            C M  NR         FLDRAA ++S ++     K    NPWR+C +TQVEEVKC+LRLL
Sbjct  294  CSMNGNRKILHTDGFKFLDRAAFISSRDID--DQKRGCRNPWRLCPITQVEEVKCILRLL  351

Query  203  PIWVCTILASIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENII  382
            PIW+CTI+ S+VF Q+ SLFVEQGAAM T I++F +PPASM++ DI+S + FI  Y  ++
Sbjct  352  PIWLCTIIYSVVFTQMASLFVEQGAAMKTTISNFKIPPASMSTFDILSVAFFIFLYRRVL  411

Query  383  LPLYVKLMKREPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLS  550
             PL     +   K   ELQR+G+G+VI+I+ M+ AGLVE +RL+YA  +    E +SSLS
Sbjct  412  DPLVSSFKQTSSKGLTELQRMGVGLVIAIMAMVSAGLVECYRLKYARKDCKHCEGSSSLS  471

Query  551  IFWQIPQYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIV  730
            IFWQ PQY L+G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++V
Sbjct  472  IFWQAPQYALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMV  531

Query  731  MKITTKHGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            +KI+T+   PGW+P NLN GHLDRF+FL A +  +DLV+++ CA+ YK+I LE K EE D
Sbjct  532  VKISTEDHMPGWIPGNLNTGHLDRFYFLLAGLTTIDLVVYMACARWYKSIKLEKKCEEND  591

Query  908  VE  913
             E
Sbjct  592  HE  593



>ref|XP_009137205.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Brassica rapa]
Length=583

 Score =   287 bits (735),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 198/275 (72%), Gaps = 1/275 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSAYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I DF +P +SM++ DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVVQGAAMKTNIKDFRIPASSMSTFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              ELQR+GIG+VI+I  M+ AG+VE +RL++      +SSLSIFWQ+PQY+++G +E F+
Sbjct  417  LTELQRMGIGLVIAITAMISAGIVEIYRLKHKETASNSSSLSIFWQVPQYMMIGASEVFM  476

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T+   PGW+P NLN
Sbjct  477  YVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTRDDLPGWIPGNLN  536

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             GHLDRF+FL AA+ A D V+++ CAK YK I  E
Sbjct  537  KGHLDRFYFLLAALTAADFVVYLVCAKWYKYIKSE  571



>emb|CDX79084.1| BnaA01g11510D [Brassica napus]
Length=583

 Score =   287 bits (734),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 196/272 (72%), Gaps = 1/272 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     NPWR+C+VTQVEEVKCV RL+PIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDDAEKVESGSTYNPWRLCSVTQVEEVKCVFRLIPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFVEQGAAM T I DF +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVEQGAAMKTNIKDFKIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              ELQR+GIG+VI+++ M+ AG+VE +RL++      +SSLSIFWQ+PQY+++G +E F+
Sbjct  417  LTELQRMGIGLVIAVMAMISAGIVEIYRLKHKGTASNSSSLSIFWQVPQYMMIGASEVFM  476

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVM I+T+   PGW+P NLN
Sbjct  477  YVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMSISTRDDLPGWIPGNLN  536

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
             GHLDRF+FL A + A D V+++ CAK YK I
Sbjct  537  KGHLDRFYFLLAGLTAADFVVYLVCAKWYKYI  568



>ref|XP_007039561.1| Nitrate transporter 1.5 [Theobroma cacao]
 gb|EOY24062.1| Nitrate transporter 1.5 [Theobroma cacao]
Length=597

 Score =   287 bits (735),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 212/287 (74%), Gaps = 7/287 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA +++ ++     K  + +PWR+C VTQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  308  KFLDRAAYISTRDVD--DQKKGIYSPWRLCPVTQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I++F +PPASM+S DI+S + FI  Y  ++ PL  ++ K++ +  
Sbjct  366  MASLFVEQGAAMTTTISNFRIPPASMSSFDILSVALFIFLYRRVLDPLVGRIRKKDSRGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I+ M+ AG+VE +RL+YA+ +    E +SSLSIFWQ+PQY  +G +E
Sbjct  426  TELQRMGIGLVIAILAMVSAGIVECYRLKYASRDCTHCEGSSSLSIFWQVPQYAFIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  486  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDVE  913
            NLN GHLDRF+FL A +  +DLV+++ CA  YK I LE K  E D +
Sbjct  546  NLNKGHLDRFYFLLAGLTTIDLVVYIACATWYKCIKLEGKTAENDKQ  592



>ref|XP_009135044.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Brassica rapa]
Length=583

 Score =   287 bits (734),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 197/272 (72%), Gaps = 1/272 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     NPWR+C+VTQVEEVKCV RL+PIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDDAEKVESGSTYNPWRLCSVTQVEEVKCVFRLIPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFVEQGAAM T I DF +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVEQGAAMKTNIKDFKIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              +LQR+GIG+VI+I+ M+ AG+VE +RL++      +SSLSIFWQ+PQY+++G +E F+
Sbjct  417  LTQLQRMGIGLVIAIMAMISAGIVELYRLKHKETASNSSSLSIFWQVPQYMMIGASEVFM  476

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVM I+T+   PGW+P NLN
Sbjct  477  YVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMSISTRDDLPGWIPGNLN  536

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
             GHLDRF+FL A + A+D V+++ CAK YK I
Sbjct  537  KGHLDRFYFLLAGLTAVDFVVYLVCAKWYKYI  568



>ref|XP_006307023.1| hypothetical protein CARUB_v10008608mg [Capsella rubella]
 gb|EOA39921.1| hypothetical protein CARUB_v10008608mg [Capsella rubella]
Length=615

 Score =   287 bits (735),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 208/283 (73%), Gaps = 8/283 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDKAAYITARD---LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT I++F +PPASM+S DI+S + FI  Y  ++ P+  +  K   K 
Sbjct  369  QMASLFVEQGAAMNTSISNFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKNGSKG  428

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              EL R+GIG+VI++I M+ AG+VE +RL+YA+      + +SSLSIFWQ PQY L+G +
Sbjct  429  ITELHRMGIGLVIAVIAMVAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGAS  488

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+P
Sbjct  489  EVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDNMPGWIP  548

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             NLN GHLDRF+FL AA+ ++DLV+++ CAK YK I LE  +E
Sbjct  549  RNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKDIKLEGKDE  591



>ref|XP_004301700.1| PREDICTED: nitrate transporter 1.5-like [Fragaria vesca subsp. 
vesca]
Length=747

 Score =   291 bits (744),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 209/278 (75%), Gaps = 6/278 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PWR+C +TQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  458  KFLDRAAYISSRDLD--NQKQGLQDPWRLCPITQVEEVKCILRLLPIWLCTILYSVVFTQ  515

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  I+ PL  ++ K + K  
Sbjct  516  MASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVAVFIFFYRRILDPLVSRIKKSDSKGL  575

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             +LQR+GIG+VI+I+ M+ AG+VE +RL+YA  E    + +S+LSIFWQIPQY  +G +E
Sbjct  576  TQLQRMGIGLVIAILAMVSAGIVECYRLKYAKKECTHCDGSSTLSIFWQIPQYAFIGASE  635

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P 
Sbjct  636  VFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSMVMKISTEDHMPGWIPG  695

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            NLN GHLDRF+FL AA+ ++DL++++ CAK YK I LE
Sbjct  696  NLNKGHLDRFYFLLAALTSIDLIVYIACAKWYKCIKLE  733



>ref|XP_004229506.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Solanum lycopersicum]
Length=663

 Score =   289 bits (739),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 201/278 (72%), Gaps = 12/278 (4%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AAI+ S E        ++ NPWR+C+VTQVEEVKC+LRL PIW+CTIL S+VF Q+
Sbjct  374  FLDKAAIITSKE--------RLDNPWRLCSVTQVEEVKCILRLFPIWLCTILYSVVFTQM  425

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ PL   L K  P+   
Sbjct  426  ASLFVEQGDAMKTTVSGFHIPPASMSSFDILSVAVFIFIYRRVLDPLVASLKKTSPRGLT  485

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAEA  598
            ELQR+G+G++I+I+ M+ AG+VE  RL++AN +      +SSLSIFWQ+PQYVL+G +E 
Sbjct  486  ELQRMGVGLIIAIMAMVAAGIVEHFRLKHANKDCSHCTNSSSLSIFWQVPQYVLIGASEV  545

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIV+KI+T    PGW+P N
Sbjct  546  FMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVIKISTNDKMPGWIPGN  605

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            LN GHLDRF+FL AA+   D V+++ CAK YK I  E+
Sbjct  606  LNKGHLDRFYFLLAALTIADFVVYLICAKWYKYIEFEQ  643



>ref|XP_009629801.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Nicotiana 
tomentosiformis]
Length=598

 Score =   287 bits (734),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 199/279 (71%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FL++AAI+ S E        +  NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  312  KFLNKAAIITSKE--------RFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  363

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ P    L K  P+  
Sbjct  364  MASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKSSPRGL  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+YAN +      +SSLSI WQ+PQYVL+G +E
Sbjct  424  TELQRMGVGLIIAIMAMVAAGIVEHFRLKYANIDCSHCTNSSSLSILWQVPQYVLIGASE  483

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T    PGW+P 
Sbjct  484  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPG  543

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+ A D V+++ CAK YK I  E+
Sbjct  544  NLNKGHLDRFYFLLAALTAADFVVYLICAKWYKYIEFEQ  582



>ref|XP_009629800.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=605

 Score =   286 bits (733),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 199/279 (71%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FL++AAI+ S E        +  NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  319  KFLNKAAIITSKE--------RFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  370

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ P    L K  P+  
Sbjct  371  MASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKSSPRGL  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+YAN +      +SSLSI WQ+PQYVL+G +E
Sbjct  431  TELQRMGVGLIIAIMAMVAAGIVEHFRLKYANIDCSHCTNSSSLSILWQVPQYVLIGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T    PGW+P 
Sbjct  491  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPG  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+ A D V+++ CAK YK I  E+
Sbjct  551  NLNKGHLDRFYFLLAALTAADFVVYLICAKWYKYIEFEQ  589



>gb|KHG17535.1| Nitrate transporter 1.5 -like protein [Gossypium arboreum]
Length=597

 Score =   286 bits (733),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 204/284 (72%), Gaps = 5/284 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AAI+          K    NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDKAAIITPKNYAKQGKKFYGRNPWRLCTVTQVEEVKCILRLLPIWLCTILFSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM TKI++F++P A M+S DI+S +TFI  Y  ++ P+ V  +K +PK  
Sbjct  357  MASLFVEQGAAMKTKISNFNIPAAGMSSFDILSVATFIFLYRLVLDPV-VARIKSKPKGL  415

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+I+ M+ AG+VE  RL+ A  +       SSLSIFWQ+PQY+L+G +E
Sbjct  416  TELQRMGVGLVIAILAMVAAGVVEVLRLKDAKKDCPNCVNASSLSIFWQVPQYMLIGASE  475

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T+   PGW+P 
Sbjct  476  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTRDDMPGWIPG  535

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRFFF+ AA+   DLV+++ CAK YK I  E  +  D
Sbjct  536  NLNKGHLDRFFFMLAALTTADLVVYIICAKWYKYIKFEGRKGAD  579



>ref|XP_009377057.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Pyrus x bretschneideri]
Length=595

 Score =   286 bits (732),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 205/286 (72%), Gaps = 6/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PW +C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  307  KFLDRAAYISSRDLDY--QKQGIRSPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I +F +PPASM+S DIIS + FI  Y  II P   ++ K + K  
Sbjct  365  MASLFVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKSDAKGL  424

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ ML AG+VE +RL+YA+ E    + +SSLSIFWQIPQY  +G +E
Sbjct  425  TELQRMGIGLVIAVMAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASE  484

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  + ++S+VMK +T    PGW+P 
Sbjct  485  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTVDHMPGWIPG  544

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL A + ++DL++++ CAK YK I LE   E D E
Sbjct  545  NLNRGHLDRFYFLLAVLTSIDLIVYIACAKWYKNIKLEGRFEVDDE  590



>ref|XP_008353085.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Malus domestica]
Length=1293

 Score =   296 bits (759),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 209/285 (73%), Gaps = 10/285 (4%)
 Frame = +2

Query  68    RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             +FLD+AAI+   EM  +   +Q  NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  1003  KFLDKAAIITPKEMNQMGKGAQ--NPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  1060

Query  248   VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
             + SLFVEQGAAM T I+ FH+PPASM+S DI+S + FI  Y  ++ PL  +LMK   K  
Sbjct  1061  MASLFVEQGAAMKTTISSFHIPPASMSSFDILSVAAFIFIYRRVLDPLVSRLMK---KGL  1117

Query  428   NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEET-SSLSIFWQIPQYVLVGVA  592
              ELQR+GIG+VI+I+ M+ AG+VE  RL+YA    N + ET SSLSIFWQ+PQYVLVG +
Sbjct  1118  TELQRMGIGLVIAILAMISAGVVELFRLKYAVKDCNTDCETPSSLSIFWQVPQYVLVGAS  1177

Query  593   EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
             E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P
Sbjct  1178  EVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTVVMKISTRDDMPGWIP  1237

Query  773   PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
              NLN GHL+RF+FL AA+   DL+++V CAK YK I  E     D
Sbjct  1238  GNLNKGHLERFYFLLAALTTADLLVYVLCAKWYKYIKFEGKGGND  1282



>ref|XP_011085074.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Sesamum indicum]
Length=590

 Score =   286 bits (731),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/279 (55%), Positives = 200/279 (72%), Gaps = 7/279 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA+M   +  +   K+   NPW +C+VTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  302  KFLDRAAVMTQEDHNI-EQKTSTHNPWLLCSVTQVEEVKCILRLLPIWLCTILYSVVFTQ  360

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +A FH+PPASM+S DI+S ++FI     II P+  K+  R+    
Sbjct  361  MQSLFVEQGAAMKTTLAGFHIPPASMSSFDILSVASFIFINRRIIEPMVAKI--RKSGGL  418

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG++I+++ ML AG VE  RLRYA  +      +SSLSIFWQ+PQYVL+G +E
Sbjct  419  TELQRMGIGLIIAVMAMLTAGAVEHFRLRYAQKDCPRCVNSSSLSIFWQVPQYVLIGASE  478

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  LSM S +LG+Y+ S+I++IVMK++T    PGW+P 
Sbjct  479  VFMYVGQLEFFNGQAPDGLKSFGSALSMMSISLGNYVSSLIVTIVMKVSTSDDMPGWIPR  538

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLD F++L AA+ A D V++V CAK YK    E+
Sbjct  539  NLNKGHLDMFYYLLAALTAADFVVYVVCAKWYKYTRFEE  577



>ref|XP_004133948.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 ref|XP_004164748.1| PREDICTED: nitrate transporter 1.5-like [Cucumis sativus]
 gb|KGN56654.1| hypothetical protein Csa_3G127170 [Cucumis sativus]
Length=597

 Score =   286 bits (731),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 206/281 (73%), Gaps = 9/281 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ SSE   L D ++  NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  315  KFLDKAAVITSSEYDQLDDGAR--NPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  372

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QGAAM T I+ FH+PPASM+S DI+S + FI  Y  +I P++ +L K      
Sbjct  373  MASLFVVQGAAMRTNISTFHVPPASMSSFDILSVAAFIFIYRRVIDPVFARLTKSS---L  429

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I  M+ AG VE  RL++AN +    + +SSLSIFWQIPQYVL+G +E
Sbjct  430  TELQRMGIGLVIAICAMVSAGTVEIFRLKHANKDCLRCDNSSSLSIFWQIPQYVLIGASE  489

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF SQ PD LKS G  L M+S + G+Y+ S++++IVMKI+     PGW+P 
Sbjct  490  VFMYVGQLEFFNSQAPDGLKSFGSALCMTSISFGNYVSSLLVTIVMKISATDNMPGWIPG  549

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            NLN GHLDRF+FL AA+ A DLV+++ CAK YK I  E  E
Sbjct  550  NLNRGHLDRFYFLLAALTAADLVVYILCAKWYKYIKFESRE  590



>ref|XP_009629799.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=646

 Score =   287 bits (735),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 199/279 (71%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FL++AAI+ S E        +  NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  360  KFLNKAAIITSKE--------RFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  411

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ P    L K  P+  
Sbjct  412  MASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKSSPRGL  471

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+YAN +      +SSLSI WQ+PQYVL+G +E
Sbjct  472  TELQRMGVGLIIAIMAMVAAGIVEHFRLKYANIDCSHCTNSSSLSILWQVPQYVLIGASE  531

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T    PGW+P 
Sbjct  532  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPG  591

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+ A D V+++ CAK YK I  E+
Sbjct  592  NLNKGHLDRFYFLLAALTAADFVVYLICAKWYKYIEFEQ  630



>gb|KDP39505.1| hypothetical protein JCGZ_05071 [Jatropha curcas]
Length=599

 Score =   286 bits (731),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 213/294 (72%), Gaps = 14/294 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA ++S +M    D++Q   NPWR+C +TQVEEVKC+LRLLPIW+CTIL S+VF 
Sbjct  309  KFLDRAAFISSRDM---DDQNQDCRNPWRLCPITQVEEVKCILRLLPIWLCTILYSVVFT  365

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAM T I++F +P ASM+S DI+S + FI  Y  ++ PL  ++   + K 
Sbjct  366  QMASLFVEQGAAMKTTISNFRIPAASMSSFDILSVALFIFLYRRVLDPLVGRIRNSKSKG  425

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              ELQR+GIG+VI+I+ M+ AG+VE +RL+YA  +    E +SSLS+FWQ+PQY L+G +
Sbjct  426  LTELQRMGIGLVIAIMAMVSAGIVECYRLKYARKDCRHCEGSSSLSVFWQVPQYALIGAS  485

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+    GW+P
Sbjct  486  EVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEGNMHGWIP  545

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI------VLEKLEETDVEL  916
             NLN GHLDRF+FL AA+ ++DL +++ CAK YK+I      V    EE D E+
Sbjct  546  GNLNKGHLDRFYFLLAALTSVDLFVYIACAKWYKSIKFQGRDVANNKEEDDFEV  599



>gb|KHG12170.1| Nitrate transporter 1.5 -like protein [Gossypium arboreum]
Length=616

 Score =   286 bits (732),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 205/285 (72%), Gaps = 6/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDK-SQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            RFLDRAAIM  ++     +K ++  NPWR+CT+TQVEEVKC+LRLLPIW+CTIL S+VF 
Sbjct  313  RFLDRAAIMTPNDYATDEEKNTKGRNPWRLCTITQVEEVKCILRLLPIWLCTILYSVVFT  372

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQG AM T +++F +P ASM+S DI+S +TFI  Y  I+ P+  ++ K  PK 
Sbjct  373  QMASLFVEQGDAMKTTVSNFDIPAASMSSFDILSVATFIFIYRRILDPIVARI-KTNPKG  431

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              ELQR+GIG+VI+I+ M+ AG+VE  RL+YAN +       SSLSIFWQIPQY+L+G +
Sbjct  432  LTELQRMGIGLVIAILAMVAAGVVEVFRLKYANKDCPNCNNASSLSIFWQIPQYMLIGAS  491

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P
Sbjct  492  EVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTRDNMPGWIP  551

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
             NLN G LD F+FL AA+   DL++++ CAK YK I  +     D
Sbjct  552  GNLNKGRLDLFYFLLAALTTADLMIYIICAKWYKCIKFDGRTNGD  596



>ref|XP_008373542.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Malus domestica]
Length=596

 Score =   286 bits (731),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 203/284 (71%), Gaps = 6/284 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  307  KFLDRAAYISSRDLDY--QKQGIRSPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I +F +PPASM+S DIIS + FI  Y  II P   ++ K + K  
Sbjct  365  MASLFVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKSDAKGL  424

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+VI+   ML AG+VE +RL+YA+ E    + +SSLSIFWQIPQY  +G +E
Sbjct  425  TELQRMGVGLVIAXXAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASE  484

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  + ++S+VMK +T+   PGW+P 
Sbjct  485  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTEDHMPGWIPG  544

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRF+FL A + ++D ++++ CAK YK I LE   E D
Sbjct  545  NLNRGHLDRFYFLLAGLTSIDXIVYIACAKWYKNIKLEGRFEVD  588



>ref|XP_002893724.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH69983.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=615

 Score =   286 bits (732),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 206/279 (74%), Gaps = 8/279 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQ-VPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  313  KFLDKAAYITARD---LDDKKQDAVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  369

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAMNT ++DF +PPASM+S DI+S + FI  Y  ++ P+  +  K   K 
Sbjct  370  QMASLFVEQGAAMNTSVSDFKIPPASMSSFDILSVALFIFLYRRVLEPVANRFKKNGSKG  429

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              EL R+GIG+VI++I M+ AG+VE +RL+YA+      + +SSLSIFWQ PQY L+G +
Sbjct  430  ITELHRMGIGLVIAVIAMIAAGIVECYRLKYADKSCTHCDGSSSLSIFWQAPQYSLIGAS  489

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+P
Sbjct  490  EVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWIP  549

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             NLN GHLDRF+FL AA+ ++DLV+++ CAK YK I LE
Sbjct  550  RNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKPIKLE  588



>gb|EYU44105.1| hypothetical protein MIMGU_mgv1a006704mg [Erythranthe guttata]
Length=434

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 208/287 (72%), Gaps = 10/287 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + + +M  L  K    NPWR+C V+QVEEVKC+ RLLPIW+CTI+ S+VF Q
Sbjct  148  KFLDRAAYLTTQDMEQL--KQNEYNPWRLCPVSQVEEVKCIARLLPIWLCTIIYSVVFTQ  205

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMNTKI++F +P ASM+S DIIS + FI  +  ++ PL   + +   K  
Sbjct  206  MASLFVEQGDAMNTKISNFRIPAASMSSFDIISVAFFIFLFRRVLDPL---VRRVRGKGL  262

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+II M+ AG+VE +RL+YA  +    + +SSLSIFWQ+PQY L+G +E
Sbjct  263  TELQRMGIGLVIAIIAMISAGIVECYRLKYAQKDCKHCQGSSSLSIFWQVPQYALIGASE  322

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T    PGW+P 
Sbjct  323  VFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTVDNMPGWIPG  382

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETDVE  913
            NLN GHLDRF+FL A + A+DLV+++ CA  YK++ L EK  E + +
Sbjct  383  NLNKGHLDRFYFLLAGLTAIDLVIYIACATWYKSMKLGEKGGENNKD  429



>ref|XP_009114885.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Brassica rapa]
Length=620

 Score =   285 bits (730),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 209/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  313  KFLDRAAYITARD---LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  369

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PK  421
            Q+ SLFVEQGAAM T ++DF +PPASM+S DI+S + FI  Y  ++ PL  +  K++  K
Sbjct  370  QMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLATRFKKKDGTK  429

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               EL R+GIG+VI+I+ M+ AGLVE  RL+YA+      + +SSLSIFWQ+PQY L+G 
Sbjct  430  GITELHRMGIGLVIAILAMVAAGLVECFRLKYADKSCTHCDGSSSLSIFWQVPQYSLIGA  489

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T    PGW+
Sbjct  490  SEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTVDHMPGWI  549

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            P NLN GHLDRF+FL AA+ ++DLV+++ CA+ YK+I LE  +E
Sbjct  550  PRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKSIKLEAKDE  593



>emb|CDP09345.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   285 bits (728),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 206/287 (72%), Gaps = 9/287 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAA++ S +     ++  + NPWR+ TVT+VEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  320  RFLDRAAVITSKDF----EEDDICNPWRLTTVTKVEEVKCILRLLPIWLCTILYSVVFTQ  375

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKR-EPKL  424
            + SLFVEQGAAM T ++ FH+PPASM+S DI+S + FI  Y  ++ PL  +L K+  P  
Sbjct  376  MASLFVEQGAAMRTTVSGFHIPPASMSSFDILSVAAFIFIYRRVLDPLAARLRKKYNPGG  435

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRY----ANGEEETSSLSIFWQIPQYVLVGVA  592
              ELQR+GIG++I+I+ M+ AG+VE  RL++     +  + +SSLSIFWQ+PQYVL+G +
Sbjct  436  LTELQRMGIGLIIAIMAMVAAGIVEHFRLKHKLTNCSDCDNSSSLSIFWQVPQYVLIGAS  495

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T    PGW+P
Sbjct  496  EVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTSDEMPGWIP  555

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
             NLN GHLDRF+FL AA+ + D V+++ CAK YK +  E     + E
Sbjct  556  GNLNKGHLDRFYFLLAALTSADFVVYLVCAKWYKYVQFEGRNLNNDE  602



>ref|XP_009757592.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana sylvestris]
Length=595

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 206/290 (71%), Gaps = 15/290 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AAI+ S        K    NPWR+C V+Q+EEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  309  KFLDKAAIITS--------KDGENNPWRLCAVSQIEEVKCILRLLPIWLCTILYSVVFTQ  360

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T ++ FH+PPASM+S DI+S + FI  Y  ++ PL  +L K  P+  
Sbjct  361  MASLFVEQGAAMKTTVSGFHIPPASMSSFDILSVAAFIFIYRRVLDPLVARLKKSAPRGL  420

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+ A+ +      +SSLSIFWQ+PQYVL+G +E
Sbjct  421  TELQRMGVGLIIAIMAMVAAGIVEHFRLKSADKDCSSCTNSSSLSIFWQVPQYVLIGASE  480

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T    PGW+P 
Sbjct  481  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTTDKMPGWIPG  540

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVEG  925
            NLN GHLDRF+FL AA+ A D ++++ CAK YK I   K EE  +E   G
Sbjct  541  NLNKGHLDRFYFLLAALTAADFLVYLICAKWYKYI---KFEERSIEKQHG  587



>ref|XP_011028221.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Populus 
euphratica]
Length=594

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 210/302 (70%), Gaps = 16/302 (5%)
 Frame = +2

Query  50   CFMPTNR---------FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLL  202
            C M  NR         FLDRAA ++S ++     K    NPWR+C +TQVEEVKC+LRLL
Sbjct  290  CSMNGNRKILHTDGFKFLDRAAFISSRDID--DQKRGCRNPWRLCPITQVEEVKCILRLL  347

Query  203  PIWVCTILASIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENII  382
            PIW+CTI+ S+VF Q+ SLFVEQGAAM T I++F +PPASM++ DI+S + FI  Y  ++
Sbjct  348  PIWLCTIIYSVVFTQMASLFVEQGAAMKTTISNFKIPPASMSAFDILSVAFFIFLYRRVL  407

Query  383  LPLYVKLMKREPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLS  550
             PL     +   K   ELQR+G+G+VI+I+ M+ AGLVE +RL+YA  +    E +SSLS
Sbjct  408  DPLVSSFKQTSSKGLTELQRMGVGLVIAIMAMVSAGLVECYRLKYARKDCKHCEGSSSLS  467

Query  551  IFWQIPQYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIV  730
            IFWQ PQY L+G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++V
Sbjct  468  IFWQAPQYALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMV  527

Query  731  MKITTKHGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            +KI+T+   PGW+P NLN GHLDRF+FL A +  +D V+++ CA+ YK+I LE K EE  
Sbjct  528  VKISTEDHMPGWIPGNLNAGHLDRFYFLLAGLTTIDFVVYMACARWYKSIKLEKKCEENG  587

Query  908  VE  913
             E
Sbjct  588  HE  589



>emb|CDY48871.1| BnaA05g35790D [Brassica napus]
Length=614

 Score =   284 bits (726),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 209/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDRAAYITARD---LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PK  421
            Q+ SLFVEQGAAM T ++DF +PPASM+S DI+S + FI  Y  ++ PL  +  K++  K
Sbjct  369  QMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTK  428

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               EL R+GIG+VI+I+ M+ AG+VE  RL+YA+      + +SSLSIFWQ+PQY L+G 
Sbjct  429  GITELHRMGIGLVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQYSLIGA  488

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+
Sbjct  489  SEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWI  548

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            P NLN GHLDRF+FL AA+ ++DLV+++ CA+ YK I LE  +E
Sbjct  549  PRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEAKDE  592



>emb|CDY32284.1| BnaC05g28620D [Brassica napus]
Length=614

 Score =   284 bits (726),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 209/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDRAAYITARD---LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PK  421
            Q+ SLFVEQGAAM T ++DF +PPASM+S DI+S + FI  Y  ++ PL  +  K++  K
Sbjct  369  QMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTK  428

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               EL R+GIG+VI+I+ M+ AG+VE  RL+YA+      + +SSLSIFWQ+PQY L+G 
Sbjct  429  GITELHRMGIGLVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQYSLIGA  488

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+
Sbjct  489  SEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWI  548

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            P NLN GHLDRF+FL AA+ ++DLV+++ CA+ YK I LE  +E
Sbjct  549  PRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEAKDE  592



>ref|XP_011028220.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Populus 
euphratica]
Length=598

 Score =   283 bits (724),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 210/302 (70%), Gaps = 16/302 (5%)
 Frame = +2

Query  50   CFMPTNR---------FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLL  202
            C M  NR         FLDRAA ++S ++     K    NPWR+C +TQVEEVKC+LRLL
Sbjct  294  CSMNGNRKILHTDGFKFLDRAAFISSRDID--DQKRGCRNPWRLCPITQVEEVKCILRLL  351

Query  203  PIWVCTILASIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENII  382
            PIW+CTI+ S+VF Q+ SLFVEQGAAM T I++F +PPASM++ DI+S + FI  Y  ++
Sbjct  352  PIWLCTIIYSVVFTQMASLFVEQGAAMKTTISNFKIPPASMSAFDILSVAFFIFLYRRVL  411

Query  383  LPLYVKLMKREPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLS  550
             PL     +   K   ELQR+G+G+VI+I+ M+ AGLVE +RL+YA  +    E +SSLS
Sbjct  412  DPLVSSFKQTSSKGLTELQRMGVGLVIAIMAMVSAGLVECYRLKYARKDCKHCEGSSSLS  471

Query  551  IFWQIPQYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIV  730
            IFWQ PQY L+G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++V
Sbjct  472  IFWQAPQYALIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMV  531

Query  731  MKITTKHGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            +KI+T+   PGW+P NLN GHLDRF+FL A +  +D V+++ CA+ YK+I LE K EE  
Sbjct  532  VKISTEDHMPGWIPGNLNAGHLDRFYFLLAGLTTIDFVVYMACARWYKSIKLEKKCEENG  591

Query  908  VE  913
             E
Sbjct  592  HE  593



>ref|XP_009151431.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Brassica rapa]
Length=614

 Score =   283 bits (725),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 209/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  312  KFLDRAAYITARD---LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  368

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PK  421
            Q+ SLFVEQGAAM T ++DF +PPASM+S DI+S + FI  Y  ++ PL  +  K++  K
Sbjct  369  QMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTK  428

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               EL R+GIG+VI+I+ M+ AG+VE  RL+YA+      + +SSLSIFWQ+PQY L+G 
Sbjct  429  GITELHRMGIGLVIAILAMVAAGVVECFRLKYADRSCTHCDGSSSLSIFWQVPQYSLIGA  488

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+
Sbjct  489  SEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWI  548

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            P NLN GHLDRF+FL AA+ ++DLV+++ CA+ YK I LE  +E
Sbjct  549  PRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEAKDE  592



>emb|CDX93833.1| BnaA09g24330D [Brassica napus]
Length=620

 Score =   283 bits (725),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 208/284 (73%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  313  KFLDRAAYITARD---LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  369

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PK  421
            Q+ SLFVEQGAAM T ++DF +PPASM+S DI+S + FI  Y  ++ PL  +  K++  K
Sbjct  370  QMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLATRFKKKDGTK  429

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               EL R+GIG+VI+I+ M+ AG+VE  RL+YA+      + +SSLSIFWQ+PQY L+G 
Sbjct  430  GITELHRMGIGLVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQYSLIGA  489

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T    PGW+
Sbjct  490  SEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTVDHMPGWI  549

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            P NLN GHLDRF+FL AA+ ++DLV+++ CA+ YK I LE  +E
Sbjct  550  PRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEAKDE  593



>ref|XP_009378974.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Pyrus 
x bretschneideri]
Length=595

 Score =   283 bits (723),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 204/284 (72%), Gaps = 6/284 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PW +C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  307  KFLDRAAYISSRDLDY--RKQGIRSPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I +F +PPASM+S DIIS + FI  Y  II P   ++ K + K  
Sbjct  365  MASLFVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKSDAKGL  424

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+++ ML AG+VE +RL+YA+ E    + +SSLSIFWQIPQY  +G +E
Sbjct  425  TELQRMGIGLVIAVMAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQIPQYACIGASE  484

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  + ++S+VMK +T+   PGW+P 
Sbjct  485  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFSTEDHMPGWIPG  544

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLD F+FL A + ++DL++++ CAK YK I LE   E D
Sbjct  545  NLNRGHLDWFYFLLAVLTSIDLIVYIACAKWYKNIKLEGRFEVD  588



>ref|XP_011070229.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Sesamum indicum]
Length=597

 Score =   283 bits (723),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 209/291 (72%), Gaps = 10/291 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + S E+  L  K    NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  311  KFLDRAAFVTSRELDQL--KQNEYNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  368

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMNTKI++F +P ASM+S DI+S +  I  Y  ++ PL  ++ K   K  
Sbjct  369  MASLFVEQGDAMNTKISNFRIPAASMSSFDIVSVAIVIFLYRRVLDPLVHRIRK---KGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I+ ML AG+VE +RL+YA  +    + +SSLSIFWQ+PQY L+G +E
Sbjct  426  TELQRMGIGLVIAIMAMLSAGIVECYRLKYAQKDCKHCQGSSSLSIFWQVPQYALIGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++SIVMKI+T    PGW+P 
Sbjct  486  VFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMKISTIDNMPGWIPR  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDVELVEG  925
            NLN GHLDRF+FL A + A+DL++++ CA  YK++ L  K  E   + V G
Sbjct  546  NLNKGHLDRFYFLLAGLTAIDLILYIACAMWYKSMKLRGKCSENKEDQVYG  596



>ref|XP_011081326.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Sesamum indicum]
Length=601

 Score =   282 bits (722),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 207/278 (74%), Gaps = 8/278 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + S +   L  K+   NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  314  KFLDRAAFLTSRDSEQLKQKAY--NPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  371

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMNT I++F +PPASM+S DI+S + FI  Y  ++ PL V+ ++++  L 
Sbjct  372  MASLFVEQGDAMNTNISNFRIPPASMSSFDILSVAFFIFLYRRVVDPL-VRRVRKKGSL-  429

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG++I++  ML AG+VE +RL+YA  +    + +SSLSIFWQ+PQY L+G +E
Sbjct  430  TELQRMGIGLIIAVAAMLSAGIVECYRLKYAKKDCRHCQGSSSLSIFWQVPQYALIGASE  489

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF ++ PD LKS G  L M+S +LG+Y+ S ++SIVMKI+T    PGW+P 
Sbjct  490  VFMYVGQLEFFNAEAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISTVDNMPGWIPG  549

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            NLN GHLDRF+FL A + A+DLV+++ CA+ Y ++ LE
Sbjct  550  NLNKGHLDRFYFLLAGLTAVDLVIYIACARWYTSMKLE  587



>ref|XP_006415196.1| hypothetical protein EUTSA_v10007088mg [Eutrema salsugineum]
 gb|ESQ33549.1| hypothetical protein EUTSA_v10007088mg [Eutrema salsugineum]
Length=618

 Score =   282 bits (722),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 209/284 (74%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  313  KFLDRAAYITARD---LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  369

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PK  421
            Q+ SLFVEQGAAM T ++DF +PPASM+S DI+S + FI  Y  ++ PL  +  K++  K
Sbjct  370  QMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLANRFKKKDGTK  429

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               EL R+GIG+VI+I+ M+ AG+VE  RL++A+      + +SSLSIFWQ+PQY L+G 
Sbjct  430  GITELHRMGIGLVIAILAMVAAGVVECFRLKFADKSCTHCDGSSSLSIFWQVPQYSLIGA  489

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T+   PGW+
Sbjct  490  SEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTEDHMPGWI  549

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            P NLN GHLDRF+FL AA+ ++DLV+++ CA+ YK I LE  +E
Sbjct  550  PRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEGKDE  593



>emb|CDY01274.1| BnaC05g24580D [Brassica napus]
Length=619

 Score =   281 bits (720),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 206/284 (73%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + + +   L DK Q   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  313  KFLDRAAYITARD---LDDKKQGGVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFT  369

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PK  421
            Q+ SLFVEQGAAM T ++DF +PPASM+S DI+S + FI  Y  ++ PL  +   ++  K
Sbjct  370  QMASLFVEQGAAMKTTVSDFKIPPASMSSFDILSVALFIFIYRRVLEPLATRFKNKDGTK  429

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               EL R+GIG+VI+I+ M+ AG+VE  RL+YA+      + +SSLSIFWQ+PQY L+G 
Sbjct  430  GITELHRMGIGLVIAILAMVAAGVVECFRLKYADKSCTHCDGSSSLSIFWQVPQYSLIGA  489

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++V+KI+T    PGW+
Sbjct  490  SEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMGNFVSSLLVTMVVKISTVDHMPGWI  549

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            P NLN GHLDRF+FL AA+ ++DLV+++ CA+ YK I LE   E
Sbjct  550  PRNLNKGHLDRFYFLLAALTSIDLVVYIACARWYKCIKLEAKHE  593



>ref|XP_009802258.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X4 [Nicotiana 
sylvestris]
Length=598

 Score =   281 bits (718),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 198/279 (71%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FL++AAI+ S E        +  NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  312  KFLNKAAIITSKE--------RFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  363

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ P    L K   +  
Sbjct  364  MASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKSSQRGL  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+YA+ +      +SSLSI WQ+PQYVL+G +E
Sbjct  424  TELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLSILWQVPQYVLIGASE  483

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T    PGW+P 
Sbjct  484  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPG  543

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+ A D ++++ CAK YK I  E+
Sbjct  544  NLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEE  582



>ref|XP_009802257.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X3 [Nicotiana 
sylvestris]
Length=599

 Score =   281 bits (718),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 198/279 (71%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FL++AAI+ S E        +  NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  313  KFLNKAAIITSKE--------RFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ P    L K   +  
Sbjct  365  MASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKSSQRGL  424

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+YA+ +      +SSLSI WQ+PQYVL+G +E
Sbjct  425  TELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLSILWQVPQYVLIGASE  484

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T    PGW+P 
Sbjct  485  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPG  544

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+ A D ++++ CAK YK I  E+
Sbjct  545  NLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEE  583



>ref|XP_009802255.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X1 [Nicotiana 
sylvestris]
Length=594

 Score =   280 bits (717),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 198/279 (71%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FL++AAI+ S E        +  NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  308  KFLNKAAIITSKE--------RFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  359

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ P    L K   +  
Sbjct  360  MASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKSSQRGL  419

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+YA+ +      +SSLSI WQ+PQYVL+G +E
Sbjct  420  TELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLSILWQVPQYVLIGASE  479

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T    PGW+P 
Sbjct  480  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPG  539

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+ A D ++++ CAK YK I  E+
Sbjct  540  NLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEE  578



>ref|XP_009802256.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X2 [Nicotiana 
sylvestris]
Length=593

 Score =   280 bits (717),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 198/279 (71%), Gaps = 12/279 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FL++AAI+ S E        +  NPWR+C VTQVEEVKC+LRL PIW+CTIL S+VF Q
Sbjct  307  KFLNKAAIITSKE--------RFDNPWRLCPVTQVEEVKCILRLFPIWLCTILYSVVFTQ  358

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T ++ FH+PPASM+S DI+S + FI  Y  ++ P    L K   +  
Sbjct  359  MASLFVEQGDAMKTTVSRFHIPPASMSSFDILSVAAFIFIYRRVLDPFVASLKKSSQRGL  418

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G++I+I+ M+ AG+VE  RL+YA+ +      +SSLSI WQ+PQYVL+G +E
Sbjct  419  TELQRMGVGLIIAIMAMVAAGIVEHFRLKYASIDCSHCTNSSSLSILWQVPQYVLIGASE  478

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++SIVM+I+T    PGW+P 
Sbjct  479  VFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVSIVMRISTTDNMPGWIPG  538

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            NLN GHLDRF+FL AA+ A D ++++ CAK YK I  E+
Sbjct  539  NLNKGHLDRFYFLLAALTAADFLVYLLCAKWYKYIEFEE  577



>ref|XP_010053584.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Eucalyptus grandis]
 gb|KCW77909.1| hypothetical protein EUGRSUZ_D02167 [Eucalyptus grandis]
Length=597

 Score =   280 bits (716),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 150/286 (52%), Positives = 208/286 (73%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA + S +   L D+ Q   N WR+C +TQVEEVKC+LRLLPIW+CTI+ S+VF 
Sbjct  308  KFLDRAAYITSRD---LEDQKQGRYNKWRLCPITQVEEVKCILRLLPIWLCTIVYSVVFT  364

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQGAAM T ++ F +PPASM+S DI+S + FI  Y  +I P+  ++ K   + 
Sbjct  365  QMASLFVEQGAAMKTTVSHFRIPPASMSSFDIVSVAVFIFLYRRVIDPVVGRIRKTHSRG  424

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVA  592
              ELQR+GIG+VI+++ M+ AG+VE +RL+YA  +    E +S+LSI WQ+PQY L+G +
Sbjct  425  LTELQRMGIGLVIAVLAMVSAGIVECYRLKYARKDCTRCEGSSTLSILWQVPQYALIGAS  484

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T+   PGW+P
Sbjct  485  EVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSMVMKISTEDHMPGWIP  544

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
             NLN GHLDRF+FL AA+  +DL++++ CAK Y+ I LE K  E D
Sbjct  545  GNLNKGHLDRFYFLLAALTVVDLMVYIACAKWYRNIKLEGKCGEDD  590



>ref|XP_010677273.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   280 bits (715),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 203/291 (70%), Gaps = 8/291 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA + S +      +  + NPWR+C + QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  308  KFLDKAAYIKSGD--FYNQEQSLHNPWRLCPIRQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I++F +P ASM+S DI+S   F+  Y  ++ P+  ++ K E    
Sbjct  366  MASLFVEQGAAMKTTISNFRIPAASMSSFDILSVVAFVFIYRKVLDPIMSRVRKTESGGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE------EETSSLSIFWQIPQYVLVGV  589
             EL R+GIG++I+++ M+ AG+VE +RL+YA  +         S+LSIFWQIPQYV +G 
Sbjct  426  TELHRMGIGLIIAVLAMVSAGIVECYRLKYAIKDCPHCRAPNPSTLSIFWQIPQYVFIGA  485

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+I+SIVMKI+T+   PGW+
Sbjct  486  SEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLIVSIVMKISTEDHMPGWI  545

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            P NLN GHLDRFFFL AA+  +D V+++ CA+ YK I LE   + D   VE
Sbjct  546  PGNLNKGHLDRFFFLLAALTTIDFVVYLLCARSYKCIKLEGKSDEDNSQVE  596



>ref|XP_008808100.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Phoenix dactylifera]
 ref|XP_008808101.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Phoenix dactylifera]
Length=601

 Score =   279 bits (714),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/280 (51%), Positives = 202/280 (72%), Gaps = 4/280 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA + + +  +   ++++ NPW++CTVTQVEEVKCVL++LPIW+CTI+ S+VF Q
Sbjct  320  RFLDKAATLTADDYCM---RAKMNNPWKLCTVTQVEEVKCVLKVLPIWLCTIIYSVVFTQ  376

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA+MNTKI  FH+PPASM+  DI+S   FI+ Y  ++ P+  +L    PK  
Sbjct  377  MASLFVEQGASMNTKIGTFHIPPASMSVFDILSVLVFIVIYRRVLTPVLSRL-SNNPKGL  435

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI ++ M+ AGLVE  RL+  +  +E SSLSIF QIPQY L+G +E F+Y
Sbjct  436  TELQRMGLGLVIGMLAMVAAGLVEVERLKGVSVPDEPSSLSIFCQIPQYALIGASEVFMY  495

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  LSM+S +LG+Y+  +I+++V  +T+    PGW+P NLN 
Sbjct  496  VGQLEFFNGQAPDGIKSFGSSLSMASISLGNYVSIMIVNLVTTVTSGDKNPGWIPGNLNH  555

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GHLDRF+FL   + A+D +++V CAK YK I LE  ++ +
Sbjct  556  GHLDRFYFLLVILTAVDFILYVVCAKWYKCIKLESNDDGE  595



>ref|XP_010934996.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X2 [Elaeis guineensis]
Length=585

 Score =   278 bits (712),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/283 (54%), Positives = 206/283 (73%), Gaps = 2/283 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + S    +L D+S   + W +CT+TQVEEVKCVLRL+PIW+ TIL S+VF Q
Sbjct  300  KFLDRAAFIDSDNNIILQDRSIPRDTWSLCTITQVEEVKCVLRLIPIWLTTILYSVVFTQ  359

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMNT IA F +PPASM++ DI+S + FI+ Y  ++ PL  KL K+EPK  
Sbjct  360  MASLFVEQGDAMNTTIAGFRIPPASMSAFDILSVAVFILFYRRLLTPLVSKL-KKEPKGL  418

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRY-ANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
             ELQR+GIG++I+I+ M+ AG+VE  RL++   G ++ SSLSI WQIPQY L+G +E F+
Sbjct  419  TELQRMGIGLIIAIMAMIAAGMVEIFRLKHVCKGCKDKSSLSILWQIPQYTLIGASEVFM  478

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMKIT +  +PGW+P NLN
Sbjct  479  YVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKITAEDNRPGWIPGNLN  538

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
             GH+DRF+FL AA+ + D +++V CA+ YK I LE     D E
Sbjct  539  KGHMDRFYFLLAALTSADFLVYVACARWYKCIKLEGRSRDDEE  581



>ref|XP_010934995.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X1 [Elaeis guineensis]
Length=618

 Score =   279 bits (714),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/283 (54%), Positives = 206/283 (73%), Gaps = 2/283 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + S    +L D+S   + W +CT+TQVEEVKCVLRL+PIW+ TIL S+VF Q
Sbjct  333  KFLDRAAFIDSDNNIILQDRSIPRDTWSLCTITQVEEVKCVLRLIPIWLTTILYSVVFTQ  392

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMNT IA F +PPASM++ DI+S + FI+ Y  ++ PL  KL K+EPK  
Sbjct  393  MASLFVEQGDAMNTTIAGFRIPPASMSAFDILSVAVFILFYRRLLTPLVSKL-KKEPKGL  451

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRY-ANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
             ELQR+GIG++I+I+ M+ AG+VE  RL++   G ++ SSLSI WQIPQY L+G +E F+
Sbjct  452  TELQRMGIGLIIAIMAMIAAGMVEIFRLKHVCKGCKDKSSLSILWQIPQYTLIGASEVFM  511

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMKIT +  +PGW+P NLN
Sbjct  512  YVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKITAEDNRPGWIPGNLN  571

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
             GH+DRF+FL AA+ + D +++V CA+ YK I LE     D E
Sbjct  572  KGHMDRFYFLLAALTSADFLVYVACARWYKCIKLEGRSRDDEE  614



>gb|KHG24156.1| Nitrate transporter 1.5 -like protein [Gossypium arboreum]
Length=599

 Score =   278 bits (711),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 143/286 (50%), Positives = 209/286 (73%), Gaps = 6/286 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA +++ ++     K    + WR+C VTQVEEVKCVLRLLPIW+CTI+ S+VF Q
Sbjct  309  KFLDRAAYISTRDVE--EQKKGTHSMWRLCPVTQVEEVKCVLRLLPIWLCTIIYSVVFTQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +++F +PPASM+S DI+S + FI  Y  ++ PL  ++ K+  +  
Sbjct  367  MASLFVEQGAAMKTTVSNFRIPPASMSSFDILSVALFIFLYRRVLDPLVTRIKKKGSRGL  426

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+VI+I+ M+ AG+VE +RL++A+ +    E +SSLSIFWQ+PQY  +G +E
Sbjct  427  TELQRMGIGLVIAIMAMVSAGIVECYRLKHADKDCMHCEGSSSLSIFWQVPQYAFIGASE  486

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMKI+T+   PGW+P 
Sbjct  487  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKISTEDHMPGWIPG  546

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLD F+FL A +  +DL++++ CA+ YK+I LE     +++
Sbjct  547  NLNKGHLDWFYFLLAGLTTIDLIVYIACARWYKSIKLEGKTAENID  592



>ref|XP_008243685.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Prunus mume]
Length=602

 Score =   278 bits (712),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 208/287 (72%), Gaps = 14/287 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +  +EM    D+S   NPWRVCT+TQVEE KCVL++LPIW+CTI+ S+VF Q+
Sbjct  316  FLDKAATI--TEM----DRSGPNNPWRVCTITQVEEAKCVLKMLPIWLCTIIYSVVFTQM  369

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREPK  421
             SLFVEQG  M + I +FH P ASM+  DI S    +IC   Y +II+P+  +L    PK
Sbjct  370  ASLFVEQGDVMESHIGNFHFPAASMSLFDIFS---VLICTGIYRHIIVPVSGRL-SGNPK  425

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
              +ELQR+GIG++I +++M+ AG  E  RL++    ++ SSLSIFWQIPQYVLVG +E F
Sbjct  426  GLSELQRMGIGLIIGLLSMVAAGATEVARLKHVQPGQKVSSLSIFWQIPQYVLVGTSEIF  485

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD +KS+G  L M+S +LG+Y+ S++++IVM IT +   PGW+P NL
Sbjct  486  MYVGQLEFFNGQAPDGIKSLGSSLCMASISLGNYVSSLLVTIVMMITARGENPGWIPNNL  545

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            N+GHLDRF+FL A + ALD V++VFCAKRYK I L++ E+ ++E +E
Sbjct  546  NEGHLDRFYFLIAILTALDFVVYVFCAKRYKGINLQEPEQ-EMESIE  591



>ref|XP_006413747.1| hypothetical protein EUTSA_v10024762mg [Eutrema salsugineum]
 gb|ESQ55200.1| hypothetical protein EUTSA_v10024762mg [Eutrema salsugineum]
Length=583

 Score =   277 bits (708),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 199/275 (72%), Gaps = 1/275 (0%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +  +  +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAVKVETGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFVEQGAAM T I  F +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVEQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              ELQR+GIG+VI+I+ M+ AG+VE +RL++ +    +SSLSIFWQ+PQY+++G +E F+
Sbjct  417  LTELQRMGIGLVIAIMAMISAGIVEIYRLKHKSSVSNSSSLSIFWQVPQYMMIGASEVFM  476

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+ +   PGW+P NLN
Sbjct  477  YVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISARDELPGWIPGNLN  536

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             GHLDRF+FL A + A D V+++ CAK YK I  E
Sbjct  537  KGHLDRFYFLLAGLTAADFVVYLVCAKWYKYIKSE  571



>ref|XP_006358632.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=594

 Score =   277 bits (709),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 206/291 (71%), Gaps = 13/291 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAA++ S E     +K    N WR+C V+QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  302  RFLDRAALITSKEQD--NEKQSNRNQWRLCPVSQVEEVKCILRLLPIWLCTIVYSVVFTQ  359

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPL--YVKLMKREPK  421
            + S+FVEQG AM T I +F +P ASM++ DI+S + FI  Y  I+ P+   +K +K E +
Sbjct  360  MASIFVEQGDAMKTTIGNFRIPAASMSTFDIMSVAVFIFLYRRILDPIVKNIKKIKGEGQ  419

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               +LQR+GIG+VI+++ ML A +VE +RL+YA  E    E +SSLSIFWQ+PQY L+G 
Sbjct  420  GITQLQRMGIGLVIAVMAMLSAAIVECYRLKYAKKECTHCEGSSSLSIFWQVPQYSLIGA  479

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T     GW+
Sbjct  480  SEVFMYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNMSGWI  539

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI-----VLEKLEETD  907
            P NLN+GHLDRF+FL A +  LDLV F+ CAK YK I     ++++++E D
Sbjct  540  PGNLNEGHLDRFYFLLAGLTILDLVAFIACAKWYKGIKHGGEMIQQVKEED  590



>ref|XP_006853963.1| hypothetical protein AMTR_s00036p00217430 [Amborella trichopoda]
 gb|ERN15430.1| hypothetical protein AMTR_s00036p00217430 [Amborella trichopoda]
Length=469

 Score =   273 bits (699),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 199/286 (70%), Gaps = 4/286 (1%)
 Frame = +2

Query  59   PTNRFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIV  238
            P  +FLD+AAIM  +  T         +PW +CTVTQVEEVKC+LRLLPIW+CTI+  +V
Sbjct  182  PDFKFLDKAAIMTENNFT---KDRPFHDPWLLCTVTQVEEVKCILRLLPIWLCTIIYYVV  238

Query  239  FVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP  418
            F Q+ SLFVEQ AAM T I+ FH+PPASM++ DI+S++ FII Y  + +P  +  +++ P
Sbjct  239  FTQMASLFVEQAAAMKTDISGFHIPPASMSTFDILSATAFIIFYRKLFIPC-LHRVRKNP  297

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
                ELQR+G+G++ +I+ M+ AG +E  RLRY    ++ SSLSI  QIPQYVL+G +E 
Sbjct  298  TGLTELQRMGLGLITAIVAMISAGFIELIRLRYVKEVDKPSSLSILLQIPQYVLIGASEV  357

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+Y+AQ EFF +Q PD LKS G  L M+S +LG+Y  S ++ IVM IT K  K GW+  N
Sbjct  358  FMYIAQLEFFNAQAPDGLKSFGNALCMTSMSLGNYFSSFLVGIVMGITRKDHKAGWIAEN  417

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVEL  916
            LN GH+D+F+FL AA+ A+D V++V CAK Y++I  E  +E   E+
Sbjct  418  LNQGHMDKFYFLLAALTAIDFVIYVICAKGYRSISYETRDEDQEEI  463



>ref|XP_007207539.1| hypothetical protein PRUPE_ppa015854mg [Prunus persica]
 gb|EMJ08738.1| hypothetical protein PRUPE_ppa015854mg [Prunus persica]
Length=602

 Score =   276 bits (707),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 152/288 (53%), Positives = 206/288 (72%), Gaps = 14/288 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +  +EM    D+S   NPWRVCTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  315  EFLDKAATI--TEM----DQSGHNNPWRVCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  368

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  M + I +FH P ASM+  DI S    +IC   Y +I++P+  +L    P
Sbjct  369  MASLFVEQGDVMESHIGNFHFPAASMSLFDIFS---VLICTGIYRHIVVPVSGRL-SGNP  424

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K  +ELQR+GIG++I +++M+ AG  E  RL++    ++ SSLSIFWQIPQYVLVG +E 
Sbjct  425  KGLSELQRMGIGLIIGLLSMVAAGATEVARLKHVQPGQKVSSLSIFWQIPQYVLVGASEI  484

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS+G  L M+S +LG+Y+ S++++IVM IT +   PGW+P N
Sbjct  485  FMYVGQLEFFNGQAPDGIKSLGSSLCMASISLGNYVSSLLVTIVMMITARGENPGWIPNN  544

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            LN+GHLDRF+FL A + ALD V++VFCAKRYK I L+   E ++E +E
Sbjct  545  LNEGHLDRFYFLIAILTALDFVVYVFCAKRYKGINLQG-PELEMESIE  591



>ref|XP_003599761.1| Peptide transporter PTR2 [Medicago truncatula]
Length=1194

 Score =   286 bits (731),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 203/267 (76%), Gaps = 2/267 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF DRA I++     +L  K Q    W   ++TQ E V  +LR+LPIW+CTI +S VF+Q
Sbjct  221  RFFDRAGIVSDEATEMLLGKGQKSYKWNFNSLTQSEAVTYILRVLPIWICTIFSSSVFIQ  280

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+ M+     F +PP+SMT+ DIIS+STFII  + +I+PLY+K+MKR PKLP
Sbjct  281  LLSLFVEQGSTMDRTFFKFQIPPSSMTAFDIISTSTFIILLDVLIIPLYIKVMKRPPKLP  340

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQ IGIG+ I+IIT+++AG VEQ RL +A N  +E SSLSIFW IPQY+L+G+AEAF+
Sbjct  341  SELQSIGIGLCITIITLIVAGFVEQRRLSFASNDGKEMSSLSIFWLIPQYMLLGIAEAFV  400

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTK-HGKPGWVPPNL  781
            YVAQ  FF SQ PD L+S+G+GLSM SSALG Y+ +  L++V KIT+   G+ GWV PNL
Sbjct  401  YVAQMNFFTSQTPDGLESLGMGLSMFSSALGCYVGNFFLTVVNKITSSGQGQHGWVSPNL  460

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCA  862
            NDGHLDRFFFL+A ++A+DL++++ C+
Sbjct  461  NDGHLDRFFFLTAFLIAIDLIVYIVCS  487



>ref|XP_003599760.1| Peptide transporter PTR2 [Medicago truncatula]
Length=1282

 Score =   286 bits (731),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 203/267 (76%), Gaps = 2/267 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF DRA I++     +L  K Q    W   ++TQ E V  +LR+LPIW+CTI +S VF+Q
Sbjct  309  RFFDRAGIVSDEATEMLLGKGQKSYKWNFNSLTQSEAVTYILRVLPIWICTIFSSSVFIQ  368

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+ M+     F +PP+SMT+ DIIS+STFII  + +I+PLY+K+MKR PKLP
Sbjct  369  LLSLFVEQGSTMDRTFFKFQIPPSSMTAFDIISTSTFIILLDVLIIPLYIKVMKRPPKLP  428

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQ IGIG+ I+IIT+++AG VEQ RL +A N  +E SSLSIFW IPQY+L+G+AEAF+
Sbjct  429  SELQSIGIGLCITIITLIVAGFVEQRRLSFASNDGKEMSSLSIFWLIPQYMLLGIAEAFV  488

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTK-HGKPGWVPPNL  781
            YVAQ  FF SQ PD L+S+G+GLSM SSALG Y+ +  L++V KIT+   G+ GWV PNL
Sbjct  489  YVAQMNFFTSQTPDGLESLGMGLSMFSSALGCYVGNFFLTVVNKITSSGQGQHGWVSPNL  548

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCA  862
            NDGHLDRFFFL+A ++A+DL++++ C+
Sbjct  549  NDGHLDRFFFLTAFLIAIDLIVYIVCS  575



>ref|XP_009792819.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Nicotiana 
sylvestris]
Length=523

 Score =   274 bits (701),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/286 (50%), Positives = 203/286 (71%), Gaps = 8/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ S E+    +K    NPWR+C ++QVEEVKC+LRL+PIW+CTI+ S+VF Q
Sbjct  236  KFLDKAALITSKELG--NEKQSNRNPWRLCPISQVEEVKCILRLMPIWLCTIIYSVVFTQ  293

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + S+FVEQG AM T I  F +P ASM+S DI+S +  I  Y  ++ P   K+ K + +  
Sbjct  294  MASIFVEQGDAMKTTIGKFRIPAASMSSFDIMSVAVVIFLYRRVLDPFVKKIKKHKGEAL  353

Query  428  N--ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               +LQR+GIG++I+++ ML AG+VE +RL+YA+ ++ +SSL+I WQIPQY LVG +E F
Sbjct  354  GITQLQRMGIGLIIAVMAMLSAGIVECYRLKYASKDQGSSSLTILWQIPQYSLVGASEVF  413

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD LKS G  L M+S +LG+Y+ ++++S+VMKI+T     GW+P NL
Sbjct  414  MYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSNLLVSVVMKISTTDNMSGWIPGNL  473

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI----VLEKLEETD  907
            N GHLDRF+FL A +  LDLV ++ CAK YK I    + ++L+E D
Sbjct  474  NKGHLDRFYFLLAGLTILDLVAYIACAKWYKGIKHGEITQQLKEED  519



>ref|XP_003551735.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=597

 Score =   276 bits (706),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 206/286 (72%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA + S ++  L +  +  NPW + TVTQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  309  RFLDKAAFITSKDLEQLEENKR--NPWCLSTVTQVEEVKCILRLLPIWLCTIMYSVVFAQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QG AM T I+ F +PPASM+S DI+  + FI  Y + + P   K+MK +    
Sbjct  367  MASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIYRHALDPFVAKVMKSK---L  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+V++I+ M+ AGLVE+ RL+YA    N  + +SSLSIFWQ+PQYVL G +E
Sbjct  424  TELQRMGIGLVLAIMAMVSAGLVEKFRLKYAIKDCNQCDGSSSLSIFWQVPQYVLTGASE  483

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+TK   PGW+P 
Sbjct  484  VFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKGDIPGWIPG  543

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL AA+   DLV++V  AK YK+I  E+  E D++
Sbjct  544  NLNLGHLDRFYFLLAALTTADLVVYVALAKWYKSIQFEENAEEDIK  589



>ref|XP_004497408.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X3 [Cicer arietinum]
Length=544

 Score =   274 bits (701),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 203/285 (71%), Gaps = 6/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +F+D+AA +  ++     D++   NPWR+CTVTQVEE KC+LR+LP+W+CTI  SIVF Q
Sbjct  263  KFMDKAATITEND-----DENSRNNPWRLCTVTQVEETKCILRMLPVWLCTITYSIVFTQ  317

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMN++I +F +P ASM++ DI S   F   Y  I++P+ V  +   PK  
Sbjct  318  MASLFVEQGDAMNSRIGEFRLPAASMSAFDICSVLVFTGVYRQILVPV-VGRLSGNPKGL  376

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG++  +++M+ +G+ E  RLR+    +++SS+SIF+QIPQYVLVG +E F+Y
Sbjct  377  TELQRMGIGLIFGMLSMVASGMTEIARLRHIIPGQKSSSMSIFYQIPQYVLVGASEVFMY  436

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++++M+IT +    GW+P NLN 
Sbjct  437  VGQLEFFNGQAPDGLKSFGSSLCMASMSLGNYMSSMLVNVIMRITARGHDKGWIPDNLNT  496

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            GH+DRFFFL A IVA D V+++FCAK YK+I +E  +E  V+ V 
Sbjct  497  GHMDRFFFLLAGIVAFDFVLYLFCAKWYKSISVEGGQEELVDDVN  541



>ref|XP_008799424.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Phoenix dactylifera]
Length=604

 Score =   276 bits (705),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 201/276 (73%), Gaps = 7/276 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLDRAA + S     L D+    +PWR CT+TQVEEVKCVLRL+PIW+ TIL S+ F Q
Sbjct  322  EFLDRAAFIDSD----LQDQLIPRDPWRCCTITQVEEVKCVLRLIPIWLTTILYSVAFTQ  377

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMNT IA F +PPASM++ DI+S + FI+    ++ PL V  +++EPK  
Sbjct  378  MASLFVEQGDAMNTTIAGFEIPPASMSAFDILSVAVFILLNRRLLTPL-VSRLRKEPKGL  436

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA--NGEEETSSLSIFWQIPQYVLVGVAEAF  601
             ELQR+GIG++++II M+ AG VE  RL++     +++ SSLSI WQIPQY+L+G +E F
Sbjct  437  TELQRMGIGLIVAIIAMVAAGTVEIVRLKHGCKGCKDDESSLSILWQIPQYMLIGASEVF  496

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q P+ LKS G  L M+S +LG+Y+ S++++IVMKITT+  +PGW+P NL
Sbjct  497  MYVGQLEFFNDQAPNGLKSFGSALCMASISLGNYVSSLLVTIVMKITTEDNRPGWIPGNL  556

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            N GH+DRF+FL AA+  +D V++V CA+ YK I LE
Sbjct  557  NKGHMDRFYFLLAALTGVDFVLYVACARWYKCIKLE  592



>ref|XP_009593650.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X2 [Nicotiana 
tomentosiformis]
Length=556

 Score =   274 bits (701),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/286 (51%), Positives = 203/286 (71%), Gaps = 12/286 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ S+E      K    NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  273  KFLDKAALITSNE------KQSNRNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  326

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + S+FVEQG AM + I  F +P ASM+S DI+S +  I  Y  ++ P   K+ K + +  
Sbjct  327  MASIFVEQGDAMKSTIGKFRIPAASMSSFDIVSVAVVIFLYRRVLDPFVKKIKKHKGEAV  386

Query  428  N--ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               + QR+GIG+VI+++ ML AG+VE +RL+YA  ++ +SSLSI WQIPQY L+G +E F
Sbjct  387  GITQRQRMGIGLVIAVMAMLSAGIVECYRLKYARKDQGSSSLSILWQIPQYSLIGASEVF  446

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T     GW+P NL
Sbjct  447  MYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNMSGWIPANL  506

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI----VLEKLEETD  907
            N GHLDRF+FL AA+  LDLV ++ CAK YKAI    ++++L+E D
Sbjct  507  NKGHLDRFYFLLAALTILDLVAYIACAKWYKAIKHGEMIQQLKEED  552



>ref|XP_010518871.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Tarenaya hassleriana]
Length=620

 Score =   276 bits (705),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 207/286 (72%), Gaps = 10/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLD+AA + + +   L D+ Q   +PWR+C V QVEEVKC+LRL+PIW+CTI+ S+VF 
Sbjct  315  KFLDKAAYITAKD---LEDQKQGRVDPWRLCPVNQVEEVKCILRLMPIWLCTIIYSVVFT  371

Query  245  QVFSLFVEQGAAMNTKIA-DFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPK  421
            Q+ SLFVEQGAAM T +  +F +PPASM+S DI+S + FI  Y  ++ PL  +  K++  
Sbjct  372  QMASLFVEQGAAMKTTVGNNFKVPPASMSSFDILSVAVFIFLYRRVLDPLASRFRKKDGS  431

Query  422  LP-NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVG  586
                ELQR+GIG+VI+++ ML AG+VE +RL+YA+      + +SSLSIFWQ+PQY L+G
Sbjct  432  RGLTELQRMGIGLVIAVVAMLSAGIVECYRLKYADKACTHCDGSSSLSIFWQVPQYALIG  491

Query  587  VAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGW  766
             +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++VMKI+T+   PGW
Sbjct  492  ASEVFMYVGQLEFFNAQAPDGLKSFGSALCMMSMSMGNFVSSLLVTMVMKISTEDHMPGW  551

Query  767  VPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEET  904
            +P NLN GHLDRF+FL A + ++DLV++V CAK YK I LE  + T
Sbjct  552  IPRNLNKGHLDRFYFLLAVLTSVDLVVYVACAKWYKCIKLEGKDGT  597



>ref|XP_003605102.1| Peptide transporter PTR2 [Medicago truncatula]
Length=1313

 Score =   285 bits (729),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 203/267 (76%), Gaps = 2/267 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF DRA I++     +L  K Q    W   ++TQ E V  +LR+LPIW+CTI +S VF+Q
Sbjct  309  RFFDRAGIVSDEATEMLLGKGQKSYKWNFNSLTQSEAVTYILRVLPIWICTIFSSSVFIQ  368

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG+ M+     F +PP+SMT+ DIIS+STFII  + +I+PLY+K+MKR PKLP
Sbjct  369  LLSLFVEQGSTMDRTFFKFQIPPSSMTAFDIISTSTFIILLDVLIIPLYIKVMKRPPKLP  428

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA-NGEEETSSLSIFWQIPQYVLVGVAEAFI  604
            +ELQ IGIG+ I+IIT+++AG VEQ RL +A N  +E SSLSIFW IPQY+L+G+AEAF+
Sbjct  429  SELQSIGIGLCITIITLIVAGFVEQRRLSFASNDGKEMSSLSIFWLIPQYMLLGIAEAFV  488

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTK-HGKPGWVPPNL  781
            YVAQ  FF SQ PD L+S+G+GLSM SSALG Y+ +  L++V KIT+   G+ GWV PNL
Sbjct  489  YVAQMNFFTSQTPDGLESLGMGLSMFSSALGCYVGNFFLTVVNKITSSGQGQHGWVSPNL  548

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCA  862
            NDGHLDRFFFL+A ++A+DL++++ C+
Sbjct  549  NDGHLDRFFFLTAFLIAIDLIVYIVCS  575



>ref|XP_006464342.1| PREDICTED: nitrate transporter 1.5-like [Citrus sinensis]
 gb|KDO85368.1| hypothetical protein CISIN_1g007201mg [Citrus sinensis]
Length=613

 Score =   275 bits (704),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 206/291 (71%), Gaps = 14/291 (5%)
 Frame = +2

Query  68   RFLDRAAIM---ASSEMTLLPDKSQVP--NPWRVCTVTQVEEVKCVLRLLPIWVCTILAS  232
            +FLD+AA++   + ++     D   +   NPW +CTVTQVEEVKC+LRLLPIW+CTIL S
Sbjct  316  KFLDKAAVITRKSDNDKNNGGDGENIDMRNPWVLCTVTQVEEVKCILRLLPIWLCTILYS  375

Query  233  IVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKR  412
            +VF Q+ SLFVEQGAAM T I+ FH+PPASM+S DI+S + FI  Y  ++ PL  +L ++
Sbjct  376  VVFTQMASLFVEQGAAMKTNISTFHIPPASMSSFDILSVAAFIFIYRRVLDPLVERLTRK  435

Query  413  EPKLP-NELQRIGIGMVISIITMLIAGLVEQHRLRYA-----NGEEETSSLSIFWQIPQY  574
                   ELQR+G+G+VI+I+ M+ AG+VE  RL+Y+     + E + S+LSIFWQIPQY
Sbjct  436  SGTRGFTELQRMGVGLVIAIMAMISAGVVEIFRLKYSIKDCNSCESKASTLSIFWQIPQY  495

Query  575  VLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHG  754
            VL+G +E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+T   
Sbjct  496  VLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKIST---  552

Query  755  KPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            +PGW+P NLN GHLDRF+FL AA+   DL +++ CA+ YK I  E+    D
Sbjct  553  RPGWIPGNLNKGHLDRFYFLLAALTTADLFIYIICARWYKYIKFEERTVGD  603



>ref|XP_006445510.1| hypothetical protein CICLE_v10023644mg [Citrus clementina]
 gb|ESR58750.1| hypothetical protein CICLE_v10023644mg [Citrus clementina]
Length=612

 Score =   275 bits (704),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 206/291 (71%), Gaps = 14/291 (5%)
 Frame = +2

Query  68   RFLDRAAIM---ASSEMTLLPDKSQVP--NPWRVCTVTQVEEVKCVLRLLPIWVCTILAS  232
            +FLD+AA++   + ++     D   +   NPW +CTVTQVEEVKC+LRLLPIW+CTIL S
Sbjct  315  KFLDKAAVITRKSDNDKNNGGDGENIDMRNPWVLCTVTQVEEVKCILRLLPIWLCTILYS  374

Query  233  IVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKR  412
            +VF Q+ SLFVEQGAAM T I+ FH+PPASM+S DI+S + FI  Y  ++ PL  +L ++
Sbjct  375  VVFTQMASLFVEQGAAMKTNISTFHIPPASMSSFDILSVAAFIFIYRRVLDPLVERLTRK  434

Query  413  EPKLP-NELQRIGIGMVISIITMLIAGLVEQHRLRYA-----NGEEETSSLSIFWQIPQY  574
                   ELQR+G+G+VI+I+ M+ AG+VE  RL+Y+     + E + S+LSIFWQIPQY
Sbjct  435  SGTRGFTELQRMGVGLVIAIMAMISAGVVEIFRLKYSIKDCNSCESKASTLSIFWQIPQY  494

Query  575  VLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHG  754
            VL+G +E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+T   
Sbjct  495  VLIGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKIST---  551

Query  755  KPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            +PGW+P NLN GHLDRF+FL AA+   DL +++ CA+ YK I  E+    D
Sbjct  552  RPGWIPGNLNKGHLDRFYFLLAALTTADLFIYIICARWYKYIKFEERTVGD  602



>ref|XP_004497406.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X1 [Cicer arietinum]
 ref|XP_004497407.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X2 [Cicer arietinum]
Length=581

 Score =   275 bits (702),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 203/285 (71%), Gaps = 6/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +F+D+AA +  ++     D++   NPWR+CTVTQVEE KC+LR+LP+W+CTI  SIVF Q
Sbjct  300  KFMDKAATITEND-----DENSRNNPWRLCTVTQVEETKCILRMLPVWLCTITYSIVFTQ  354

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMN++I +F +P ASM++ DI S   F   Y  I++P+ V  +   PK  
Sbjct  355  MASLFVEQGDAMNSRIGEFRLPAASMSAFDICSVLVFTGVYRQILVPV-VGRLSGNPKGL  413

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG++  +++M+ +G+ E  RLR+    +++SS+SIF+QIPQYVLVG +E F+Y
Sbjct  414  TELQRMGIGLIFGMLSMVASGMTEIARLRHIIPGQKSSSMSIFYQIPQYVLVGASEVFMY  473

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++++M+IT +    GW+P NLN 
Sbjct  474  VGQLEFFNGQAPDGLKSFGSSLCMASMSLGNYMSSMLVNVIMRITARGHDKGWIPDNLNT  533

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            GH+DRFFFL A IVA D V+++FCAK YK+I +E  +E  V+ V 
Sbjct  534  GHMDRFFFLLAGIVAFDFVLYLFCAKWYKSISVEGGQEELVDDVN  578



>gb|KFK28750.1| hypothetical protein AALP_AA7G041900 [Arabis alpina]
Length=588

 Score =   275 bits (702),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 200/277 (72%), Gaps = 6/277 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +           +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEVKKVQSGSTYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFVEQGA+M T I +F +P +SM+S DI+S + FI  Y   + PL+ +L K+EP K 
Sbjct  357  MASLFVEQGASMKTNINNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKKEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE-----EETSSLSIFWQIPQYVLVGV  589
              ELQR+GIG+VI+I+ M+ AG+VE +RLR+ + E       +SSLSIFWQ+PQY+++G 
Sbjct  417  LTELQRMGIGLVIAIMAMISAGVVEIYRLRHKDPESSNSVSSSSSLSIFWQVPQYMMIGA  476

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S++++IVMKI+T+   PGW+
Sbjct  477  SEVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVTIVMKISTRDDLPGWI  536

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
            P NLN GHLDRF+FL A + A D V+++ CAK YK I
Sbjct  537  PSNLNKGHLDRFYFLLAGLTAADFVVYLICAKWYKYI  573



>ref|XP_009593649.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 isoform X1 [Nicotiana 
tomentosiformis]
Length=588

 Score =   274 bits (701),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/286 (51%), Positives = 203/286 (71%), Gaps = 12/286 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ S+E      K    NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  305  KFLDKAALITSNE------KQSNRNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  358

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + S+FVEQG AM + I  F +P ASM+S DI+S +  I  Y  ++ P   K+ K + +  
Sbjct  359  MASIFVEQGDAMKSTIGKFRIPAASMSSFDIVSVAVVIFLYRRVLDPFVKKIKKHKGEAV  418

Query  428  N--ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               + QR+GIG+VI+++ ML AG+VE +RL+YA  ++ +SSLSI WQIPQY L+G +E F
Sbjct  419  GITQRQRMGIGLVIAVMAMLSAGIVECYRLKYARKDQGSSSLSILWQIPQYSLIGASEVF  478

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+T     GW+P NL
Sbjct  479  MYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNMSGWIPANL  538

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI----VLEKLEETD  907
            N GHLDRF+FL AA+  LDLV ++ CAK YKAI    ++++L+E D
Sbjct  539  NKGHLDRFYFLLAALTILDLVAYIACAKWYKAIKHGEMIQQLKEED  584



>ref|XP_009378973.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Pyrus 
x bretschneideri]
Length=605

 Score =   275 bits (702),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 204/294 (69%), Gaps = 16/294 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA ++S ++     K  + +PW +C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  307  KFLDRAAYISSRDLDY--RKQGIRSPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I +F +PPASM+S DIIS + FI  Y  II P   ++ K + K  
Sbjct  365  MASLFVEQGAAMKTTIPNFSIPPASMSSFDIISVAVFIFIYRRIIDPFVGRIKKSDAKGL  424

Query  428  NELQRIGIGMV----------ISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQI  565
             ELQR+GIG+V          I+++ ML AG+VE +RL+YA+ E    + +SSLSIFWQI
Sbjct  425  TELQRMGIGLVIAVMAMLSAGIAVMAMLSAGIVECYRLKYADKECPHCDGSSSLSIFWQI  484

Query  566  PQYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITT  745
            PQY  +G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y  + ++S+VMK +T
Sbjct  485  PQYACIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYFSTFLVSVVMKFST  544

Query  746  KHGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            +   PGW+P NLN GHLD F+FL A + ++DL++++ CAK YK I LE   E D
Sbjct  545  EDHMPGWIPGNLNRGHLDWFYFLLAVLTSIDLIVYIACAKWYKNIKLEGRFEVD  598



>ref|XP_007139566.1| hypothetical protein PHAVU_008G040500g [Phaseolus vulgaris]
 gb|ESW11560.1| hypothetical protein PHAVU_008G040500g [Phaseolus vulgaris]
Length=599

 Score =   275 bits (702),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 202/286 (71%), Gaps = 8/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA++ S     + +     +PW + TVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  310  RFLDKAAVITSKNFKEMEESK--CSPWSLSTVTQVEEVKCILRLLPIWLCTILYSVVFAQ  367

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM+T+I+ FH+PPASM++ DI+S + FI  Y  ++ PL  + MK   K  
Sbjct  368  MASLFVEQGDAMDTRISRFHIPPASMSTFDILSVAVFIFIYRRVLDPLVARTMK--SKGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+V++I+ M+ AGLVE  RL++A    N  E +SSLSIFWQ+PQYVLVG +E
Sbjct  426  TELQRMGIGLVLAIMAMVSAGLVEHFRLKHAIEDCNECEGSSSLSIFWQVPQYVLVGASE  485

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+ +   PGW+P 
Sbjct  486  VFMYVGQLEFFNGQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISARDEMPGWIPG  545

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL AA+   DL +++  AK YK +  +   E  + 
Sbjct  546  NLNKGHLDRFYFLLAALTIADLAVYIAMAKWYKYVKFQGNNENHIN  591



>ref|XP_009418231.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Musa acuminata 
subsp. malaccensis]
Length=600

 Score =   275 bits (702),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 201/280 (72%), Gaps = 4/280 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA+    +M +   K+   +PW++CTVTQVEEVKCVL++LPIW+CTI+ S+VF Q
Sbjct  319  RFLDKAAVPTGEDMHVQAIKN---DPWQLCTVTQVEEVKCVLKMLPIWLCTIIYSVVFTQ  375

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + S+FVEQGA MNT +A F +P ASM+  DI+S   FI  Y N+++P+  ++ K EPK  
Sbjct  376  MASIFVEQGATMNTNVAAFRIPAASMSVFDILSVIIFIFIYRNLLVPVMARISK-EPKGI  434

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+G+G+VI ++ M++AG+VE  RL+     +E SSLSIFWQIPQY L+G +E F+Y
Sbjct  435  SELQRMGVGLVIGMLAMIVAGVVEVERLKRVVVPDEPSSLSIFWQIPQYALIGASEVFMY  494

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  ++++IV  +T+K   PGW+P NLN 
Sbjct  495  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMLVNIVTSVTSKKNSPGWIPRNLNS  554

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GHLDRFFFL AA+  +D + ++ CAK Y+ I L+  +  +
Sbjct  555  GHLDRFFFLLAALTLIDFMAYLVCAKWYRCIKLDNDDRQE  594



>ref|XP_009792818.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   274 bits (701),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 142/286 (50%), Positives = 203/286 (71%), Gaps = 8/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ S E+    +K    NPWR+C ++QVEEVKC+LRL+PIW+CTI+ S+VF Q
Sbjct  308  KFLDKAALITSKELG--NEKQSNRNPWRLCPISQVEEVKCILRLMPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + S+FVEQG AM T I  F +P ASM+S DI+S +  I  Y  ++ P   K+ K + +  
Sbjct  366  MASIFVEQGDAMKTTIGKFRIPAASMSSFDIMSVAVVIFLYRRVLDPFVKKIKKHKGEAL  425

Query  428  N--ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               +LQR+GIG++I+++ ML AG+VE +RL+YA+ ++ +SSL+I WQIPQY LVG +E F
Sbjct  426  GITQLQRMGIGLIIAVMAMLSAGIVECYRLKYASKDQGSSSLTILWQIPQYSLVGASEVF  485

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD LKS G  L M+S +LG+Y+ ++++S+VMKI+T     GW+P NL
Sbjct  486  MYVGQLEFFNEQAPDGLKSFGSALCMTSISLGNYVSNLLVSVVMKISTTDNMSGWIPGNL  545

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI----VLEKLEETD  907
            N GHLDRF+FL A +  LDLV ++ CAK YK I    + ++L+E D
Sbjct  546  NKGHLDRFYFLLAGLTILDLVAYIACAKWYKGIKHGEITQQLKEED  591



>ref|XP_008338492.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Malus domestica]
Length=621

 Score =   275 bits (702),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 199/284 (70%), Gaps = 7/284 (2%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +   + T   D++   NPWR+CTVTQVEE KCVL++LP+W+CTI+ S+VF Q+
Sbjct  306  FLDKAATITEKDQT--ADET---NPWRLCTVTQVEEAKCVLKMLPVWLCTIIYSVVFTQM  360

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQG  M + I  FH+P ASM+  DI S       Y N ++PL  +L    PK  +
Sbjct  361  ASLFVEQGDVMESHIGKFHLPAASMSVFDICSVFICTGLYRNFLVPLAGRL-SGNPKGLS  419

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYV  610
            ELQR+G+G++I ++ M+ AG  E  RLR     E+ SSLSIFWQIPQYVLVG +E F+YV
Sbjct  420  ELQRMGVGLIIGLLAMVAAGATEIARLRGVTPGEKVSSLSIFWQIPQYVLVGTSEVFMYV  479

Query  611  AQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDG  790
             Q EFF  Q PD +KS G  L M+S +LG+Y+ S++++IV  IT + G PGW+P NLN+G
Sbjct  480  GQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNIVTHITARGGDPGWIPNNLNEG  539

Query  791  HLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            HLDRF+FL A + ALD V+++FCAK YK I L+  E+ ++E++E
Sbjct  540  HLDRFYFLIAILTALDFVVYLFCAKWYKGINLQSSEQ-EIEIME  582



>ref|XP_010265895.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
 ref|XP_010265896.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
 ref|XP_010265897.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
 ref|XP_010265898.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Nelumbo nucifera]
Length=612

 Score =   273 bits (699),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/285 (51%), Positives = 194/285 (68%), Gaps = 8/285 (3%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA M  S++    D      PWR+CTVTQVEE KCVL++LPIW+CTI+ S+VF Q+
Sbjct  326  FLDKAATMTESDLHGPMD------PWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQM  379

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQGA MN+   +FH+P ASM++ DI S   F   Y  I++P+  +L    PK  +
Sbjct  380  ASLFVEQGAVMNSDAGNFHLPAASMSAFDICSVLVFTGIYRQILVPVVGRLTGN-PKGLS  438

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYV  610
            ELQR+G+G+VI ++ M+ AG+ E  RL       E SSLSIFWQIPQY LVG +E F+YV
Sbjct  439  ELQRMGVGLVIGMLAMVAAGITELQRLEKVTPGNEISSLSIFWQIPQYTLVGASEVFMYV  498

Query  611  AQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDG  790
             Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM IT K+ KPGW+P +LN G
Sbjct  499  GQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVHMVMGITAKNNKPGWIPGDLNSG  558

Query  791  HLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVEG  925
            H+DRF+FL A + A+D  +++FCAK YK I LE       E+ EG
Sbjct  559  HMDRFYFLLAGLTAIDFGVYLFCAKWYKCINLE-CHAQGTEMAEG  602



>ref|XP_009364152.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Pyrus x bretschneideri]
 ref|XP_009349426.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Pyrus x bretschneideri]
Length=621

 Score =   273 bits (699),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 199/284 (70%), Gaps = 7/284 (2%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +   + T   D++   NPWR+CTVTQVEE KCVL++LP+W+CTI+ S+VF Q+
Sbjct  306  FLDKAATITEKDQT--ADET---NPWRLCTVTQVEEAKCVLKMLPVWLCTIIYSVVFTQM  360

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQG  M + I  FH+P ASM+  DI S       Y N ++PL  +L    PK  +
Sbjct  361  ASLFVEQGDVMESHIGKFHLPAASMSVFDICSVFICTGLYRNFLVPLAGRL-SGNPKGLS  419

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYV  610
            ELQR+G+G++I ++ M+ AG  E  RLR     E+ SSLSIFWQIPQYVLVG +E F+YV
Sbjct  420  ELQRMGVGLIIGLLAMVAAGATEIARLRGVTPGEKVSSLSIFWQIPQYVLVGSSEVFMYV  479

Query  611  AQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDG  790
             Q EFF  Q PD +KS G  L M+S +LG+Y+ S++++IV  IT + G PGW+P NLN+G
Sbjct  480  GQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNIVTHITARGGDPGWIPNNLNEG  539

Query  791  HLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            HLDRF+FL A + ALD V+++FCAK YK I L+  E+ ++E++E
Sbjct  540  HLDRFYFLIAILTALDFVVYLFCAKWYKGINLQGSEQ-EIEIME  582



>ref|XP_002299155.2| hypothetical protein POPTR_0001s05090g [Populus trichocarpa]
 gb|EEE83960.2| hypothetical protein POPTR_0001s05090g [Populus trichocarpa]
Length=469

 Score =   269 bits (687),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 189/274 (69%), Gaps = 7/274 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA M   ++      S   NPWR+CT+TQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  156  EFLDKAATMTEDDL------SHQKNPWRLCTITQVEEAKCVLKMLPIWLCTIIYSVVFTQ  209

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++PL  +L    PK  
Sbjct  210  MASLFVEQGDVMNSYIGKFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL-SGNPKGL  268

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG+VI ++ ML AG  E  RL+      + SSLSIFWQIPQYVLVG +E F+Y
Sbjct  269  TELQRMGIGLVIGMLAMLAAGATEIERLKNVIEGHKVSSLSIFWQIPQYVLVGASEVFMY  328

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            + Q EFF  Q PD +KS G  L M+S +LG+Y  S+++++VMKITTK  KPGW+P +LN 
Sbjct  329  IGQLEFFNGQAPDGIKSFGSSLCMASISLGNYASSMLVNMVMKITTKGDKPGWIPDDLNT  388

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            GH+DRF+FL A + A D V+++FCAK YK I ++
Sbjct  389  GHMDRFYFLIAVLTAFDFVIYLFCAKWYKPINID  422



>gb|EYU40300.1| hypothetical protein MIMGU_mgv1a025093mg [Erythranthe guttata]
Length=592

 Score =   272 bits (696),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 194/276 (70%), Gaps = 3/276 (1%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLDRAA++   + T+    S   NPWR+C+V+QVEEVKC+LRLLPIW+CTIL S+VF Q+
Sbjct  304  FLDRAAVVTHKDHTVEVKTSAAHNPWRLCSVSQVEEVKCILRLLPIWLCTILYSVVFTQM  363

Query  251  FSLFVEQGAAMNTKIA-DFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
             SLFVEQGAAM T  A  FH+PPASM+S DI+S +TFI     +I P  V  M++    P
Sbjct  364  TSLFVEQGAAMKTTTAGGFHIPPASMSSFDILSVATFIFLSRRVIFPA-VARMRKSGLAP  422

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRY-ANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
             EL+R+G G+VI+   M+ AG+VE  RLR   +  +    +SIFWQ+PQYVL+G +E F+
Sbjct  423  TELERMGAGLVIAAAAMISAGVVEHFRLRSVDSSGDGGGGMSIFWQVPQYVLIGASEVFM  482

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF  Q PD LKS G  LSM+S +LG+Y+ S+I++IVMK++     PGW+P NLN
Sbjct  483  YVGQLEFFNGQAPDGLKSFGSALSMTSISLGNYVSSLIVTIVMKVSASDEMPGWIPRNLN  542

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
            DGHLDRF++L AA+ A D  ++V CA+ YK    E+
Sbjct  543  DGHLDRFYYLLAALTAADFGVYVLCARWYKYTRFEE  578



>ref|XP_008788684.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Phoenix dactylifera]
Length=619

 Score =   272 bits (696),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA +   +  +L D+S   NPWR CT+ QVEEVKC+LRL+PIW+ TIL S+VF Q
Sbjct  333  KFLDRAAFIEFDDKVMLQDRSIPRNPWRFCTINQVEEVKCILRLIPIWLTTILYSVVFTQ  392

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM+T IA F +PPASM++ DI+S + FI+ Y  ++ PL  KL+K +PK  
Sbjct  393  MASLFVEQGDAMSTTIAGFEIPPASMSAFDILSVAVFILFYRRLLTPLVSKLVK-DPKGL  451

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRY-ANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
             +LQR+GIG++I+I+ M+ AG VE  RL++   G ++ SSLSI WQIPQY+L+G +E F+
Sbjct  452  TQLQRMGIGLIIAIMAMIAAGTVEVFRLKHVCEGCKDESSLSILWQIPQYMLIGASEVFM  511

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF  QVPD LKS G  L M+S +LG+Y+ S++++IVMKIT +  +PGW+P NLN
Sbjct  512  YVGQLEFFNDQVPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKITVEDNRPGWIPGNLN  571

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             GH+DRF+FL AA+ + D V+++ CA+ Y  I LE
Sbjct  572  KGHMDRFYFLLAALTSADFVVYLACARWYSCIKLE  606



>gb|KHN13615.1| Nitrate transporter 1.5 [Glycine soja]
Length=855

 Score =   277 bits (709),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 206/286 (72%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA + S ++  L +  +  NPW + TVTQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  567  RFLDKAAFITSKDLEQLEENKR--NPWCLSTVTQVEEVKCILRLLPIWLCTIMYSVVFAQ  624

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QG AM T I+ F +PPASM+S DI+  + FI  Y + + P   K+MK +    
Sbjct  625  MASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIYRHALDPFVAKVMKSK---L  681

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+V++I+ M+ AGLVE+ RL+YA    N  + +SSLSIFWQ+PQYVL G +E
Sbjct  682  TELQRMGIGLVLAIMAMVSAGLVEKFRLKYAIKDCNQCDGSSSLSIFWQVPQYVLTGASE  741

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+TK   PGW+P 
Sbjct  742  VFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKGDIPGWIPG  801

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL AA+   DLV++V  AK YK+I  E+  E D++
Sbjct  802  NLNLGHLDRFYFLLAALTTADLVVYVALAKWYKSIQFEENAEEDIK  847



>ref|XP_004244546.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Solanum lycopersicum]
Length=600

 Score =   271 bits (694),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 203/289 (70%), Gaps = 9/289 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++ S E  L   K    NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  309  KFLDRAAVVTSKE--LESQKQGDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPL--YVKLMKREPK  421
            + SLFVEQG AM T IA+F +P ASM++ DI+S +  I     ++ PL    K  K +  
Sbjct  367  MASLFVEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVKRFKKCKDDDA  426

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               ELQR+GIG+VI+++ ML +G+VE +RL+YA+ +    E +SSL+IFWQ+PQY  +G 
Sbjct  427  GLTELQRMGIGLVIAVMAMLSSGIVECYRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGA  486

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YVAQ EFF +Q PD LKS G  L M+S +LG+Y+ S ++SIVMKI+     PGW+
Sbjct  487  SEVFMYVAQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWI  546

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETDVE  913
            P NLN GHLDRF+FL A +  +DLV ++ CAK YK I   EK++E + E
Sbjct  547  PGNLNKGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEKIQEHEEE  595



>ref|XP_010097732.1| Nitrate transporter 1.5 [Morus notabilis]
 gb|EXB70687.1| Nitrate transporter 1.5 [Morus notabilis]
Length=618

 Score =   272 bits (695),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 204/289 (71%), Gaps = 15/289 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++   E+    DK+   NPWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  322  KFLDRAAVITEKEL----DKTG-KNPWRLCTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  376

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T ++ FH+PPASM+S DI+S + FI  Y  ++ PL  ++ K  P+  
Sbjct  377  MASLFVEQGAAMKTTVSGFHIPPASMSSFDILSVAAFIFLYRRVLDPLVARVTK-NPRGL  435

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRY---------ANGEEETSSLSIFWQIPQYVL  580
             ELQR+G+G+VI+I+ M+ AG+VE  RL+Y          +  +  SSLSIFWQ+PQYVL
Sbjct  436  TELQRMGMGLVIAIMAMVSAGVVECFRLKYKVVVVEEGVGDHHKSPSSLSIFWQVPQYVL  495

Query  581  VGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKP  760
            +G +E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+T+   P
Sbjct  496  IGASEVFMYVGQLEFFNGQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKISTRDDMP  555

Query  761  GWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GW+P NLN GHL+RF+FL AA+ A DL ++  CAK YK    E     D
Sbjct  556  GWIPGNLNKGHLERFYFLLAALTAADLAVYFLCAKWYKYTKFEGRNVQD  604



>ref|XP_010943514.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X3 [Elaeis guineensis]
Length=589

 Score =   271 bits (692),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 203/291 (70%), Gaps = 4/291 (1%)
 Frame = +2

Query  50   CFMPTNRFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILA  229
            C     RFLD+AA + + +  +   +++  NPW++CTVTQVEEVKCVL++LPIW+CTI+ 
Sbjct  302  CHSNEFRFLDKAATLTADDYCM---QAKTKNPWKLCTVTQVEEVKCVLKMLPIWLCTIIY  358

Query  230  SIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMK  409
            S+VF Q+ SLFVEQGA+MNT I  FH+PPASM+  DI+S   FI+ Y  +++P+  +L  
Sbjct  359  SVVFTQMASLFVEQGASMNTNIGTFHIPPASMSVFDILSVLFFIVIYRRVLIPVMSRL-S  417

Query  410  REPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGV  589
            + PK   ELQR+G+G+VI ++ M+ AG+VE  RL+     +E SSLSI  QIPQY  +G 
Sbjct  418  QNPKGLTELQRMGVGLVIGMLAMVAAGVVEVERLKRVEVPDEPSSLSILCQIPQYAFIGA  477

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF  Q PD +KS G  L M+S +LG+Y+  +I++IV  +T++   PGW+
Sbjct  478  SEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMIVNIVTAVTSRDKNPGWI  537

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            P NLN GHL+RF+FL A +  +D ++++ CA+ YK I LE  +E +  +V+
Sbjct  538  PGNLNRGHLERFYFLLATLTVVDFIVYLVCARWYKCIKLETNDEEEEMIVK  588



>ref|XP_011037917.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Populus euphratica]
 ref|XP_011037918.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Populus euphratica]
Length=606

 Score =   271 bits (692),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/285 (51%), Positives = 193/285 (68%), Gaps = 7/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA M   ++      S   NPWR+CT+TQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  322  EFLDKAATMTEDDL------SHQKNPWRLCTITQVEEAKCVLKMLPIWLCTIIYSVVFTQ  375

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++PL  +L    PK  
Sbjct  376  MASLFVEQGDVMNSYIGKFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL-SGNPKGL  434

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG+VI ++ ML AG  E  RL+      + SSLSIFWQIPQYVLVG +E F+Y
Sbjct  435  TELQRMGIGLVIGMLAMLAAGATEIERLKNVIEGHKVSSLSIFWQIPQYVLVGASEVFMY  494

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            + Q EFF  Q PD +KS G  L M+S +LG+Y  S+++++VMKITTK  KPGW+P +LN 
Sbjct  495  IGQLEFFNGQAPDGIKSFGSSLCMASISLGNYASSMLVNMVMKITTKGDKPGWIPDDLNT  554

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            GH+DRF+FL A + A D V+++FCAK Y  I ++  +  ++E  E
Sbjct  555  GHMDRFYFLIAVLTAFDFVIYLFCAKWYTPINIDDSQGIEMEKQE  599



>ref|XP_010943513.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X2 [Elaeis guineensis]
Length=601

 Score =   271 bits (692),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 203/291 (70%), Gaps = 4/291 (1%)
 Frame = +2

Query  50   CFMPTNRFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILA  229
            C     RFLD+AA + + +  +   +++  NPW++CTVTQVEEVKCVL++LPIW+CTI+ 
Sbjct  314  CHSNEFRFLDKAATLTADDYCM---QAKTKNPWKLCTVTQVEEVKCVLKMLPIWLCTIIY  370

Query  230  SIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMK  409
            S+VF Q+ SLFVEQGA+MNT I  FH+PPASM+  DI+S   FI+ Y  +++P+  +L  
Sbjct  371  SVVFTQMASLFVEQGASMNTNIGTFHIPPASMSVFDILSVLFFIVIYRRVLIPVMSRL-S  429

Query  410  REPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGV  589
            + PK   ELQR+G+G+VI ++ M+ AG+VE  RL+     +E SSLSI  QIPQY  +G 
Sbjct  430  QNPKGLTELQRMGVGLVIGMLAMVAAGVVEVERLKRVEVPDEPSSLSILCQIPQYAFIGA  489

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF  Q PD +KS G  L M+S +LG+Y+  +I++IV  +T++   PGW+
Sbjct  490  SEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMIVNIVTAVTSRDKNPGWI  549

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            P NLN GHL+RF+FL A +  +D ++++ CA+ YK I LE  +E +  +V+
Sbjct  550  PGNLNRGHLERFYFLLATLTVVDFIVYLVCARWYKCIKLETNDEEEEMIVK  600



>ref|XP_010943512.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X1 [Elaeis guineensis]
Length=604

 Score =   271 bits (692),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 203/291 (70%), Gaps = 4/291 (1%)
 Frame = +2

Query  50   CFMPTNRFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILA  229
            C     RFLD+AA + + +  +   +++  NPW++CTVTQVEEVKCVL++LPIW+CTI+ 
Sbjct  317  CHSNEFRFLDKAATLTADDYCM---QAKTKNPWKLCTVTQVEEVKCVLKMLPIWLCTIIY  373

Query  230  SIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMK  409
            S+VF Q+ SLFVEQGA+MNT I  FH+PPASM+  DI+S   FI+ Y  +++P+  +L  
Sbjct  374  SVVFTQMASLFVEQGASMNTNIGTFHIPPASMSVFDILSVLFFIVIYRRVLIPVMSRL-S  432

Query  410  REPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGV  589
            + PK   ELQR+G+G+VI ++ M+ AG+VE  RL+     +E SSLSI  QIPQY  +G 
Sbjct  433  QNPKGLTELQRMGVGLVIGMLAMVAAGVVEVERLKRVEVPDEPSSLSILCQIPQYAFIGA  492

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF  Q PD +KS G  L M+S +LG+Y+  +I++IV  +T++   PGW+
Sbjct  493  SEVFMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSIMIVNIVTAVTSRDKNPGWI  552

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            P NLN GHL+RF+FL A +  +D ++++ CA+ YK I LE  +E +  +V+
Sbjct  553  PGNLNRGHLERFYFLLATLTVVDFIVYLVCARWYKCIKLETNDEEEEMIVK  603



>ref|XP_009595682.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana tomentosiformis]
Length=599

 Score =   270 bits (691),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 204/288 (71%), Gaps = 11/288 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVP-NPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
            +FLDRAA++ S E   L D+ Q   NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF 
Sbjct  308  KFLDRAAVVTSRE---LDDQKQSDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFT  364

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQG AM T IA+F +P ASM++ DI+S +  I     ++ PL  +  K +   
Sbjct  365  QMASLFVEQGDAMQTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVSRFKKCKGDH  424

Query  425  PN--ELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVG  586
                ELQR+GIG+VI+++ ML AG+VE +RL+YA+ +    E +SSL+IFWQ+PQY  +G
Sbjct  425  TGLTELQRMGIGLVIAVMAMLSAGIVECYRLKYASNDCKNCEGSSSLNIFWQVPQYAFIG  484

Query  587  VAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGW  766
             +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+     PGW
Sbjct  485  ASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISATDNMPGW  544

Query  767  VPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETD  907
            +P NLN GHLDRF+FL A +  +DLV ++ CAK YK I   EK++E +
Sbjct  545  IPGNLNKGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEKIQEHE  592



>ref|XP_004245877.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3 [Solanum lycopersicum]
Length=591

 Score =   270 bits (691),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 197/277 (71%), Gaps = 10/277 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAA++ S E     D  +  N W +C V+QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  301  RFLDRAALITSKEQ----DHEKNRNQWLLCPVSQVEEVKCILRLLPIWLCTIVYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPL--YVKLMKREPK  421
            + S+FVEQG AM T I +F +P ASM++ DI+S + FI  Y  ++ P+   +K +K E +
Sbjct  357  MASIFVEQGDAMKTSIGNFRIPAASMSTFDIMSVAVFIFLYRRVLDPIVKNIKKIKGEGQ  416

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               +LQR+GIG+VI+++ ML A +VE +RL+YA  E    E +SSLSIFWQ+PQY L+G 
Sbjct  417  GITQLQRMGIGLVIAVMAMLSAAIVECYRLKYAKKECRHCEGSSSLSIFWQVPQYSLIGA  476

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF  Q P+ LKS G  L M+S +LG+Y+ S+++S+VMKI+T     GW+
Sbjct  477  SEVFMYVGQLEFFNEQAPEGLKSFGSALCMTSISLGNYVSSLLVSVVMKISTTDNMSGWI  536

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
            P NLN+GHLDRF+FL A +  LDLV F+ CAK YK I
Sbjct  537  PGNLNEGHLDRFYFLLAGLTILDLVAFIACAKWYKGI  573



>ref|XP_006847685.1| hypothetical protein AMTR_s00149p00049280 [Amborella trichopoda]
 gb|ERN09266.1| hypothetical protein AMTR_s00149p00049280 [Amborella trichopoda]
Length=607

 Score =   270 bits (691),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/285 (53%), Positives = 204/285 (72%), Gaps = 6/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA +   + T   D+S   +PW +CTVTQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  323  KFLDKAATVTKKDFT--EDRS-TRDPWFLCTVTQVEEVKCILRLLPIWLCTIIYSVVFTQ  379

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T I  FH+PPASM+  DI+S + FI+ Y   ++P   K++K    + 
Sbjct  380  MASLFVEQGAAMKTDIIGFHIPPASMSMFDILSVAAFILFYRRFLIPCLHKIIKNSKGI-  438

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G++I+II M+ AG VE  RL+YA   ++ SSLSI WQIPQYVL+G +E F+Y
Sbjct  439  TELQRMGVGLIIAIIAMISAGTVEVMRLKYATEVDKPSSLSILWQIPQYVLIGASEVFMY  498

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD LKS G  L M+S + G+Y+ S+++SIVM IT K  + GW+P NLN 
Sbjct  499  VGQLEFFNGQTPDGLKSFGSALCMTSISFGNYVSSLLVSIVMDITRKDHEAGWIPGNLNK  558

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE--KLEETDVEL  916
            GH+DRF+FL A + A+D V++V CAK Y+ I LE    +E D+E+
Sbjct  559  GHMDRFYFLLAILTAVDFVLYVICAKGYRPISLEIRDEDEEDIEM  603



>gb|KHN11611.1| Nitrate transporter 1.5 [Glycine soja]
Length=604

 Score =   270 bits (690),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 205/286 (72%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            R+LD+AA + S ++  L +  +  NPW + TVTQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  316  RYLDKAAFITSKDLEQLEENKR--NPWCLSTVTQVEEVKCILRLLPIWLCTIMYSVVFAQ  373

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QG AM T I+ F +PPASM+S DI+  + FI  Y + + P   K+MK +    
Sbjct  374  MASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIYRHALDPFVAKVMKSK---L  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+V++I+ M+ AGLVE+ RL++A    +  + +SSLSIFWQ+PQYVL G +E
Sbjct  431  TELQRMGIGLVLAIMAMVSAGLVEKFRLKFAIKDCSNCDGSSSLSIFWQVPQYVLTGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+TK   PGW+P 
Sbjct  491  VFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKGDIPGWIPG  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL AA+  +DLV++V  AK YK I  E   + D++
Sbjct  551  NLNLGHLDRFYFLLAALTTVDLVVYVALAKWYKYINFEGNNQEDIK  596



>ref|XP_006587754.1| PREDICTED: nitrate transporter 1.5-like [Glycine max]
Length=597

 Score =   270 bits (689),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 205/286 (72%), Gaps = 9/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            R+LD+AA + S ++  L +  +  NPW + TVTQVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  309  RYLDKAAFITSKDLEQLEENKR--NPWCLSTVTQVEEVKCILRLLPIWLCTIMYSVVFAQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QG AM T I+ F +PPASM+S DI+  + FI  Y + + P   K+MK +    
Sbjct  367  MASLFVVQGDAMATGISSFKIPPASMSSFDILGVAFFIFIYRHALDPFVAKVMKSK---L  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+V++I+ M+ AGLVE+ RL++A    +  + +SSLSIFWQ+PQYVL G +E
Sbjct  424  TELQRMGIGLVLAIMAMVSAGLVEKFRLKFAIKDCSNCDGSSSLSIFWQVPQYVLTGASE  483

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+TK   PGW+P 
Sbjct  484  VFMYVPQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKGDIPGWIPG  543

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLDRF+FL AA+  +DLV++V  AK YK I  E   + D++
Sbjct  544  NLNLGHLDRFYFLLAALTTVDLVVYVALAKWYKYINFEGNNQEDIK  589



>ref|XP_007014834.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY32453.1| Major facilitator superfamily protein [Theobroma cacao]
Length=654

 Score =   271 bits (693),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 203/288 (70%), Gaps = 14/288 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +  +++   P+     NPWR+CTVTQVEE KCVL+LLPIW+CTI+ S++F Q
Sbjct  369  RFLDKAATVTQNDL-WGPN-----NPWRLCTVTQVEEAKCVLKLLPIWLCTIIYSVIFTQ  422

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  M  K  +FH+P ASM++ DI S    +IC   Y +I++PL  KL    P
Sbjct  423  MASLFVEQGDVMTAKFGNFHLPAASMSAFDICS---VLICTGIYRHILVPLAGKL-SGNP  478

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K  +ELQR+GIG++I ++ M+ AG+ E  RL++    E+ SSL+IFWQIPQYVLVG +E 
Sbjct  479  KGLSELQRMGIGLIIGMLAMIAAGVTEIQRLKFVTPGEKRSSLNIFWQIPQYVLVGSSEV  538

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+Y+ Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +   PGW+P +
Sbjct  539  FMYIGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNMVMGITARGDSPGWIPAD  598

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            LN GH+DRF+FL A + A+D V++VFCAK YK I L+   E  ++L E
Sbjct  599  LNAGHMDRFYFLIAGLTAIDFVIYVFCAKWYKCINLDA-SEKGIQLEE  645



>ref|XP_009761241.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana sylvestris]
Length=595

 Score =   269 bits (687),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 201/287 (70%), Gaps = 9/287 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++ S E+     K    NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  306  KFLDRAAVVTSRELD--DQKLSDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  363

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPL--YVKLMKREPK  421
            + SLFVEQG AM T IA+F +P ASM++ DI+S +  I     ++ PL    K  K +  
Sbjct  364  MASLFVEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVSRFKKCKGDNT  423

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               ELQR+GIG+VI+++ ML AG+VE +RL+YA+ +    E +SSL+IFWQ+PQY  +G 
Sbjct  424  GLTELQRMGIGLVIAVMAMLSAGIVECYRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGA  483

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S ++SIVMKI+     PGW+
Sbjct  484  SEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWI  543

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETD  907
            P NLN GHLDRF+FL A +  +DLV ++ CAK YK I   EK++E +
Sbjct  544  PGNLNKGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEKIQEHE  590



>ref|XP_006589795.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X3 [Glycine max]
 gb|KHN37268.1| Putative peptide/nitrate transporter [Glycine soja]
Length=595

 Score =   268 bits (686),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/281 (51%), Positives = 193/281 (69%), Gaps = 7/281 (2%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            F+D+AA +  +E      +    NPWR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q+
Sbjct  312  FMDKAATIKETE------EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQM  365

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++PL  +L    PK  +
Sbjct  366  ASLFVEQGDVMNSYIGSFHLPAASMSAFDIFSVLVCTGIYRQILVPLAGRL-SGNPKGLS  424

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYV  610
            ELQR+GIG++I ++ M+ +G  E  RLR  +  ++TSSLSIFWQIPQYVLVG +E F+YV
Sbjct  425  ELQRMGIGLIIGMLAMVASGATEIARLRRISHGQKTSSLSIFWQIPQYVLVGASEVFMYV  484

Query  611  AQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDG  790
             Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +    GW+P NLN G
Sbjct  485  GQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENLNTG  544

Query  791  HLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            H+DRFFFL A + A D V+++FCAK YK I +E  +  D E
Sbjct  545  HMDRFFFLLAGLAAFDFVLYLFCAKWYKNINIEDSDMGDQE  585



>ref|XP_006283396.1| hypothetical protein CARUB_v10004438mg [Capsella rubella]
 gb|EOA16294.1| hypothetical protein CARUB_v10004438mg [Capsella rubella]
Length=586

 Score =   268 bits (685),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 199/279 (71%), Gaps = 7/279 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I +F +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEE----ETSSLSIFWQIPQYVLVGVA  592
              ELQR+GIG+VI+I+ M+ AG+VE +RL+  N E+     +SSLSIFWQ+PQY+L+G +
Sbjct  417  LTELQRMGIGLVIAIMAMISAGIVEIYRLK--NKEQGSSSGSSSLSIFWQVPQYMLIGAS  474

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T    PGW+P
Sbjct  475  EVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDKFPGWIP  534

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             NLN GHL+RF+FL A + A D V+++ CAK YK I  E
Sbjct  535  ENLNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  573



>ref|XP_006589794.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X2 [Glycine max]
 ref|XP_003535794.2| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X1 [Glycine max]
Length=602

 Score =   268 bits (686),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/281 (51%), Positives = 193/281 (69%), Gaps = 7/281 (2%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            F+D+AA +  +E      +    NPWR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q+
Sbjct  319  FMDKAATIKETE------EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQM  372

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++PL  +L    PK  +
Sbjct  373  ASLFVEQGDVMNSYIGSFHLPAASMSAFDIFSVLVCTGIYRQILVPLAGRL-SGNPKGLS  431

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYV  610
            ELQR+GIG++I ++ M+ +G  E  RLR  +  ++TSSLSIFWQIPQYVLVG +E F+YV
Sbjct  432  ELQRMGIGLIIGMLAMVASGATEIARLRRISHGQKTSSLSIFWQIPQYVLVGASEVFMYV  491

Query  611  AQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDG  790
             Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +    GW+P NLN G
Sbjct  492  GQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENLNTG  551

Query  791  HLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            H+DRFFFL A + A D V+++FCAK YK I +E  +  D E
Sbjct  552  HMDRFFFLLAGLAAFDFVLYLFCAKWYKNINIEDSDMGDQE  592



>gb|KHN27133.1| Putative peptide/nitrate transporter [Glycine soja]
Length=596

 Score =   268 bits (685),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 193/280 (69%), Gaps = 7/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             F+D+AA +  +E      +    NPWR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q
Sbjct  311  EFMDKAATIKETE------EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++PL  +L    PK  
Sbjct  365  MASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL-SGNPKGL  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG++I ++ M+ +G  E  RLR  +  ++TSSLSIFWQIPQYVLVG +E F+Y
Sbjct  424  SELQRMGIGLIIGMLAMVASGATEIARLRRISHGQKTSSLSIFWQIPQYVLVGASEVFMY  483

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +    GW+P NLN 
Sbjct  484  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENLNT  543

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GH+DRFFFL A + A D V+++FCAK YK+I +E  +  D
Sbjct  544  GHMDRFFFLLAGLAAFDFVLYLFCAKWYKSINIEDSDMGD  583



>gb|KHN24967.1| Putative peptide/nitrate transporter [Glycine soja]
Length=593

 Score =   268 bits (685),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 193/285 (68%), Gaps = 10/285 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA +         D   + N WR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q
Sbjct  311  RFMDKAATITE------KDAVHLKNHWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN +I  FH+P ASM+  DI S       Y  I++PL  +L    P+  
Sbjct  365  MASLFVEQGNVMNNEIGKFHLPAASMSVFDICSVLLCTGIYRQILVPLAGRL-SGNPRGL  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI ++ ML AG+ E  RL++    E+ SSLSIFWQIPQYVLVG +E F+Y
Sbjct  424  TELQRMGVGLVIGMLAMLAAGVTEFERLKHVTPREKASSLSIFWQIPQYVLVGASEVFMY  483

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM+IT +   PGW+P NLN 
Sbjct  484  VGQLEFFNGQAPDGIKSFGSSLCMASMSLGNYVSSMLVYMVMRITARGENPGWIPNNLNV  543

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            GH+DRFFFL A + ALD V+++ CA+ YK+I    L + D+E  E
Sbjct  544  GHMDRFFFLVAVLNALDFVLYLLCARWYKSI---NLGDGDMESQE  585



>ref|XP_009384121.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Musa acuminata 
subsp. malaccensis]
Length=594

 Score =   268 bits (685),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/278 (52%), Positives = 190/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLDRAA++ S + T    +S     WR+CT+TQVEEVKCVLRLLPIW+CTIL S+VF Q+
Sbjct  311  FLDRAAVVDSDDFTF-QAQSTHRKLWRLCTITQVEEVKCVLRLLPIWLCTILYSVVFTQM  369

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFV QGAAM   +    +PP+ M++ DI+S   FI  Y+ ++ PL  ++ K    L  
Sbjct  370  ASLFVVQGAAMRRTVGGVTIPPSIMSAFDILSVVAFIFFYKRLLQPLVCRVRKNTTGL-T  428

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLR-YANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            ELQR+GIG++I+ + M+ AG+VE  RL+    G  + SSL I WQ+PQYVLVG +E F+Y
Sbjct  429  ELQRMGIGLIIAALAMVSAGVVEHFRLKLRCRGCTDASSLHIMWQVPQYVLVGASEVFMY  488

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V+Q +FF  Q PD LKS G  L M+S A G++    I++IVMKIT K G+PGW+P NLND
Sbjct  489  VSQLQFFNGQTPDGLKSFGSALYMTSIAFGNFFSDFIVTIVMKITGKGGRPGWIPANLND  548

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRF+FL AA+   DLV +V CA  YK I +E   E
Sbjct  549  GHLDRFYFLLAALSCADLVAYVVCAMSYKCIKMEGRRE  586



>ref|XP_006606590.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X2 [Glycine max]
Length=596

 Score =   268 bits (684),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 193/280 (69%), Gaps = 7/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             F+D+AA +  +E      +    NPWR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q
Sbjct  311  EFMDKAATIKETE------EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQ  364

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++PL  +L    PK  
Sbjct  365  MASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL-SGNPKGL  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG++I ++ M+ +G  E  RLR  +  ++TSSLSIFWQIPQYVLVG +E F+Y
Sbjct  424  SELQRMGIGLIIGMLAMVASGATEIARLRRISHGQKTSSLSIFWQIPQYVLVGASEVFMY  483

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +    GW+P NLN 
Sbjct  484  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQSKGWIPENLNT  543

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GH+DRFFFL A + A D V+++FCAK YK+I +E  +  D
Sbjct  544  GHMDRFFFLLAGLAAFDFVLYLFCAKWYKSINIEDSDMGD  583



>ref|XP_008352702.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Malus domestica]
Length=621

 Score =   268 bits (686),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 199/287 (69%), Gaps = 13/287 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +   + T     +   NPWR+CTVTQVEE KCVL++LP+W+CTI+ S+VF Q+
Sbjct  306  FLDKAATITEKDQT-----AAEKNPWRLCTVTQVEEAKCVLKMLPVWLCTIIYSVVFTQM  360

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREPK  421
             SLFVEQG  M + I  FH+P ASM++ DI S    +IC   Y   ++PL  +L    PK
Sbjct  361  ASLFVEQGDVMESHIGKFHLPAASMSAFDICS---VLICTGLYRQCLVPLAGRL-SGNPK  416

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
              +ELQR+G+G++I ++ M+ AG  E  RLR     E+ SSLSIFWQIPQYVLVG +E F
Sbjct  417  GLSELQRMGVGLIIGLLAMVAAGATEIARLRGVIPGEKISSLSIFWQIPQYVLVGASEVF  476

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++V   T K G PGW+P NL
Sbjct  477  MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNMVTHFTAKGGDPGWIPNNL  536

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            N+GH+DRF+FL A + ALD V+++FCAK YK I L+  E+ ++E++E
Sbjct  537  NEGHMDRFYFLIAILAALDFVVYLFCAKWYKGINLQGSEQ-EIEIME  582



>ref|XP_003555644.2| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
isoform X1 [Glycine max]
Length=603

 Score =   268 bits (684),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 193/280 (69%), Gaps = 7/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             F+D+AA +  +E      +    NPWR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q
Sbjct  318  EFMDKAATIKETE------EHSPKNPWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQ  371

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++PL  +L    PK  
Sbjct  372  MASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRL-SGNPKGL  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG++I ++ M+ +G  E  RLR  +  ++TSSLSIFWQIPQYVLVG +E F+Y
Sbjct  431  SELQRMGIGLIIGMLAMVASGATEIARLRRISHGQKTSSLSIFWQIPQYVLVGASEVFMY  490

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +    GW+P NLN 
Sbjct  491  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQSKGWIPENLNT  550

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GH+DRFFFL A + A D V+++FCAK YK+I +E  +  D
Sbjct  551  GHMDRFFFLLAGLAAFDFVLYLFCAKWYKSINIEDSDMGD  590



>ref|XP_006586602.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Glycine max]
Length=629

 Score =   268 bits (685),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 194/285 (68%), Gaps = 10/285 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA +         D   + N WR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q
Sbjct  347  RFMDKAATITE------KDAVHLKNHWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQ  400

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN +I  FH+P ASM+ +DI S       Y  I++PL  +L    P+  
Sbjct  401  MASLFVEQGNVMNNEIGKFHLPAASMSVLDICSVLLCTGIYRQILVPLAGRL-SGNPRGL  459

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI ++ ML AG+ E  RL++    E+ SSLSIFWQIPQYVLVG +E F+Y
Sbjct  460  TELQRMGVGLVIGMLAMLAAGVTEFERLKHVTPREKASSLSIFWQIPQYVLVGASEVFMY  519

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM+IT +   PGW+P NLN 
Sbjct  520  VGQLEFFNGQAPDGIKSFGSSLCMASMSLGNYVSSMLVYMVMRITARGENPGWIPNNLNV  579

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            GH+DRFFFL A + ALD V+++ CA+ YK+I    L + D+E  E
Sbjct  580  GHMDRFFFLVAVLNALDFVLYLLCARWYKSI---NLGDGDMESQE  621



>ref|XP_009376599.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Pyrus x bretschneideri]
Length=635

 Score =   268 bits (686),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/287 (51%), Positives = 199/287 (69%), Gaps = 13/287 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +   + T     +   NPWR+CTVTQVEE KCVL++LPIW+CTI+ S+VF Q+
Sbjct  320  FLDKAATITEKDQT-----AAEKNPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQM  374

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREPK  421
             SLFVEQG  M + I  FH+P ASM++ DI S    +IC   Y   ++PL  +L    PK
Sbjct  375  ASLFVEQGDVMESHIGKFHLPAASMSAFDICS---VLICTGLYRQCLVPLAGRL-SGNPK  430

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
              +ELQR+G+G++I ++ M+ AG  E  RLR     E+ SSLSIFWQIPQYVLVG +E F
Sbjct  431  GLSELQRMGVGLIIGLLAMVAAGATEIARLRGVIPGEKISSLSIFWQIPQYVLVGASEVF  490

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++V   T K G PGW+P NL
Sbjct  491  MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNMVTHFTAKGGDPGWIPNNL  550

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            N+GH+DRF+FL A + ALD V+++FCAK YK I L+  E+ ++E++E
Sbjct  551  NEGHMDRFYFLIAILAALDFVVYLFCAKWYKGINLQGSEQ-EIEIME  596



>ref|XP_010257465.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like isoform X2 [Nelumbo 
nucifera]
Length=602

 Score =   267 bits (683),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 140/284 (49%), Positives = 193/284 (68%), Gaps = 11/284 (4%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA    +++    D      PWR+CTVTQVEE KCVL++LPIW+CTI+ S+VF Q+
Sbjct  318  FLDKAATKTQNDLHGTND------PWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQM  371

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQG  MN+   DF +P ASM++ DI S   F   Y  I++P+  +L    PK  +
Sbjct  372  ASLFVEQGVVMNSSTGDFRLPAASMSAFDICSVLVFTGIYRQILVPVAGRLTG-NPKGLS  430

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYV  610
            ELQR+G+G++I ++ M+ AG+ E  RLR      E+SSL IFWQIPQY LVG +E F+YV
Sbjct  431  ELQRMGVGLIIGMLAMVAAGITEIERLRRVTPGYESSSLIIFWQIPQYTLVGASEVFMYV  490

Query  611  AQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDG  790
             Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT ++ KPGW+P NLN G
Sbjct  491  GQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNMVMGITARNNKPGWIPGNLNSG  550

Query  791  HLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            H+DRF+FL A +  +D  ++++CAK YK I LE     DVE +E
Sbjct  551  HMDRFYFLLAGLTVIDFGIYLYCAKWYKCIKLEG----DVEAIE  590



>ref|XP_006647794.1| PREDICTED: nitrate transporter 1.5-like [Oryza brachyantha]
Length=586

 Score =   267 bits (682),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 193/278 (69%), Gaps = 4/278 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA + + E    P+  Q  NPWR+CTVTQVEEVKC+L++LPIW+CTI+ S+VF Q
Sbjct  303  RFLDKAATV-TEEDYCTPENMQ--NPWRLCTVTQVEEVKCILKMLPIWLCTIVYSVVFTQ  359

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MNT I  FH+P ASM+  DI+S   FI  Y  +++P+  +L    P+  
Sbjct  360  MASLFVEQGTTMNTNIGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMSRL-SGNPQGL  418

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+V+ +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  419  TELQRMGVGLVVGMAAMVVAGVVEVERLKRVVAPDQPSSLSVLWQVPQYALIGASEVFMY  478

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  479  VGQLEFFNGQAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGDRRPGWIPGNLNS  538

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRF+FL AA+  +DL ++V CA  YK I L+  EE
Sbjct  539  GHLDRFYFLLAALSLVDLAVYVACAVWYKGIKLDSNEE  576



>ref|XP_010257463.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010257464.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like isoform X1 [Nelumbo 
nucifera]
Length=604

 Score =   267 bits (683),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/284 (49%), Positives = 193/284 (68%), Gaps = 11/284 (4%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA    +++    D      PWR+CTVTQVEE KCVL++LPIW+CTI+ S+VF Q+
Sbjct  320  FLDKAATKTQNDLHGTND------PWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQM  373

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPN  430
             SLFVEQG  MN+   DF +P ASM++ DI S   F   Y  I++P+  +L    PK  +
Sbjct  374  ASLFVEQGVVMNSSTGDFRLPAASMSAFDICSVLVFTGIYRQILVPVAGRLTG-NPKGLS  432

Query  431  ELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYV  610
            ELQR+G+G++I ++ M+ AG+ E  RLR      E+SSL IFWQIPQY LVG +E F+YV
Sbjct  433  ELQRMGVGLIIGMLAMVAAGITEIERLRRVTPGYESSSLIIFWQIPQYTLVGASEVFMYV  492

Query  611  AQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDG  790
             Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT ++ KPGW+P NLN G
Sbjct  493  GQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNMVMGITARNNKPGWIPGNLNSG  552

Query  791  HLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            H+DRF+FL A +  +D  ++++CAK YK I LE     DVE +E
Sbjct  553  HMDRFYFLLAGLTVIDFGIYLYCAKWYKCIKLEG----DVEAIE  592



>ref|XP_002283281.3| PREDICTED: protein NRT1/ PTR FAMILY 7.1 isoform X2 [Vitis vinifera]
Length=570

 Score =   266 bits (680),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 147/278 (53%), Positives = 195/278 (70%), Gaps = 8/278 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA M  ++M         PNPWR+CTVTQVEE KCV+++LPIW+CTI+ S++F Q
Sbjct  287  EFLDKAATMIEADMV-------DPNPWRLCTVTQVEEAKCVIKMLPIWLCTIIYSVIFTQ  339

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN KI +F +P ASM++ DI S       Y  I++P+  KL    PK  
Sbjct  340  MASLFVEQGDVMNRKIGNFEIPAASMSAFDIFSVLLCTGIYRQILVPISGKLTGN-PKGM  398

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG++I I  M+ AGL E  RLR  +  EE SSLSIFWQ PQYVLVG +E F+Y
Sbjct  399  SELQRMGIGLIIGIAAMIAAGLTELGRLRRVSPNEEASSLSIFWQTPQYVLVGASEVFMY  458

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS+G  L M+S +LG+Y+ S++++IVM +TT+   PGW+P +LN 
Sbjct  459  VGQLEFFNGQAPDGIKSLGSSLCMASISLGNYVSSLLVNIVMGVTTRGDNPGWIPEDLNT  518

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRF+FL A +  +D V++VFCAK YK+I LE  E+
Sbjct  519  GHLDRFYFLIAVLTVIDFVIYVFCAKWYKSINLESFEK  556



>emb|CAN77230.1| hypothetical protein VITISV_005961 [Vitis vinifera]
Length=594

 Score =   266 bits (681),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 197/283 (70%), Gaps = 9/283 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA M  ++M         PNPWR+CTVTQVEE KCV+++LPIW+CTI+ S++F Q
Sbjct  311  EFLDKAATMIEADMV-------DPNPWRLCTVTQVEEAKCVIKMLPIWLCTIIYSVIFTQ  363

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN KI +F +P ASM++ DI S       Y  I++P+  KL    PK  
Sbjct  364  MASLFVEQGDVMNRKIGNFEIPAASMSAFDIFSVLLCTGIYRQILVPISGKLTGN-PKGM  422

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG++I I  M+ AGL E  RLR  +  EE SSLSIFWQ PQYVLVG +E F+Y
Sbjct  423  SELQRMGIGLIIGIAAMIAAGLTELGRLRRVSPNEEASSLSIFWQTPQYVLVGASEVFMY  482

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS+G  L M+S +LG+Y+ S++++IVM +TT+   PGW+P +LN 
Sbjct  483  VGQLEFFNGQAPDGIKSLGSSLCMASISLGNYVSSLLVNIVMGVTTRGDNPGWIPEDLNT  542

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE-ETDVE  913
            GHLDRF+FL A +  +D V++VFCAK YK+I LE  E E D E
Sbjct  543  GHLDRFYFLIAVLTVIDFVIYVFCAKWYKSINLESFEKEKDQE  585



>ref|XP_011080231.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Sesamum indicum]
Length=600

 Score =   267 bits (682),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 140/284 (49%), Positives = 195/284 (69%), Gaps = 10/284 (4%)
 Frame = +2

Query  74   LDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQVF  253
            LD+AAI+         D+    +PWR+CTVTQVEE KC+LR+LPIW+CTI+ S+VF Q+ 
Sbjct  311  LDKAAIITEQ------DRQGPADPWRLCTVTQVEEAKCILRMLPIWLCTIIYSVVFTQMA  364

Query  254  SLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPNE  433
            SLFVEQG  MN+ + +FH+PPASM++ DI S       Y  I++P+  +L    PK   E
Sbjct  365  SLFVEQGNVMNSTVGNFHLPPASMSAFDICSVLLCTGIYRQILVPIAGRL-SGNPKGLTE  423

Query  434  LQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIYVA  613
            LQR+GIG++I ++ M+ AG+ E  RL+     E  S +SIFWQIPQYVLVG +E F+YV 
Sbjct  424  LQRMGIGLIIGMLAMVAAGVTEMERLKRVIPGEHDSQMSIFWQIPQYVLVGASEVFMYVG  483

Query  614  QWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLNDGH  793
            Q EFF  Q PD +KS+G  L M+S +LG+++ S+++++VM IT ++ KPGW+P +LN GH
Sbjct  484  QLEFFNGQAPDGVKSLGSSLCMASMSLGNFVSSLLVNMVMGITARNNKPGWIPADLNTGH  543

Query  794  LDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVEG  925
            +D F+FL A + A DLV++V CAK YK I    LE+TD +   G
Sbjct  544  MDMFYFLIAGLTAADLVVYVACAKWYKCI---NLEDTDGDHEGG  584



>ref|NP_001047928.1| Os02g0716800 [Oryza sativa Japonica Group]
 dbj|BAD09179.1| peptide transporter-like [Oryza sativa Japonica Group]
 dbj|BAD12890.1| peptide transporter-like [Oryza sativa Japonica Group]
 dbj|BAF09842.1| Os02g0716800 [Oryza sativa Japonica Group]
 gb|EAZ24393.1| hypothetical protein OsJ_08148 [Oryza sativa Japonica Group]
Length=584

 Score =   266 bits (681),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 193/278 (69%), Gaps = 4/278 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA + + E    P+  Q  +PWR+CTVTQVEEVKC+L++LPIW+CTI+ S+VF Q
Sbjct  302  RFLDKAATV-TEEDYCTPENMQ--DPWRLCTVTQVEEVKCILKMLPIWLCTIVYSVVFTQ  358

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MNT I  FH+P ASM+  DI+S   FI  Y  +++P+  +L    P+  
Sbjct  359  MASLFVEQGTTMNTNIGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMSRL-SGNPQGL  417

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+V+ +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  418  TELQRMGVGLVVGMAAMVVAGVVEVERLKRVGAPDQPSSLSVLWQVPQYALIGASEVFMY  477

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  478  VGQLEFFNGQAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGDRRPGWIPGNLNS  537

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRF+FL AA+  +DL ++V CA  YK I L+  EE
Sbjct  538  GHLDRFYFLLAALSLVDLAVYVACAVWYKGIKLDSNEE  575



>ref|XP_010434145.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X1 [Camelina 
sativa]
 ref|XP_010434147.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 isoform X2 [Camelina 
sativa]
Length=586

 Score =   266 bits (680),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 198/277 (71%), Gaps = 3/277 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRL+PIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLIPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I  F +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVVQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE--EETSSLSIFWQIPQYVLVGVAEA  598
             +ELQR+GIG+VI+I+ M+ AG+VE +RL++   E   ++SSLSIFWQ+PQY+L+G +E 
Sbjct  417  LSELQRMGIGLVIAIMAMISAGIVEIYRLKHKEPESTSDSSSLSIFWQVPQYMLIGASEV  476

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMK +T    PGW+P N
Sbjct  477  FMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKFSTTDEVPGWIPEN  536

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            LN GHL+RF+FL A + A D V+++ CAK YK I  E
Sbjct  537  LNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  573



>gb|KDP30601.1| hypothetical protein JCGZ_16932 [Jatropha curcas]
Length=598

 Score =   266 bits (681),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 144/285 (51%), Positives = 197/285 (69%), Gaps = 13/285 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   +M    D      PWR+CTVTQVEE KCVL+L+PIW+CTI+ S+VF Q
Sbjct  321  EFLDKAATITEDDMMHQND------PWRICTVTQVEEAKCVLKLIPIWLCTIIYSVVFTQ  374

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  MN+KI +F +P ASM++ DI S    +IC   Y  I++PL  KL    P
Sbjct  375  MASLFVEQGDVMNSKIGNFQLPAASMSAFDICS---VLICTGIYRKILVPLAGKL-SGNP  430

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K   ELQR+GIG++I ++ M  AG+ E  RL++    ++ SSLSIFWQIPQYVLVG +E 
Sbjct  431  KGLTELQRMGIGLIIGMLAMFAAGVTEIERLKHVIPGQKVSSLSIFWQIPQYVLVGASEV  490

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +  KPGW+P +
Sbjct  491  FMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNVVMGITARGEKPGWIPDD  550

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            LN GHLDRF+FL A + ALD V+++F A  YK I L++ ++ + E
Sbjct  551  LNTGHLDRFYFLIAVLTALDFVLYLFSANWYKTISLQESDKQEDE  595



>ref|XP_002452648.1| hypothetical protein SORBIDRAFT_04g029890 [Sorghum bicolor]
 gb|EES05624.1| hypothetical protein SORBIDRAFT_04g029890 [Sorghum bicolor]
Length=580

 Score =   266 bits (679),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/285 (47%), Positives = 192/285 (67%), Gaps = 9/285 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +   E        ++ NPWR+CTVTQVEEVKC+L++LPIW+CTI+ S+VF Q
Sbjct  302  RFLDKAATITEGE--------KMENPWRLCTVTQVEEVKCILKMLPIWLCTIVYSVVFTQ  353

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M+T I  FH P ASM+  D++S   FI  Y  +++P+  +L    P+  
Sbjct  354  MASLFVEQGATMDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARL-SGNPQGL  412

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  413  TELQRMGVGLVIGMAAMVVAGVVEVERLKRVAAPDQPSSLSVLWQVPQYALIGASEVFMY  472

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  473  VGQLEFFNGQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNS  532

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            GHLDRF+FL AA+  +DL +++ CA  YK I L+  +  D   V 
Sbjct  533  GHLDRFYFLLAALSLVDLAVYIACAMWYKGIKLDGGDGDDSRKVS  577



>emb|CDP12983.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   266 bits (680),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/297 (48%), Positives = 206/297 (69%), Gaps = 18/297 (6%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA +AS +     +K    N W +C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  309  KFLDRAAFIASRDFN---EKQGYYNRWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  365

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMK------  409
            + S+FVEQGAAM TK+ +F +PPASM+S DI+S +  I  Y  ++ P+  ++ K      
Sbjct  366  MASIFVEQGAAMKTKVWNFEIPPASMSSFDILSVAVVIFFYRRVLDPIVSRIKKSGAKDL  425

Query  410  ---REPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIP  568
               ++ K   ELQR+GIG VI+++ ML AG+VE +R +YA  +    E +SSLSI WQ+P
Sbjct  426  TETKDSKGLTELQRMGIGFVIAVMAMLSAGIVENYRRKYARIDCTNCEGSSSLSIVWQVP  485

Query  569  QYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTK  748
            QY L+G +E F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S+I+S+VM+I+ +
Sbjct  486  QYALIGASEVFMYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLIVSMVMRISAR  545

Query  749  HGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK--LEETDVE  913
               PGW+P NLN+GHLDRF+FL A +  +DL +++ CAK YK+  +E   +E+T+ E
Sbjct  546  DDMPGWIPINLNNGHLDRFYFLLAGLTIIDLAVYMACAKWYKSAKIEGKYVEDTEKE  602



>ref|XP_009595683.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana tomentosiformis]
Length=601

 Score =   266 bits (679),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/287 (51%), Positives = 199/287 (69%), Gaps = 9/287 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++ S E+     K    NPW +C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  310  KFLDRAAVVTSRELD--NQKQGDHNPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  367

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPL--YVKLMKREPK  421
            + SLFVEQG AM T IA+F +P ASM++ DI+S +  I     ++ PL    K  K +  
Sbjct  368  MASLFVEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVSRFKKCKGDNT  427

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               ELQR+GIG+VI+++ ML AG+VE  RL+YA+ +    E +SSL+IFWQ+PQY  +G 
Sbjct  428  GLTELQRMGIGLVIAVMAMLSAGIVECFRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGA  487

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S ++SIVMKI+     PGW+
Sbjct  488  SEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWI  547

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETD  907
            P NLN GHLDRF+FL A +  +DLV ++ CAK YK I   EK++E +
Sbjct  548  PGNLNKGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEKIQEHE  594



>ref|XP_007139109.1| hypothetical protein PHAVU_008G002100g [Phaseolus vulgaris]
 gb|ESW11103.1| hypothetical protein PHAVU_008G002100g [Phaseolus vulgaris]
Length=555

 Score =   265 bits (676),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 194/280 (69%), Gaps = 6/280 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA +   +   L       N WR+CTVTQVEE KCV+R+LP+W+CTI+ S+VF Q
Sbjct  273  RFMDKAATITEKDGDDLK-----KNNWRLCTVTQVEEAKCVMRMLPVWLCTIIYSVVFTQ  327

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  M+ +I +FH P ASM+  DI+S     I Y ++++PL  K +   P+  
Sbjct  328  MASLFVEQGDVMDNRIGNFHFPAASMSVFDILSVFLSTISYIHVVVPL-TKYLTGNPRGL  386

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G++I I++M+ AG+ E  RL++    E+ SSL+IFWQ+PQYVLVG +E F+Y
Sbjct  387  TELQRMGVGLIIGILSMIAAGVTEMERLKHIVPGEKASSLTIFWQVPQYVLVGASEIFVY  446

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q +FF  Q PD +KS G  L M+S +LG+Y+ SI++ IVM IT +   PGW+P NLN 
Sbjct  447  VGQLDFFNGQAPDGIKSFGSSLCMASISLGNYVSSILVYIVMAITERGDNPGWIPNNLNL  506

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GHLDRF+FL A + A+D V + FCA+ YK I +E+ ++ +
Sbjct  507  GHLDRFYFLIAILTAVDFVFYYFCARWYKYINIEEGDKKN  546



>ref|XP_006492658.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Citrus sinensis]
Length=612

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/294 (49%), Positives = 198/294 (67%), Gaps = 23/294 (8%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +  +++      +   NPW++CTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  325  EFLDKAATITDNDL------AGPKNPWKLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  378

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  MN+ I +F +P ASM++ DI S    +IC   Y  I++P+  KL    P
Sbjct  379  MASLFVEQGDVMNSHIGEFRLPAASMSAFDICS---VLICTGIYRKILVPVAGKL-NGNP  434

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K  +ELQR+GIG++I ++ M+ AG  E  RL+Y +  E+ SSLSIFWQIPQYVLVG +E 
Sbjct  435  KGLSELQRMGIGLIIGMLAMIAAGATEIQRLKYISPGEKASSLSIFWQIPQYVLVGASEV  494

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S + G+Y+ S+++ +VM IT K  KPGW+P +
Sbjct  495  FMYVGQLEFFNGQAPDGIKSFGSSLCMASISFGNYVSSLLVVMVMGITAKGDKPGWIPDD  554

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE----------KLEETDV  910
            LN GH+DRF+FL A + A D V+++ CA  YK I L+          KL+E DV
Sbjct  555  LNTGHMDRFYFLLAVLTAFDFVIYLICANWYKGINLDEDSCEKEMEMKLDEDDV  608



>gb|KDO56443.1| hypothetical protein CISIN_1g039271mg [Citrus sinensis]
Length=609

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/294 (49%), Positives = 198/294 (67%), Gaps = 23/294 (8%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +  +++      +   NPW++CTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  322  EFLDKAATITDNDL------AGPKNPWKLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  375

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  MN+ I +F +P ASM++ DI S    +IC   Y  I++P+  KL    P
Sbjct  376  MASLFVEQGDVMNSHIGEFRLPAASMSAFDICS---VLICTGIYRKILVPVAGKL-NGNP  431

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K  +ELQR+GIG++I ++ M+ AG  E  RL+Y +  E+ SSLSIFWQIPQYVLVG +E 
Sbjct  432  KGLSELQRMGIGLIIGMLAMIAAGATEIQRLKYISPGEKASSLSIFWQIPQYVLVGASEV  491

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S + G+Y+ S+++ +VM IT K  KPGW+P +
Sbjct  492  FMYVGQLEFFNGQAPDGIKSFGSSLCMASISFGNYVSSLLVVMVMGITAKGDKPGWIPDD  551

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE----------KLEETDV  910
            LN GH+DRF+FL A + A D V+++ CA  YK I L+          KL+E DV
Sbjct  552  LNTGHMDRFYFLLAVLTAFDFVIYLICANWYKGINLDEDSCEKEMEMKLDEDDV  605



>ref|XP_010651313.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 isoform X1 [Vitis vinifera]
 ref|XP_010651314.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 isoform X1 [Vitis vinifera]
Length=611

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 147/278 (53%), Positives = 195/278 (70%), Gaps = 8/278 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA M  ++M         PNPWR+CTVTQVEE KCV+++LPIW+CTI+ S++F Q
Sbjct  328  EFLDKAATMIEADMV-------DPNPWRLCTVTQVEEAKCVIKMLPIWLCTIIYSVIFTQ  380

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN KI +F +P ASM++ DI S       Y  I++P+  KL    PK  
Sbjct  381  MASLFVEQGDVMNRKIGNFEIPAASMSAFDIFSVLLCTGIYRQILVPISGKLTGN-PKGM  439

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG++I I  M+ AGL E  RLR  +  EE SSLSIFWQ PQYVLVG +E F+Y
Sbjct  440  SELQRMGIGLIIGIAAMIAAGLTELGRLRRVSPNEEASSLSIFWQTPQYVLVGASEVFMY  499

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS+G  L M+S +LG+Y+ S++++IVM +TT+   PGW+P +LN 
Sbjct  500  VGQLEFFNGQAPDGIKSLGSSLCMASISLGNYVSSLLVNIVMGVTTRGDNPGWIPEDLNT  559

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRF+FL A +  +D V++VFCAK YK+I LE  E+
Sbjct  560  GHLDRFYFLIAVLTVIDFVIYVFCAKWYKSINLESFEK  597



>ref|XP_009376620.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like, partial [Pyrus 
x bretschneideri]
Length=610

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 201/288 (70%), Gaps = 14/288 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   ++      S   NPW++CTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  327  EFLDKAATITEDDL------SGPKNPWKLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  380

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  M +   DFH+P ASM++ DI S    +IC   Y  +++PL  K+    P
Sbjct  381  MASLFVEQGDVMKSNFGDFHLPAASMSAFDICS---VLICTGIYRQLLVPLARKI-SGNP  436

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K  +EL+R+GIG++I +++M+ AG+ E  RL++    E+ S+LSIFWQIPQYVLVG +E 
Sbjct  437  KGLSELKRMGIGLIIGMLSMIAAGVTEIARLKHVQPHEKISTLSIFWQIPQYVLVGASEV  496

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM IT K   PGW+P +
Sbjct  497  FMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVYMVMGITAKGKSPGWIPDD  556

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            LN GH+DRF+FL AA+ A D V++VFCAK YK I  E + + +++++E
Sbjct  557  LNTGHMDRFYFLIAALTAFDFVIYVFCAKWYKGIDFE-VTKMEIQIME  603



>ref|XP_010439444.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Camelina sativa]
Length=586

 Score =   265 bits (677),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 201/288 (70%), Gaps = 8/288 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRL+PIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLIPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I  F +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVVQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE----TSSLSIFWQIPQYVLVGVA  592
             +ELQR+G+G+VI+I+ M+ AG+VE +RL+  N E E    +SSLSIFWQ+PQY+L+G +
Sbjct  417  LSELQRMGVGLVIAIMAMISAGIVEIYRLK--NKEPESTSDSSSLSIFWQVPQYMLIGAS  474

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMK +T    PGW+P
Sbjct  475  EVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKFSTTDEVPGWIP  534

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETDVE  913
             NLN GHL+RF+FL A + A D V+++ CAK YK I  E    E+  E
Sbjct  535  ENLNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSEASFSESTTE  582



>ref|XP_002265725.3| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Vitis vinifera]
Length=604

 Score =   265 bits (678),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 154/285 (54%), Positives = 208/285 (73%), Gaps = 7/285 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ + E      +S+  +PWR+CTVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  313  KFLDKAAVLTAKEREQEDKESR--SPWRICTVTQVEEVKCILRLLPIWLCTILYSVVFTQ  370

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM T +  FH+PPASM+S DI+S + FI  Y  ++ PL  +L   + +  
Sbjct  371  MASLFVEQGAAMKTTLLGFHIPPASMSSFDIVSVAAFIFIYRRVLDPLVARLKGTKARGL  430

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG++I+II M+ AG+VE  RL+YA  +    E  SSLSIFWQIPQYVL+G +E
Sbjct  431  TELQRMGIGLIIAIIAMVAAGIVEWFRLKYAKKDCRQCESESSLSIFWQIPQYVLIGASE  490

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q PD LKS G  L M+S +LG+Y+ S++++IVMK +T+   PGW+P 
Sbjct  491  VFMYVGQLEFFNDQAPDGLKSFGSALCMTSISLGNYVSSLLVTIVMKFSTRDQMPGWIPS  550

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE-KLEETD  907
            NLN GHLDRF+FL AA+   D  +++ CAK YK+I LE K E+++
Sbjct  551  NLNKGHLDRFYFLLAALTMADFGVYIICAKWYKSIKLEGKYEDSN  595



>ref|XP_010449021.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Camelina sativa]
 ref|XP_010449022.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like [Camelina sativa]
Length=586

 Score =   265 bits (676),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/279 (54%), Positives = 196/279 (70%), Gaps = 7/279 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRL+PIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLIPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I  F +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVVQGAAMKTNIKSFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE----TSSLSIFWQIPQYVLVGVA  592
              ELQR+GIG+VI+I+ M+ AG VE +RL+  N E E    +SSLSIFWQ+PQY+L+G +
Sbjct  417  LTELQRMGIGLVIAIMAMISAGTVEIYRLK--NKEPESTSDSSSLSIFWQVPQYMLIGAS  474

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMK +T    PGW+P
Sbjct  475  EVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKFSTTAEVPGWIP  534

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             NLN GHL+RF+FL A + A D V+++ CAK YK I  E
Sbjct  535  ENLNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  573



>ref|XP_009393946.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=527

 Score =   263 bits (671),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 189/279 (68%), Gaps = 7/279 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + + + TL  D+S   NPWR+CT+TQVEEVKCVLRL+PIW+CTIL S+VF Q
Sbjct  250  KFLDRAAFVTAGDFTL-QDQSLRRNPWRLCTITQVEEVKCVLRLIPIWLCTILYSVVFTQ  308

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QGAAM T +  F +PP+SM++ DI+    FI   + ++ PL  ++ K    L 
Sbjct  309  MASLFVVQGAAMRTTVGAFSIPPSSMSAFDILGVVIFIFLRDRLLHPLVCRIKKSRVGL-  367

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANG-----EEETSSLSIFWQIPQYVLVGVA  592
             ELQR+G+G+VI+++ M+ AG  E  RL+ A           SSL I WQ+PQY L+G +
Sbjct  368  TELQRMGVGLVIAVMAMIAAGTAEHFRLKQARAPCSGCSGAASSLHILWQVPQYALIGAS  427

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EF+  Q P  LKS G  L ++S + G++   +I++ VMK+T + G+ GW+P
Sbjct  428  EVFMYVGQLEFYNGQAPYGLKSFGSALYLTSMSFGNFFSDLIVTAVMKLTARGGRAGWIP  487

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             NLN GHLDRF+FL AA+ + D V+FV CAK YK+  LE
Sbjct  488  ENLNHGHLDRFYFLLAALTSADFVVFVACAKWYKSTKLE  526



>ref|XP_003621431.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES77649.1| peptide/nitrate transporter [Medicago truncatula]
Length=647

 Score =   266 bits (679),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 191/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA         L D ++  N WR+CTVTQVEE KCVLR++P+W+CTI+ S+VF Q
Sbjct  363  RFMDKAATWT------LKDGNESGNQWRLCTVTQVEEAKCVLRMIPVWLCTIIYSVVFTQ  416

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AMN K+  FH+P A+M+  DI S       Y  +++PL  KL    PK  
Sbjct  417  MASLFVEQGDAMNNKVRKFHLPAATMSVFDIGSVLVCTGLYRQVLVPLAGKL-SGNPKGL  475

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+G+G+VI +  M+ AG  E  RL++   EE+ SSLSIF+QIPQYVLVG +E F+Y
Sbjct  476  SELQRMGVGLVIGMFAMVAAGATEFVRLKHVKPEEKASSLSIFYQIPQYVLVGASEVFVY  535

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++  VMKITTK  + GW+P NLND
Sbjct  536  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMMVKSVMKITTKGEELGWIPNNLND  595

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAI  880
            GH+D FF+L AA+ AL+LV++VFCA+ YK +
Sbjct  596  GHMDWFFYLIAALSALNLVVYVFCARWYKGV  626



>ref|XP_002867832.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44091.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=589

 Score =   264 bits (675),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/282 (54%), Positives = 197/282 (70%), Gaps = 10/282 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     + WR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSKYDSWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREP-KL  424
            + SLFV QGAAM T I +F +P +SM+S DI+S + FI  Y   + PL+ +L K EP K 
Sbjct  357  MASLFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTEPNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE-------TSSLSIFWQIPQYVLV  583
              ELQR+GIG+VI+I+ M+ AG VE +RL+  N E E       +SSLSIFWQ+PQY+L+
Sbjct  417  LTELQRMGIGLVIAIMAMISAGTVEIYRLK--NKEPESSTSVSSSSSLSIFWQVPQYMLI  474

Query  584  GVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPG  763
            G +E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T    PG
Sbjct  475  GASEVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVPG  534

Query  764  WVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            W+P NLN GHL+RF+FL A + A D V+++ CAK YK I  E
Sbjct  535  WIPENLNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  576



>ref|XP_006445924.1| hypothetical protein CICLE_v10018037mg, partial [Citrus clementina]
 gb|ESR59164.1| hypothetical protein CICLE_v10018037mg, partial [Citrus clementina]
Length=664

 Score =   266 bits (679),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 144/294 (49%), Positives = 198/294 (67%), Gaps = 23/294 (8%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +  +++      +   NPW++CTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  377  EFLDKAATITDNDL------AGPKNPWKLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  430

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  MN+ I +F +P ASM++ DI S    +IC   Y  I++P+  KL    P
Sbjct  431  MASLFVEQGDVMNSHIGEFRLPAASMSAFDICS---VLICTGIYRKILVPVAGKL-NGNP  486

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K  +ELQR+GIG++I ++ M+ AG  E  RL+Y +  E+ SSLSIFWQIPQYVLVG +E 
Sbjct  487  KGLSELQRMGIGLIIGMLAMIAAGATEIQRLKYISPGEKASSLSIFWQIPQYVLVGASEV  546

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S + G+Y+ S+++ +VM IT K  KPGW+P +
Sbjct  547  FMYVGQLEFFNGQAPDGIKSFGSSLCMASISFGNYVSSLLVVMVMGITAKGDKPGWIPDD  606

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE----------KLEETDV  910
            LN GH+DRF+FL A + A D V+++ CA  YK I L+          KL+E DV
Sbjct  607  LNTGHMDRFYFLLAVLTAFDFVIYLICANWYKGINLDEDSCEKEMEMKLDEDDV  660



>gb|EMT20726.1| Peptide transporter PTR1 [Aegilops tauschii]
Length=585

 Score =   264 bits (674),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 192/278 (69%), Gaps = 4/278 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            R+LD+AA +   +     +  ++ +PWR+CTVTQVEEVKC+L++LPIW+CTI+ S+VF Q
Sbjct  304  RYLDKAATVTEEDYC---EPERMKDPWRLCTVTQVEEVKCILKMLPIWMCTIVYSVVFTQ  360

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  M+T I  FH+P ASM+  DI+S   FI  Y  +++P+  +L    P+  
Sbjct  361  MASLFVEQGTTMDTNIGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMARL-SGNPQGL  419

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  420  TELQRMGVGLVIGMGAMVVAGVVEGERLKRVAAPDQPSSLSVLWQVPQYALIGASEVFMY  479

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  480  VGQLEFFNGQAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGDKRPGWIPGNLNS  539

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRF+FL AA+  +DL ++V CA  YK I L+  EE
Sbjct  540  GHLDRFYFLLAALSLVDLAVYVACAMWYKGIKLDSNEE  577



>ref|XP_009761242.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Nicotiana sylvestris]
Length=598

 Score =   264 bits (674),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 200/290 (69%), Gaps = 12/290 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++ S E+     K    NPW +C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  309  KFLDRAAVVTSRELD--NQKQSDHNPWHLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM T IA+F +P ASM++ DI+S +  I     ++ PL  +  K +    
Sbjct  367  MASLFVEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVSRFKKCKGDHI  426

Query  428  N--ELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               ELQR+GIG+VI+++ ML AG+VE +RL+YA+ +      +SSL+IFWQ+PQY  +G 
Sbjct  427  GLTELQRMGIGLVIAVMAMLSAGIVECYRLKYASNDCKNCGGSSSLNIFWQVPQYAFIGA  486

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++S+VMKI+     PGW+
Sbjct  487  SEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVSVVMKISATDKMPGWI  546

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAI----VLEKLEETD  907
            P NLN GHLDRF+FL A +  +DLV ++ CAK YK I     +++ EE D
Sbjct  547  PGNLNKGHLDRFYFLLAGLTLIDLVAYIACAKWYKNIKHSEKIQEYEEDD  596



>ref|XP_010540767.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Tarenaya 
hassleriana]
Length=599

 Score =   263 bits (673),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 208/284 (73%), Gaps = 12/284 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ + +M    +++   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF Q
Sbjct  300  KFLDKAAVITAEDME--DEENGRVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQ  357

Query  248  VFSLFVEQGAAMNTKIA----DFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE  415
            + SLFVEQGAAM T +A     F +PPASM+S DI+S + FI  Y  +I P   +L ++E
Sbjct  358  MASLFVEQGAAMKTAMAAAENSFRVPPASMSSFDILSVAVFIFLYRRVIEPTASRLRQKE  417

Query  416  --PKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYV  577
               K   EL+R+GIG+VI+++ ML AG+VE +RL+YA+      + +SSLSIFWQ+PQY 
Sbjct  418  NGSKGMTELERMGIGLVIAVLAMLSAGIVESYRLKYADKSCTHCDGSSSLSIFWQVPQYA  477

Query  578  LVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGK  757
            L+G +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++VMKI+T+   
Sbjct  478  LIGASEVFMYVGQLEFFNAQAPDGLKSFGSSLCMMSMSMGNFVSSLLVTMVMKISTEDHV  537

Query  758  PGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            PGW+P NLN GHLDRF+FL A + ++DLV+++ CAK YK I L+
Sbjct  538  PGWIPRNLNKGHLDRFYFLLAVLTSVDLVVYIACAKWYKCIKLQ  581



>ref|XP_007207679.1| hypothetical protein PRUPE_ppa023462mg [Prunus persica]
 gb|EMJ08878.1| hypothetical protein PRUPE_ppa023462mg [Prunus persica]
Length=612

 Score =   264 bits (674),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 197/288 (68%), Gaps = 14/288 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   ++          NPWR+CTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  326  EFLDKAATITEDDLC------GPKNPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  379

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  M +   +FH+P ASM++ DI S    +IC   Y  +++PL  KL     
Sbjct  380  MASLFVEQGDVMKSNFGNFHLPAASMSAFDICS---VLICTGIYRQVLVPLAGKLSGNTK  436

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
             + +EL+R+GIG+VI ++ M+ AG  E  RL++    E+ SSL+IFWQIPQYVLVG +E 
Sbjct  437  GI-SELKRMGIGLVIGMLAMVAAGATEIARLKHVLPGEKISSLNIFWQIPQYVLVGASEV  495

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S +LG+Y  S ++++VM IT +   PGW+P +
Sbjct  496  FMYVGQLEFFNGQAPDGIKSFGSSLCMASMSLGNYASSFLVNMVMGITARGKDPGWIPDD  555

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            LN GHLDRF+FL AA+ A D V++VFCAK YK+I LE   E +++++E
Sbjct  556  LNTGHLDRFYFLIAALTAFDFVIYVFCAKWYKSINLEG-SEKEIQIIE  602



>ref|XP_010540766.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Tarenaya 
hassleriana]
Length=609

 Score =   263 bits (673),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 208/284 (73%), Gaps = 12/284 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLD+AA++ + +M    +++   NPWR+C VTQVEEVKC+LRL+PIW+CTI+ S+VF Q
Sbjct  310  KFLDKAAVITAEDME--DEENGRVNPWRLCPVTQVEEVKCILRLMPIWLCTIIYSVVFTQ  367

Query  248  VFSLFVEQGAAMNTKIA----DFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE  415
            + SLFVEQGAAM T +A     F +PPASM+S DI+S + FI  Y  +I P   +L ++E
Sbjct  368  MASLFVEQGAAMKTAMAAAENSFRVPPASMSSFDILSVAVFIFLYRRVIEPTASRLRQKE  427

Query  416  --PKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYV  577
               K   EL+R+GIG+VI+++ ML AG+VE +RL+YA+      + +SSLSIFWQ+PQY 
Sbjct  428  NGSKGMTELERMGIGLVIAVLAMLSAGIVESYRLKYADKSCTHCDGSSSLSIFWQVPQYA  487

Query  578  LVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGK  757
            L+G +E F+YV Q EFF +Q PD LKS G  L M S ++G+++ S+++++VMKI+T+   
Sbjct  488  LIGASEVFMYVGQLEFFNAQAPDGLKSFGSSLCMMSMSMGNFVSSLLVTMVMKISTEDHV  547

Query  758  PGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            PGW+P NLN GHLDRF+FL A + ++DLV+++ CAK YK I L+
Sbjct  548  PGWIPRNLNKGHLDRFYFLLAVLTSVDLVVYIACAKWYKCIKLQ  591



>gb|KHN12584.1| Putative peptide/nitrate transporter [Glycine soja]
Length=595

 Score =   263 bits (672),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/273 (51%), Positives = 186/273 (68%), Gaps = 7/273 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA +         D   + N WR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q
Sbjct  313  RFMDKAATITE------KDAVNLKNHWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN KI +FH+P ASM+  DI S       Y  I++PL  +     P+  
Sbjct  367  MASLFVEQGDVMNNKIGNFHLPAASMSVFDICSVLLCTGIYRQILVPLAGRF-SGNPRGL  425

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G++I ++ +L AG  E  RL++    E+ SSLSIFWQIPQYVLVG +E F+Y
Sbjct  426  TELQRMGVGLIIGMLAILAAGATEFERLKHITPGEKASSLSIFWQIPQYVLVGASEVFMY  485

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM IT +   PGW+P NLN 
Sbjct  486  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVYMVMGITARGENPGWIPNNLNV  545

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL  886
            GH+DRFFFL A + ALD V+++ CA+ YK+I L
Sbjct  546  GHMDRFFFLVAVLTALDFVLYLLCARWYKSINL  578



>ref|XP_008243619.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Prunus mume]
Length=613

 Score =   263 bits (673),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 197/288 (68%), Gaps = 14/288 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   ++          NPWR+CTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  327  EFLDKAATITEDDLC------GPKNPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  380

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  M +   +FH+P ASM++ DI S    +IC   Y  +++PL  KL     
Sbjct  381  MASLFVEQGDVMKSNFGNFHLPAASMSAFDICS---VLICTGIYRQVLVPLAGKLSGNTK  437

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
             + +EL+R+GIG+VI ++ M+ AG  E  RL++    E+ SSL+IFWQIPQYVLVG +E 
Sbjct  438  GI-SELKRMGIGLVIGMLAMVAAGATEIARLKHVLPGEKISSLNIFWQIPQYVLVGASEV  496

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S +LG+Y  S ++++VM IT +   PGW+P +
Sbjct  497  FMYVGQLEFFNGQAPDGIKSFGSSLCMASMSLGNYASSFLVNMVMGITARGKDPGWIPDD  556

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            LN GHLDRF+FL AA+ A D V++VFCAK YK+I LE   E +++++E
Sbjct  557  LNRGHLDRFYFLIAALTAFDFVIYVFCAKWYKSINLEG-SEKEIQIIE  603



>ref|XP_006603076.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Glycine max]
Length=592

 Score =   263 bits (672),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/273 (51%), Positives = 186/273 (68%), Gaps = 7/273 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA +         D   + N WR+CTVTQVEE KCVLR+LP+W+CTI+ S+VF Q
Sbjct  310  RFMDKAATITE------KDAVNLKNHWRLCTVTQVEEAKCVLRMLPVWLCTIIYSVVFTQ  363

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN KI +FH+P ASM+  DI S       Y  I++PL  +     P+  
Sbjct  364  MASLFVEQGDVMNNKIGNFHLPAASMSVFDICSVLLCTGIYRQILVPLAGRF-SGNPRGL  422

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G++I ++ +L AG  E  RL++    E+ SSLSIFWQIPQYVLVG +E F+Y
Sbjct  423  TELQRMGVGLIIGMLAILAAGATEFERLKHITPGEKASSLSIFWQIPQYVLVGASEVFMY  482

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM IT +   PGW+P NLN 
Sbjct  483  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVYMVMGITARGENPGWIPNNLNV  542

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL  886
            GH+DRFFFL A + ALD V+++ CA+ YK+I L
Sbjct  543  GHMDRFFFLVAVLTALDFVLYLLCARWYKSINL  575



>ref|XP_009393944.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=601

 Score =   263 bits (672),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 189/279 (68%), Gaps = 7/279 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA + + + TL  D+S   NPWR+CT+TQVEEVKCVLRL+PIW+CTIL S+VF Q
Sbjct  324  KFLDRAAFVTAGDFTL-QDQSLRRNPWRLCTITQVEEVKCVLRLIPIWLCTILYSVVFTQ  382

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QGAAM T +  F +PP+SM++ DI+    FI   + ++ PL  ++ K    L 
Sbjct  383  MASLFVVQGAAMRTTVGAFSIPPSSMSAFDILGVVIFIFLRDRLLHPLVCRIKKSRVGL-  441

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANG-----EEETSSLSIFWQIPQYVLVGVA  592
             ELQR+G+G+VI+++ M+ AG  E  RL+ A           SSL I WQ+PQY L+G +
Sbjct  442  TELQRMGVGLVIAVMAMIAAGTAEHFRLKQARAPCSGCSGAASSLHILWQVPQYALIGAS  501

Query  593  EAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVP  772
            E F+YV Q EF+  Q P  LKS G  L ++S + G++   +I++ VMK+T + G+ GW+P
Sbjct  502  EVFMYVGQLEFYNGQAPYGLKSFGSALYLTSMSFGNFFSDLIVTAVMKLTARGGRAGWIP  561

Query  773  PNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
             NLN GHLDRF+FL AA+ + D V+FV CAK YK+  LE
Sbjct  562  ENLNHGHLDRFYFLLAALTSADFVVFVACAKWYKSTKLE  600



>ref|XP_011025229.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Populus euphratica]
Length=601

 Score =   263 bits (672),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 188/278 (68%), Gaps = 7/278 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   ++      SQ  NPWR+CT++QVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  316  EFLDKAATVTEDDL------SQQKNPWRLCTISQVEEAKCVLKMLPIWLCTIIYSVVFTQ  369

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+    FH+P ASM++ DI S       Y  I++PL  +L      L 
Sbjct  370  MASLFVEQGDVMNSYAGKFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRLSGNTKGL-  428

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG++I ++ M  AG  E  RL++    ++ SSLSIFWQIPQYVLVG +E F+Y
Sbjct  429  TELQRMGIGLIIGMLAMFAAGATEIERLKHVPEGKKVSSLSIFWQIPQYVLVGASEVFMY  488

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++S+VMKIT K  KPGW+P +LN 
Sbjct  489  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVSMVMKITAKGDKPGWIPDDLNT  548

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GH+DRF+FL A + A D V+++FCA  Y  I ++   E
Sbjct  549  GHMDRFYFLIAVLTAFDFVIYLFCANWYTPINIDDSHE  586



>gb|KCW73263.1| hypothetical protein EUGRSUZ_E01723 [Eucalyptus grandis]
Length=543

 Score =   261 bits (667),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 201/288 (70%), Gaps = 17/288 (6%)
 Frame = +2

Query  68   RFLDRAAIMA---------SSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCT  220
            +FLD+AAI+          SS   L P ++   NPWR+CTVTQVEEVKC+LRLLPIW+CT
Sbjct  237  KFLDKAAIITPTDFIQDCNSSSSRLQPPQN---NPWRLCTVTQVEEVKCILRLLPIWLCT  293

Query  221  ILASIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVK  400
            IL S+VF Q+ SLFVEQGA M      FH+PPASM+S DI+S + FI  Y  I+ P+ V 
Sbjct  294  ILYSVVFTQMASLFVEQGAGMRATFGGFHIPPASMSSFDILSVAAFIFIYRRILDPV-VA  352

Query  401  LMKREPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANG----EEETSSLSIFWQIP  568
             ++ +P    +LQR+G+G++++++ M+ AG VE  RL+YA+      E +SSLSIFWQ+P
Sbjct  353  RVRTKPHGLTQLQRMGVGLIVAVLAMVAAGTVEHFRLKYADKSCSSCEGSSSLSIFWQVP  412

Query  569  QYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTK  748
            QYVL+G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMK + +
Sbjct  413  QYVLIGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKFSAR  472

Query  749  HGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
               PGW+P NLN GHLDRF+FL AA+ A D  +++ CAK Y+ I   +
Sbjct  473  DDMPGWIPRNLNRGHLDRFYFLLAALTAADFFVYLLCAKWYQCIEFAR  520



>ref|XP_010046454.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Eucalyptus grandis]
 gb|KCW85858.1| hypothetical protein EUGRSUZ_B02590 [Eucalyptus grandis]
Length=637

 Score =   263 bits (673),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/282 (50%), Positives = 197/282 (70%), Gaps = 13/282 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            +LD+AA +  S      D S   NPWR+CTV+QVEE KCVL+++P+W+CTI+ S+VF Q+
Sbjct  351  YLDKAATITES------DLSSPKNPWRLCTVSQVEEAKCVLKMIPVWLCTIIYSVVFTQM  404

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREPK  421
             SLFVEQG  MN+ I  FH+P ASM++ DI S    +IC   Y  I++PL  +L    PK
Sbjct  405  ASLFVEQGNVMNSMIGQFHLPAASMSAFDICS---VLICTGIYRQILVPLAGRL-SGNPK  460

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               +LQR+GIG++I +  ML AG  E  RLR+    E++S+LSIFWQ+PQY+LVG +E F
Sbjct  461  GLTQLQRMGIGLIIGMSAMLAAGATEVARLRHVVPGEKSSALSIFWQVPQYMLVGASEVF  520

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++V +ITT+  KPGW+P +L
Sbjct  521  MYVGQLEFFNEQAPDGIKSFGSSLCMASMSLGNYVSSMLVNMVTRITTEGDKPGWIPEDL  580

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            N GH++RF+FL AA+ A D V+++FCAK YK   LE  E+ +
Sbjct  581  NTGHMERFYFLIAALTAFDFVIYLFCAKWYKINNLESEEDNE  622



>emb|CAB36812.1| peptide transporter-like protein [Arabidopsis thaliana]
 emb|CAB81275.1| peptide transporter-like protein [Arabidopsis thaliana]
Length=576

 Score =   262 bits (669),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 197/282 (70%), Gaps = 10/282 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  284  RFLDRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  343

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PKL  424
            + SLFV QGAAM T I +F +P +SM+S DI+S + FI  Y   + PL+ +L K E  K 
Sbjct  344  MASLFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTERNKG  403

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE-------TSSLSIFWQIPQYVLV  583
              ELQR+GIG+VI+I+ M+ AG+VE HRL+  N E E       +S+LSIFWQ+PQY+L+
Sbjct  404  LTELQRMGIGLVIAIMAMISAGIVEIHRLK--NKEPESATSISSSSTLSIFWQVPQYMLI  461

Query  584  GVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPG  763
            G +E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T     G
Sbjct  462  GASEVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVHG  521

Query  764  WVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            W+P NLN GHL+RF+FL A + A D V+++ CAK YK I  E
Sbjct  522  WIPENLNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  563



>ref|XP_002528132.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF34262.1| Peptide transporter, putative [Ricinus communis]
Length=481

 Score =   259 bits (662),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 193/285 (68%), Gaps = 9/285 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   +     D+      WR+CT+TQVEE KCVL+++PIW+CTI+ S+VF Q
Sbjct  187  EFLDKAATITQDDTIRQNDR------WRLCTITQVEEAKCVLKMIPIWLCTIIYSVVFTQ  240

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ + +FH+P ASM++ DI S       Y  I++P+  KL    PK  
Sbjct  241  MASLFVEQGDVMNSNVGEFHLPAASMSAFDICSVLICTGIYRQILVPVAGKL-SGNPKGL  299

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG++I ++ M+ AG  E  RL+     +  SSLSIFWQIPQYVLVG +E F+Y
Sbjct  300  SELQRMGIGLIIGMLAMVAAGATEIERLKNVTPGQRISSLSIFWQIPQYVLVGASEVFMY  359

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+++ S+++++VM IT K  KPGW+P +LN 
Sbjct  360  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNFVSSLLVNMVMGITAKGEKPGWIPDDLNT  419

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            GH+DRF+FL AA+ A D V+++ CAK YK I L+  E+ D E  E
Sbjct  420  GHMDRFYFLIAALTAFDFVIYLLCAKWYKPINLQ--EDDDGEDNE  462



>ref|NP_193899.2| nitrate transporter 1.8 [Arabidopsis thaliana]
 sp|Q8GXN2.2|PTR47_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 7.2; Short=AtNPF7.2; AltName: 
Full=Nitrate transporter 1.8 [Arabidopsis thaliana]
 gb|AEE84489.1| nitrate transporter 1.8 [Arabidopsis thaliana]
Length=589

 Score =   262 bits (669),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 197/282 (70%), Gaps = 10/282 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PKL  424
            + SLFV QGAAM T I +F +P +SM+S DI+S + FI  Y   + PL+ +L K E  K 
Sbjct  357  MASLFVVQGAAMKTNIKNFRIPASSMSSFDILSVAFFIFAYRRFLDPLFARLNKTERNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE-------TSSLSIFWQIPQYVLV  583
              ELQR+GIG+VI+I+ M+ AG+VE HRL+  N E E       +S+LSIFWQ+PQY+L+
Sbjct  417  LTELQRMGIGLVIAIMAMISAGIVEIHRLK--NKEPESATSISSSSTLSIFWQVPQYMLI  474

Query  584  GVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPG  763
            G +E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T     G
Sbjct  475  GASEVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVHG  534

Query  764  WVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            W+P NLN GHL+RF+FL A + A D V+++ CAK YK I  E
Sbjct  535  WIPENLNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  576



>ref|XP_003592858.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES63109.1| peptide/nitrate transporter [Medicago truncatula]
Length=589

 Score =   261 bits (668),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/288 (47%), Positives = 201/288 (70%), Gaps = 10/288 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            R +D+AA +  ++     D+    NPW++CTVTQVEE KCVLR+LPIW+CTI  S+VF Q
Sbjct  293  RLMDKAATITKND-----DEQIGNNPWKLCTVTQVEETKCVLRMLPIWLCTICYSVVFTQ  347

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ I +FH+P ASM+  DI S     + Y  I++PL  +L+     + 
Sbjct  348  MASLFVEQGDVMNSNIGEFHLPAASMSVFDICSVLVCTVIYRTILVPLVGRLIGNTRGI-  406

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +EL+R+GIG++I++++M+ +G+ E  RLR     ++ SS+SIF+QIPQYVL+G +E F+Y
Sbjct  407  SELERMGIGLIIAMLSMVASGMTEMVRLRNIIPGQKRSSMSIFYQIPQYVLIGASEVFMY  466

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VMKIT +    GW+P NLN 
Sbjct  467  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVHVVMKITARGNDKGWIPENLNK  526

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL----EKLEETDVELV  919
            GH+DRFFFL A +V  D V+++FCAK YK+I +    E+L++ D +++
Sbjct  527  GHMDRFFFLLAGLVVFDFVIYLFCAKWYKSINVQGDQEELDDDDAQVI  574



>ref|XP_003621236.1| Peptide transporter PTR1 [Medicago truncatula]
Length=580

 Score =   261 bits (668),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 209/290 (72%), Gaps = 14/290 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +   ++  + +     +PW + TVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  287  RFLDKAAFITPKDLKQMEENK--CSPWFLSTVTQVEEVKCILRLLPIWLCTILFSVVFSQ  344

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM TKI+ FH+PPASM+S DI+S  +FI  Y  I+ PL  +  K+   + 
Sbjct  345  MASLFVEQGAAMETKISTFHIPPASMSSFDILSVVSFIFIYRRILDPLVARFTKKSKGI-  403

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE-------TSSLSIFWQIPQYVLVG  586
             ELQR+GIG+V++II M+ AGLVE  RL+YA  EE+       TSSLSIFWQ+PQYVL+G
Sbjct  404  TELQRMGIGLVLAIIAMVSAGLVEIFRLKYAIKEEKNCSHCEGTSSLSIFWQVPQYVLIG  463

Query  587  VAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKH-GKPG  763
             +E F+YV Q EFF SQ PD LKS G  L M+S +LG+Y+ S++++IVMKI+T++ G  G
Sbjct  464  ASEVFMYVGQLEFFNSQAPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTRNEGMLG  523

Query  764  WVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            W+P NLN GHLDRF+FL AA+ A DL++++  A+ YK +   K    ++E
Sbjct  524  WIPGNLNMGHLDRFYFLLAALTAADLLVYIAMARWYKYV---KFHGNNIE  570



>gb|ABD32535.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES77454.2| peptide/nitrate transporter [Medicago truncatula]
Length=589

 Score =   261 bits (668),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 209/290 (72%), Gaps = 14/290 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +   ++  + +     +PW + TVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  296  RFLDKAAFITPKDLKQMEENK--CSPWFLSTVTQVEEVKCILRLLPIWLCTILFSVVFSQ  353

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGAAM TKI+ FH+PPASM+S DI+S  +FI  Y  I+ PL  +  K+   + 
Sbjct  354  MASLFVEQGAAMETKISTFHIPPASMSSFDILSVVSFIFIYRRILDPLVARFTKKSKGI-  412

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE-------TSSLSIFWQIPQYVLVG  586
             ELQR+GIG+V++II M+ AGLVE  RL+YA  EE+       TSSLSIFWQ+PQYVL+G
Sbjct  413  TELQRMGIGLVLAIIAMVSAGLVEIFRLKYAIKEEKNCSHCEGTSSLSIFWQVPQYVLIG  472

Query  587  VAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKH-GKPG  763
             +E F+YV Q EFF SQ PD LKS G  L M+S +LG+Y+ S++++IVMKI+T++ G  G
Sbjct  473  ASEVFMYVGQLEFFNSQAPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTRNEGMLG  532

Query  764  WVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            W+P NLN GHLDRF+FL AA+ A DL++++  A+ YK +   K    ++E
Sbjct  533  WIPGNLNMGHLDRFYFLLAALTAADLLVYIAMARWYKYV---KFHGNNIE  579



>ref|XP_008352266.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Malus domestica]
Length=610

 Score =   262 bits (669),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 193/280 (69%), Gaps = 13/280 (5%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   ++      S   NPWR+CTVTQVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  326  EFLDKAATITEDDL------SGPKNPWRLCTVTQVEEAKCVLKMLPIWLCTIIYSVVFTQ  379

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  M +   DFH+P ASM++ DI S    +IC   Y  +++PL  K+    P
Sbjct  380  MASLFVEQGDVMKSNFGDFHLPAASMSAFDICS---VLICTGIYRQLLVPLAGKI-SGNP  435

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K  +EL+R+GIG++I +++M+ AG+ E  RL++    E+ S+LSIFWQIPQYVLVG +E 
Sbjct  436  KGLSELKRMGIGLIIGMLSMIAAGVTEIARLKHVQPHEKISTLSIFWQIPQYVLVGASEV  495

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM IT K   PGW+P +
Sbjct  496  FMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVYMVMGITAKGKSPGWIPDD  555

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE  898
            LN G +D F+FL AA+ A D V++VFCAK YK I + K E
Sbjct  556  LNTGRMDXFYFLIAALTAFDFVIYVFCAKWYKGIEVTKKE  595



>ref|XP_006362495.1| PREDICTED: nitrate transporter 1.5-like [Solanum tuberosum]
Length=600

 Score =   261 bits (668),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 203/289 (70%), Gaps = 9/289 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +FLDRAA++ S E  L   K    NPWR+C ++QVEEVKC+LRLLPIW+CTI+ S+VF Q
Sbjct  309  KFLDRAAVVTSKE--LESQKQGDHNPWRLCPISQVEEVKCILRLLPIWLCTIIYSVVFTQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPL--YVKLMKREPK  421
            + SLFVEQG AM T IA+F +P ASM++ DI+S +  I     ++ PL    K  K +  
Sbjct  367  MASLFVEQGDAMKTTIANFRIPAASMSTFDILSVAGVIFLNRRVLNPLVKRFKKCKDDDA  426

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGV  589
               ELQR+GIG+VI+++ ML +G+VE +RL+YA+ +    E +SSL+IFWQ+PQY  +G 
Sbjct  427  GLTELQRMGIGLVIAVMAMLSSGIVECYRLKYASNDCKHCEGSSSLNIFWQVPQYAFIGA  486

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YVAQ EFF +Q PD LKS G  L M+S +LG+Y+ S ++SIVMKI+     PGW+
Sbjct  487  SEVFMYVAQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSFLVSIVMKISATDNMPGWI  546

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVL-EKLEETDVE  913
            P NLN GHLDRF+FL A +  LDLV ++ CAK YK I   EK++E + E
Sbjct  547  PGNLNKGHLDRFYFLLAGLTLLDLVAYIACAKWYKNIKHSEKIQEHEEE  595



>ref|XP_004953690.1| PREDICTED: nitrate transporter 1.5-like isoform X1 [Setaria italica]
 ref|XP_004953691.1| PREDICTED: nitrate transporter 1.5-like isoform X2 [Setaria italica]
Length=583

 Score =   261 bits (666),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 190/278 (68%), Gaps = 4/278 (1%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF DRAA +   E +  P++ +  +PWR+CTVTQVEEVKC+LR+LPIW+CTI+ S+VF Q
Sbjct  302  RFFDRAATVTEEERST-PERME--DPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQ  358

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA MNT I  F +P ASM+  DI+S   FI  Y   ++P   ++    P+  
Sbjct  359  MASLFVEQGATMNTTIGSFRIPAASMSLFDILSVLVFIAVYRRALVPAMARV-SGNPRGL  417

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI +  M++AG+VE  RLR     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  418  TELQRMGVGLVIGMAAMVVAGVVEVERLRRVAAPDQPSSLSVLWQVPQYALIGASEVFMY  477

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  478  VGQLEFFNGQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGERRPGWIPGNLNS  537

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
            GHLDRF+FL A +  +DL +++ CA  YK I L+  +E
Sbjct  538  GHLDRFYFLLAVLSLVDLAVYIPCAVWYKGIRLDGGDE  575



>ref|XP_010691959.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Beta vulgaris subsp. 
vulgaris]
Length=600

 Score =   261 bits (667),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 197/285 (69%), Gaps = 8/285 (3%)
 Frame = +2

Query  74   LDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQVF  253
            LD+AA+M  +   +  +     N   +CTVTQVEEVKC+LRLLPIW+CTI+ S+VF Q+ 
Sbjct  312  LDKAAVMKYTPERISTNNHTKYNERNLCTVTQVEEVKCILRLLPIWICTIMYSVVFTQMA  371

Query  254  SLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLPNE  433
            SLFVEQGAAM   I +F++PPASM+  DI+S  +FI  Y  ++ P   +L KR      E
Sbjct  372  SLFVEQGAAMKATIGNFYIPPASMSIFDILSVVSFIFIYRRVLNPFVTRLRKRG---LTE  428

Query  434  LQRIGIGMVISIITMLIAGLVEQHRLRYANGE----EETSSLSIFWQIPQYVLVGVAEAF  601
            LQR+GIG++ +I+ M+ AG VE  RL++A  +    +  SSLSIFWQIPQY+L+G +E F
Sbjct  429  LQRMGIGLIFAILAMIAAGTVEIFRLKFAINDCKNCKNASSLSIFWQIPQYMLIGASEVF  488

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q P+ LK+ G  L M S + G+YL SII++I+MKITT++  PGW+P +L
Sbjct  489  MYVGQLEFFNGQAPEGLKTFGSALCMLSMSFGNYLSSIIVTILMKITTQNNMPGWIPEDL  548

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLE-ETDVE  913
            N GHL+RFFFL A + A+D ++++F A  YK I  E+ + E+D E
Sbjct  549  NKGHLERFFFLLAGLTAVDFMVYLFYASSYKYIQAEEPKGESDGE  593



>ref|XP_004296304.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Fragaria vesca subsp. vesca]
Length=677

 Score =   263 bits (672),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 140/281 (50%), Positives = 192/281 (68%), Gaps = 10/281 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQV-PNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFV  244
             FLD+AA +         DK Q   NPWR+CTVTQVEE KCVL+LLPIW+CTI+ S++F 
Sbjct  392  EFLDKAATIT--------DKDQNEKNPWRLCTVTQVEEAKCVLKLLPIWLCTIIYSVIFT  443

Query  245  QVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            Q+ SLFVEQG  M+ KI +FH+P ASM++ DI S       Y  +++PL  +L    PK 
Sbjct  444  QMASLFVEQGDVMHAKIGNFHIPAASMSAFDICSVLIATGIYRQVLVPLAGRL-SGNPKG  502

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
             +ELQR+GIG++I +  M+ AG+ E  R +Y    +  SSLSIFWQIPQYV VGV+E F+
Sbjct  503  LSELQRMGIGLIIGLFAMVAAGVTEIARRKYVEPGKRISSLSIFWQIPQYVCVGVSEVFM  562

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF  + PD +KS G  L M+S +LG+Y+ S+++++VM IT +   PGW+P NLN
Sbjct  563  YVGQLEFFNGEAPDGIKSFGSSLCMASISLGNYVSSMLVAVVMGITARGSDPGWIPNNLN  622

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            +GH+DRF+FL A +  +D V++V+ +KRYK I LE  E  +
Sbjct  623  EGHMDRFYFLIAGLAVIDFVIYVYLSKRYKYINLEGPENEE  663



>ref|XP_004296302.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Fragaria vesca subsp. vesca]
Length=606

 Score =   261 bits (667),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 140/288 (49%), Positives = 199/288 (69%), Gaps = 15/288 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPN-PWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            FLD+AA + + ++         PN PW++CTVTQVEE KCVL++LPIW+CTI+ S++F Q
Sbjct  320  FLDKAATITNHDLC-------GPNDPWKLCTVTQVEEAKCVLKMLPIWLCTIIYSVIFTQ  372

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREP  418
            + SLFVEQG  M + I  FH+P ASM++ DI S    +IC   Y  +++PL  KL    P
Sbjct  373  MASLFVEQGDVMKSHIGSFHLPAASMSAFDICS---VLICTGIYRQVLVPLAGKLTGN-P  428

Query  419  KLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEA  598
            K   ELQR+GIG++I +++M+ AG  E  RL+Y    E+ SSLSIFWQ+PQYVLVG +E 
Sbjct  429  KGLTELQRMGIGLLIGMLSMVAAGATEIARLKYVVRGEKISSLSIFWQVPQYVLVGASEV  488

Query  599  FIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPN  778
            F+YV Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM IT +   PGW+P +
Sbjct  489  FMYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVIMVMGITARGKNPGWIPDD  548

Query  779  LNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            LN GH+DRF+FL A + A D V++V+ AK YK I L+  ++ +V+++E
Sbjct  549  LNTGHMDRFYFLLAVLAAFDFVIYVYLAKWYKCINLQDSDDKEVQIIE  596



>ref|XP_010056493.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Eucalyptus grandis]
Length=619

 Score =   261 bits (668),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 201/288 (70%), Gaps = 17/288 (6%)
 Frame = +2

Query  68   RFLDRAAIMA---------SSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCT  220
            +FLD+AAI+          SS   L P ++   NPWR+CTVTQVEEVKC+LRLLPIW+CT
Sbjct  313  KFLDKAAIITPTDFIQDCNSSSSRLQPPQN---NPWRLCTVTQVEEVKCILRLLPIWLCT  369

Query  221  ILASIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVK  400
            IL S+VF Q+ SLFVEQGA M      FH+PPASM+S DI+S + FI  Y  I+ P+ V 
Sbjct  370  ILYSVVFTQMASLFVEQGAGMRATFGGFHIPPASMSSFDILSVAAFIFIYRRILDPV-VA  428

Query  401  LMKREPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANG----EEETSSLSIFWQIP  568
             ++ +P    +LQR+G+G++++++ M+ AG VE  RL+YA+      E +SSLSIFWQ+P
Sbjct  429  RVRTKPHGLTQLQRMGVGLIVAVLAMVAAGTVEHFRLKYADKSCSSCEGSSSLSIFWQVP  488

Query  569  QYVLVGVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTK  748
            QYVL+G +E F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S+++++VMK + +
Sbjct  489  QYVLIGASEVFMYVGQLEFFNAQAPDGLKSFGSALCMTSISLGNYVSSLLVTMVMKFSAR  548

Query  749  HGKPGWVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEK  892
               PGW+P NLN GHLDRF+FL AA+ A D  +++ CAK Y+ I   +
Sbjct  549  DDMPGWIPRNLNRGHLDRFYFLLAALTAADFFVYLLCAKWYQCIEFAR  596



>dbj|BAC42767.1| putative peptide transporter [Arabidopsis thaliana]
Length=589

 Score =   261 bits (666),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 197/282 (70%), Gaps = 10/282 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLDRAAI+   +     +     +PWR+C+VTQVEEVKCVLRLLPIW+CTIL S+VF Q
Sbjct  297  RFLDRAAIVTPDDEAEKVESGSKYDPWRLCSVTQVEEVKCVLRLLPIWLCTILYSVVFTQ  356

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKRE-PKL  424
            + SLFV QGAAM T I +F +P +SM+S DI++ + FI  Y   + PL+ +L K E  K 
Sbjct  357  MASLFVVQGAAMKTNIKNFRIPASSMSSFDILNVAFFIFAYRRFLDPLFARLNKTERNKG  416

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEE-------TSSLSIFWQIPQYVLV  583
              ELQR+GIG+VI+I+ M+ AG+VE HRL+  N E E       +S+LSIFWQ+PQY+L+
Sbjct  417  LTELQRMGIGLVIAIMAMISAGIVEIHRLK--NKEPESATSISSSSTLSIFWQVPQYMLI  474

Query  584  GVAEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPG  763
            G +E F+YV Q EFF SQ P  LKS    L M+S +LG+Y+ S+++SIVMKI+T     G
Sbjct  475  GASEVFMYVGQLEFFNSQAPTGLKSFASALCMASISLGNYVSSLLVSIVMKISTTDDVHG  534

Query  764  WVPPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            W+P NLN GHL+RF+FL A + A D V+++ CAK YK I  E
Sbjct  535  WIPENLNKGHLERFYFLLAGLTAADFVVYLICAKWYKYIKSE  576



>ref|XP_008679035.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679036.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679037.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679038.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 ref|XP_008679039.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X3 [Zea 
mays]
 gb|AFW63622.1| hypothetical protein ZEAMMB73_688553 [Zea mays]
Length=582

 Score =   260 bits (664),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 188/280 (67%), Gaps = 9/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +   E            PWR+CTVTQVEEVKC+LR+LPIW+CTI+ S+VF Q
Sbjct  304  RFLDKAATITEEEEEE--------GPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQ  355

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M+T I  FH P ASM+  D++S   FI  Y  +++P+  +L    P+  
Sbjct  356  MASLFVEQGATMDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARL-SGNPQGL  414

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  415  TELQRMGVGLVIGMAAMVVAGVVEVERLKRVAAPDQPSSLSVLWQVPQYALIGASEVFMY  474

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  475  VGQLEFFNGQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNS  534

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GHLDRF+FL AA+  +DL ++V CA  YK I L+  +  +
Sbjct  535  GHLDRFYFLLAALSLVDLAVYVACAMWYKGIKLDGGDGDN  574



>ref|XP_002304892.1| hypothetical protein POPTR_0003s21800g [Populus trichocarpa]
 gb|EEE79871.1| hypothetical protein POPTR_0003s21800g [Populus trichocarpa]
Length=611

 Score =   261 bits (666),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/274 (50%), Positives = 186/274 (68%), Gaps = 7/274 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
             FLD+AA +   ++      S   NPWR+CT++QVEE KCVL++LPIW+CTI+ S+VF Q
Sbjct  326  EFLDKAATVTEDDL------SHQKNPWRLCTISQVEEAKCVLKMLPIWLCTIIYSVVFTQ  379

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+    FH+P ASM++ DI S       Y  I++PL  +L      L 
Sbjct  380  MASLFVEQGDVMNSYAGKFHLPAASMSAFDICSVLVCTGIYRQILVPLAGRLSGNTKGL-  438

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+GIG++I ++ M  AG  E  RL++    ++ SSLSIFWQIPQYVLVG +E F+Y
Sbjct  439  TELQRMGIGLIIGMLAMFAAGATEIERLKHVTEGKKVSSLSIFWQIPQYVLVGASEVFMY  498

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++S+VMKIT K  KPGW+P +LN 
Sbjct  499  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVSMVMKITAKGDKPGWIPDDLNT  558

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            GH+DRF+FL A + A D V+++FCA  Y  I ++
Sbjct  559  GHMDRFYFLIAVLTAFDFVIYLFCANWYTPINID  592



>ref|XP_003570234.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like [Brachypodium distachyon]
Length=585

 Score =   259 bits (663),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 191/279 (68%), Gaps = 5/279 (2%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            R+LD+AA +   E     D  ++ +PWR+CTVTQVEEVKC+L++LPIW+CTI+ S+VF Q
Sbjct  302  RYLDKAATVTEEEYF---DPERMKDPWRLCTVTQVEEVKCILKMLPIWMCTIVYSVVFTQ  358

Query  248  VFSLFVEQGAAMNTKI-ADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKL  424
            + SLFVEQG  M+T I   FH+P ASM+  DI+S   FI  Y  +++P+  +L    P+ 
Sbjct  359  MASLFVEQGTTMDTNIVGSFHVPAASMSVFDILSVLAFIAIYRRVLVPVMARL-SGNPQG  417

Query  425  PNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFI  604
              ELQR+G+G+VI +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+
Sbjct  418  LTELQRMGVGLVIGMGAMVVAGVVEVERLKRVAAPDQPSSLSVLWQVPQYALIGASEVFM  477

Query  605  YVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLN  784
            YV Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN
Sbjct  478  YVGQLEFFNGQAPDGVKSFGSSLCMASISLGNYVSIMLVSVVTSLTAGERRPGWIPGNLN  537

Query  785  DGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEE  901
             GHLDRF+FL AA+  +DL ++V CA  YK I L+   E
Sbjct  538  SGHLDRFYFLLAALSLVDLAVYVACAMWYKGIKLDNSNE  576



>ref|XP_004228926.2| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Solanum lycopersicum]
Length=598

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 197/289 (68%), Gaps = 8/289 (3%)
 Frame = +2

Query  56   MPTNRF--LDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILA  229
            + +N F  LD+AAI+   +      +  V NPWR+CT+TQVEE KC+LR+ PIW+CTI+ 
Sbjct  309  LHSNDFKKLDKAAIVTDEDR-----QRPVINPWRLCTITQVEEAKCILRMFPIWLCTIMY  363

Query  230  SIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMK  409
            S++F Q+ SLFVEQG  M+  I +FH+P ASM++ DI S  T    Y  +++PL  K+  
Sbjct  364  SVIFTQMASLFVEQGEVMDATIGNFHLPAASMSAFDICSVLTCTFLYRFMVVPLAGKI-S  422

Query  410  REPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGV  589
              PK  +ELQR+G+G++I +++M+ AG+ E  RLR      ETSSLSIFWQIPQY+LVG 
Sbjct  423  GNPKGLSELQRMGVGLIIGMLSMVAAGVTEIFRLRRVIPGNETSSLSIFWQIPQYILVGA  482

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF  Q PD +KS+G  L M+S +LG+Y+ S+++++VM  T K  + GW+
Sbjct  483  SEVFMYVGQLEFFNGQAPDGIKSLGSSLCMASMSLGNYVSSMLVNMVMHFTAKGTRHGWI  542

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVEL  916
            P NLN+GH+DRF+FL   +  +DLV FVF AK YK I +E     + E+
Sbjct  543  PENLNNGHIDRFYFLLFGLALVDLVAFVFFAKWYKGINIEDSNHGEKEI  591



>ref|XP_008679033.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X1 [Zea 
mays]
Length=628

 Score =   260 bits (665),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 188/280 (67%), Gaps = 9/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +   E            PWR+CTVTQVEEVKC+LR+LPIW+CTI+ S+VF Q
Sbjct  350  RFLDKAATITEEEEEE--------GPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQ  401

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M+T I  FH P ASM+  D++S   FI  Y  +++P+  +L    P+  
Sbjct  402  MASLFVEQGATMDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARL-SGNPQGL  460

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  461  TELQRMGVGLVIGMAAMVVAGVVEVERLKRVAAPDQPSSLSVLWQVPQYALIGASEVFMY  520

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  521  VGQLEFFNGQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNS  580

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GHLDRF+FL AA+  +DL ++V CA  YK I L+  +  +
Sbjct  581  GHLDRFYFLLAALSLVDLAVYVACAMWYKGIKLDGGDGDN  620



>ref|XP_006354232.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Solanum tuberosum]
Length=576

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/291 (47%), Positives = 199/291 (68%), Gaps = 8/291 (3%)
 Frame = +2

Query  56   MPTNRF--LDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILA  229
            + +N F  LD+AAI+   +      +  V NPWR+CT+TQVEE KC++R+ PIW+CTI+ 
Sbjct  287  LHSNDFKKLDKAAIVTDED-----RQRPVINPWRLCTITQVEEAKCIIRMFPIWLCTIMY  341

Query  230  SIVFVQVFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMK  409
            S++F Q+ SLFVEQG  M+  I +FH+P ASM++ DI S  T    Y  +++PL  K+  
Sbjct  342  SVIFTQMASLFVEQGEVMDATIGNFHLPAASMSAFDICSVLTCTFLYRFMVVPLAGKI-S  400

Query  410  REPKLPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGV  589
              P+  +ELQR+G+G++I +++M+ AG+ E  RLR      ETSSLSIFWQIPQY+LVG 
Sbjct  401  GNPRGLSELQRMGVGLIIGMLSMVAAGVTEIFRLRRVIPGNETSSLSIFWQIPQYILVGA  460

Query  590  AEAFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWV  769
            +E F+YV Q EFF  Q PD +KS+G  L M+S +LG+Y+ S+++++VM  T K  + GW+
Sbjct  461  SEVFMYVGQLEFFNGQAPDGIKSLGSSLCMASMSLGNYVSSMLVNMVMHFTAKGTRHGWI  520

Query  770  PPNLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVELVE  922
            P NLN+GH+DRF+FL   +  +D+V FVF AK YK I +E     + E+V+
Sbjct  521  PENLNNGHIDRFYFLLFGLALVDMVAFVFFAKWYKGINIEDSNHGEKEIVQ  571



>ref|XP_008679034.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2-like isoform X2 [Zea 
mays]
Length=625

 Score =   260 bits (665),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 188/280 (67%), Gaps = 9/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +   E            PWR+CTVTQVEEVKC+LR+LPIW+CTI+ S+VF Q
Sbjct  347  RFLDKAATITEEEEEE--------GPWRLCTVTQVEEVKCILRMLPIWLCTIVYSVVFTQ  398

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA M+T I  FH P ASM+  D++S   FI  Y  +++P+  +L    P+  
Sbjct  399  MASLFVEQGATMDTNIGSFHFPAASMSLFDVLSVLAFIAIYRRVLVPVMARL-SGNPQGL  457

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI +  M++AG+VE  RL+     ++ SSLS+ WQ+PQY L+G +E F+Y
Sbjct  458  TELQRMGVGLVIGMAAMVVAGVVEVERLKRVAAPDQPSSLSVLWQVPQYALIGASEVFMY  517

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  518  VGQLEFFNGQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNS  577

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GHLDRF+FL AA+  +DL ++V CA  YK I L+  +  +
Sbjct  578  GHLDRFYFLLAALSLVDLAVYVACAMWYKGIKLDGGDGDN  617



>gb|AES77223.2| peptide/nitrate transporter [Medicago truncatula]
Length=585

 Score =   258 bits (660),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/280 (49%), Positives = 192/280 (69%), Gaps = 9/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA         + D ++  N WR+CTVTQVEE KCVLR++P+W+CTI+ S+VF Q
Sbjct  306  RFMDKAATRT------VKDGNESGNQWRLCTVTQVEEAKCVLRMIPVWLCTIIYSVVFTQ  359

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN K+  FH+P A+M+  DI S       Y  +++PL  KL    PK  
Sbjct  360  MASLFVEQGDVMNNKVGKFHLPAATMSVFDICSVLVCTGLYRQVLVPLAGKL-SGNPKGL  418

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+G+G+VI ++ M+ AG+ E  RL+     ++ S+LSIF QIPQYVLVG +E F+Y
Sbjct  419  SELQRMGVGLVIGMLAMVAAGVTEFERLKQVQPGQKQSNLSIFCQIPQYVLVGASEVFMY  478

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM  T +  +PGW+P NLN 
Sbjct  479  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMMVKLVMIFTARGEEPGWIPNNLNV  538

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GH+DRFF+L AA+ ALDLV++VFCA+ YK +    +E +D
Sbjct  539  GHMDRFFYLIAALSALDLVIYVFCARWYKGVT--NIEGSD  576



>ref|XP_010046691.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1-like [Eucalyptus grandis]
Length=596

 Score =   258 bits (660),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 193/285 (68%), Gaps = 13/285 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +   ++          NPWR+CTVTQVEE KCVL++LP+W+CTI+ S+VF Q+
Sbjct  312  FLDKAATITEDDLC------HSRNPWRLCTVTQVEEAKCVLKMLPVWLCTIMYSVVFTQM  365

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREPK  421
             SLFVEQG  M +    FH+P ASM++ DI S    +IC   Y  II+PL  +L    P+
Sbjct  366  ASLFVEQGDVMRSNFGKFHVPAASMSAFDICS---VLICTGIYRRIIVPLAGRL-SSNPQ  421

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               ELQR+G+G++  ++ M+ AG  E  RL+Y    +++SSLSIFWQ PQYVLVGV+E F
Sbjct  422  GLTELQRMGVGLIFGMLAMVAAGATEIQRLKYVEPGKKSSSLSIFWQTPQYVLVGVSEVF  481

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD +KS G  L M+S +LG+++ S+++ +V  ITT+  + GW+P +L
Sbjct  482  MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNFVSSLLVIMVTAITTRGNEQGWIPQDL  541

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVEL  916
            N GH+DRF+FL A + A D ++++FCAK YK I LE   +T V++
Sbjct  542  NKGHIDRFYFLLAVLTAFDFMIYLFCAKWYKCINLEADNKTAVKI  586



>gb|KCW87117.1| hypothetical protein EUGRSUZ_B03643 [Eucalyptus grandis]
Length=584

 Score =   258 bits (659),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 193/285 (68%), Gaps = 13/285 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +   ++          NPWR+CTVTQVEE KCVL++LP+W+CTI+ S+VF Q+
Sbjct  300  FLDKAATITEDDLC------HSRNPWRLCTVTQVEEAKCVLKMLPVWLCTIMYSVVFTQM  353

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREPK  421
             SLFVEQG  M +    FH+P ASM++ DI S    +IC   Y  II+PL  +L    P+
Sbjct  354  ASLFVEQGDVMRSNFGKFHVPAASMSAFDICS---VLICTGIYRRIIVPLAGRL-SSNPQ  409

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               ELQR+G+G++  ++ M+ AG  E  RL+Y    +++SSLSIFWQ PQYVLVGV+E F
Sbjct  410  GLTELQRMGVGLIFGMLAMVAAGATEIQRLKYVEPGKKSSSLSIFWQTPQYVLVGVSEVF  469

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +YV Q EFF  Q PD +KS G  L M+S +LG+++ S+++ +V  ITT+  + GW+P +L
Sbjct  470  MYVGQLEFFNGQAPDGIKSFGSSLCMASISLGNFVSSLLVIMVTAITTRGNEQGWIPQDL  529

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVEL  916
            N GH+DRF+FL A + A D ++++FCAK YK I LE   +T V++
Sbjct  530  NKGHIDRFYFLLAVLTAFDFMIYLFCAKWYKCINLEADNKTAVKI  574



>ref|XP_007139567.1| hypothetical protein PHAVU_008G040600g [Phaseolus vulgaris]
 gb|ESW11561.1| hypothetical protein PHAVU_008G040600g [Phaseolus vulgaris]
Length=598

 Score =   258 bits (659),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 152/284 (54%), Positives = 208/284 (73%), Gaps = 9/284 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA++ S ++  + +  +  NPWR+ TVTQVEEVKCVLRLLPIW+CTI+ S+VF Q
Sbjct  309  RFLDKAALITSKDLEQIEENKR--NPWRLSTVTQVEEVKCVLRLLPIWLCTIMYSVVFAQ  366

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFV QG AM+T+++ F++PPASM+S DI+  + FI  Y + + PL  K MK   KL 
Sbjct  367  MASLFVVQGDAMDTRVSSFNIPPASMSSFDILGVAFFIFIYRHALDPLVAKTMK--SKL-  423

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+G+G+V++I+ M+ AG VE+ RLRYA    +  + +SSLSIFWQ+PQYVL G +E
Sbjct  424  TELQRMGVGLVLAIMAMVSAGTVEKFRLRYAIKDCDKCDGSSSLSIFWQVPQYVLTGASE  483

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF  Q P+ LKS G  L M+S +LG+Y+ S++++IVMKI+TKH  PGW+P 
Sbjct  484  VFMYVPQLEFFNGQAPEGLKSFGSALCMTSISLGNYVSSLLVAIVMKISTKHDIPGWIPG  543

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            NLN GHLDRFFFL AA+   DLV+++  AK YK +  E  +E +
Sbjct  544  NLNLGHLDRFFFLLAALTLADLVVYIALAKWYKYVKFEGNQELE  587



>gb|AGT17043.1| Proton-dependent oligopeptide transporter family [Saccharum hybrid 
cultivar R570]
Length=606

 Score =   258 bits (660),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 186/274 (68%), Gaps = 9/274 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA +   E        ++ N WR+CTVTQVEEVKC+L++LPIW+ TI+ S+VF Q
Sbjct  328  RFLDKAATITEGE--------KMENQWRLCTVTQVEEVKCILKMLPIWLSTIVYSVVFTQ  379

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQGA MNT I  FH P ASM+  D++S   FI  Y  +++P+  +L    P+  
Sbjct  380  MASLFVEQGATMNTNIGSFHFPAASMSLFDVLSVLVFIAIYRRVLVPVMARL-SGNPQGL  438

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
             ELQR+G+G+VI +  M++AG+VE  RL+     +  SSLS+ WQ+PQY L+G +E F+Y
Sbjct  439  TELQRMGVGLVIGMAAMVVAGVVEVERLKRVAAPDRPSSLSVLWQVPQYALIGASEVFMY  498

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+  +++S+V  +T    +PGW+P NLN 
Sbjct  499  VGQLEFFNGQAPDGVKSFGSALCMASISLGNYVSIMLVSVVTSLTAGEKRPGWIPGNLNS  558

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            GHLDRF+FL AA+  +DL +++ CA  YK I L+
Sbjct  559  GHLDRFYFLLAALSLVDLAVYIACAMCYKGIKLD  592



>ref|XP_010087388.1| Putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB28998.1| Putative peptide/nitrate transporter [Morus notabilis]
Length=668

 Score =   259 bits (663),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/276 (50%), Positives = 193/276 (70%), Gaps = 13/276 (5%)
 Frame = +2

Query  71   FLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQV  250
            FLD+AA +   ++      +   NPWR+CTVTQVEE KCVL++ PIW+CTI+ S+VF Q+
Sbjct  378  FLDKAATLTEKDL------AGPMNPWRICTVTQVEEAKCVLKMFPIWLCTIIYSVVFTQM  431

Query  251  FSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIIC---YENIILPLYVKLMKREPK  421
             SLFVEQG  M++ + +F +P ASM++ DI S    +IC   Y  I++P+  +L    PK
Sbjct  432  ASLFVEQGDLMDSHVGNFRLPAASMSAFDIFS---VLICTGIYRQILVPIAGRL-SGNPK  487

Query  422  LPNELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAF  601
               EL R+GIG++I ++ ML AG+ E  RL+    EE+TSSLSIFWQ+PQYVLVG +E F
Sbjct  488  GLTELHRMGIGLIIGMLAMLAAGITEVERLKRVIPEEKTSSLSIFWQVPQYVLVGASEVF  547

Query  602  IYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNL  781
            +Y+ Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT K  +PGW+  +L
Sbjct  548  MYIGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSLLVNMVMGITAKGEQPGWISDDL  607

Query  782  NDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLE  889
            N GH+DRF+FL AA+ A D V++VFCAK YK I ++
Sbjct  608  NAGHMDRFYFLIAALTAFDFVVYVFCAKWYKCINID  643



>ref|XP_007142617.1| hypothetical protein PHAVU_007G002800g, partial [Phaseolus vulgaris]
 gb|ESW14611.1| hypothetical protein PHAVU_007G002800g, partial [Phaseolus vulgaris]
Length=658

 Score =   259 bits (661),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 193/281 (69%), Gaps = 10/281 (4%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            +F+D+AA +  +E   L  K    NPWR+CTVTQVEE KC+LR+LP+W+CTI+ S+VF Q
Sbjct  374  KFMDKAATIKENEE--LSSK----NPWRLCTVTQVEEAKCLLRMLPVWLCTIIYSVVFTQ  427

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN+ I  FH+P ASM++ DI S       Y  I++P   KL    PK  
Sbjct  428  MASLFVEQGDVMNSYIGSFHLPAASMSAFDICSVLVCTGIYRQILVPFAGKL-SGNPKGL  486

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+GIG+VI ++ M+ +G  E  RL+     ++TSSLSIFWQIPQYVLVG +E F+Y
Sbjct  487  SELQRMGIGLVIGMLAMVASGATEIARLKRIIHGQKTSSLSIFWQIPQYVLVGASEVFMY  546

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++++VM IT +    GW+P NLN 
Sbjct  547  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMLVNMVMIITARGQNKGWIPENLNT  606

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDV  910
            GH+DRFFFL A + A D V+++ CAK YK I    +E++D+
Sbjct  607  GHMDRFFFLLAGLAAFDFVLYLLCAKWYKNI---NVEDSDM  644



>gb|KHN11612.1| Nitrate transporter 1.5 [Glycine soja]
Length=549

 Score =   256 bits (654),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 200/286 (70%), Gaps = 8/286 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RFLD+AA + S     + +     +PW + TVTQVEEVKC+LRLLPIW+CTIL S+VF Q
Sbjct  260  RFLDKAAFITSKNFKQMEESK--CSPWYLSTVTQVEEVKCILRLLPIWLCTILYSVVFAQ  317

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG AM+T+I+ FH+PPASM++ DI+S +  I  Y  ++ PL  + MK   K  
Sbjct  318  MASLFVEQGDAMDTRISRFHIPPASMSTFDILSVAVVIFIYRRVLDPLVARTMK--SKGL  375

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYA----NGEEETSSLSIFWQIPQYVLVGVAE  595
             ELQR+GIG+V++I+ M+ AGLVE  RL+ A    N  E +SSLSIFWQ+PQYVLVG +E
Sbjct  376  TELQRMGIGLVLAIMAMVSAGLVEHFRLKNAIEDCNECEGSSSLSIFWQVPQYVLVGASE  435

Query  596  AFIYVAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPP  775
             F+YV Q EFF +Q PD LKS G  L M+S +LG+Y+ S++++IVMKI+     PGW+P 
Sbjct  436  VFMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVAIVMKISATDEMPGWIPG  495

Query  776  NLNDGHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETDVE  913
            NLN GHLD F+FL AA+ A DLV++V  A+ YK I  +   +  + 
Sbjct  496  NLNKGHLDMFYFLLAALTAADLVIYVLMARWYKYIKFQGNNDNGIN  541



>gb|ABN09773.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
Length=648

 Score =   258 bits (660),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/280 (49%), Positives = 192/280 (69%), Gaps = 9/280 (3%)
 Frame = +2

Query  68   RFLDRAAIMASSEMTLLPDKSQVPNPWRVCTVTQVEEVKCVLRLLPIWVCTILASIVFVQ  247
            RF+D+AA         + D ++  N WR+CTVTQVEE KCVLR++P+W+CTI+ S+VF Q
Sbjct  369  RFMDKAATRT------VKDGNESGNQWRLCTVTQVEEAKCVLRMIPVWLCTIIYSVVFTQ  422

Query  248  VFSLFVEQGAAMNTKIADFHMPPASMTSVDIISSSTFIICYENIILPLYVKLMKREPKLP  427
            + SLFVEQG  MN K+  FH+P A+M+  DI S       Y  +++PL  KL    PK  
Sbjct  423  MASLFVEQGDVMNNKVGKFHLPAATMSVFDICSVLVCTGLYRQVLVPLAGKL-SGNPKGL  481

Query  428  NELQRIGIGMVISIITMLIAGLVEQHRLRYANGEEETSSLSIFWQIPQYVLVGVAEAFIY  607
            +ELQR+G+G+VI ++ M+ AG+ E  RL+     ++ S+LSIF QIPQYVLVG +E F+Y
Sbjct  482  SELQRMGVGLVIGMLAMVAAGVTEFERLKQVQPGQKQSNLSIFCQIPQYVLVGASEVFMY  541

Query  608  VAQWEFFASQVPDslksiglglsmsssalgsylcsIILSIVMKITTKHGKPGWVPPNLND  787
            V Q EFF  Q PD +KS G  L M+S +LG+Y+ S+++ +VM  T +  +PGW+P NLN 
Sbjct  542  VGQLEFFNGQAPDGIKSFGSSLCMASISLGNYVSSMMVKLVMIFTARGEEPGWIPNNLNV  601

Query  788  GHLDRFFFLSAAIVALDLVMFVFCAKRYKAIVLEKLEETD  907
            GH+DRFF+L AA+ ALDLV++VFCA+ YK +    +E +D
Sbjct  602  GHMDRFFYLIAALSALDLVIYVFCARWYKGVT--NIEGSD  639



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5085976925088