BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25945_g1_i2 len=2361 path=[9189:0-55 5374:56-79 5398:80-145
107:146-160 122:161-172 134:173-197 15483:198-212 174:213-243
15516:244-244 206:245-278 240:279-296 15539:297-311 273:312-328
290:329-349 15597:350-350 15598:351-352 314:353-357 15601:358-379
15623:380-388 15632:389-410 372:411-441 15662:442-443 15664:444-461
423:462-527 15692:528-540 502:541-545 507:546-583 15728:584-626
15766:627-631 10294:632-683 15814:684-697 15828:698-719
15848:720-728 690:729-752 714:753-805 15924:806-812 15931:813-816
13957:817-817 15947:818-830 15960:831-833 15963:834-841
13982:842-850 7626:851-859 821:860-939 901:940-1018 16072:1019-1057
16042:1058-1080 1042:1081-1118 11199:1119-1189 16148:1190-1211
11290:1212-1214 1176:1215-1215 1177:1216-1239 1201:1240-1246
1208:1247-1271 9128:1272-1276 16221:1277-1277 1239:1278-1323
1285:1324-1356 16268:1357-1366 1328:1367-1371 16288:1372-1383
16300:1384-1397 1359:1398-1418 16315:1419-1427 1389:1428-1489
1451:1490-1504 1466:1505-1532 16385:1533-1540 1502:1541-1550
16397:1551-1569 1531:1570-1606 1568:1607-1607 1569:1608-1639
13810:1640-1673 13843:1674-1680 9076:1681-1699 13868:1700-1700
1647:1701-1741 5094:1742-1742 1689:1743-1783 1730:1784-1805
1752:1806-1831 5740:1832-1844 5753:1845-1884 5793:1885-1910
16604:1911-1927 1877:1928-1942 16631:1943-1955 1905:1956-1979
16653:1980-1981 16655:1982-1993 6302:1994-2003 1953:2004-2036
16690:2037-2051 16705:2052-2072 2022:2073-2106 2056:2107-2107
16759:2108-2110 2060:2111-2119 2069:2120-2123 2073:2124-2125
2075:2126-2162 2112:2163-2201 2151:2202-2296 16877:2297-2298
16879:2299-2308 4908:2309-2321 4921:2322-2360]

Length=2361
                                                                      Score     E

ref|XP_009611073.1|  PREDICTED: subtilisin-like protease SBT5.3         983   0.0     
ref|XP_009759675.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    982   0.0     
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         974   0.0     
emb|CDP06146.1|  unnamed protein product                                965   0.0     
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    965   0.0     Vitis vinifera
gb|KCW88582.1|  hypothetical protein EUGRSUZ_A00959                     963   0.0     
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         961   0.0     
ref|XP_004243217.1|  PREDICTED: subtilisin-like protease SBT5.3         959   0.0     
gb|EYU34388.1|  hypothetical protein MIMGU_mgv1a001745mg                957   0.0     
ref|XP_002320540.2|  subtilisin-like protease family protein            957   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         956   0.0     
gb|ACP18876.1|  subtilisin-like serine protease                         956   0.0     Carica papaya [mamon]
ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    952   0.0     
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         950   0.0     
ref|XP_010107369.1|  Subtilisin-like protease                           947   0.0     
ref|XP_008462019.1|  PREDICTED: subtilisin-like protease isoform X1     944   0.0     
ref|XP_007049440.1|  Subtilisin-like serine endopeptidase family ...    942   0.0     
gb|KGN43389.1|  hypothetical protein Csa_7G030520                       941   0.0     
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         939   0.0     
ref|XP_006447869.1|  hypothetical protein CICLE_v10014351mg             939   0.0     
ref|XP_004144624.1|  PREDICTED: subtilisin-like protease-like           939   0.0     
ref|XP_006469397.1|  PREDICTED: subtilisin-like protease-like iso...    938   0.0     
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease-like           936   0.0     
gb|KDO42093.1|  hypothetical protein CISIN_1g038881mg                   935   0.0     
ref|XP_010048342.1|  PREDICTED: subtilisin-like protease SBT5.3         934   0.0     
emb|CBI39824.3|  unnamed protein product                                933   0.0     
ref|XP_007217687.1|  hypothetical protein PRUPE_ppa001727mg             932   0.0     
ref|XP_008229767.1|  PREDICTED: subtilisin-like protease                931   0.0     
ref|XP_007214967.1|  hypothetical protein PRUPE_ppa001732mg             931   0.0     
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         927   0.0     
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                927   0.0     
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     926   0.0     
ref|XP_009591665.1|  PREDICTED: subtilisin-like protease SBT5.3         925   0.0     
ref|XP_002299062.1|  hypothetical protein POPTR_0001s47280g             925   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         924   0.0     
gb|KDP45154.1|  hypothetical protein JCGZ_15019                         922   0.0     
ref|XP_011039832.1|  PREDICTED: subtilisin-like protease SBT5.4         920   0.0     
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         918   0.0     
ref|XP_008384293.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    918   0.0     
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           917   0.0     
ref|XP_003601486.1|  Subtilisin-like protease                           915   0.0     
ref|XP_006350127.1|  PREDICTED: subtilisin-like protease-like           911   0.0     
ref|XP_007213363.1|  hypothetical protein PRUPE_ppa026835mg             910   0.0     
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             909   0.0     
emb|CDY65487.1|  BnaA03g57660D                                          908   0.0     
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      908   0.0     Ricinus communis
ref|XP_006377976.1|  hypothetical protein POPTR_0011s16870g             907   0.0     
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3         907   0.0     
emb|CDY15084.1|  BnaC03g44450D                                          905   0.0     
ref|XP_008224681.1|  PREDICTED: subtilisin-like protease                904   0.0     
ref|XP_011000330.1|  PREDICTED: subtilisin-like protease SBT5.4         903   0.0     
ref|NP_001267495.1|  SUB1 homolog precursor                             903   0.0     
ref|XP_011005797.1|  PREDICTED: subtilisin-like protease SBT5.4         902   0.0     
ref|XP_010063229.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    902   0.0     
ref|XP_004167057.1|  PREDICTED: subtilisin-like protease-like           902   0.0     
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             901   0.0     
ref|XP_002885743.1|  hypothetical protein ARALYDRAFT_899224             901   0.0     
ref|XP_009374900.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    900   0.0     
gb|AFV08661.1|  subtilisin-like protease                                899   0.0     
ref|XP_008348301.1|  PREDICTED: subtilisin-like protease                899   0.0     
ref|XP_006418604.1|  hypothetical protein EUTSA_v10002408mg             899   0.0     
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3         898   0.0     
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    897   0.0     
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3         897   0.0     
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    895   0.0     
ref|XP_010063228.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    894   0.0     
ref|NP_565309.2|  subtilisin-like serine endopeptidase family pro...    894   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                894   0.0     
ref|XP_010466978.1|  PREDICTED: subtilisin-like protease SBT5.3         893   0.0     
ref|XP_010252985.1|  PREDICTED: subtilisin-like protease SBT5.4         890   0.0     
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                889   0.0     
gb|KDO78650.1|  hypothetical protein CISIN_1g048642mg                   888   0.0     
ref|XP_006468177.1|  PREDICTED: subtilisin-like protease-like           887   0.0     
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                887   0.0     
ref|XP_010063230.1|  PREDICTED: subtilisin-like protease SBT5.4         885   0.0     
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         884   0.0     
gb|KFK31799.1|  hypothetical protein AALP_AA6G160400                    884   0.0     
gb|AAC62611.1|  subtilisin-like protease                                882   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4         882   0.0     
ref|XP_010059708.1|  PREDICTED: subtilisin-like protease SBT5.4         881   0.0     
gb|KCW75459.1|  hypothetical protein EUGRSUZ_E04225                     881   0.0     
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           878   0.0     
ref|XP_008810184.1|  PREDICTED: subtilisin-like protease SBT5.3         876   0.0     
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         876   0.0     
emb|CDP06171.1|  unnamed protein product                                871   0.0     
ref|XP_007207992.1|  hypothetical protein PRUPE_ppa015005mg             869   0.0     
ref|XP_010092373.1|  Subtilisin-like protease                           869   0.0     
ref|XP_007020377.1|  Xylem serine proteinase 1, putative                867   0.0     
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         866   0.0     
gb|KDP32632.1|  hypothetical protein JCGZ_13182                         865   0.0     
ref|XP_010096499.1|  Subtilisin-like protease                           864   0.0     
gb|KCW70438.1|  hypothetical protein EUGRSUZ_F03663                     864   0.0     
ref|XP_002525223.1|  Xylem serine proteinase 1 precursor, putative      864   0.0     Ricinus communis
ref|XP_010063227.1|  PREDICTED: subtilisin-like protease SBT5.4         863   0.0     
gb|AAM15483.1|  subtilisin-like serine protease AIR3                    862   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KCW70439.1|  hypothetical protein EUGRSUZ_F03664                     860   0.0     
gb|KGN55998.1|  hypothetical protein Csa_3G045120                       860   0.0     
ref|XP_010064971.1|  PREDICTED: subtilisin-like protease SBT5.4         860   0.0     
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         857   0.0     
gb|KEH32715.1|  subtilisin-like serine protease                         857   0.0     
ref|XP_006400913.1|  hypothetical protein EUTSA_v10015943mg             857   0.0     
ref|XP_010539197.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    855   0.0     
ref|XP_006469402.1|  PREDICTED: subtilisin-like protease-like           854   0.0     
ref|XP_009394691.1|  PREDICTED: subtilisin-like protease SBT5.3         854   0.0     
gb|AIC80771.1|  subtilase                                               852   0.0     
ref|XP_006447860.1|  hypothetical protein CICLE_v10014355mg             852   0.0     
ref|XP_004499342.1|  PREDICTED: subtilisin-like protease-like           851   0.0     
ref|XP_007206786.1|  hypothetical protein PRUPE_ppa025514mg             851   0.0     
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         850   0.0     
ref|XP_009784573.1|  PREDICTED: subtilisin-like protease SBT5.4         850   0.0     
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         849   0.0     
ref|XP_009396094.1|  PREDICTED: subtilisin-like protease SBT5.3         849   0.0     
ref|XP_011095872.1|  PREDICTED: subtilisin-like protease SBT5.4         848   0.0     
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3         849   0.0     
ref|XP_010108994.1|  Subtilisin-like protease                           850   0.0     
ref|XP_010443761.1|  PREDICTED: subtilisin-like protease SBT5.4         848   0.0     
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease                846   0.0     
ref|XP_009610677.1|  PREDICTED: subtilisin-like protease SBT5.4         846   0.0     
ref|XP_011039899.1|  PREDICTED: subtilisin-like protease SBT5.4         850   0.0     
ref|XP_006449983.1|  hypothetical protein CICLE_v10018000mg             844   0.0     
ref|XP_010693559.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    855   0.0     
ref|XP_010657502.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    836   0.0     
ref|XP_010455547.1|  PREDICTED: subtilisin-like protease SBT5.4         842   0.0     
ref|XP_004296127.1|  PREDICTED: subtilisin-like protease-like           842   0.0     
ref|XP_006282063.1|  hypothetical protein CARUB_v10028308mg             842   0.0     
emb|CDY65693.1|  BnaA02g06800D                                          841   0.0     
ref|XP_004515893.1|  PREDICTED: subtilisin-like protease-like           840   0.0     
ref|XP_009759676.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    833   0.0     
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    839   0.0     
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    839   0.0     
ref|XP_003528716.1|  PREDICTED: subtilisin-like protease-like           838   0.0     
gb|KEH35216.1|  subtilisin-like serine protease                         833   0.0     
ref|XP_004515894.1|  PREDICTED: subtilisin-like protease-like           837   0.0     
gb|KHN40225.1|  Subtilisin-like protease                                836   0.0     
ref|XP_009126658.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    837   0.0     
ref|XP_003625338.1|  Subtilisin-like serine protease                    836   0.0     
ref|XP_002308740.2|  hypothetical protein POPTR_0006s00370g             833   0.0     Populus trichocarpa [western balsam poplar]
ref|NP_200789.2|  Subtilase 5.4                                         837   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296137.1|  PREDICTED: subtilisin-like protease-like           836   0.0     
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    862   0.0     
dbj|BAB08348.1|  serine protease-like protein                           835   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447864.1|  hypothetical protein CICLE_v10017839mg             832   0.0     
gb|EYU27629.1|  hypothetical protein MIMGU_mgv1a001914mg                832   0.0     
ref|XP_003608826.1|  Subtilisin-like protease                           833   0.0     
ref|XP_010538433.1|  PREDICTED: subtilisin-like protease SBT5.4         832   0.0     
gb|KGN55992.1|  hypothetical protein Csa_3G045060                       828   0.0     
ref|XP_004169297.1|  PREDICTED: subtilisin-like protease-like           831   0.0     
ref|XP_009587856.1|  PREDICTED: subtilisin-like protease SBT5.4         825   0.0     
emb|CDY40408.1|  BnaA02g27220D                                          824   0.0     
gb|AES91025.2|  subtilisin-like serine protease                         823   0.0     
emb|CDY37334.1|  BnaC02g33520D                                          823   0.0     
ref|XP_009107091.1|  PREDICTED: subtilisin-like protease SBT5.4         822   0.0     
ref|XP_010942532.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    823   0.0     
ref|XP_010942533.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    822   0.0     
ref|XP_002299064.1|  hypothetical protein POPTR_0001s47300g             821   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3         819   0.0     
ref|XP_003608828.1|  Subtilisin-like serine protease                    820   0.0     
gb|AES91026.2|  subtilisin-like serine protease                         819   0.0     
gb|AES91027.2|  subtilisin-like serine protease                         818   0.0     
ref|XP_004951554.1|  PREDICTED: subtilisin-like protease-like iso...    818   0.0     
ref|XP_002530613.1|  Xylem serine proteinase 1 precursor, putative      815   0.0     Ricinus communis
ref|XP_006469398.1|  PREDICTED: subtilisin-like protease-like iso...    811   0.0     
ref|XP_008462020.1|  PREDICTED: subtilisin-like protease isoform X2     812   0.0     
ref|XP_006398487.1|  hypothetical protein EUTSA_v10001201mg             816   0.0     
ref|XP_003608829.1|  Subtilisin-like serine protease                    816   0.0     
ref|XP_004957134.1|  PREDICTED: subtilisin-like protease-like           816   0.0     
ref|XP_009759335.1|  PREDICTED: subtilisin-like protease SBT5.4         814   0.0     
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4         814   0.0     
dbj|BAC42673.1|  putative subtilisin-like protease                      812   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049441.1|  Subtilisin-like serine endopeptidase family ...    804   0.0     
ref|XP_004951553.1|  PREDICTED: subtilisin-like protease-like iso...    811   0.0     
ref|XP_002866352.1|  subtilase family protein                           808   0.0     
ref|XP_010942695.1|  PREDICTED: subtilisin-like protease SBT5.3         808   0.0     
ref|XP_011039898.1|  PREDICTED: subtilisin-like protease SBT5.4         805   0.0     
ref|XP_002299063.2|  hypothetical protein POPTR_0001s47290g             804   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002530614.1|  Cucumisin precursor, putative                      803   0.0     Ricinus communis
ref|XP_007155547.1|  hypothetical protein PHAVU_003G210900g             802   0.0     
ref|XP_003608824.1|  Subtilisin-like protease                           803   0.0     
ref|XP_010092360.1|  Subtilisin-like protease                           800   0.0     
gb|KEH35215.1|  subtilisin-like serine protease                         795   0.0     
ref|XP_006857645.1|  hypothetical protein AMTR_s00061p00140690          800   0.0     
ref|XP_008794758.1|  PREDICTED: subtilisin-like protease SBT5.3         799   0.0     
gb|EEE69917.1|  hypothetical protein OsJ_29768                          800   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148290.1|  PREDICTED: uncharacterized protein LOC101212014    828   0.0     
ref|XP_008449184.1|  PREDICTED: uncharacterized protein LOC103491134    822   0.0     
gb|KGN64982.1|  hypothetical protein Csa_1G171040                       796   0.0     
ref|XP_004159123.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    795   0.0     
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like           795   0.0     
ref|XP_004162792.1|  PREDICTED: subtilisin-like protease-like           796   0.0     
ref|XP_004148289.1|  PREDICTED: subtilisin-like protease-like           795   0.0     
ref|XP_003608830.1|  Subtilisin-like serine protease                    819   0.0     
ref|XP_008645399.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    793   0.0     
ref|XP_008464322.1|  PREDICTED: subtilisin-like protease                790   0.0     
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         789   0.0     
ref|XP_008448997.1|  PREDICTED: subtilisin-like protease                789   0.0     
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    786   0.0     
emb|CBI38460.3|  unnamed protein product                                788   0.0     
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    787   0.0     
ref|NP_001046210.1|  Os02g0198700                                       788   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EAY84890.1|  hypothetical protein OsI_06255                          788   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      785   0.0     Ricinus communis
ref|XP_004164572.1|  PREDICTED: subtilisin-like protease-like           785   0.0     
gb|KGN55995.1|  hypothetical protein Csa_3G045090                       784   0.0     
ref|XP_007154079.1|  hypothetical protein PHAVU_003G089100g             785   0.0     
ref|XP_009126659.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    782   0.0     
ref|XP_008645398.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    786   0.0     
gb|KHN14107.1|  Subtilisin-like protease                                791   0.0     
ref|XP_008359025.1|  PREDICTED: subtilisin-like protease                773   0.0     
gb|KDP35557.1|  hypothetical protein JCGZ_08995                         778   0.0     
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             775   0.0     
dbj|BAK01624.1|  predicted protein                                      776   0.0     
ref|XP_006857622.1|  hypothetical protein AMTR_s00061p00122710          774   0.0     
gb|AIC80772.1|  subtilase                                               772   0.0     
ref|XP_004500162.1|  PREDICTED: subtilisin-like protease-like           773   0.0     
gb|KEH31720.1|  subtilisin-like serine protease                         772   0.0     
emb|CAN62337.1|  hypothetical protein VITISV_004299                     765   0.0     Vitis vinifera
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             771   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3         769   0.0     
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4         769   0.0     Vitis vinifera
gb|AET00862.2|  subtilisin-like serine protease                         769   0.0     
emb|CBI38462.3|  unnamed protein product                                769   0.0     
emb|CBI38458.3|  unnamed protein product                                766   0.0     
ref|XP_008344750.1|  PREDICTED: subtilisin-like protease                761   0.0     
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         764   0.0     
ref|XP_002309930.2|  hypothetical protein POPTR_0007s04500g             763   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      762   0.0     Ricinus communis
ref|XP_003600434.1|  Subtilisin-like protease                           761   0.0     
ref|XP_008449005.1|  PREDICTED: subtilisin-like protease isoform X2     758   0.0     
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         761   0.0     
ref|XP_011022895.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    761   0.0     
ref|XP_008464289.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    760   0.0     
gb|AES70685.2|  subtilisin-like serine protease                         758   0.0     
ref|XP_008661010.1|  PREDICTED: subtilisin-like protease SBT5.3         758   0.0     
ref|XP_010675634.1|  PREDICTED: subtilisin-like protease SBT5.4         757   0.0     
ref|XP_006475104.1|  PREDICTED: subtilisin-like protease-like           757   0.0     
ref|XP_004491541.1|  PREDICTED: subtilisin-like protease-like           757   0.0     
ref|XP_011022894.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    756   0.0     
gb|ACN85315.1|  subtilisin-like protease precursor                      756   0.0     Oryza brachyantha
ref|XP_006452710.1|  hypothetical protein CICLE_v10010380mg             753   0.0     
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         753   0.0     
ref|XP_006452708.1|  hypothetical protein CICLE_v10010806mg             752   0.0     
ref|XP_004296128.1|  PREDICTED: subtilisin-like protease-like           750   0.0     
gb|KDO74053.1|  hypothetical protein CISIN_1g047013mg                   751   0.0     
gb|ACN85269.1|  subtilisin-like protease precursor                      751   0.0     Oryza alta
gb|EPS60041.1|  subtilase family protein                                748   0.0     
ref|XP_006475105.1|  PREDICTED: subtilisin-like protease-like           755   0.0     
ref|XP_006380388.1|  hypothetical protein POPTR_0007s04520g             751   0.0     
ref|XP_008650860.1|  PREDICTED: uncharacterized protein LOC100192...    750   0.0     
ref|XP_004515813.1|  PREDICTED: subtilisin-like protease-like           748   0.0     
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g             745   0.0     
dbj|BAD35630.1|  putative subtilisin-like proteinase                    746   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008449002.1|  PREDICTED: subtilisin-like protease isoform X1     743   0.0     
gb|ACN85165.1|  subtilisin-like protease precursor                      745   0.0     Oryza nivara
ref|XP_003571078.1|  PREDICTED: subtilisin-like protease SBT5.3         745   0.0     
ref|XP_003576659.2|  PREDICTED: subtilisin-like protease SBT5.4         739   0.0     
ref|XP_008229805.1|  PREDICTED: subtilisin-like protease                736   0.0     
gb|KGN64981.1|  hypothetical protein Csa_1G171030                       740   0.0     
emb|CDP06138.1|  unnamed protein product                                744   0.0     
ref|XP_004159122.1|  PREDICTED: subtilisin-like protease-like           739   0.0     
emb|CAJ75644.1|  subtilisin-like protease                               735   0.0     Triticum aestivum [Canadian hard winter wheat]
gb|KHN44769.1|  Subtilisin-like protease                                736   0.0     
ref|XP_006595826.1|  PREDICTED: subtilisin-like protease-like iso...    736   0.0     
ref|XP_006648425.1|  PREDICTED: subtilisin-like protease-like           733   0.0     
ref|XP_004967192.1|  PREDICTED: subtilisin-like protease-like           733   0.0     
gb|ACN85256.1|  subtilisin-like protease precursor                      733   0.0     Oryza alta
gb|ACN85243.1|  subtilisin-like protease precursor                      733   0.0     Oryza officinalis
gb|ACN85215.1|  subtilisin-like protease precursor                      731   0.0     Oryza punctata
ref|XP_002269456.2|  PREDICTED: subtilisin-like protease SBT5.4         722   0.0     Vitis vinifera
gb|KDO74052.1|  hypothetical protein CISIN_1g040503mg                   729   0.0     
ref|XP_002517380.1|  Xylem serine proteinase 1 precursor, putative      728   0.0     Ricinus communis
gb|KHN44767.1|  Subtilisin-like protease                                728   0.0     
gb|EEC84763.1|  hypothetical protein OsI_31779                          741   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007026418.1|  Subtilase family protein, putative                 726   0.0     
ref|XP_003560594.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    724   0.0     
ref|XP_004139596.1|  PREDICTED: subtilisin-like protease-like           724   0.0     
ref|XP_010227516.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    721   0.0     
gb|EEC80955.1|  hypothetical protein OsI_23669                          731   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_003545195.1|  PREDICTED: subtilisin-like protease-like           719   0.0     
ref|XP_002437266.1|  hypothetical protein SORBIDRAFT_10g023870          718   0.0     Sorghum bicolor [broomcorn]
ref|XP_007139652.1|  hypothetical protein PHAVU_008G047900g             714   0.0     
ref|XP_011100610.1|  PREDICTED: subtilisin-like protease SBT5.4         714   0.0     
dbj|BAK07347.1|  predicted protein                                      714   0.0     
gb|ACN85198.1|  subtilisin-like protease precursor                      713   0.0     
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661              711   0.0     
ref|XP_006447865.1|  hypothetical protein CICLE_v10018333mg             707   0.0     
ref|XP_002972076.1|  hypothetical protein SELMODRAFT_172478             708   0.0     
ref|XP_008380083.1|  PREDICTED: subtilisin-like protease                702   0.0     
ref|XP_006602865.1|  PREDICTED: subtilisin-like protease-like           709   0.0     
ref|XP_003616914.1|  Subtilisin-like protease                           708   0.0     
ref|XP_007139650.1|  hypothetical protein PHAVU_008G047700g             707   0.0     
ref|XP_003614591.1|  Subtilisin-like protease                           703   0.0     
gb|KEH31721.1|  subtilisin-like serine protease                         701   0.0     
emb|CAN77862.1|  hypothetical protein VITISV_022393                     706   0.0     
ref|XP_006602868.1|  PREDICTED: subtilisin-like protease-like           707   0.0     
ref|XP_008357992.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    699   0.0     
gb|KHN40540.1|  Subtilisin-like protease                                706   0.0     
gb|KGN55997.1|  hypothetical protein Csa_3G045110                       697   0.0     
ref|XP_003533568.1|  PREDICTED: subtilisin-like protease-like           701   0.0     
gb|KHN11556.1|  Subtilisin-like protease                                699   0.0     
ref|XP_007141639.1|  hypothetical protein PHAVU_008G213000g             699   0.0     
ref|XP_004491111.1|  PREDICTED: subtilisin-like protease-like           697   0.0     
dbj|BAC22315.1|  putative subtilisin-like serine protease AIR3          696   0.0     
ref|XP_004492929.1|  PREDICTED: subtilisin-like protease-like iso...    697   0.0     
emb|CBI29567.3|  unnamed protein product                                691   0.0     
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             699   0.0     
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668              696   0.0     
ref|XP_010647520.1|  PREDICTED: subtilisin-like protease SBT5.3         691   0.0     
ref|XP_004492919.1|  PREDICTED: subtilisin-like protease-like           692   0.0     
gb|KHM99088.1|  Subtilisin-like protease                                691   0.0     
ref|XP_007155591.1|  hypothetical protein PHAVU_003G215100g             686   0.0     
ref|XP_003545192.1|  PREDICTED: subtilisin-like protease-like           691   0.0     
gb|EMT31638.1|  Subtilisin-like protease                                688   0.0     
ref|XP_006452711.1|  hypothetical protein CICLE_v10010711mg             691   0.0     
ref|XP_003571633.1|  PREDICTED: subtilisin-like protease SBT5.3         690   0.0     
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3         690   0.0     
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3         686   0.0     
ref|XP_004492921.1|  PREDICTED: subtilisin-like protease-like           682   0.0     
ref|XP_006475103.1|  PREDICTED: subtilisin-like protease-like           682   0.0     
gb|KHN40543.1|  Subtilisin-like protease                                679   0.0     
ref|XP_003624300.1|  Subtilisin-like protease                           681   0.0     
sp|I1N462.3|SBT1_SOYBN  RecName: Full=Subtilisin-like protease Gl...    681   0.0     
ref|XP_004492930.1|  PREDICTED: subtilisin-like protease-like iso...    676   0.0     
gb|EAZ42320.1|  hypothetical protein OsJ_26892                          694   0.0     
ref|XP_006452712.1|  hypothetical protein CICLE_v10010631mg             677   0.0     
gb|AES80526.2|  subtilisin-like serine protease                         677   0.0     
gb|KHN40545.1|  Subtilisin-like protease                                675   0.0     
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3         675   0.0     
ref|XP_001777292.1|  predicted protein                                  672   0.0     
ref|XP_008794760.1|  PREDICTED: subtilisin-like protease SBT5.3         670   0.0     
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like           672   0.0     
ref|XP_002463463.1|  hypothetical protein SORBIDRAFT_01g000350          671   0.0     
gb|KDO74051.1|  hypothetical protein CISIN_1g044682mg                   668   0.0     
gb|AAM15440.1|  subtilisin-like serine protease AIR3                    660   0.0     
gb|EEC83379.1|  hypothetical protein OsI_28793                          684   0.0     
dbj|BAK05312.1|  predicted protein                                      667   0.0     
ref|XP_004492916.1|  PREDICTED: subtilisin-like protease-like           666   0.0     
ref|XP_002988851.1|  hypothetical protein SELMODRAFT_128873             664   0.0     
ref|NP_001151755.1|  subtilisin-like protease precursor                 665   0.0     
tpg|DAA52605.1|  TPA: putative subtilase family protein                 664   0.0     
ref|XP_003624306.1|  Subtilisin-like protease                           661   0.0     
gb|KEH23427.1|  subtilisin-like serine protease                         662   0.0     
ref|XP_002967356.1|  hypothetical protein SELMODRAFT_408319             659   0.0     
ref|XP_003624308.1|  Subtilisin-like serine protease                    660   0.0     
ref|XP_002960359.1|  hypothetical protein SELMODRAFT_437460             658   0.0     
ref|XP_002964212.1|  hypothetical protein SELMODRAFT_81842              656   0.0     
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4         657   0.0     
ref|XP_010272679.1|  PREDICTED: subtilisin-like protease SBT5.4         657   0.0     
gb|EYU28144.1|  hypothetical protein MIMGU_mgv1a001682mg                657   0.0     
gb|KDO74048.1|  hypothetical protein CISIN_1g044993mg                   650   0.0     
ref|XP_010688246.1|  PREDICTED: subtilisin-like protease SBT5.4         652   0.0     
ref|XP_007025242.1|  Subtilase family protein, putative isoform 1       651   0.0     
gb|AES80515.2|  subtilisin-like serine protease                         650   0.0     
ref|XP_002269555.2|  PREDICTED: subtilisin-like protease SBT5.3         647   0.0     
ref|XP_002460418.1|  hypothetical protein SORBIDRAFT_02g027810          643   0.0     
ref|XP_011102178.1|  PREDICTED: subtilisin-like protease                642   0.0     
gb|KDO51019.1|  hypothetical protein CISIN_1g042484mg                   636   0.0     
ref|XP_011010424.1|  PREDICTED: subtilisin-like protease SBT5.3         639   0.0     
ref|XP_011045349.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    638   0.0     
gb|EMT01094.1|  Subtilisin-like protease                                637   0.0     
ref|XP_002453487.1|  hypothetical protein SORBIDRAFT_04g006740          629   0.0     
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease                635   0.0     
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg             635   0.0     
ref|XP_011045348.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    636   0.0     
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease                635   0.0     
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3         635   0.0     
ref|XP_002269375.1|  PREDICTED: subtilisin-like protease SBT5.3         635   0.0     
ref|XP_010052139.1|  PREDICTED: subtilisin-like protease SBT5.3         634   0.0     
ref|XP_006660048.1|  PREDICTED: subtilisin-like protease-like           633   0.0     
ref|XP_002317314.1|  subtilase family protein                           634   0.0     
ref|XP_007025243.1|  Subtilase family protein isoform 2                 632   0.0     
gb|KCW76039.1|  hypothetical protein EUGRSUZ_D00408                     631   0.0     
ref|XP_010676115.1|  PREDICTED: subtilisin-like protease SBT5.4         628   0.0     
gb|KDP29035.1|  hypothetical protein JCGZ_16424                         640   0.0     
ref|XP_009360803.1|  PREDICTED: subtilisin-like protease SBT5.3         629   0.0     
gb|KGN56002.1|  hypothetical protein Csa_3G045160                       624   0.0     
ref|XP_011096454.1|  PREDICTED: subtilisin-like protease                624   0.0     
ref|XP_006467568.1|  PREDICTED: subtilisin-like protease-like           627   0.0     
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease                627   0.0     
ref|XP_006449587.1|  hypothetical protein CICLE_v10014347mg             627   0.0     
gb|EEC71345.1|  hypothetical protein OsI_03414                          623   0.0     
ref|XP_010052138.1|  PREDICTED: subtilisin-like protease SBT5.3         624   0.0     
ref|XP_002522297.1|  Xylem serine proteinase 1 precursor, putative      623   0.0     
ref|XP_010095116.1|  Subtilisin-like protease                           623   0.0     
ref|XP_010675509.1|  PREDICTED: subtilisin-like protease SBT5.4         623   0.0     
ref|NP_001043993.2|  Os01g0702300                                       620   0.0     
gb|EAZ13237.1|  hypothetical protein OsJ_03159                          620   0.0     
ref|XP_004972123.1|  PREDICTED: subtilisin-like protease-like           622   0.0     
ref|XP_010665649.1|  PREDICTED: subtilisin-like protease SBT5.3         615   0.0     
emb|CAN61728.1|  hypothetical protein VITISV_036029                     618   0.0     
ref|XP_009407016.1|  PREDICTED: subtilisin-like protease SBT5.3         613   0.0     
ref|XP_003569718.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    614   0.0     
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940          613   0.0     
ref|XP_004295413.1|  PREDICTED: subtilisin-like protease-like           613   0.0     
dbj|BAD81785.1|  P69E protein-like                                      619   0.0     
ref|XP_010916207.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    612   0.0     
emb|CDY23110.1|  BnaC09g18640D                                          612   0.0     
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             611   0.0     
gb|AFW70718.1|  putative subtilase family protein                       604   0.0     
gb|KFK31536.1|  hypothetical protein AALP_AA6G125100                    611   0.0     
ref|XP_007141643.1|  hypothetical protein PHAVU_008G213300g             606   0.0     
emb|CDY13044.1|  BnaA09g17730D                                          610   0.0     
ref|XP_004134922.1|  PREDICTED: subtilisin-like protease-like           608   0.0     
ref|XP_009114399.1|  PREDICTED: subtilisin-like protease SBT5.3         607   0.0     
ref|XP_003617903.1|  Subtilisin-like protease                           598   0.0     
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                605   0.0     
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like           605   0.0     
ref|XP_002986912.1|  hypothetical protein SELMODRAFT_425827             604   0.0     
ref|XP_004969820.1|  PREDICTED: subtilisin-like protease-like           604   0.0     
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             602   0.0     
ref|NP_199378.1|  subtilase family protein                              604   0.0     
ref|XP_002986914.1|  hypothetical protein SELMODRAFT_425830             602   0.0     
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                602   0.0     
ref|XP_002977794.1|  hypothetical protein SELMODRAFT_107394             600   0.0     
ref|XP_008439697.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    602   0.0     
ref|XP_002863463.1|  subtilase family protein                           602   0.0     
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                601   0.0     
ref|XP_010441687.1|  PREDICTED: subtilisin-like protease SBT5.3         602   0.0     
ref|XP_009414290.1|  PREDICTED: subtilisin-like protease SBT5.3         603   0.0     
dbj|BAB21149.1|  subtilisin-like proteinase-like                        601   0.0     
ref|XP_010090327.1|  Subtilisin-like protease                           601   0.0     
ref|XP_004486283.1|  PREDICTED: subtilisin-like protease-like           601   0.0     
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    600   0.0     
ref|NP_569048.1|  subtilisin-like protease                              600   0.0     
gb|AIC80766.1|  subtilase                                               600   0.0     
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           600   0.0     
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         600   0.0     
emb|CDY65695.1|  BnaA02g06820D                                          591   0.0     
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             598   0.0     
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           598   0.0     
gb|KHG30296.1|  Subtilisin-like protease                                598   0.0     
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  597   0.0     
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           597   0.0     
gb|EEC71416.1|  hypothetical protein OsI_03596                          597   0.0     
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           597   0.0     
ref|XP_006398246.1|  hypothetical protein EUTSA_v10000784mg             597   0.0     
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             596   0.0     
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     595   0.0     
gb|AAM10321.1|  AT5g67360/K8K14_8                                       595   0.0     
gb|EPS74422.1|  hypothetical protein M569_00335                         586   0.0     
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_002458431.1|  hypothetical protein SORBIDRAFT_03g033440          595   0.0     
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             594   0.0     
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                595   0.0     
gb|KHN12975.1|  Subtilisin-like protease                                594   0.0     
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    595   0.0     
gb|EMT15470.1|  Subtilisin-like protease                                593   0.0     
ref|XP_010481547.1|  PREDICTED: subtilisin-like protease SBT5.3         595   0.0     
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                594   0.0     
gb|KEH30495.1|  subtilisin-like serine protease                         594   0.0     
emb|CDM84099.1|  unnamed protein product                                595   0.0     
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           594   0.0     
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     593   0.0     
gb|KDP21172.1|  hypothetical protein JCGZ_21643                         593   0.0     
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             592   0.0     
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             592   0.0     
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    592   0.0     
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             591   0.0     
ref|XP_010494682.1|  PREDICTED: subtilisin-like protease SBT5.3         592   0.0     
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_002977793.1|  hypothetical protein SELMODRAFT_107351             590   0.0     
ref|XP_010518867.1|  PREDICTED: subtilisin-like protease SBT5.3         592   0.0     
ref|XP_010105478.1|  Subtilisin-like protease                           591   0.0     
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g             591   0.0     
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         590   0.0     
emb|CDP14569.1|  unnamed protein product                                590   0.0     
ref|XP_010916217.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    587   0.0     
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           591   0.0     
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          590   0.0     
ref|XP_002991849.1|  hypothetical protein SELMODRAFT_236400             590   0.0     
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                590   0.0     
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                590   0.0     
ref|XP_003523496.1|  PREDICTED: subtilisin-like protease-like           590   0.0     
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             589   0.0     
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease                590   0.0     
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                589   0.0     
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             589   0.0     
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                589   0.0     
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                588   0.0     
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease                589   0.0     
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             588   0.0     
ref|XP_002533857.1|  Cucumisin precursor, putative                      587   0.0     
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             587   0.0     
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         588   0.0     
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           587   0.0     
ref|XP_011102273.1|  PREDICTED: subtilisin-like protease SBT5.3         587   0.0     
emb|CDY40653.1|  BnaA03g53100D                                          587   0.0     
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                587   0.0     
ref|XP_010529231.1|  PREDICTED: subtilisin-like protease                587   0.0     
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           586   0.0     
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                586   0.0     
ref|XP_009389184.1|  PREDICTED: subtilisin-like protease                588   0.0     
ref|XP_010232258.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    583   0.0     
gb|AIX97848.1|  SBT1.5                                                  586   0.0     
gb|KEH36679.1|  subtilisin-like serine protease                         586   0.0     
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                585   0.0     
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650             585   0.0     
emb|CDX72509.1|  BnaC07g45310D                                          585   0.0     
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           585   0.0     



>ref|XP_009611073.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=772

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/730 (66%), Positives = 584/730 (80%), Gaps = 7/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D DRV+ SHH+ LG+YLGS DKA++AIFYSYT+HINGF+AMLE++EA EI+K+P+V+SV
Sbjct  49    IDYDRVRDSHHEFLGSYLGSTDKAKEAIFYSYTKHINGFSAMLEDDEAVEISKHPQVVSV  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR R+LQTTRSW FLGLE +G VIH  S+WKKA+FGEDTIIGNLDTG WPES+SF +E
Sbjct  109   FPNRGRKLQTTRSWNFLGLENDG-VIHPSSLWKKARFGEDTIIGNLDTGAWPESESFIDE  167

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
               GPIP +W+GICQN  D +F CNRKLIGARYF +GY++  G LNSSF TPRD  GHGSH
Sbjct  168   ELGPIPSKWRGICQNDSDHTFQCNRKLIGARYFNKGYATLAGSLNSSFNTPRDTDGHGSH  227

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV G++VFG GNGTAKGGSPKARVAAY+VCWPP   G +C+D+DILA FD A
Sbjct  228   TLSTAGGNFVQGSSVFGYGNGTAKGGSPKARVAAYRVCWPPIM-GNECFDSDILAAFDMA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I+DGVDVLSVSLGGD  G Y NDS+AIGSFHAVK+GIVVV SAGN GP  G+V+NVAPWL
Sbjct  287   IDDGVDVLSVSLGGD-AGAYVNDSVAIGSFHAVKHGIVVVTSAGNSGPGPGTVSNVAPWL  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR+F S ++LGNKK Y GES     LP G F+P+++AASA+       ST D
Sbjct  346   ITVGASTMDRQFPSYIILGNKKQYKGESLSVETLPKGNFFPIINAASAKA---PHASTDD  402

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CK G LDP+KVKG +LVCL+G+N R++K  +AALAGAVGMILAND  SGNEIIAD H
Sbjct  403   AQLCKAGALDPKKVKGTILVCLRGDNARVDKGQQAALAGAVGMILANDYASGNEIIADPH  462

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPAT ++Y+DGL +F Y+N TR P A ITHP T LG KPAPV+AAFSS GPN + P+IL
Sbjct  463   VLPATQISYTDGLELFAYLNSTRAPTASITHPTTQLGTKPAPVMAAFSSIGPNTVTPEIL  522

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV++IAA+T A GP++ D+DKR V FN  SGTSMSCPH++GVVGLLKTL+P+W
Sbjct  523   KPDITAPGVSIIAAYTGAEGPTNQDFDKRRVKFNSVSGTSMSCPHISGVVGLLKTLHPTW  582

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SP+ I+SAIMTTA  R N+ + +  + + +KT+PFAYGAGH+ PN A DPGLVYDL + D
Sbjct  583   SPSAIKSAIMTTARTRDNAIEPML-NASHIKTSPFAYGAGHVWPNRAMDPGLVYDLTMDD  641

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y++F+C QGYN+T+I      P+KCP+ ++    N PSITVP+L GT T+TRTLKNVGSP
Sbjct  642   YLSFLCGQGYNETQIKTFTQGPFKCPEPVNFIDMNLPSITVPNLNGTVTITRTLKNVGSP  701

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ATY A +R P+G S  V P  L+F+ +GEE+SFK+TLK KG     DY FG L WSD KH
Sbjct  702   ATYKARIRRPIGISAAVEPNSLEFKNIGEEKSFKITLKVKGSKGPKDYVFGQLIWSDSKH  761

Query  200   RVRSPIVVKT  171
              VRSPIVVK+
Sbjct  762   YVRSPIVVKS  771



>ref|XP_009759675.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Nicotiana 
sylvestris]
Length=772

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/730 (66%), Positives = 581/730 (80%), Gaps = 7/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D DRV+ SHH+ LG+YLGS DKA++AIFYSYT+HINGF+AMLE++EA EIAK+P+V+SV
Sbjct  49    IDYDRVRDSHHEFLGSYLGSTDKAKEAIFYSYTKHINGFSAMLEDDEAVEIAKHPQVVSV  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLNR R+L TTRSW FLGLE +G VIH  S+WKKA+FGEDTIIGNLDTG WPESKSF +E
Sbjct  109   FLNRGRKLHTTRSWNFLGLENDG-VIHPSSLWKKARFGEDTIIGNLDTGAWPESKSFIDE  167

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
               GPIP +W+GICQN  D +F CNRKLIGARYF QGY++  G LNSSF TPRD  GHGSH
Sbjct  168   ELGPIPSKWRGICQNDSDHTFQCNRKLIGARYFNQGYATLAGSLNSSFNTPRDTDGHGSH  227

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAY+VCWPP   G +C+D+DILA FD A
Sbjct  228   TLSTAGGNFVQGASVFGYGNGTAKGGSPKARVAAYRVCWPPIM-GNECFDSDILAAFDMA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD  G Y NDS+AIGSFHAVK+GIVVV SAGN GP  G+V+NVAPWL
Sbjct  287   IHDGVDVLSVSLGGD-AGAYVNDSVAIGSFHAVKHGIVVVTSAGNSGPGPGTVSNVAPWL  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR+F S ++LGNKK Y GES     LP GK +P+++AASA+       ST D
Sbjct  346   ITVGASTMDRQFPSYIILGNKKQYKGESLSVETLPKGKLFPIINAASAKA---PHASTDD  402

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CK G LDP+KVKG +LVCL+G+N R++K  +AALAGAVGM+LAND  SGNEIIAD H
Sbjct  403   AQLCKAGALDPKKVKGTILVCLRGDNARVDKGQQAALAGAVGMVLANDYASGNEIIADPH  462

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPAT ++Y+DGL +F Y+N TR P A ITHP T LG KPAPV+AAFSS GPN + P+ L
Sbjct  463   VLPATQISYTDGLELFAYVNSTRTPTASITHPKTQLGTKPAPVMAAFSSIGPNTVTPEFL  522

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+T A GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTLYP+W
Sbjct  523   KPDITAPGVSVIAAYTGAEGPTNQDFDKRRVKFNSVSGTSMSCPHVSGIVGLLKTLYPTW  582

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SP+ I+SAIMTTA  R N+ + +  + + +KT+PFAYGAGH+ PN A DPGLVYDL + D
Sbjct  583   SPSAIKSAIMTTARTRDNAIEPML-NASYIKTSPFAYGAGHVRPNRAMDPGLVYDLTIDD  641

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y++F+CAQGYN+T+I      P+KCP+ I+    N PSITVP+L G+ TVTRTLKNVGSP
Sbjct  642   YLSFLCAQGYNETQIKTFTQGPFKCPEPINFINMNLPSITVPNLNGSVTVTRTLKNVGSP  701

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY A +R P+G S  V P  L+F+ +GE++SFK+TLK KG     DY FG L WS  KH
Sbjct  702   GTYKACIRRPIGISAVVEPNSLEFKNIGEKKSFKLTLKVKGSKGPKDYVFGQLIWSYGKH  761

Query  200   RVRSPIVVKT  171
              VRSPIVVK+
Sbjct  762   YVRSPIVVKS  771



>ref|XP_010045213.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW88581.1| hypothetical protein EUGRSUZ_A00959 [Eucalyptus grandis]
Length=769

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/728 (67%), Positives = 579/728 (80%), Gaps = 7/728 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+ LG++LGS D A +AIFYSYTRHINGFAA LE+E AA+IA++P V+SVF
Sbjct  46    DLSRVTESHHEFLGSFLGSQDDAEEAIFYSYTRHINGFAATLEDEVAAQIARHPRVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSWEFLGLE + GV+   SIWKKA+FGEDTIIGNLDTG WP+SKSFS++G
Sbjct  106   LNQGKKLHTTRSWEFLGLE-QNGVVSSDSIWKKARFGEDTIIGNLDTGAWPDSKSFSDQG  164

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +WKGICQN KD  F CNRKLIGARYF +GY++AVGPLN+SF TPRD  GHGSHT
Sbjct  165   LGPIPPKWKGICQNDKDPRFRCNRKLIGARYFNKGYAAAVGPLNASFDTPRDNDGHGSHT  224

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+VFG G GTAKGGSP+ARVAAYKVCWPP + G +C+DADILAGFD AI
Sbjct  225   LSTAGGNFVAGASVFGYGQGTAKGGSPRARVAAYKVCWPPVT-GSECFDADILAGFDAAI  283

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P P FNDS+AIGSFHA++NGIVVV SAGN GP  G+V+N++PWLI
Sbjct  284   HDGVDVLSVSLGGD-PSPLFNDSIAIGSFHAMRNGIVVVCSAGNSGPSDGTVSNISPWLI  342

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+TMDR F + VV+G+K+ + G S  P  LP  KFY L+SAA AR+   + +S  +A
Sbjct  343   TVAASTMDRDFSNYVVIGDKRRFKGASLSPKSLPGDKFYKLISAADARL---SHVSADEA  399

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L C+ GTLDP KVK K+LVCL+GEN R++K  +A LAGAVGM+LAN+  SGNEI+AD HF
Sbjct  400   LLCQNGTLDPRKVKEKILVCLRGENARVDKGEQAFLAGAVGMVLANNILSGNEIVADPHF  459

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+HV Y+DG AIF YIN T+ P A IT   T LGVKP+P +AAFSS+GPN I P+ILK
Sbjct  460   LPASHVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFMAAFSSKGPNTITPEILK  519

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APG++VIAA+TEA GP++ D D+R V FN  SGTSMSCPHV+GV GLLKTL+P WS
Sbjct  520   PDITAPGLSVIAAYTEAVGPTNEDIDQRRVPFNAVSGTSMSCPHVSGVAGLLKTLHPEWS  579

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMT+AT+R N+ ++I  + +  K TPF+YGAGHI PN A DPGLVYDL + DY
Sbjct  580   PAVIRSAIMTSATIRDNAMESII-NASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIKDY  638

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             +NF+C+ GYN T+I+      Y C   I L  FNYPSITVP L G+ TVTRT+KNVG P 
Sbjct  639   LNFLCSLGYNATQISMFSDGAYNCSKRIGLLDFNYPSITVPKLPGSITVTRTVKNVGLPG  698

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY ASV  P G SV V P  LKF+K+ EE+SFKV LKAKG NAT DY+FG L WSD +H 
Sbjct  699   TYKASVLEPNGVSVHVKPAHLKFKKINEEKSFKVVLKAKGANATGDYSFGELIWSDTEHH  758

Query  197   VRSPIVVK  174
             VRSPIVVK
Sbjct  759   VRSPIVVK  766



>emb|CDP06146.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/731 (66%), Positives = 581/731 (79%), Gaps = 7/731 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D DRV  SH+  LG++LGS +KA++AIFYSYTRHINGFAA+L++ EAAEI+K+PEVISV
Sbjct  45    IDYDRVTDSHYSFLGSFLGSKEKAQEAIFYSYTRHINGFAAILDDAEAAEISKHPEVISV  104

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ ++L TTRSWEFLGLE +G  IH  S+WK+A+FGE TIIGNLDTGVWPESKSFS++
Sbjct  105   FLNKGKKLHTTRSWEFLGLEHDGK-IHPSSLWKRARFGEGTIIGNLDTGVWPESKSFSDD  163

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP +WKG CQN +D++FHCNRKLIGARYF +GY+SAVG LNS+F +PRD  GHGSH
Sbjct  164   GYGPIPVKWKGTCQNGEDETFHCNRKLIGARYFNKGYASAVGKLNSTFNSPRDGEGHGSH  223

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GANVFG GNGTAKGGSP+ARVAAYKVCWPP S  E C+DADILAG D A
Sbjct  224   TLSTAGGNFVVGANVFGYGNGTAKGGSPRARVAAYKVCWPPVSNNE-CFDADILAGIDMA  282

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDV+SVSLGGD P PYFNDS+AIGSFHAVK+GIVV+ SAGN GP   SV+NVAPW 
Sbjct  283   IHDGVDVISVSLGGD-PVPYFNDSIAIGSFHAVKHGIVVICSAGNSGPTPASVSNVAPWQ  341

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITV A+TMDR F S VVLGN   ++GES     LP  KF+P+++A S +    A  S +D
Sbjct  342   ITVAASTMDRHFPSYVVLGNNMRFSGESLSQEALPDKKFFPIVAAKSVKA---AYASDKD  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CK GTLD  K KGK+LVCL+G+N R++K  +AA  GAVGM+L ND+ SGNEIIAD H
Sbjct  399   AELCKAGTLDHSKAKGKILVCLRGDNARVDKGQQAAAVGAVGMVLTNDKLSGNEIIADPH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ Y+DGLA+F YI  +R+P A+ITHP T LG KPAP +AAFSS+GPN + P++L
Sbjct  459   VLPASHINYTDGLAVFSYIYSSRSPKAYITHPTTELGTKPAPFMAAFSSKGPNTLTPELL  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAAFTEA GP+   +DKR V FN ESGTSMSCPHV+G+VGLLKTL+P W
Sbjct  519   KPDITAPGVSVIAAFTEAQGPTSEGFDKRRVLFNSESGTSMSCPHVSGIVGLLKTLHPDW  578

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMT+A  R N+ + I  + + +K +PF+YGAGHI PN AADPGLVYDL   D
Sbjct  579   SPAAIRSAIMTSARSRDNAFEPII-NASYVKASPFSYGAGHIWPNRAADPGLVYDLTAND  637

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+ F+C+ GYN+++I      P KCP  ISL   NYPSITVP L+G+ TVTRTLKNVG+P
Sbjct  638   YLTFLCSLGYNESQIALFTQVPKKCPKPISLLDLNYPSITVPKLRGSITVTRTLKNVGAP  697

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ATYTA + SP G SV + PK L F ++GEE+SFK+TL+ K   A  DY FG L WSD KH
Sbjct  698   ATYTAKIVSPPGVSVDIQPKSLTFARIGEEKSFKLTLQLKKPGAARDYVFGRLAWSDGKH  757

Query  200   RVRSPIVVKTA  168
              VRSPIVVK +
Sbjct  758   FVRSPIVVKAS  768



>ref|XP_002266728.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
 emb|CBI28486.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/730 (67%), Positives = 580/730 (79%), Gaps = 7/730 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLD+V  SH++ LG++LGS D A++AI YSYTRHINGFAA L++ EAA+IA +P+V+SVF
Sbjct  47    DLDQVTESHYEFLGSFLGSRDNAKEAIIYSYTRHINGFAATLQDHEAAQIANHPKVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TTRSW FLGLE +G +I   SIWKKA+FG+DTIIGNLDTGVWPES SFS+EG
Sbjct  107   LNKGRKLHTTRSWHFLGLENDG-IIPSNSIWKKARFGQDTIIGNLDTGVWPESASFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP RW+GICQN KD  FHCNRKLIGARYF QGY++AVG LNSSF TPRD  GHGSHT
Sbjct  166   MGPIPSRWRGICQNDKDAGFHCNRKLIGARYFHQGYAAAVGSLNSSFHTPRDTEGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+VFG GNGTAKGGSPKARVAAYKVCWPP   G +C+DADILA FD AI
Sbjct  226   LSTAGGNFVEGASVFGFGNGTAKGGSPKARVAAYKVCWPPVG-GNECFDADILAAFDIAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLS SLGG  P P+FNDSL+IGSFHAVK+GIVVV SAGN GP  G+V+N++PW  
Sbjct  285   HDGVDVLSASLGG-LPTPFFNDSLSIGSFHAVKHGIVVVCSAGNSGPADGTVSNISPWQF  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR+F S +VLGNKK   G S  P  LP  KF+PL+SAA A+    A+ S  DA
Sbjct  344   TVGASTMDRQFPSYLVLGNKKRLEGGSLSPKALPPNKFFPLISAADAK---AANASADDA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK GTLD  KVKGK+LVCL+GEN R++K  +AALAGAVGM+LAN+E +GNE+IAD H 
Sbjct  401   LLCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHV  460

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+H+ ++DG+A+F Y+N T++P+A+IT   T LG KPAP +AAFSS+GPN I P+ILK
Sbjct  461   LPASHINFTDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILK  520

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTL+P WS
Sbjct  521   PDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWS  580

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSA+MTTA    NS +AI  + +  K TPF+YGAGH+ PN A +PGLVYDL + DY
Sbjct  581   PAAIRSAMMTTARTMDNSMEAIL-NASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDY  639

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             +NF+CA GYN+T I      PY CP  ISL+ FNYPSITVP L G+ TVTRTLKNVG P 
Sbjct  640   LNFLCALGYNQTLIKMFSERPYTCPKPISLTNFNYPSITVPKLHGSITVTRTLKNVGPPG  699

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY A +R P G SV+V P  LKF K+GEE++F +TL+A+   A  DY FG L WSD KH 
Sbjct  700   TYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHF  759

Query  197   VRSPIVVKTA  168
             VRSPIVVK A
Sbjct  760   VRSPIVVKAA  769



>gb|KCW88582.1| hypothetical protein EUGRSUZ_A00959 [Eucalyptus grandis]
Length=788

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/747 (65%), Positives = 579/747 (78%), Gaps = 26/747 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+ LG++LGS D A +AIFYSYTRHINGFAA LE+E AA+IA++P V+SVF
Sbjct  46    DLSRVTESHHEFLGSFLGSQDDAEEAIFYSYTRHINGFAATLEDEVAAQIARHPRVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSWEFLGLE + GV+   SIWKKA+FGEDTIIGNLDTG WP+SKSFS++G
Sbjct  106   LNQGKKLHTTRSWEFLGLE-QNGVVSSDSIWKKARFGEDTIIGNLDTGAWPDSKSFSDQG  164

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +WKGICQN KD  F CNRKLIGARYF +GY++AVGPLN+SF TPRD  GHGSHT
Sbjct  165   LGPIPPKWKGICQNDKDPRFRCNRKLIGARYFNKGYAAAVGPLNASFDTPRDNDGHGSHT  224

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+VFG G GTAKGGSP+ARVAAYKVCWPP + G +C+DADILAGFD AI
Sbjct  225   LSTAGGNFVAGASVFGYGQGTAKGGSPRARVAAYKVCWPPVT-GSECFDADILAGFDAAI  283

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P P FNDS+AIGSFHA++NGIVVV SAGN GP  G+V+N++PWLI
Sbjct  284   HDGVDVLSVSLGGD-PSPLFNDSIAIGSFHAMRNGIVVVCSAGNSGPSDGTVSNISPWLI  342

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+TMDR F + VV+G+K+ + G S  P  LP  KFY L+SAA AR+   + +S  +A
Sbjct  343   TVAASTMDRDFSNYVVIGDKRRFKGASLSPKSLPGDKFYKLISAADARL---SHVSADEA  399

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L C+ GTLDP KVK K+LVCL+GEN R++K  +A LAGAVGM+LAN+  SGNEI+AD HF
Sbjct  400   LLCQNGTLDPRKVKEKILVCLRGENARVDKGEQAFLAGAVGMVLANNILSGNEIVADPHF  459

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+HV Y+DG AIF YIN T+ P A IT   T LGVKP+P +AAFSS+GPN I P+ILK
Sbjct  460   LPASHVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFMAAFSSKGPNTITPEILK  519

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APG++VIAA+TEA GP++ D D+R V FN  SGTSMSCPHV+GV GLLKTL+P WS
Sbjct  520   PDITAPGLSVIAAYTEAVGPTNEDIDQRRVPFNAVSGTSMSCPHVSGVAGLLKTLHPEWS  579

Query  737   PAEIRSAIMTT-------------------ATVRANSGKAITDDKTGLKTTPFAYGAGHI  615
             PA IRSAIMT+                   AT+R N+ ++I  + +  K TPF+YGAGHI
Sbjct  580   PAVIRSAIMTSGVSKMRNVLIDLCPVCLLAATIRDNAMESII-NASYYKATPFSYGAGHI  638

Query  614   NPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVP  435
              PN A DPGLVYDL + DY+NF+C+ GYN T+I+      Y C   I L  FNYPSITVP
Sbjct  639   QPNRAMDPGLVYDLGIKDYLNFLCSLGYNATQISMFSDGAYNCSKRIGLLDFNYPSITVP  698

Query  434   HLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGE  255
              L G+ TVTRT+KNVG P TY ASV  P G SV V P  LKF+K+ EE+SFKV LKAKG 
Sbjct  699   KLPGSITVTRTVKNVGLPGTYKASVLEPNGVSVHVKPAHLKFKKINEEKSFKVVLKAKGA  758

Query  254   NATADYAFGVLTWSDKKHRVRSPIVVK  174
             NAT DY+FG L WSD +H VRSPIVVK
Sbjct  759   NATGDYSFGELIWSDTEHHVRSPIVVK  785



>ref|XP_011012624.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=769

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/729 (67%), Positives = 585/729 (80%), Gaps = 9/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D +  K SH++ LG++LGS + A+DAIFYSYTRHINGFAA LE+E AAEIAK+P V+SVF
Sbjct  47    DANLAKDSHYEFLGSFLGSREFAQDAIFYSYTRHINGFAATLEDEVAAEIAKHPRVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+  TT SW FLGLE +G  +   SIWKKA+FGEDTIIGNLDTGVWPES+SFS+EG
Sbjct  107   LNQGRRQHTTHSWSFLGLEKDG-FVPSSSIWKKARFGEDTIIGNLDTGVWPESESFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GPIP +WKGICQN  D  FHCNRKLIGARYF +GY+S VG LNSSF TPRD  GHGSHT
Sbjct  166   WGPIPSKWKGICQNGNDPGFHCNRKLIGARYFNKGYASIVGHLNSSFDTPRDEDGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+VF +GNGTAKGGSPKARVAAYKVC+PP   GE+C+DADILA FD AI
Sbjct  226   LSTAGGNFVAGASVFYMGNGTAKGGSPKARVAAYKVCYPPVD-GEECFDADILAAFDAAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG+ P  +FNDS+AIGSFHAVK+GIVV+ SAGN GPV G+V+NVAPW I
Sbjct  285   SDGVDVLSVSLGGN-PTAFFNDSVAIGSFHAVKHGIVVICSAGNSGPVDGTVSNVAPWEI  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F S VVLGNK  + GES     LP  KF+PL+SAA AR   NAS+  ++A
Sbjct  344   TVGASTMDREFPSYVVLGNKISFKGESLSAKALPKNKFFPLMSAADAR-ATNASV--ENA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK G+LDPEK KGK+LVCL+G N R++K  +AALAGAVGM+LAN++D+GNEI+AD H 
Sbjct  401   LLCKDGSLDPEKAKGKILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPHV  460

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LP +H+ Y+ G+AIF YIN T  PVA+ITHP T +G+KPAPV+AAFSS+GPN + P+ILK
Sbjct  461   LPVSHIKYTSGVAIFKYINSTEYPVAYITHPVTRIGMKPAPVVAAFSSKGPNTVTPEILK  520

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV+VIAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+VGLLKT++P+WS
Sbjct  521   PDITAPGVSVIAAYTKAQGPTNQDFDTRRVLFNAVSGTSMSCPHVSGIVGLLKTMHPTWS  580

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  + N+ + I  +    K +PF+YGAGHI PN A DPGLVYDL + DY
Sbjct  581   PASIKSAIMTTAMTQDNTMEPIL-NANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVDDY  639

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             +NF+CA GYN+T+I+     PY+CP   ISL+ FNYPSITVP   G+ T++RT+KNVGSP
Sbjct  640   LNFLCALGYNETQISTFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGSP  699

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY   +R P G SV V PK L+F+KVGEE++F VTLK KG+ A  DY FG L WSDKKH
Sbjct  700   NTYKLRIRKPTGVSVYVEPKKLEFKKVGEEKAFTVTLKGKGK-AAKDYVFGELIWSDKKH  758

Query  200   RVRSPIVVK  174
              VRSPIVVK
Sbjct  759   HVRSPIVVK  767



>ref|XP_004243217.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=774

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/730 (65%), Positives = 573/730 (78%), Gaps = 7/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLG-SWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVIS  2184
             +D D V+ SHH+ LG+YLG S +KA+++IFYSYTRHINGF+AMLE+EEA EI+K+P+V+S
Sbjct  49    IDYDNVRDSHHEFLGSYLGGSNEKAKESIFYSYTRHINGFSAMLEDEEAIEISKHPQVVS  108

Query  2183  VFLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSE  2004
             VF NR R+L TTRSW FLGLE   GVI   S+WKKA+FGED++IGNLDTG WPES+SFS+
Sbjct  109   VFENRGRKLHTTRSWSFLGLENNDGVIPSSSLWKKARFGEDSVIGNLDTGAWPESESFSD  168

Query  2003  EGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGS  1824
             EG+GPIP +W+GICQ+  D +FHCNRKLIGARYF +GY++  G LNS+F TPRD  GHGS
Sbjct  169   EGYGPIPSKWRGICQSDFDPTFHCNRKLIGARYFNKGYATLAGSLNSTFNTPRDTDGHGS  228

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGNFV G++VFG GNGTAKGGSPKARVAAYKVCW P S G +C+DADILA FD 
Sbjct  229   HTLSTAGGNFVEGSSVFGYGNGTAKGGSPKARVAAYKVCWTPIS-GNECFDADILAAFDM  287

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVSLGGD   PY NDS+AIGSFHAVK+GIVVV SAGN GP   +V+NVAPW
Sbjct  288   AIHDGVDVLSVSLGGDAV-PYANDSIAIGSFHAVKHGIVVVTSAGNSGPAVSTVSNVAPW  346

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITVGA+TMDR+F S V LGN K Y GES     LP GK +P+++AASA+       +T 
Sbjct  347   VITVGASTMDRQFPSYVTLGNNKCYKGESLSVEALPKGKLFPIITAASAKA---THATTY  403

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  CK G LDP+KVKG +LVCL+GEN R++K  +AALAGAV M+LAND  SGNEIIAD 
Sbjct  404   DAQLCKAGALDPKKVKGTILVCLRGENARVDKGQQAALAGAVAMVLANDYASGNEIIADP  463

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPAT ++Y+DGL +  Y+N TR P A ITHP T LG KPAPV+AAFSS GPN + P I
Sbjct  464   HVLPATQISYTDGLDVIAYVNSTRAPTAFITHPTTQLGTKPAPVMAAFSSIGPNTVTPQI  523

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV++IAAFT A GP++  +DKR V FN  SGTSMSCPHV+G+VGLLKTL+P+
Sbjct  524   LKPDITAPGVSIIAAFTGAQGPTEQAFDKRRVKFNSVSGTSMSCPHVSGIVGLLKTLHPT  583

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSP+ I+SAIMTTA  R NS + +  + + +KT+PFAYGAGH+ PN A DPGLVYDL + 
Sbjct  584   WSPSAIKSAIMTTARTRDNSVEPML-NASYIKTSPFAYGAGHVRPNRAMDPGLVYDLTID  642

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY++F+CAQGYN+T+I       +KCPD I+    N PSITVP+L  + T+TRTLKNVGS
Sbjct  643   DYLSFLCAQGYNETQIKTFTLGSFKCPDPINFIDMNLPSITVPNLNSSVTITRTLKNVGS  702

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A +R P+G S  V P  L+F+ + EE+SFK+TLK KG  A  DY FG L WSD K
Sbjct  703   PGTYKARIRHPIGISAVVEPNSLEFKNINEEKSFKLTLKVKGSKAPKDYVFGQLIWSDNK  762

Query  203   HRVRSPIVVK  174
             H VRSPIVVK
Sbjct  763   HYVRSPIVVK  772



>gb|EYU34388.1| hypothetical protein MIMGU_mgv1a001745mg [Erythranthe guttata]
Length=765

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/731 (66%), Positives = 576/731 (79%), Gaps = 10/731 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD D V  SH++ LG++LGS DKA+DAIFYSYT+HINGFAA LE+EEA +I+K+P+V+SV
Sbjct  41    VDYDTVTQSHYEFLGSFLGSSDKAKDAIFYSYTKHINGFAANLEDEEALQISKHPKVVSV  100

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGLE E G I   S+WKKA+FGEDTIIGNLDTGVWP+SKSFS+E
Sbjct  101   FLNQGRKLHTTRSWDFLGLE-ENGEIRANSLWKKARFGEDTIIGNLDTGVWPDSKSFSDE  159

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
              FG IP +W+G+CQN  D SFHCNRKLIGARYF +GYSSAVGPLNS+F TPRD  GHGSH
Sbjct  160   NFGSIPSKWRGVCQNNFDASFHCNRKLIGARYFNKGYSSAVGPLNSTFRTPRDTEGHGSH  219

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSP+ARVAAYKVCWPP   G +C+DADILA FD A
Sbjct  220   TLSTAGGNFVAGASVFGFGNGTAKGGSPRARVAAYKVCWPPIG-GNECFDADILAAFDVA  278

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD   P++NDS+AIGSFHAV++G+VVV SAGN GP AG+V+NVAPW 
Sbjct  279   IHDGVDVLSVSLGGDAV-PFYNDSVAIGSFHAVRHGVVVVCSAGNSGPGAGTVSNVAPWQ  337

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR+F S VVLGNK    GES     LP  K + ++SA  A+    A+ S   
Sbjct  338   ITVGASTMDRQFPSYVVLGNKMRLRGESLSAKSLPKKKSFQIISATDAKA---ANASADQ  394

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLD +KVKGK+LVCL+G+N R++K  +AAL GAVGM+LAN++ SGNEI+AD H
Sbjct  395   ALLCKAGTLDAKKVKGKILVCLRGDNARVDKGEQAALCGAVGMVLANNQISGNEILADPH  454

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ Y+DGLA+F YIN TR+P+A+IT   T LG KPAP +AAFSS GPN +NP+IL
Sbjct  455   VLPASHINYTDGLALFSYINSTRSPIAYITKGTTELGTKPAPFMAAFSSNGPNTLNPEIL  514

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+TEA GP++ D+D R V FN  SGTSMSCPHV+GVVGLLKTL+P W
Sbjct  515   KPDITAPGVSVIAAYTEAQGPTNQDFDTRRVLFNSVSGTSMSCPHVSGVVGLLKTLHPHW  574

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAI+TTA  R N+ K +T+     K TPF YG GHI PN A DPGLVYDL   D
Sbjct  575   SPAAIKSAIITTAKTRDNTMKPLTNASYS-KATPFNYGGGHIQPNRAMDPGLVYDLSAND  633

Query  560   YVNFICAQGYNKTEITAV--LGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             Y++F+CA GYN T+I         YKC D ISL  FNYPSITVP LKGT TV+R +KNVG
Sbjct  634   YLDFLCALGYNATQIQQFSNESQTYKCRDPISLIDFNYPSITVPSLKGTVTVSRKVKNVG  693

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P TY A VRSP G SV V P  L+FE+ GEE+ ++VTL AK ++   DY FG LTWSD 
Sbjct  694   TPGTYKARVRSPRGISVRVEPNSLRFEREGEEKGYRVTLMAK-KSGVRDYVFGQLTWSDG  752

Query  206   KHRVRSPIVVK  174
             +H VRS IVVK
Sbjct  753   RHYVRSSIVVK  763



>ref|XP_002320540.2| subtilisin-like protease family protein [Populus trichocarpa]
 gb|EEE98855.2| subtilisin-like protease family protein [Populus trichocarpa]
Length=769

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/729 (66%), Positives = 582/729 (80%), Gaps = 9/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D +  K SH++ LG++LGS + A DAIFYSYTRHINGFAA LE+E AAEIAK+P V+SVF
Sbjct  47    DANLAKDSHYEFLGSFLGSREFAEDAIFYSYTRHINGFAATLEDEVAAEIAKHPRVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+  TT SW FLGLE +G V+   SIWKKA+FGED IIGNLDTGVWPES+SFS+EG
Sbjct  107   LNQGRKQHTTHSWSFLGLEKDG-VVPSSSIWKKARFGEDAIIGNLDTGVWPESESFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +WKGICQN  D  FHCNRKLIGARYF +GY+S VG LNSSF TPRD  GHGSHT
Sbjct  166   LGPVPSKWKGICQNGYDPGFHCNRKLIGARYFNKGYASIVGHLNSSFDTPRDEDGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+VF +GNGTAKGGSPKARVAAYKVC+PP   G++C+DADILA FD AI
Sbjct  226   LSTAGGNFVAGASVFYMGNGTAKGGSPKARVAAYKVCYPPVD-GDECFDADILAAFDAAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG+ P  +FNDS+AIGSFHAVK+GIVV+ SAGN GPV G+V+NVAPW I
Sbjct  285   SDGVDVLSVSLGGN-PTAFFNDSVAIGSFHAVKHGIVVICSAGNSGPVDGTVSNVAPWEI  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F S VVLGNK  + GES     LP  KF+PL+SAA AR   NASI  ++A
Sbjct  344   TVGASTMDREFPSYVVLGNKISFKGESLSAKALPKNKFFPLMSAADAR-ATNASI--ENA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK G+LDPEK KGK+LVCL+G N R++K  +AALAGAVGM+LAN++D+GNEI+AD H 
Sbjct  401   LLCKDGSLDPEKAKGKILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPHV  460

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LP +H+ Y+ G+AIF YIN T  PVA+ITHP T +G KPAPV+AAFSS+GPN + P+ILK
Sbjct  461   LPVSHINYTSGVAIFKYINSTEYPVAYITHPVTRIGTKPAPVVAAFSSKGPNTVTPEILK  520

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV+VIAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+VGLLKTL+P+WS
Sbjct  521   PDITAPGVSVIAAYTKAQGPTNQDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPTWS  580

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  + N+ + I  +    K +PF+YGAGHI PN A DPGLVYDL + DY
Sbjct  581   PASIKSAIMTTAMTQDNTMEPIL-NANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVNDY  639

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             +N +CA GYN+T+I+     PY+CP   ISL+ FNYPSITVP   G+ T++RT+KNVGSP
Sbjct  640   LNLLCALGYNETQISTFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGSP  699

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TY   +R P G SV+V PK L+F+KVGEE++F VTLK KG+ A  DY FG L WSD KH
Sbjct  700   STYKLRIRKPTGVSVSVEPKKLEFKKVGEEKAFTVTLKGKGK-AAKDYVFGELIWSDNKH  758

Query  200   RVRSPIVVK  174
              VRSPIVVK
Sbjct  759   HVRSPIVVK  767



>ref|XP_010067699.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=901

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/728 (65%), Positives = 570/728 (78%), Gaps = 7/728 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+ LG++LGS D A++AIFYSYTRHINGFAA  E+E AA+IAK+P V+SVF
Sbjct  133   DLSRVTESHHEFLGSFLGSRDDAKEAIFYSYTRHINGFAATFEDEVAAQIAKHPRVVSVF  192

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSWEFLGLE + GVI   SIWKKA+FGED IIGNLDTGVWPESKSFS++G
Sbjct  193   LNQGKKLHTTRSWEFLGLE-QNGVISSESIWKKARFGEDAIIGNLDTGVWPESKSFSDQG  251

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +WKGICQN KD  F CNRKLIGARYF  GY++ VGPLN+SF  PRD  GHGSHT
Sbjct  252   LGPIPPKWKGICQNDKDPRFRCNRKLIGARYFKGGYAAVVGPLNASFDAPRDNNGHGSHT  311

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FV GA++FG G GTAKGGSP ARVA YKVCWPP + G +C+DADILAGFD AI
Sbjct  312   LSTAGGHFVAGASIFGYGRGTAKGGSPGARVATYKVCWPPVA-GTECFDADILAGFDAAI  370

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLG D P P FN+S+AIGSFHAV+NG+VVV SAGN GP  G+V+N++PWLI
Sbjct  371   HDGVDVLSVSLGSD-PSPLFNNSIAIGSFHAVRNGVVVVCSAGNAGPSEGTVSNISPWLI  429

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+TMDR F + VV+G++  + G S  P  LP GKFY L+SAA AR+   + +S  +A
Sbjct  430   TVAASTMDRDFSNYVVIGDQSRFKGASLSPKSLPRGKFYKLISAADARL---SHVSANEA  486

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK GTLDP KVKGK+LVCL+G+N R++K  +A LA AVGM+LAN+  SG+EI++D HF
Sbjct  487   LLCKNGTLDPRKVKGKILVCLRGDNARVDKGEQALLASAVGMVLANNLVSGSEILSDPHF  546

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+HV Y+DG AIF YIN T+ P A IT   T LGVKP+P +AAFSS+GPN I P+ILK
Sbjct  547   LPASHVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFMAAFSSKGPNTIIPEILK  606

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PD++APGV+VIAA+TEA GP+D  YDKR V +N  SGTSMSCPHV+GV GLLKTL+P WS
Sbjct  607   PDVTAPGVSVIAAYTEAAGPTDQAYDKRRVPYNAMSGTSMSCPHVSGVAGLLKTLHPEWS  666

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMT+AT+  N+ ++I ++ +  K TPF+YGAGHI PN A DPGLVYDL + DY
Sbjct  667   PAAIRSAIMTSATILDNAMESIMNN-SFYKATPFSYGAGHIQPNRAMDPGLVYDLGIIDY  725

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             +NF+C+ GYN  +I+ V    Y C   I L  FNYPSITVP L  + TVTRT+KNVG P 
Sbjct  726   LNFLCSLGYNAMQISNVTDGAYDCSKRIGLLDFNYPSITVPKLSRSITVTRTVKNVGFPG  785

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY AS+  P G  V V P  LKF+K+GEE+SFKV LK KG  AT DY+FG L WSD +H 
Sbjct  786   TYRASILEPNGVLVLVKPAYLKFKKIGEEKSFKVMLKVKGAGATEDYSFGELIWSDTEHH  845

Query  197   VRSPIVVK  174
             VRSPIVVK
Sbjct  846   VRSPIVVK  853



>gb|ACP18876.1| subtilisin-like serine protease [Carica papaya]
Length=771

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/732 (65%), Positives = 585/732 (80%), Gaps = 9/732 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRVK SH+  LG++LGS ++A+++IFYSYT+HINGFAA L +E AA++AK+P+V+SVF
Sbjct  47    DLDRVKESHYDFLGSFLGSPEEAQESIFYSYTKHINGFAAELNDEVAAKLAKHPKVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TTRSW+FLGLE + GV+   SIWKKA+FGEDTIIGNLDTGVWPESKSFS+EG
Sbjct  107   LNKGRKLHTTRSWDFLGLE-QNGVVPSSSIWKKARFGEDTIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +W+GIC + KD SFHCNRKLIGAR+F +GY+SAVG LNSSF +PRD  GHG+HT
Sbjct  166   LGPIPSKWRGICDHGKDSSFHCNRKLIGARFFNRGYASAVGSLNSSFESPRDNEGHGTHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGN V  A+VFGLG GTAKGGSP+ARVAAYKVCWPP   G +C+DADILA FD AI
Sbjct  226   LSTAGGNMVANASVFGLGKGTAKGGSPRARVAAYKVCWPPVL-GNECFDADILAAFDAAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              D VDVLSVSLGG   G +FNDS+AIGSFHAVK+GIVVV SAGN GP  GSV+NVAPW I
Sbjct  285   HDRVDVLSVSLGGT-AGGFFNDSVAIGSFHAVKHGIVVVCSAGNSGPDDGSVSNVAPWQI  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F S V+LGN   + GES     LP   F+PL+SA +A+     + S ++A
Sbjct  344   TVGASTMDREFPSYVLLGNNMSFKGESLSDAVLPGTNFFPLISALNAKA---TNASNEEA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             + C+ G LDP+KVKGK+LVCL+G N R++K  +AALAGAVGMILAN E +GNEIIADAH 
Sbjct  401   ILCEAGALDPKKVKGKILVCLRGLNARVDKGQQAALAGAVGMILANSELNGNEIIADAHV  460

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+H++++DGL++F+YIN T +PVA++T P T L  KPAPV+AAFSS+GPN + P+ILK
Sbjct  461   LPASHISFTDGLSVFEYINLTNSPVAYMTRPKTKLPTKPAPVMAAFSSKGPNIVTPEILK  520

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVNVIAA+T A GP++ ++D+R V FN  SGTSMSCPHV+G+VGLLKTLYPSWS
Sbjct  521   PDITAPGVNVIAAYTRAQGPTNQNFDRRRVQFNSVSGTSMSCPHVSGIVGLLKTLYPSWS  580

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMT+AT   N  ++I  + + +K TPF+YGAGH+ PN A +PGLVYDL   DY
Sbjct  581   PAAIRSAIMTSATTMDNINESIL-NASNVKATPFSYGAGHVQPNQAMNPGLVYDLNTKDY  639

Query  557   VNFICAQGYNKTEITAVLGTPYKCP-DHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             + F+CA GY+KT I+      + CP  +ISL+ FNYPSITVP LKG  T++R +KNVGSP
Sbjct  640   LKFLCALGYSKTLISIFSNDKFNCPRTNISLADFNYPSITVPELKGLITLSRKVKNVGSP  699

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK-K  204
              TY  +V+ P G SVTV PKILKF+K GEE+SF VTLK K +N T +Y FG L WSD+ +
Sbjct  700   TTYRVTVQKPKGISVTVKPKILKFKKAGEEKSFTVTLKMKAKNPTKEYVFGELVWSDEDE  759

Query  203   HRVRSPIVVKTA  168
             H VRSPIVVK A
Sbjct  760   HYVRSPIVVKAA  771



>ref|XP_010256205.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3, 
partial [Nelumbo nucifera]
Length=803

 Score =   952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/730 (66%), Positives = 578/730 (79%), Gaps = 8/730 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D DRV  SH++ LG++LGS +KA+ AIFYSYT+HINGF+A LEEEEAAEIAK+P V+SVF
Sbjct  76    DFDRVTDSHYEFLGSFLGSKEKAKAAIFYSYTKHINGFSATLEEEEAAEIAKHPRVVSVF  135

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGS-IWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             LN+ R+L TTRSW+FLGL    GV   GS +W KA+FGEDTIIGNLD+GVWPESKSFS++
Sbjct  136   LNQGRKLHTTRSWDFLGLGRINGVDPSGSSLWLKARFGEDTIIGNLDSGVWPESKSFSDD  195

Query  2000  GFGPIPKRWKGICQNQ-KDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGS  1824
             G+GPIP +WKGICQ    + +F CNRKLIGARYF +GYSS VGPL+SS+ T RD  GHGS
Sbjct  196   GYGPIPSKWKGICQKGGSNDTFVCNRKLIGARYFNKGYSSYVGPLDSSYDTARDNEGHGS  255

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGNFVPGA++FG G G AKGGSP+ARVAAYKVCWPP     +C+DADI+A FD 
Sbjct  256   HTLSTAGGNFVPGASIFGYGQGIAKGGSPRARVAAYKVCWPPVGDSGECFDADIMAAFDA  315

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLS+SLGG  P  YF D L+IG+FHAVK GIVVV SAGN GP  GSV+NV+PW
Sbjct  316   AIHDGVDVLSISLGGS-PDYYFEDGLSIGAFHAVKKGIVVVCSAGNSGPTDGSVSNVSPW  374

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITVGA+T+DR F S VVLGNK ++ GES     LP  +FYPL+SA  A+    A+ ST 
Sbjct  375   MITVGASTIDREFASYVVLGNKLYFKGESLSTNGLPVKEFYPLISAGDAKA---ANASTN  431

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DAL CK G LDPEKV+GK+L CL+GE  R++K  +AA AGAVGMILAND  + NEIIADA
Sbjct  432   DALLCKAGALDPEKVRGKILTCLRGETARVDKGEQAARAGAVGMILANDVTTANEIIADA  491

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA+H+TY+DGLA+F YIN T++PVA++TH  TLLGVKPAP +A+FSS+GPN + P+I
Sbjct  492   HVLPASHITYTDGLAVFAYINSTKSPVAYLTHGTTLLGVKPAPFMASFSSKGPNLVTPEI  551

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGVN+IAAFTEA G +  + DKRIV FN+ SGTSMSCPHV+GV GLLKTL+P 
Sbjct  552   LKPDITAPGVNIIAAFTEAQGAASEN-DKRIVPFNIMSGTSMSCPHVSGVAGLLKTLHPD  610

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA ++SAIMTTA  R N G+ I  + + ++ TPF+YGAGH+ PN A DPGLVYDL + 
Sbjct  611   WSPAAVKSAIMTTAGARDNIGEQIL-NSSHVEATPFSYGAGHVQPNRAMDPGLVYDLTVK  669

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY++F+CA GYN+T+I      PY CP   +L  FNYPSITVP+L G+ATVTRTLKNVG+
Sbjct  670   DYLDFLCALGYNQTQIETFSDKPYTCPKSATLMDFNYPSITVPNLSGSATVTRTLKNVGT  729

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TYTASV +P G SV+V P  LKFEK+GEE++F++TLK    +A  DY FG L WSD  
Sbjct  730   PGTYTASVDAPNGISVSVEPASLKFEKMGEEKTFRLTLKTNKADAAMDYVFGQLIWSDGL  789

Query  203   HRVRSPIVVK  174
             H VRSPIVVK
Sbjct  790   HYVRSPIVVK  799



>ref|XP_011082896.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=769

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/729 (66%), Positives = 572/729 (78%), Gaps = 8/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D DRV  SH++ LG++LGS  KARDAIFYSYTRHINGFAA LE+EEA +I+K+P+V+SVF
Sbjct  46    DYDRVTESHYEFLGSFLGSSGKARDAIFYSYTRHINGFAASLEDEEAVQISKHPKVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TTRSW+FLGLE  G  I   S+WKKA+FGEDTIIGNLDTGVWPESKSFS+E 
Sbjct  106   LNQGRKLHTTRSWDFLGLENNGE-ISASSLWKKARFGEDTIIGNLDTGVWPESKSFSDEQ  164

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +W+GICQN  D SFHCNRKLIGARYF +GYS+ VGPLNS+F +PRD  GHGSHT
Sbjct  165   MGPVPLKWRGICQNDVDPSFHCNRKLIGARYFNKGYSAVVGPLNSTFDSPRDTEGHGSHT  224

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV  A+VFG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADILA FD AI
Sbjct  225   LSTAGGNFVSRASVFGFGNGTAKGGSPRARVAAYKVCWPPVA-GNECFDADILAAFDIAI  283

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P P++NDS+AIGSFHAVK+GIVVV SAGN GP AG+V+NVAPW I
Sbjct  284   HDGVDVLSVSLGGD-PVPFYNDSVAIGSFHAVKHGIVVVCSAGNSGPDAGTVSNVAPWQI  342

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR+F S VVLGNK  + GES     L   K +P++SA  A+    A+ S  +A
Sbjct  343   TVGASTMDRQFPSYVVLGNKMRFRGESLSAKSLLKKKSFPIISARYAK---AANASADEA  399

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               CK GTLDP KVKGK+LVCL+G+N R++K  +AALAGAVGM+LAN++ SGNEI+AD H 
Sbjct  400   ALCKAGTLDPTKVKGKILVCLRGDNARVDKGEQAALAGAVGMVLANNQISGNEILADPHV  459

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y+DGLA+F YI  TR+PVA+IT   T L  KPAP +AAFSS+GPN I P+ILK
Sbjct  460   LPASQINYTDGLALFSYIKSTRSPVAYITKATTQLHTKPAPFMAAFSSKGPNTITPEILK  519

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV++IAA+T+A  P++ D+DKR V FN  SGTSMSCPHV+GVVGLLKTL+P+WS
Sbjct  520   PDITAPGVSIIAAYTKAQAPTNQDFDKRRVLFNSVSGTSMSCPHVSGVVGLLKTLHPNWS  579

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  R N+ K +T D + LK TP  YG GH+ PN A DPGLVYDL   DY
Sbjct  580   PAAIKSAIMTTARTRDNTLKPLT-DASYLKATPLNYGGGHVQPNRAMDPGLVYDLGANDY  638

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             +NF+CA GYN+T+I      PY CP  I L   NYPSITVP L G+ TVTR +KNVGSP 
Sbjct  639   LNFLCALGYNQTQIQLFSEEPYACPQPIRLIDLNYPSITVPGLTGSVTVTRKVKNVGSPG  698

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGE-NATADYAFGVLTWSDKKH  201
             TY A VRSP G SV V P  LKFE+ GEE+ F+VTL+ K    A  DY FG L WSD +H
Sbjct  699   TYRARVRSPHGISVHVEPDSLKFERAGEEKRFRVTLQVKKPGGAVKDYVFGQLIWSDGRH  758

Query  200   RVRSPIVVK  174
              VRSPIVVK
Sbjct  759   YVRSPIVVK  767



>ref|XP_010107369.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC15620.1| Subtilisin-like protease [Morus notabilis]
Length=752

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/731 (65%), Positives = 570/731 (78%), Gaps = 7/731 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D +RV  SH++ LG++LGS + A++A+FYSYTRHINGFAA LEEE AAEIA +P VISV
Sbjct  29    LDSERVTQSHYEFLGSFLGSHEVAKEALFYSYTRHINGFAATLEEEVAAEIANHPRVISV  88

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGLE   G +   S+WKKA++GE+ IIGNLDTGVWPESKSFS+E
Sbjct  89    FLNKGRKLHTTRSWDFLGLE-HNGFVPKSSLWKKARYGENAIIGNLDTGVWPESKSFSDE  147

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
               GPIP +WKGICQ   D SFHCNRKLIGARYF +GY +A GPLNS+F +PRD  GHGSH
Sbjct  148   ELGPIPPKWKGICQKGLDSSFHCNRKLIGARYFNKGYGAAAGPLNSTFDSPRDNEGHGSH  207

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GNFVP ANVFG GNGTAKGGSP+ARVAAYKVCWPP   G +C+DADILA FD A
Sbjct  208   TLSTASGNFVPAANVFGFGNGTAKGGSPRARVAAYKVCWPPID-GNECFDADILAAFDIA  266

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG  P P+FNDS+AIGSFHA+K+GIVVV S GN GP   +V+NVAPW 
Sbjct  267   IHDGVDVLSVSLGGS-PAPFFNDSVAIGSFHAIKHGIVVVCSGGNSGPADATVSNVAPWE  325

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S V+LGNKK + G+S     L  GKFYPL+SA  A+    A+ S  D
Sbjct  326   ITVGASTMDREFPSYVILGNKKSFKGQSLSAKALQIGKFYPLVSALDAK---AANASAAD  382

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CKP TLDP+KV GK+LVCL+G+N R++K  +A  AGAVGMILAN+E +GNEIIAD H
Sbjct  383   ALLCKPATLDPKKVTGKILVCLRGQNARVDKGQQALEAGAVGMILANNELTGNEIIADPH  442

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ Y+DG+ +F YIN T++P  +IT   T LG KPAP +AAFSS+GPN + P+IL
Sbjct  443   VLPASHINYNDGINVFTYINSTKSPKGYITPATTKLGTKPAPFMAAFSSKGPNTVTPEIL  502

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV++IAA+TEA GP++ ++DKR +SFN  SGTSMSCPHV+G+VGLLKTL+P W
Sbjct  503   KPDITAPGVSIIAAYTEAQGPTNEEFDKRRISFNSISGTSMSCPHVSGIVGLLKTLHPDW  562

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA  R N  + + +  +  K TPF+YGAGH+NPNGA DPGLVYDL   D
Sbjct  563   SPAAIKSAIMTTARTRDNQMEPLLNS-SNFKATPFSYGAGHVNPNGAMDPGLVYDLSFND  621

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA  YN T+I      PYKC   ISL+  NYPSITVP L G+  VTRTLKNVG+P
Sbjct  622   YLNFLCALRYNATQIEMFSEKPYKCSKKISLTNLNYPSITVPKLSGSIAVTRTLKNVGTP  681

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY A V +  G SV+V PK LKF++VGEE+SF +TLKAK   A  DYAFG L WSD  H
Sbjct  682   GTYRARVENQAGISVSVEPKSLKFKRVGEEKSFTLTLKAKNPKAAKDYAFGKLIWSDGTH  741

Query  200   RVRSPIVVKTA  168
              VRSPIVVK A
Sbjct  742   YVRSPIVVKAA  752



>ref|XP_008462019.1| PREDICTED: subtilisin-like protease isoform X1 [Cucumis melo]
Length=773

 Score =   944 bits (2439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/728 (65%), Positives = 566/728 (78%), Gaps = 8/728 (1%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDK-ARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             D V  SHHQ L  +L S ++  +D IFYSYTRHINGFAAMLE+E AA++AK+P V+SVFL
Sbjct  50    DVVADSHHQFLQPFLKSGEEFTKDVIFYSYTRHINGFAAMLEDEVAAQLAKHPRVVSVFL  109

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             NR R+L TTRSWEF+GLE E GVI   SIWKKA+FGEDTIIGNLDTGVW ESKSFS++  
Sbjct  110   NRGRKLHTTRSWEFMGLENENGVIESESIWKKARFGEDTIIGNLDTGVWAESKSFSDDEM  169

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQ D SFHCNRKLIGARYF +GY+S VGPLNSSF +PRD  GHGSHTL
Sbjct  170   GPIPHRWKGICQNQNDPSFHCNRKLIGARYFNKGYASVVGPLNSSFHSPRDKEGHGSHTL  229

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGGNFV GA+VFGLG GTAKGGSP+ARVAAYKVCWPP + G +C+DADILA FD AI 
Sbjct  230   STAGGNFVAGASVFGLGKGTAKGGSPRARVAAYKVCWPPKA-GNECFDADILAAFDLAIH  288

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DGVDVLSVSLGGD P P FNDS+AIGSFHA+K+GIVV+ SAGN GP AG+V NVAPW IT
Sbjct  289   DGVDVLSVSLGGD-PNPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQIT  347

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR+F S VVLGNKK   GES     LP+ K YPL++AA  R+   A+ S  +A 
Sbjct  348   VGASTMDRKFPSLVVLGNKKQIEGESLSQEALPSKKLYPLMNAADVRL---ANASAHEAQ  404

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK GTLDP K KGK+LVCL+G+N R++K  +A LAGA GMILAN+E SGNEI+AD H L
Sbjct  405   LCKAGTLDPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  464

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PA H+ Y+DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  465   PALHINYTDGSAVFAYINSTKFPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  524

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APG++VIAA+TEA GP++ ++D R V FN  SGTSMSCPHV+G+ GLL+TLYP WSP
Sbjct  525   DITAPGLSVIAAYTEAEGPTNQEFDNRRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSP  584

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A I+SAIMTTA+   N+ + +  + +    TPF YGAGH++PNGA DPGLVYD+ + +Y+
Sbjct  585   AAIKSAIMTTASTLDNNFEPLL-NASYFVATPFNYGAGHVHPNGATDPGLVYDIDVNEYL  643

Query  554   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  375
             +F+CA GY+K +I+     P+ C + ISL+  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  644   SFLCALGYDKAQISQFSDGPFNCSEPISLTNLNYPSITVPKLSRSITITRRLKNVGSPGT  703

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  198
             Y A +R P G SV V PK L F K+GEE SFKV +K KG   A  +Y +G L WSD KH 
Sbjct  704   YEAKIRKPAGISVWVKPKKLNFTKLGEELSFKVFMKVKGHKVAKKNYVYGDLIWSDGKHH  763

Query  197   VRSPIVVK  174
             VRSPIVVK
Sbjct  764   VRSPIVVK  771



>ref|XP_007049440.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOX93597.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=794

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/729 (66%), Positives = 574/729 (79%), Gaps = 7/729 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLD V  SH++ LG++LGS D AR+AIFYSYTRHINGFAA LE+E AAEIA++P+V+S+
Sbjct  71    VDLDAVMESHYEFLGSFLGSRDYAREAIFYSYTRHINGFAANLEDEVAAEIARHPKVVSL  130

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R L TTRSWEFLGLE + GV+   SIW KA++GEDTIIGNLDTGVWPESKSFS++
Sbjct  131   FLNKGRNLHTTRSWEFLGLE-QKGVVPSNSIWNKARYGEDTIIGNLDTGVWPESKSFSDD  189

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP +WKGICQN KD  FHCNRKLIGARYF +GY+S VG LNSSF TPRD  GHG+H
Sbjct  190   GYGPIPSKWKGICQNDKDDGFHCNRKLIGARYFNKGYASIVGKLNSSFDTPRDKEGHGTH  249

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGN V  A+V G G GTAKGGSP+ARVAAYKVCWPP S G++C+DADILA FD A
Sbjct  250   TLSTAGGNLVAKASVLGFGKGTAKGGSPRARVAAYKVCWPPVS-GDECFDADILAAFDVA  308

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD P P+FNDS+AIGSFHA+K+GIVVV SAGN GP  G+V N+APW 
Sbjct  309   IHDGVDVLSVSLGGD-PTPFFNDSVAIGSFHAIKHGIVVVCSAGNSGPAYGTVTNIAPWQ  367

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S VVLGN   Y G+S     LP  KF+PL+SAA A+    A+ S ++
Sbjct  368   ITVGASTMDREFPSIVVLGNNMRYKGQSLSANDLPDKKFFPLISAADAK---AANASIEN  424

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL C+ GT+DPEK  GK LVCL+G+N R++K  +AALAGAVGM+LAN+  +GNEIIADAH
Sbjct  425   ALLCQAGTIDPEKASGKFLVCLRGQNARVDKGQQAALAGAVGMVLANNILAGNEIIADAH  484

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ Y+DGLA+F YIN T+ P A+IT   T +G KPAP +AAFSS+GPN I P+IL
Sbjct  485   VLPASHINYTDGLAVFTYINSTKYPTAYITPVTTQIGTKPAPFMAAFSSKGPNTITPEIL  544

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTLYP W
Sbjct  545   KPDITAPGVSVIAAYTEAQGPTNEDFDKRRVQFNCVSGTSMSCPHVSGIVGLLKTLYPDW  604

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMT+AT   N  + I  + + +K  PF+YGAGHI PN A DPGLVYDL  TD
Sbjct  605   SPAAIKSAIMTSATTWDNMKEPIL-NASNIKAGPFSYGAGHIQPNLAMDPGLVYDLAATD  663

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+C  GYN+T I+     PYKCP  ISL+ FNYPSI VP+L G+ TVTRT+KNVGSP
Sbjct  664   YLNFLCTLGYNETLISMFSQNPYKCPKPISLANFNYPSIAVPNLVGSITVTRTVKNVGSP  723

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY A V+ P G SV V PK LKF+KVGEE++F VTL     +   +Y FG L WSD  H
Sbjct  724   GTYRAQVQRPTGISVQVKPKKLKFKKVGEEKTFSVTLNVMKAHPVKEYVFGQLIWSDHVH  783

Query  200   RVRSPIVVK  174
              V SPIVVK
Sbjct  784   HVSSPIVVK  792



>gb|KGN43389.1| hypothetical protein Csa_7G030520 [Cucumis sativus]
Length=736

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/729 (64%), Positives = 572/729 (78%), Gaps = 8/729 (1%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDK-ARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             D V +SHH+ L  +L S ++  +D IFYSYTRHINGFAAMLE+E A ++AK+P+V+SVFL
Sbjct  13    DVVANSHHEFLQPFLKSGEEFTKDVIFYSYTRHINGFAAMLEDEVAVQLAKHPKVVSVFL  72

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             NR R+L TTRSWEF+GLE + GVI+  SIWKKA+FGEDTIIGNLDTGVW ESKSFS++ +
Sbjct  73    NRGRKLHTTRSWEFMGLENKNGVINSESIWKKARFGEDTIIGNLDTGVWAESKSFSDDEY  132

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD SFHCNRKLIGARYF +GY+S VGPLNSSF +PRD  GHGSHTL
Sbjct  133   GPIPHRWKGICQNQKDPSFHCNRKLIGARYFNKGYASVVGPLNSSFHSPRDKEGHGSHTL  192

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGGNFV GA+VFGLG GTAKGGSP+ARVAAYKVCWPP + G +C+DADILA FD AI 
Sbjct  193   STAGGNFVAGASVFGLGKGTAKGGSPRARVAAYKVCWPPKA-GNECFDADILAAFDFAIH  251

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DGVDVLSVSLGGD P P FNDS+AIGSFHA+K+GIVV+ SAGN GP AG+V NVAPW IT
Sbjct  252   DGVDVLSVSLGGD-PNPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQIT  310

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR+F S VVLGN+K   GES     LP+ K YPL++AA  R+   A+ S  +A 
Sbjct  311   VGASTMDRKFPSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRL---ANASVHEAQ  367

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK GTL+P K KGK+LVCL+G+N R++K  +A LAGA GMILAN+E SGNEI+AD H L
Sbjct  368   LCKAGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  427

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PA+H+ ++DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  428   PASHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  487

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APG++VIAA+TEA GP++ ++D R + FN  SGTSMSCPHV+G+ GLLKTLYP WSP
Sbjct  488   DITAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSP  547

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A I+SAIMTTA++  N+ + + +    +  +PF YGAGH++PNGAADPGLVYD+++ +Y+
Sbjct  548   AAIKSAIMTTASILDNNFEPLLNASYSV-ASPFNYGAGHVHPNGAADPGLVYDIEVNEYL  606

Query  554   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  375
             +F+CA GYNK +I+     P+ C D IS +  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  607   SFLCALGYNKAQISQFSNGPFNCSDPISPTNLNYPSITVPKLSRSITITRRLKNVGSPGT  666

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  198
             Y A +R P G SV V PK L F ++GEE SFKV +K K    A  +Y +G L WSD KH 
Sbjct  667   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHH  726

Query  197   VRSPIVVKT  171
             VRSPIVVK 
Sbjct  727   VRSPIVVKV  735



>ref|XP_010644656.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=768

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/729 (64%), Positives = 578/729 (79%), Gaps = 7/729 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLDRV +SH+  LG++LGS +KA+DA+FYSY ++INGFAA+LEEEEAAEIAK+P VISV
Sbjct  46    VDLDRVTNSHYDFLGSFLGSNEKAKDAMFYSYNKNINGFAAILEEEEAAEIAKHPNVISV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW FL LE + GVI   SIWKKA+FGEDTIIGNLDTGVWPESKSFS+E
Sbjct  106   FLNKGRKLHTTRSWHFLDLE-KNGVIQPNSIWKKARFGEDTIIGNLDTGVWPESKSFSDE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G G +P +W+G CQ++   +  CNRKLIGARYF +GY++  GPLNSSF + RD  GHGSH
Sbjct  165   GMGLVPSKWRGTCQDETKNAVTCNRKLIGARYFNKGYAAYAGPLNSSFNSARDHEGHGSH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGG+ V GA+VFG GNGTAKGGSP ARVAAYKVCWP  + G  C+DADI+A FD A
Sbjct  225   TLSTAGGSLVYGASVFGYGNGTAKGGSPGARVAAYKVCWPQVNNG-GCFDADIMAAFDAA  283

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD    YF D LAIGSFHAVK GIVVV+SAGN+GP   SV+NV+PW+
Sbjct  284   IHDGVDVLSVSLGGD-ASDYFTDGLAIGSFHAVKRGIVVVSSAGNDGPKDASVSNVSPWM  342

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F + V LGN+KH  G S     LP+ KFYP++S+  A+    A+ S QD
Sbjct  343   ITVGASTIDREFTNYVALGNRKHLKGMSLSTKGLPSNKFYPVISSLDAKA---ANASAQD  399

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ CKPGTL+P+KVKGK+LVCL+GEN R++K  +AALAGAVG ILAND  SGNE+IAD H
Sbjct  400   AILCKPGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPH  459

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HV +SDG A+F+YIN T+NP+A++T   T LG+KPAP +A+FSS+GPN I P+IL
Sbjct  460   VLPASHVNFSDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA++E+ GP+D  +DKR + FN +SGTSMSCPH++G+VGLLKTL+P W
Sbjct  520   KPDITAPGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMT+A  R ++ + + +  + LK TPF+YGAGH+ PN A DPGLVYD  + D
Sbjct  580   SPAAIKSAIMTSARTRDDNMEPMLNS-SNLKATPFSYGAGHVRPNRAMDPGLVYDSTVND  638

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GYN+T++      PYKCP   SL+ FNYPSIT P+L G+ T++RT+KNVG+P
Sbjct  639   YLNFLCAIGYNETQLQIFSQKPYKCPKSFSLTGFNYPSITAPNLSGSVTISRTVKNVGTP  698

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TYTASV++P G SV V P  L+F + GEE+SF++TLKAKG     DY FG L WSD +H
Sbjct  699   GTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQH  758

Query  200   RVRSPIVVK  174
              VRS IVVK
Sbjct  759   YVRSSIVVK  767



>ref|XP_006447869.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
 gb|ESR61109.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
Length=773

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/733 (64%), Positives = 577/733 (79%), Gaps = 9/733 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL RV  SH++ LG++L   D   DAIFYSYTRHINGFAA L++  AAEIAK+P+V+SV
Sbjct  48    VDLHRVTESHYEFLGSFLHGNDNPEDAIFYSYTRHINGFAAKLDDAVAAEIAKHPKVVSV  107

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SWEFLGLE   G +   SIWKKA++GEDTIIGNLDTGVWPESKSFS+E
Sbjct  108   FLNQGRKLHTTHSWEFLGLE-RNGRVESNSIWKKARYGEDTIIGNLDTGVWPESKSFSDE  166

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +WKGIC+N KD  F CNRKLIGARYF +GY++AVGPLNSSF TPRD  GHG+H
Sbjct  167   GLGPIPSKWKGICENDKDAKFLCNRKLIGARYFNKGYAAAVGPLNSSFDTPRDKDGHGTH  226

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV  A+VFGLG GTAKGGSPKARVAAYKVCWPP + G +CYDADILA FD A
Sbjct  227   TLSTAGGNFVAKASVFGLGKGTAKGGSPKARVAAYKVCWPPVT-GNECYDADILAAFDMA  285

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG  P  +FNDS AIGSFHAVK+G+VV+ SAGN GP   +V+N+APW 
Sbjct  286   IHDGVDVLSVSLGGG-PSKFFNDSTAIGSFHAVKHGMVVICSAGNSGPTDSTVSNIAPWQ  344

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S VV+ N K Y G+S     LP  K +PL+SAA A+    A+ ST+ 
Sbjct  345   ITVGASTMDRDFPSYVVVSNNKRYKGQSLSSKGLPRNKLFPLISAADAK---AANASTEV  401

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL C+ GTLDP+KVKGK+LVCL+G+N RI+K  +A LAGAVGM+LAN  ++GNE++AD H
Sbjct  402   ALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELLADPH  461

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HV Y+DG  +F Y+N T+ PV ++T   T LG+KPAP++AAFSS+GP++I P+IL
Sbjct  462   LLPASHVNYTDGADLFRYVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSIAPEIL  521

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCPHV+G+VGLLKTL+P W
Sbjct  522   KPDITAPGVTIIAAYTEAVGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKTLHPEW  581

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+++ N+   I  + +  K TPF+YGAGHI PN A DPGLVYDL   D
Sbjct  582   SPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQPNLAMDPGLVYDLTEND  640

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L G+  V+RT++NVGSP
Sbjct  641   YLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKLSGSIIVSRTVRNVGSP  700

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWS-DK  207
              TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   AT DY FG L W+ DK
Sbjct  701   GTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGDLVWADDK  760

Query  206   KHRVRSPIVVKTA  168
             +H+VRSPIVV  A
Sbjct  761   QHQVRSPIVVNPA  773



>ref|XP_004144624.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=758

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/729 (64%), Positives = 571/729 (78%), Gaps = 8/729 (1%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDK-ARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             D V +SHH+ L  +L S ++  +D IFYSYTRHINGFAAMLE+E A ++AK+P+V+SVFL
Sbjct  35    DVVANSHHEFLQPFLKSGEEFTKDVIFYSYTRHINGFAAMLEDEVAVQLAKHPKVVSVFL  94

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             NR R+L TTRSWEF+GLE + GVI+  SIWKKA+FGEDTIIGNL+ GVW ESKSFS++ +
Sbjct  95    NRGRKLHTTRSWEFMGLENKNGVINSESIWKKARFGEDTIIGNLEIGVWAESKSFSDDEY  154

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD SFHCNRKLIGARYF +GY+S VGPLNSSF +PRD  GHGSHTL
Sbjct  155   GPIPHRWKGICQNQKDPSFHCNRKLIGARYFNKGYASVVGPLNSSFHSPRDKEGHGSHTL  214

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGGNFV GA+VFGLG GTAKGGSP+ARVAAYKVCWPP + G +C+DADILA FD AI 
Sbjct  215   STAGGNFVAGASVFGLGKGTAKGGSPRARVAAYKVCWPPKA-GNECFDADILAAFDFAIH  273

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DGVDVLSVSLGGD P P FNDS+AIGSFHA+K+GIVV+ SAGN GP AG+V NVAPW IT
Sbjct  274   DGVDVLSVSLGGD-PNPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQIT  332

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR+F S VVLGN+K   GES     LP+ K YPL++AA  R+   A+ S  +A 
Sbjct  333   VGASTMDRKFPSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRL---ANASVHEAQ  389

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK GTL+P K KGK+LVCL+G+N R++K  +A LAGA GMILAN+E SGNEI+AD H L
Sbjct  390   LCKAGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  449

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PA+H+ ++DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  450   PASHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  509

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APG++VIAA+TEA GP++ ++D R + FN  SGTSMSCPHV+G+ GLLKTLYP WSP
Sbjct  510   DITAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSP  569

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A I+SAIMTTA++  N+ + + +    +  +PF YGAGH++PNGAADPGLVYD+++ +Y+
Sbjct  570   AAIKSAIMTTASILDNNFEPLLNASYSV-ASPFNYGAGHVHPNGAADPGLVYDIEVNEYL  628

Query  554   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  375
             +F+CA GYNK +I+     P+ C D IS +  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  629   SFLCALGYNKAQISQFSNGPFNCSDPISPTNLNYPSITVPKLSRSITITRRLKNVGSPGT  688

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  198
             Y A +R P G SV V PK L F ++GEE SFKV +K K    A  +Y +G L WSD KH 
Sbjct  689   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHH  748

Query  197   VRSPIVVKT  171
             VRSPIVVK 
Sbjct  749   VRSPIVVKV  757



>ref|XP_006469397.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
Length=773

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/733 (64%), Positives = 577/733 (79%), Gaps = 9/733 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL RV  SH++ LG++L   D   DAIFYSYTRHINGFAA L++  AAEIAK+P+V+SV
Sbjct  48    VDLHRVTESHYEFLGSFLHGNDNPEDAIFYSYTRHINGFAAKLDDAVAAEIAKHPKVVSV  107

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SWEFLGLE   G +   SIWKKA++GEDTIIGNLDTGVWPESKSFS+E
Sbjct  108   FLNQGRKLHTTHSWEFLGLE-RNGRVESNSIWKKARYGEDTIIGNLDTGVWPESKSFSDE  166

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +WKGIC+N KD  F CNRKLIGARYF +GY++AVGPLNSSF TPRD  GHG+H
Sbjct  167   GLGPIPSKWKGICENDKDAKFLCNRKLIGARYFNKGYAAAVGPLNSSFDTPRDKDGHGTH  226

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV  A+VFGLG GTAKGGSPKARVAAYKVCWPP + G +CYDADILA FD A
Sbjct  227   TLSTAGGNFVAKASVFGLGKGTAKGGSPKARVAAYKVCWPPVT-GNECYDADILAAFDMA  285

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG  P  +FNDS AIGSFHAVK+G+VV+ SAGN GP   +V+N+APW 
Sbjct  286   IHDGVDVLSVSLGGG-PSKFFNDSTAIGSFHAVKHGMVVICSAGNSGPTDSTVSNIAPWQ  344

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S VV+ N K Y G+S     LP  K +PL+SAA A+    A+ ST+ 
Sbjct  345   ITVGASTMDRDFPSYVVVSNNKRYKGQSLSSKGLPRNKLFPLISAADAK---AANASTEV  401

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL C+ GTLDP+KVKGK+LVCL+G+N RI+K  +A LAGAVGM+LAN  ++GNE++AD H
Sbjct  402   ALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELLADPH  461

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HV Y+DG  +F Y+N T+ PV ++T   T LG+KPAP++AAFSS+GP++I P+IL
Sbjct  462   LLPASHVNYTDGADLFRYVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSIAPEIL  521

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCPHV+G+VGLLKTL+P W
Sbjct  522   KPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKTLHPEW  581

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+++ N+   I  + +  K TPF+YGAGHI PN A DPGLVYDL   D
Sbjct  582   SPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQPNLAMDPGLVYDLTEND  640

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L G+  V+RT++NVGSP
Sbjct  641   YLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKLSGSIIVSRTVRNVGSP  700

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWS-DK  207
              TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   AT DY FG L W+ DK
Sbjct  701   GTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGDLVWADDK  760

Query  206   KHRVRSPIVVKTA  168
             +H+VRSPIVV  A
Sbjct  761   QHQVRSPIVVNPA  773



>ref|XP_004294696.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=771

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/732 (64%), Positives = 577/732 (79%), Gaps = 8/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L +V+ +H++ LG++LGS + A+D+IFYSYTRHINGFAA LEEE+AA+IAK+P+VISV
Sbjct  47    LELTQVRENHYEFLGSFLGSHEVAKDSIFYSYTRHINGFAATLEEEDAAQIAKHPKVISV  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FL LE   GV    S+W+KA++GEDTII NLDTGVWPESKSFS+E
Sbjct  107   FLNKGRKLHTTRSWDFLELE-HNGVTPPNSVWEKARYGEDTIIANLDTGVWPESKSFSDE  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP +W GICQN+ D  FHCNRKLIGARYF +G+++ VG LNSSF +PRD  GHGSH
Sbjct  166   GYGPIPPKWTGICQNETDSGFHCNRKLIGARYFNKGFAAVVGSLNSSFQSPRDEEGHGSH  225

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAYKVCWPP + G +C+DADILA FD A
Sbjct  226   TLSTAGGNFVTGASVFGYGNGTAKGGSPKARVAAYKVCWPPVN-GSECFDADILAAFDMA  284

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD P  +FNDS+AIGSFHAVK+GIVVV SAGN GP   +V+NVA W 
Sbjct  285   IHDGVDVLSVSLGGD-PVAFFNDSVAIGSFHAVKHGIVVVCSAGNSGPADSTVSNVAVWE  343

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S + LGN KH  G+S   + L + +FYPL+SAA A+    A+ S  +
Sbjct  344   ITVGASTMDREFPSYITLGNWKHLKGQSLSAMALRSKRFYPLISAADAK---AANASVHE  400

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLDPEKVKGK+L CL+G+N R++K  ++ LAGAVGMILANDE +GNEII+D H
Sbjct  401   ALLCKAGTLDPEKVKGKILACLRGDNARVDKGEQSLLAGAVGMILANDEVNGNEIISDPH  460

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA H+ ++DG  +F YIN+T +P A+I  P T+LG KPAP +AAFSS+GPN+I PDIL
Sbjct  461   VLPAAHINFTDGALVFAYINETTSPRAYIKRPTTMLGTKPAPFMAAFSSKGPNSITPDIL  520

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA++EA GP++ ++D+R + FN  SGTSMSCPH++G+VGLLKTLYP W
Sbjct  521   KPDITAPGVSVIAAYSEAQGPTNQEFDRRRIPFNSVSGTSMSCPHISGIVGLLKTLYPHW  580

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA  + N+ + +  + +  + TPF+YGAGH+ PN A DPGLVYDL   D
Sbjct  581   SPAAIKSAIMTTAKTQDNNREPLL-NASNSEATPFSYGAGHVKPNSAMDPGLVYDLDTDD  639

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+N +CA GYNKT+I       YKCP   ISL+  NYPSITVP L G+  V RTLKNVG 
Sbjct  640   YLNVLCALGYNKTQIETFSQESYKCPSPAISLTNLNYPSITVPKLSGSLVVKRTLKNVGE  699

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TYTA + +P G  V+V PK LKF+KVGEE+SF V L+AK  NA  +Y FG L WSD K
Sbjct  700   PGTYTARITNPDGILVSVEPKSLKFKKVGEEKSFNVVLEAKDSNAAKNYVFGKLIWSDGK  759

Query  203   HRVRSPIVVKTA  168
             H VRSPIVVK A
Sbjct  760   HNVRSPIVVKAA  771



>gb|KDO42093.1| hypothetical protein CISIN_1g038881mg [Citrus sinensis]
Length=794

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/733 (64%), Positives = 578/733 (79%), Gaps = 9/733 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL RV  SH++ LG++L   D   DAIFYSYTRHINGFAA L++  AAEIAK+P+V+SV
Sbjct  69    VDLHRVTESHYEFLGSFLHGNDNPEDAIFYSYTRHINGFAAKLDDAVAAEIAKHPKVVSV  128

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SWEFLGLE   G +   SIWKKA++GEDTIIGNLDTGVWPESKSFS+E
Sbjct  129   FLNQGRKLHTTHSWEFLGLE-RNGRVESNSIWKKARYGEDTIIGNLDTGVWPESKSFSDE  187

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +WKGIC+N KD  F CNRKLIGARYF +GY++AVGPLNSSF TPRD  GHG+H
Sbjct  188   GLGPIPSKWKGICENDKDAKFLCNRKLIGARYFNKGYAAAVGPLNSSFDTPRDKDGHGTH  247

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV  A+VFGLG GTAKGGSPKARVAAYKVCWPP + G +CYDADILA FD A
Sbjct  248   TLSTAGGNFVAKASVFGLGKGTAKGGSPKARVAAYKVCWPPVT-GNECYDADILAAFDMA  306

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG  P  +FNDS AIGSFHAVK+G+VV+ SAGN GP   +V+N+APW 
Sbjct  307   IHDGVDVLSVSLGGG-PSKFFNDSTAIGSFHAVKHGMVVICSAGNSGPTDSTVSNIAPWQ  365

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S VV+ N K Y G+S     LP+ K +PL+SAA A+    A+ ST+ 
Sbjct  366   ITVGASTMDRDFPSYVVVSNNKRYKGQSLSSKGLPSNKLFPLISAADAK---AANASTEV  422

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL C+ GTLDP+KVKGK+LVCL+G+N RI+K  +A LAGAVGM+LAN +++GNE++AD H
Sbjct  423   ALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLANAQENGNELLADPH  482

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG  +F  +N T+ PV ++T   T LG+KPAP++AAFSS+GP+++ P+IL
Sbjct  483   LLPASHINFTDGADLFRDVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSVAPEIL  542

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCPHV+G+VGLLKTL+P W
Sbjct  543   KPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKTLHPEW  602

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+++ N+   I  + +  K TPF+YGAGHI PN A DPGLVYDL   D
Sbjct  603   SPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQPNLAMDPGLVYDLTEND  661

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L G+  V+RT++NVGSP
Sbjct  662   YLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKLSGSIIVSRTVRNVGSP  721

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKA-KGENATADYAFGVLTWS-DK  207
              TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   AT DY FG L W+ DK
Sbjct  722   GTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKVRKVRAATKDYVFGDLVWADDK  781

Query  206   KHRVRSPIVVKTA  168
             +H+VRSPIVV  A
Sbjct  782   QHQVRSPIVVNPA  794



>ref|XP_010048342.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW89053.1| hypothetical protein EUGRSUZ_A01377 [Eucalyptus grandis]
Length=770

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/729 (65%), Positives = 563/729 (77%), Gaps = 7/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+ LG++LGS D A +AIFYSYTRHINGFAA LE+E AA+IAK+P V+SVF
Sbjct  46    DLSRVTESHHEFLGSFLGSRDDAEEAIFYSYTRHINGFAATLEDEVAAQIAKHPRVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSWEFLGLE + GVI   SIWKKA+FGED IIGNLD+G WPESKSFS++G
Sbjct  106   LNQGKKLHTTRSWEFLGLE-QNGVIPSESIWKKARFGEDIIIGNLDSGAWPESKSFSDQG  164

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +WKGICQN KD  F CNRKLIGARYF QGY++AV PL++SF TPRD  GHGSHT
Sbjct  165   LGPIPPKWKGICQNDKDPRFRCNRKLIGARYFNQGYAAAVEPLSASFDTPRDNEGHGSHT  224

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+VFG G GTAKGGSPKARVAAYKVC PP + G  C+DADI+AGFD AI
Sbjct  225   LSTAGGNFVAGASVFGYGRGTAKGGSPKARVAAYKVCGPPVAAGA-CFDADIMAGFDAAI  283

Query  1637  EDGVDVLSVSLGGDHPGP-YFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
              DGVDVLSVSLGG  P P   NDS+AIGSFHAV NGIVVV SAGN+GP   +V+N+ PWL
Sbjct  284   HDGVDVLSVSLGGSPPLPTLLNDSIAIGSFHAVTNGIVVVCSAGNDGPGDRTVSNIWPWL  343

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITV A+TMDR F + VV+G+++ + G S  P  LP GKFY L+SAA A +   + +S  +
Sbjct  344   ITVAASTMDRDFSNYVVIGDQRRFKGASLSPKSLPGGKFYKLISAADAGL---SHVSPDE  400

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ CK GTLDP KVKG +LVCL GEN  + +  +A LAGAVGM+LAN   SGNEI+AD H
Sbjct  401   AIFCKDGTLDPRKVKGNILVCLWGENATVHEGEQAFLAGAVGMVLANSILSGNEILADPH  460

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HV Y DG AIF YI  T+ P A IT   T LGVKP+P++AAFSS+GPN I P+IL
Sbjct  461   LLPASHVNYGDGAAIFSYIKSTKFPTAQITRVVTNLGVKPSPLMAAFSSKGPNTITPEIL  520

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+TEA GP+D ++DKR V FN  SGTSMSCPHV+GV GLLKTL+P W
Sbjct  521   KPDITAPGVSVIAAYTEAAGPTDEEFDKRRVPFNAVSGTSMSCPHVSGVAGLLKTLHPEW  580

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMT+AT++ N+ ++I  + +  K TPF+YGAGHI PN A DPGLVYDL + D
Sbjct  581   SPAAIRSAIMTSATIQDNAMESII-NASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIED  639

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y NF+C+ GYN  +I+      Y C  HI L  FNYPSITVP L G+  VTRT+KNVG P
Sbjct  640   YPNFLCSLGYNAMQISMFSDGAYNCSKHIGLLDFNYPSITVPKLSGSIMVTRTVKNVGLP  699

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY AS+  P G SV V P  LKF+K+ E++SFKV LKAKG + T DY+FG L WSD +H
Sbjct  700   GTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLKAKGASVTGDYSFGELIWSDTEH  759

Query  200   RVRSPIVVK  174
              VRSPIVVK
Sbjct  760   YVRSPIVVK  768



>emb|CBI39824.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/735 (63%), Positives = 578/735 (79%), Gaps = 13/735 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLDRV +SH+  LG++LGS +KA+DA+FYSY ++INGFAA+LEEEEAAEIAK+P VISV
Sbjct  75    VDLDRVTNSHYDFLGSFLGSNEKAKDAMFYSYNKNINGFAAILEEEEAAEIAKHPNVISV  134

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW FL LE + GVI   SIWKKA+FGEDTIIGNLDTGVWPESKSFS+E
Sbjct  135   FLNKGRKLHTTRSWHFLDLE-KNGVIQPNSIWKKARFGEDTIIGNLDTGVWPESKSFSDE  193

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G G +P +W+G CQ++   +  CNRKLIGARYF +GY++  GPLNSSF + RD  GHGSH
Sbjct  194   GMGLVPSKWRGTCQDETKNAVTCNRKLIGARYFNKGYAAYAGPLNSSFNSARDHEGHGSH  253

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGG+ V GA+VFG GNGTAKGGSP ARVAAYKVCWP  + G  C+DADI+A FD A
Sbjct  254   TLSTAGGSLVYGASVFGYGNGTAKGGSPGARVAAYKVCWPQVNNG-GCFDADIMAAFDAA  312

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD    YF D LAIGSFHAVK GIVVV+SAGN+GP   SV+NV+PW+
Sbjct  313   IHDGVDVLSVSLGGD-ASDYFTDGLAIGSFHAVKRGIVVVSSAGNDGPKDASVSNVSPWM  371

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGE------SAVPLKLPTGKFYPLLSAASARIKINA  1299
             ITVGA+T+DR F + V LGN+KH   E      S     LP+ KFYP++S+  A+    A
Sbjct  372   ITVGASTIDREFTNYVALGNRKHLKNEHLQMGMSLSTKGLPSNKFYPVISSLDAKA---A  428

Query  1298  SISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNE  1119
             + S QDA+ CKPGTL+P+KVKGK+LVCL+GEN R++K  +AALAGAVG ILAND  SGNE
Sbjct  429   NASAQDAILCKPGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNE  488

Query  1118  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  939
             +IAD H LPA+HV +SDG A+F+YIN T+NP+A++T   T LG+KPAP +A+FSS+GPN 
Sbjct  489   LIADPHVLPASHVNFSDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNT  548

Query  938   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  759
             I P+ILKPDI+APGVN+IAA++E+ GP+D  +DKR + FN +SGTSMSCPH++G+VGLLK
Sbjct  549   ITPEILKPDITAPGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLK  608

Query  758   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVY  579
             TL+P WSPA I+SAIMT+A  R ++ + + +  + LK TPF+YGAGH+ PN A DPGLVY
Sbjct  609   TLHPDWSPAAIKSAIMTSARTRDDNMEPMLNS-SNLKATPFSYGAGHVRPNRAMDPGLVY  667

Query  578   DLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTL  399
             D  + DY+NF+CA GYN+T++      PYKCP   SL+ FNYPSIT P+L G+ T++RT+
Sbjct  668   DSTVNDYLNFLCAIGYNETQLQIFSQKPYKCPKSFSLTGFNYPSITAPNLSGSVTISRTV  727

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLT  219
             KNVG+P TYTASV++P G SV V P  L+F + GEE+SF++TLKAKG     DY FG L 
Sbjct  728   KNVGTPGTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLI  787

Query  218   WSDKKHRVRSPIVVK  174
             WSD +H VRS IVVK
Sbjct  788   WSDGQHYVRSSIVVK  802



>ref|XP_007217687.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
 gb|EMJ18886.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
Length=773

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/732 (64%), Positives = 580/732 (79%), Gaps = 8/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L++V  +H++ LG++LGS + A+++IFYSYTRHINGFAA LEEEEAA+IAK+P+V+S+
Sbjct  49    LELNQVTENHYEFLGSFLGSHEVAKESIFYSYTRHINGFAATLEEEEAAQIAKHPKVVSI  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGLE +G V    SIW KA++GEDTIIGNLDTG WPES SFS+E
Sbjct  109   FLNQGRKLHTTRSWDFLGLEHDG-VTPPNSIWNKARYGEDTIIGNLDTGAWPESNSFSDE  167

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP +WKGICQN+ D  F+CNRKLIGARYF +GY++  G LNSSF +PRD  GHGSH
Sbjct  168   GYGPIPSKWKGICQNETDSEFYCNRKLIGARYFNKGYAAVAGTLNSSFDSPRDNEGHGSH  227

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAYKVCWPP + G++C++ADILA FD A
Sbjct  228   TLSTAGGNFVTGASVFGFGNGTAKGGSPKARVAAYKVCWPPVN-GDECFEADILAAFDIA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD P  +FND +AIG+FHAVK+GIVVV SAGN GP  G+V++VAPW 
Sbjct  287   IHDGVDVLSVSLGGD-PTAFFNDGVAIGAFHAVKHGIVVVCSAGNSGPAEGTVSSVAPWQ  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F S V LGN KH+ G+S  P  LP  +FY L+SAA A+    A+ S Q+
Sbjct  346   ITVGASTIDREFPSYVTLGNWKHFRGQSLSPEALPGKRFYQLISAADAK---AANASVQE  402

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLD +KVKGK+L CL+GE+ R++K  +A LAGAVGMILANDE SGNE+I+D H
Sbjct  403   ALLCKAGTLDLKKVKGKILACLRGESARVDKGEQALLAGAVGMILANDELSGNEVISDPH  462

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG  +F YIN T++P A+I  P T LG KPAP +AAFSS+GPN I PDIL
Sbjct  463   VLPASHINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAAFSSKGPNTITPDIL  522

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA+TEA GP++  +D+R V FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  523   KPDITAPGVNIIAAYTEAQGPTNQMFDERRVLFNSVSGTSMSCPHISGICGLLKTLYPHW  582

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTAT + NS + +  + +  + TPF+YGAGH+NPN A DPGLVYDL L D
Sbjct  583   SPAAIKSAIMTTATTQDNSREPVL-NASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLND  641

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+NF+C+ GYNK +I  V    YKCP   IS +  NYPSITVP L G+  VTRT+KNVG+
Sbjct  642   YLNFLCSNGYNKRQIEMVSEETYKCPKPAISRTNLNYPSITVPKLNGSLVVTRTVKNVGT  701

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A +++P G SV+V P  L+F+K+GEE+SFK+ L+ K   A  +Y FG L WSD K
Sbjct  702   PGTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGK  761

Query  203   HRVRSPIVVKTA  168
             H VRSPIVVK A
Sbjct  762   HYVRSPIVVKVA  773



>ref|XP_008229767.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=773

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/732 (64%), Positives = 581/732 (79%), Gaps = 8/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L++V+ +H++ LG++LGS + A+++IFYSYT+HINGFAA LEEEEAA+IA++P+V+S+
Sbjct  49    LELNQVRENHYEFLGSFLGSHEVAKESIFYSYTKHINGFAATLEEEEAAQIARHPKVVSI  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGLE +G V    SIW KA++GEDTIIGNLDTG WPES SFS+E
Sbjct  109   FLNQGRKLHTTRSWDFLGLEHDG-VTPPNSIWNKARYGEDTIIGNLDTGAWPESNSFSDE  167

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
              +GPIP +WKGICQN+ D  F+CNRKLIGARY+ +GY++A G LNSSF +PRD  GHGSH
Sbjct  168   EYGPIPSKWKGICQNEADSEFYCNRKLIGARYYNKGYAAAAGTLNSSFDSPRDNEGHGSH  227

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAYKVCWPP + G  C++ADILA FD A
Sbjct  228   TLSTAGGNFVTGASVFGFGNGTAKGGSPKARVAAYKVCWPPVN-GNQCFEADILAAFDIA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD P  +FNDS+AIG+FHAVK+GIVVV SAGN GP  G+V NVAPW 
Sbjct  287   IHDGVDVLSVSLGGD-PSAFFNDSIAIGAFHAVKHGIVVVCSAGNSGPAEGTVCNVAPWQ  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F S V LGN KH+ G+S  P+ LP  +FY L+SAA A+    A+ S Q+
Sbjct  346   ITVGASTIDREFPSYVTLGNWKHFRGQSLSPVALPGKRFYRLISAADAK---AANASVQE  402

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLD +KVKGK+L CLQG++  ++K  +A LAGAVGMILANDE SGNEII+D H
Sbjct  403   ALLCKAGTLDLKKVKGKILACLQGDSATVDKGEQALLAGAVGMILANDELSGNEIISDPH  462

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG  +F YIN T++P A+I  P T LG KPAPV+AAFSS+GPN I PDIL
Sbjct  463   VLPASHINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPVMAAFSSKGPNTITPDIL  522

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV++IAA+TEA GP++  +DKR V FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  523   KPDITAPGVSIIAAYTEAQGPTNQMFDKRRVLFNSVSGTSMSCPHISGICGLLKTLYPHW  582

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTAT + NS + +  + +  + TPF+YGAGH+NPN A DPGLVYDL L D
Sbjct  583   SPAAIKSAIMTTATTQDNSREPLL-NASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLND  641

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+NF+C+ GYNKT+I  V    Y+CP   +SL+  NYPSITVP L G+  VTRT+KNVG+
Sbjct  642   YLNFLCSNGYNKTQIEMVSEEAYECPKPAVSLTNLNYPSITVPKLNGSLVVTRTVKNVGT  701

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A +++P G SV+V P  L+F+K+GEE+SFK+ L+     A  +Y FG L WSD K
Sbjct  702   PGTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVIDAKAAKNYVFGKLIWSDGK  761

Query  203   HRVRSPIVVKTA  168
             H VRSPIVVK A
Sbjct  762   HYVRSPIVVKAA  773



>ref|XP_007214967.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
 gb|EMJ16166.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
Length=773

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/732 (64%), Positives = 579/732 (79%), Gaps = 8/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L++V  +H++ LG++LGS + A+++IFYSYTRHINGFAA LEEEEAA+IAK+P+V+S+
Sbjct  49    LELNQVTENHYEFLGSFLGSHEVAKESIFYSYTRHINGFAATLEEEEAAQIAKHPKVVSI  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGL+ +G V    SIW KA++GEDTIIGNLD+G WPES SFS+E
Sbjct  109   FLNQGRKLHTTRSWDFLGLQHDG-VTPPNSIWNKARYGEDTIIGNLDSGAWPESNSFSDE  167

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
              +GPIP +WKGICQN+ D  F+CNRKLIGARYF +GY++  G LNSSF +PRD +GHGSH
Sbjct  168   EYGPIPSKWKGICQNETDSEFYCNRKLIGARYFNKGYAAVAGTLNSSFDSPRDNVGHGSH  227

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAYKVCWPP + G +CY+ADILA FD A
Sbjct  228   TLSTAGGNFVTGASVFGFGNGTAKGGSPKARVAAYKVCWPPVN-GRECYEADILAAFDIA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG+ P  +FND +AIG+FHAVK+GIVVV SAGN GP  G+V+NVAPW 
Sbjct  287   IHDGVDVLSVSLGGN-PSAFFNDGVAIGAFHAVKHGIVVVCSAGNSGPAEGTVSNVAPWQ  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F S V LGN KH+ G+S  P+ LP  +FYPL+SAA A+    A+ S Q+
Sbjct  346   ITVGASTIDREFPSYVTLGNWKHFRGQSLSPVALPGKRFYPLISAADAK---AANASVQE  402

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLD +KVKGK+L CL+G++ R++K  +A LAGAVGMILANDE SGNEII+D H
Sbjct  403   ALLCKAGTLDLKKVKGKILACLRGDSARVDKGEQALLAGAVGMILANDELSGNEIISDPH  462

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG  +F YIN T++P A+I  P T LG KPAP +A FSS+GPN I PDIL
Sbjct  463   VLPASHINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAEFSSKGPNTITPDIL  522

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV++IAAFTEA GP++  +DKR V FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  523   KPDITAPGVSIIAAFTEAQGPTNQMFDKRRVLFNSLSGTSMSCPHISGICGLLKTLYPHW  582

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTAT + NS + +  + +  + TPF+YGAGH+NPN   DPGLVYDL L D
Sbjct  583   SPAAIKSAIMTTATTQDNSREPVL-NASFYRATPFSYGAGHVNPNSVMDPGLVYDLSLND  641

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+NF+C+ GYNKT+I  V    YKCP   IS +  NYPSITVP L G+  VTRT+KNVG+
Sbjct  642   YLNFLCSNGYNKTQIEMVSEETYKCPKPAISGTNLNYPSITVPKLDGSLVVTRTVKNVGT  701

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A +++P G  V+V P  L+F+K+GEE+SFK+ L+ K   A  +Y FG L WSD K
Sbjct  702   PGTYKARIQNPDGILVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGK  761

Query  203   HRVRSPIVVKTA  168
             H VRSPIVVK A
Sbjct  762   HYVRSPIVVKAA  773



>ref|XP_010048355.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=781

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/729 (64%), Positives = 559/729 (77%), Gaps = 13/729 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+ LG++LGS D A +AIFYSYTRHINGFAA LE+E AA+IAK+P V+SVF
Sbjct  63    DLSRVTESHHEFLGSFLGSRDDAEEAIFYSYTRHINGFAATLEDEVAAQIAKHPRVVSVF  122

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSWEFLGLE + GVI   SIWKKA+FGED IIGNLDTG WPESKSFS++G
Sbjct  123   LNQGKKLHTTRSWEFLGLE-QDGVIPSESIWKKARFGEDIIIGNLDTGAWPESKSFSDQG  181

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +WKGICQN KD  F CNRKLIGARYF +G+++  GPLN+SF TPRD  GHGSHT
Sbjct  182   LGPIPPKWKGICQNDKDPRFRCNRKLIGARYFNKGFAAVAGPLNASFDTPRDNYGHGSHT  241

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LS AGGNFV GA+V+G G GTAKGGSPKARVAAYKVCWP       C+D DILAGFD AI
Sbjct  242   LSIAGGNFVAGASVYGYGLGTAKGGSPKARVAAYKVCWP------GCFDVDILAGFDAAI  295

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLG D P P F +S+AIGSFHAVKNGIVVV +AGN GP  G+V N++PW+I
Sbjct  296   HDGVDVLSVSLG-DSPSPLFKNSIAIGSFHAVKNGIVVVCAAGNSGPSDGTVGNISPWVI  354

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+TMDR F + VV+G+ + + G S  P  LP GKFY L+SAA AR+   + +S  +A
Sbjct  355   TVAASTMDRDFSNYVVIGDHRRFKGASLSPKSLPGGKFYKLISAADARL---SHVSAHEA  411

Query  1277  LHCKPGTLDPEKVKGKVLVCL-QGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             L CK GTLDP KVKG +LVCL +GE   + +  +A LAGAVGM+LAN   SGNEI+AD H
Sbjct  412   LFCKDGTLDPRKVKGNILVCLLEGEYATVYEGAQAFLAGAVGMVLANSILSGNEILADPH  471

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HV Y DG AIF YI  T+ P A IT   T LGVKP+P++AAFSSRGPN I P+IL
Sbjct  472   LLPASHVNYDDGAAIFSYIKSTKFPTARITRVVTNLGVKPSPLMAAFSSRGPNTITPEIL  531

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA++EA GP++ + DKR V FN ESGTSMSCPHV+GV GLLKTL+P W
Sbjct  532   KPDITAPGVSVIAAYSEAAGPTNEEIDKRRVPFNAESGTSMSCPHVSGVAGLLKTLHPEW  591

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMT+AT++ N+ ++I  + +  K TPF+YGAGHI PN A DPGLVYDL + D
Sbjct  592   SPAAIRSAIMTSATIQDNAMESII-NASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIKD  650

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+N +C+ GYN T+I+      Y C   I L  FNYPSITVP L G+  VTRT+KNVG P
Sbjct  651   YLNLLCSLGYNATQISLFSDGAYNCSKRIGLLDFNYPSITVPKLSGSIMVTRTVKNVGLP  710

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY AS+  P G SV V P  LKF+K+ E++SFKV LKAKG + T DY+FG L WSD +H
Sbjct  711   GTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLKAKGASVTGDYSFGELIWSDTEH  770

Query  200   RVRSPIVVK  174
              VRSPIVVK
Sbjct  771   YVRSPIVVK  779



>ref|XP_008342263.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=777

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/734 (64%), Positives = 578/734 (79%), Gaps = 10/734 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L++V  +H++ LG++LGS + A++++FYSYTRHINGFAA LEEEEAA+IA++P V+S+
Sbjct  51    LELNQVTDNHYEFLGSFLGSHEVAKESLFYSYTRHINGFAATLEEEEAAQIARHPRVVSL  110

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGLE EG V+   SIWKKA++GED+IIGNLDTG WPESKSFS+E
Sbjct  111   FLNQGRKLHTTRSWDFLGLEQEG-VVPPNSIWKKARYGEDSIIGNLDTGAWPESKSFSDE  169

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP +WKGICQNQ D  FHCNRKLIGARYF +G+++  GPLNSSF +PRD  GHGSH
Sbjct  170   GYGPIPSKWKGICQNQTDPKFHCNRKLIGARYFNKGFAAVAGPLNSSFDSPRDNEGHGSH  229

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+ FG GNGTAKGGSPKARVAAYKVCWPP   GE C+DADILA FD A
Sbjct  230   TLSTAGGNFVTGASAFGFGNGTAKGGSPKARVAAYKVCWPPMEGGE-CFDADILAAFDVA  288

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I+DGVDVLS+SLGGD P  +FNDS++IG+FHAVK GIVVV SAGN GP  G+V+N++PW 
Sbjct  289   IDDGVDVLSISLGGD-PTTFFNDSVSIGAFHAVKRGIVVVCSAGNSGPAEGTVSNISPWQ  347

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGES--AVPLKLPTGKFYPLLSAASARIKINASIST  1287
             ITVGA+TMDR F S V LGN KH+ G+S   V L+    KFY L+SAA A+    A+ S 
Sbjct  348   ITVGASTMDREFPSYVTLGNWKHFKGQSLSTVALRSKKKKFYQLISAADAK---AANASA  404

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             Q+AL CKP TLDP+KVKGK+L CL+G+N R++K  +A LAGAVGMILAN+E +GNEIIAD
Sbjct  405   QEALLCKPNTLDPKKVKGKILACLRGDNARVDKGEQALLAGAVGMILANNELTGNEIIAD  464

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPA+H+ ++DG  +F YIN T++P A+I    T LG KP+P +AAFSSRGPN I P 
Sbjct  465   PHVLPASHINFTDGNLVFTYINSTKSPRAYIKRAITELGTKPSPFMAAFSSRGPNTITPG  524

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPH++G+ GLLKTLYP
Sbjct  525   ILKPDITAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYP  584

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SAIMTTA  R NS + +  + +  + TPF+YGAGH+NPN A DPGLVYDL L
Sbjct  585   HWSPAAIKSAIMTTAVTRDNSMEPLL-NASFYEATPFSYGAGHVNPNSAMDPGLVYDLSL  643

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNV  390
              DY+NF+CA GYN+T+I       Y C    ISL++ NYPSITVP + G+  VTRT+KNV
Sbjct  644   NDYLNFLCAIGYNETQIEMFSEEMYMCSKPAISLTSLNYPSITVPKISGSLEVTRTVKNV  703

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             GSP TY A +++P G SV+V PK LKF+K+GEE+SFKV L+        +Y FG L WSD
Sbjct  704   GSPGTYKARIQNPBGISVSVEPKELKFKKIGEEKSFKVLLQVXEAKQDKNYVFGKLIWSD  763

Query  209   KKHRVRSPIVVKTA  168
              KH VRSPIVVK A
Sbjct  764   GKHYVRSPIVVKAA  777



>gb|KCW89054.1| hypothetical protein EUGRSUZ_A01380 [Eucalyptus grandis]
Length=764

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/729 (64%), Positives = 559/729 (77%), Gaps = 13/729 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+ LG++LGS D A +AIFYSYTRHINGFAA LE+E AA+IAK+P V+SVF
Sbjct  46    DLSRVTESHHEFLGSFLGSRDDAEEAIFYSYTRHINGFAATLEDEVAAQIAKHPRVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSWEFLGLE + GVI   SIWKKA+FGED IIGNLDTG WPESKSFS++G
Sbjct  106   LNQGKKLHTTRSWEFLGLE-QDGVIPSESIWKKARFGEDIIIGNLDTGAWPESKSFSDQG  164

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +WKGICQN KD  F CNRKLIGARYF +G+++  GPLN+SF TPRD  GHGSHT
Sbjct  165   LGPIPPKWKGICQNDKDPRFRCNRKLIGARYFNKGFAAVAGPLNASFDTPRDNYGHGSHT  224

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LS AGGNFV GA+V+G G GTAKGGSPKARVAAYKVCWP       C+D DILAGFD AI
Sbjct  225   LSIAGGNFVAGASVYGYGLGTAKGGSPKARVAAYKVCWP------GCFDVDILAGFDAAI  278

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLG D P P F +S+AIGSFHAVKNGIVVV +AGN GP  G+V N++PW+I
Sbjct  279   HDGVDVLSVSLG-DSPSPLFKNSIAIGSFHAVKNGIVVVCAAGNSGPSDGTVGNISPWVI  337

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+TMDR F + VV+G+ + + G S  P  LP GKFY L+SAA AR+   + +S  +A
Sbjct  338   TVAASTMDRDFSNYVVIGDHRRFKGASLSPKSLPGGKFYKLISAADARL---SHVSAHEA  394

Query  1277  LHCKPGTLDPEKVKGKVLVCL-QGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             L CK GTLDP KVKG +LVCL +GE   + +  +A LAGAVGM+LAN   SGNEI+AD H
Sbjct  395   LFCKDGTLDPRKVKGNILVCLLEGEYATVYEGAQAFLAGAVGMVLANSILSGNEILADPH  454

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HV Y DG AIF YI  T+ P A IT   T LGVKP+P++AAFSSRGPN I P+IL
Sbjct  455   LLPASHVNYDDGAAIFSYIKSTKFPTARITRVVTNLGVKPSPLMAAFSSRGPNTITPEIL  514

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA++EA GP++ + DKR V FN ESGTSMSCPHV+GV GLLKTL+P W
Sbjct  515   KPDITAPGVSVIAAYSEAAGPTNEEIDKRRVPFNAESGTSMSCPHVSGVAGLLKTLHPEW  574

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMT+AT++ N+ ++I  + +  K TPF+YGAGHI PN A DPGLVYDL + D
Sbjct  575   SPAAIRSAIMTSATIQDNAMESII-NASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIKD  633

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+N +C+ GYN T+I+      Y C   I L  FNYPSITVP L G+  VTRT+KNVG P
Sbjct  634   YLNLLCSLGYNATQISLFSDGAYNCSKRIGLLDFNYPSITVPKLSGSIMVTRTVKNVGLP  693

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY AS+  P G SV V P  LKF+K+ E++SFKV LKAKG + T DY+FG L WSD +H
Sbjct  694   GTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLKAKGASVTGDYSFGELIWSDTEH  753

Query  200   RVRSPIVVK  174
              VRSPIVVK
Sbjct  754   YVRSPIVVK  762



>ref|XP_009591665.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=1380

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/732 (63%), Positives = 559/732 (76%), Gaps = 7/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D DRV  SHH+ LG++LGS +KA+DAIFYSYTRHINGFAAMLE+EEAA ++K+P V+SV
Sbjct  655   IDFDRVTDSHHEFLGSHLGSIEKAKDAIFYSYTRHINGFAAMLEDEEAAALSKHPGVVSV  714

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLNR ++L TTRSW FLGLE +G  IH+ S+WKKAKFGED IIGN+D+GVWPES+SFS+E
Sbjct  715   FLNRGKELHTTRSWNFLGLEHDGK-IHESSLWKKAKFGEDIIIGNIDSGVWPESESFSDE  773

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPL-NSSFFTPRDVIGHGS  1824
             G GPIP RWKG CQ+  D SF CNRKLIGARYFI G+++A G L NSSF+TPRD +GHGS
Sbjct  774   GMGPIPSRWKGTCQHGTDASFRCNRKLIGARYFINGFAAAAGALVNSSFYTPRDTLGHGS  833

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGNFV GAN+FG GNGTAKGGSP+ARVAAYK CWPP  P + C DAD+LA FD 
Sbjct  834   HTLSTAGGNFVQGANIFGYGNGTAKGGSPRARVAAYKACWPPIIPSDSCTDADVLAAFDM  893

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVS+GG  P PY NDS+AIGSFHAVK+GIVVV S GN G   G++ N APW
Sbjct  894   AIHDGVDVLSVSMGG-LPVPYVNDSIAIGSFHAVKHGIVVVTSGGNSGAYPGTIANTAPW  952

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             LITVGA+T+DR F S V+LGN K Y G S     +P GK +P+++ ASA++   A+ + Q
Sbjct  953   LITVGASTIDRVFASYVILGNNKRYRGVSLATEAVPHGKSFPIITGASAKL---ANATAQ  1009

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
              A  C  GTLDP+K KG +LVC +G +  ++K  +A L GAVG+++ N E  GNE+ A+ 
Sbjct  1010  AANFCLGGTLDPKKTKGAILVCHRGGSPGLDKCTQATLVGAVGIVILNSEFFGNEMYAEP  1069

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             +F PAT ++YSDGL +  Y+N TR P A+IT P T LG KPAP++AAFSS GPN + P+I
Sbjct  1070  YFCPATLISYSDGLEVLAYLNSTRTPTAYITRPTTELGTKPAPIVAAFSSIGPNRVTPEI  1129

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV++IAA+T    P+   +D R V FN  +GTSMSCPHVAGVVGLLK L+P+
Sbjct  1130  LKPDITAPGVSIIAAYTGVQPPTQIGFDDRRVKFNTMTGTSMSCPHVAGVVGLLKALHPT  1189

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WS A I+SAIMT+A  R N+ K +T + T LK TPFAYGAG+I PN A DPGLVYDL + 
Sbjct  1190  WSAAAIKSAIMTSARTRDNTFKPMT-NSTDLKVTPFAYGAGNIWPNRAMDPGLVYDLTID  1248

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY++F+CAQGYNKT+I       +KCP+ IS    N PSITVP L G+  VTRTLKNVGS
Sbjct  1249  DYMSFLCAQGYNKTQINIFSQGYFKCPEPISFINLNLPSITVPKLNGSVVVTRTLKNVGS  1308

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A +RSP G SV V P  L+F K+GEE+SFK+TLK KG  A  DY FG L WSD K
Sbjct  1309  PGTYRARIRSPAGISVVVEPNTLEFNKIGEEKSFKLTLKVKGNKAPKDYVFGQLIWSDGK  1368

Query  203   HRVRSPIVVKTA  168
             H VRSPIVVK +
Sbjct  1369  HNVRSPIVVKAS  1380



>ref|XP_002299062.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
 gb|EEE83867.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
Length=772

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/728 (63%), Positives = 560/728 (77%), Gaps = 6/728 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++RV  SH++LLG++    +KA++ IFYSYT +INGFAA+LEEEEA+ +AK+P+V+SVF
Sbjct  49    DIERVTDSHYELLGSFTEGKEKAKEKIFYSYTNNINGFAAVLEEEEASSLAKHPDVVSVF  108

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSW FLGLE +G ++   S+WKKA++GED IIGNLDTGVWPESKSFS+EG
Sbjct  109   LNKGKKLHTTRSWNFLGLEADG-MVPPYSLWKKARYGEDVIIGNLDTGVWPESKSFSDEG  167

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +W+GICQ+       CNRKLIG RYF +GY++  G LNSSF T RD  GHG+HT
Sbjct  168   MGPVPSKWRGICQHDNKDGVVCNRKLIGTRYFNKGYAAYAGHLNSSFQTARDSEGHGTHT  227

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGA+V G GNGTAKGGSP AR AAYKVCWPP +   +C+DADILA FD AI
Sbjct  228   LSTAAGNFVPGADVLGYGNGTAKGGSPHARAAAYKVCWPPINGSNECFDADILAAFDVAI  287

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P  + +D++AIGSFHAV  GI VVASAGN GP  G+V+NVAPWLI
Sbjct  288   SDGVDVLSVSLGGD-PAEFSDDAIAIGSFHAVAKGITVVASAGNSGPSPGTVSNVAPWLI  346

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F   V LGN+KH  G S    +LP  KFYPL+SAA A+    A  S +DA
Sbjct  347   TVGASTMDRAFTIYVALGNRKHLKGASLSEKRLPAEKFYPLISAADAKA---ADQSEEDA  403

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CKPG LDP+KVKGK+LVCL+GEN R++K H+A LAGAVGMILANDE+SGNEIIAD H 
Sbjct  404   LLCKPGALDPKKVKGKILVCLRGENGRVDKGHQALLAGAVGMILANDENSGNEIIADTHV  463

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA HV ++DG A+F Y+N T+ P+A +T+  T L  KPAP +A+FSSRGPN I   ILK
Sbjct  464   LPAAHVNFTDGEAVFSYLNFTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESILK  523

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV+VIAAFT+A GPSD +YDKR   +N +SGTSMSCPHV+G+VGLLKTL+P WS
Sbjct  524   PDITAPGVSVIAAFTQAIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIVGLLKTLHPEWS  583

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTTAT R N+G+ I  D T  K TPFA GAGH+ PN AADPGL+YDL + D+
Sbjct  584   PAAIRSAIMTTATTRDNNGEPIM-DSTNTKATPFADGAGHVQPNHAADPGLIYDLTVNDF  642

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             +NF+C +G  K  I      PY CP   SL+ FNYPSITV +L  + TVTR +KNVGSP 
Sbjct  643   LNFLCNRGNTKKNIKLFSDKPYTCPKSFSLADFNYPSITVTNLNDSITVTRRVKNVGSPG  702

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY   +R+P G +V+V P IL+F+K+GEE+ FKVT K   +    DY FG+LTW D KH 
Sbjct  703   TYNIHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKLAPKAVLTDYVFGMLTWGDGKHF  762

Query  197   VRSPIVVK  174
             VRSP+VV+
Sbjct  763   VRSPLVVR  770



>ref|XP_009361505.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=777

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/734 (64%), Positives = 581/734 (79%), Gaps = 10/734 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L++V  +H++ LG++LGS + A++++FYSYTRHINGFAA LEEEEAA+IAK+P+V+S+
Sbjct  51    LELNQVTDNHYEFLGSFLGSHEAAKESLFYSYTRHINGFAATLEEEEAAQIAKHPKVVSL  110

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGLE EG V+   SIWKKA++GED+IIGNLDTG WPESKSFS+E
Sbjct  111   FLNQGRKLHTTRSWDFLGLEQEG-VVPPNSIWKKARYGEDSIIGNLDTGAWPESKSFSDE  169

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP +WKGICQNQ D  FHCNRKLIGARYF +G+++  GPLNSSF +PRD  GHGSH
Sbjct  170   GYGPIPSKWKGICQNQTDPKFHCNRKLIGARYFNKGFAAVAGPLNSSFNSPRDNDGHGSH  229

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSPK+RVAAYKVCWPP   G  C+DADILA FD A
Sbjct  230   TLSTAGGNFVTGASVFGFGNGTAKGGSPKSRVAAYKVCWPPMG-GGGCFDADILAAFDVA  288

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I+DGVDVLSVSLGG+ P  +FNDS++IG+FHAVK GIVVV SAGN GP  G+V+N++PW 
Sbjct  289   IDDGVDVLSVSLGGN-PTTFFNDSVSIGAFHAVKRGIVVVCSAGNSGPAEGTVSNISPWQ  347

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGES--AVPLKLPTGKFYPLLSAASARIKINASIST  1287
             ITVGA+TMDR F S V LGN KH+ G+S  AV L+    KFY L+SAA A+    A+ S 
Sbjct  348   ITVGASTMDREFPSYVTLGNWKHFKGQSLSAVALRSKKKKFYQLISAADAK---AANASA  404

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             Q+AL CKP TLDP+KVKGK+L CL+G+N R++K  +A LAGAVGMILAN+E +GNEIIAD
Sbjct  405   QEALLCKPNTLDPKKVKGKILACLRGDNARVDKGEQAFLAGAVGMILANNELTGNEIIAD  464

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPA+H+ ++DG  +F YI  T++P A+I    T LG KP+P +AAFSS+GPNAI P 
Sbjct  465   PHVLPASHINFTDGNLVFAYIYSTKSPRAYIKRAITELGTKPSPFMAAFSSKGPNAITPG  524

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPH++G+ GLLKTLYP
Sbjct  525   ILKPDITAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYP  584

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SAIMTTA  + NS + +  + +  + TPF+YGAGH+NPN A DPGLVYDL L
Sbjct  585   HWSPAAIKSAIMTTAVTQDNSMEPLL-NASFYEATPFSYGAGHVNPNSAMDPGLVYDLSL  643

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNV  390
              DY+NF+CA GYN+T+I       YKC    ISL+  NYPSITVP + G+  VTRT+KNV
Sbjct  644   NDYLNFLCAIGYNETQIEMFSEEMYKCSKPAISLTNLNYPSITVPKISGSLEVTRTVKNV  703

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             GSP TY A +++P G SV+V PK LKF+K+GEE+SFKV L+ +      +Y FG L WSD
Sbjct  704   GSPGTYKARIQNPDGISVSVEPKELKFKKIGEEKSFKVLLQVREAKQDKNYVFGKLIWSD  763

Query  209   KKHRVRSPIVVKTA  168
              KH VRSPIVVK A
Sbjct  764   GKHYVRSPIVVKAA  777



>gb|KDP45154.1| hypothetical protein JCGZ_15019 [Jatropha curcas]
Length=771

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/732 (63%), Positives = 570/732 (78%), Gaps = 10/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D + V  SH+  LG++LGS D A+D+IFYSYTRHINGFAA +++  A EIAK+P+V+S+
Sbjct  46    IDQNLVTDSHYDFLGSFLGSRDLAQDSIFYSYTRHINGFAATIDDGIAEEIAKHPKVVSI  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ ++L TT SW FLGLE + GV+   SIWKKA+FGEDTIIGNLDTGVWPESKSFS+E
Sbjct  106   FLNKGKKLHTTHSWNFLGLE-QNGVVPSNSIWKKARFGEDTIIGNLDTGVWPESKSFSDE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +WKG CQN  D  F+CNRKLIGARYF +GY++  GPLNSS+ +PRD  GHGSH
Sbjct  165   GLGPIPSKWKGTCQNGSDPGFYCNRKLIGARYFNKGYATVAGPLNSSYDSPRDKEGHGSH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV  A+VFG G G AKGG+PKARVAAYKVC+PP   G +C+DADILA FD A
Sbjct  225   TLSTAGGNFVSDASVFGFGEGVAKGGAPKARVAAYKVCYPPIG-GNECFDADILAAFDSA  283

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLG D+   +FNDS+AIGSFHAVKNGIVV+ SAGN GP   +V+N+APW 
Sbjct  284   INDGVDVLSVSLGADNTA-FFNDSVAIGSFHAVKNGIVVICSAGNSGPAEATVSNLAPWQ  342

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S VVLGN   Y GES     LP  KF+ ++SAA AR    A+ S QD
Sbjct  343   ITVGASTMDREFPSYVVLGNNMTYKGESLSAKALPKNKFFRIISAAEAR---AANASAQD  399

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK G LDP+K KGK+LVCL+G N R+EK  +AALAGAV M+LAND+DS NEI+AD H
Sbjct  400   ALLCKAGALDPKKAKGKILVCLRGSNARVEKGEQAALAGAVAMVLANDKDSENEILADPH  459

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HV Y +G+AIF+YIN T++ V +IT P T +G KPAP++AAFSS+GPN I P+IL
Sbjct  460   VLPASHVNYINGVAIFNYINNTKSSVGYITRPKTQVGTKPAPIMAAFSSKGPNTIAPEIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+  LLKTL+P+W
Sbjct  520   KPDITAPGVSVIAAYTKAEGPTNEDFDMRRVQFNSMSGTSMSCPHVSGIAALLKTLHPNW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SA+MTTAT   NS + I  + +  K TPF+YGAGHI PN A DPGL+YDL + D
Sbjct  580   SPAAIKSAVMTTATTLDNSKEEIL-NASHSKATPFSYGAGHIRPNEAMDPGLIYDLSVND  638

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG-  387
             Y+NF+C  GY++ +I +   T +KCP   +SL+ FNYPSIT+P   G+ TVTR +KNVG 
Sbjct  639   YLNFLCTLGYSEAQILSFSQTSFKCPKKPVSLANFNYPSITIPKFSGSITVTRKVKNVGV  698

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD-  210
             SP+ Y A ++ P GFS++V PK+LKF+K+GEE+SF+VTLK+K   A  DY FG L WSD 
Sbjct  699   SPSIYQAHIKKPSGFSISVEPKVLKFKKIGEEKSFRVTLKSKKSYAIKDYVFGELVWSDS  758

Query  209   KKHRVRSPIVVK  174
              K+ VRSPIVVK
Sbjct  759   NKYYVRSPIVVK  770



>ref|XP_011039832.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=772

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/728 (63%), Positives = 557/728 (77%), Gaps = 6/728 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++RV  SH++LLG++    +KA++ IFYSYT +INGFAA+LEEEEA+ +AK+P+V+SVF
Sbjct  49    DIERVTDSHYELLGSFTEGKEKAKEKIFYSYTNNINGFAAVLEEEEASSLAKHPDVVSVF  108

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TTRSW FLGLE +G ++   S+WKKA++GED IIGNLDTGVWPESKSFS+EG
Sbjct  109   LNKGKKLHTTRSWNFLGLEADG-MVPPYSLWKKARYGEDVIIGNLDTGVWPESKSFSDEG  167

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +W+GICQ+    S  CNRKLIG RYF +GY++  G LNSSF T RD  GHG+HT
Sbjct  168   MGPVPSKWRGICQHDTKDSVVCNRKLIGTRYFNKGYAAYAGHLNSSFQTARDSEGHGTHT  227

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGANV G GNGTAKGGSP AR AAYKVCWPP +   +C+DADILA FD AI
Sbjct  228   LSTAAGNFVPGANVLGYGNGTAKGGSPHARAAAYKVCWPPINGSNECFDADILAAFDVAI  287

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P  + +D++AIGSFHAV  GI VVASAGN GP  G+V+NVAPWLI
Sbjct  288   SDGVDVLSVSLGGD-PAEFSDDAIAIGSFHAVAKGITVVASAGNSGPSPGTVSNVAPWLI  346

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F   V LGN+KH  G S    +LP  KFYPL+SAA A+    A  S +DA
Sbjct  347   TVGASTMDRAFTIYVALGNRKHLKGASLSEKRLPAEKFYPLISAADAKA---ADQSEEDA  403

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CKPG LD +KVKGK+LVCL+GEN R++K H+A LAGA GMILANDE+SGNEIIAD H 
Sbjct  404   LLCKPGALDSKKVKGKILVCLRGENGRVDKGHQALLAGAAGMILANDENSGNEIIADTHV  463

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA H+ ++DG A+F Y+  T+ P+A +T+  T L  KPAP +A+FSSRGPN I   ILK
Sbjct  464   LPAAHINFTDGEAVFSYLKLTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESILK  523

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APG++VIAAFTEA GPSD +YDKR   +N +SGTSMSCPHV+G+ GLLKTL+P WS
Sbjct  524   PDITAPGISVIAAFTEAIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIAGLLKTLHPKWS  583

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTTAT R N+G+ I  D T  K TPFA GAGH+ PN AADPGL+YDL + D+
Sbjct  584   PAAIRSAIMTTATTRDNNGEPIL-DSTNTKATPFADGAGHVQPNRAADPGLIYDLTVNDF  642

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             +NF+C +G  K  I      PY CP   SL+ FNYPSITV +L  + TVTR +KNVGSP+
Sbjct  643   LNFLCNRGNTKKNIKLFSDKPYTCPKSFSLADFNYPSITVTNLNDSITVTRRVKNVGSPS  702

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY   +R+P G +V+V P IL+F+K+GEE+ FKVT K        DY FG+LTW D KH 
Sbjct  703   TYNIHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKLAPNAVLTDYVFGMLTWGDGKHF  762

Query  197   VRSPIVVK  174
             VRSP+VV+
Sbjct  763   VRSPLVVR  770



>ref|XP_010542042.1| PREDICTED: subtilisin-like protease SBT5.3 [Tarenaya hassleriana]
Length=772

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/731 (62%), Positives = 562/731 (77%), Gaps = 10/731 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ SH++ LG++ GS ++A+D IFYSYT+HINGFAA L++   + I+K+P+V+SVF 
Sbjct  49    VDRVRESHYEFLGSFTGSRERAKDEIFYSYTKHINGFAAHLDDATVSAISKHPKVLSVFP  108

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSE-EG  1998
             NR  +L TTRSW+F+GLE +G      SIW KA+FGED+II NLDTGVWPESKSFS+ EG
Sbjct  109   NRGLKLHTTRSWDFMGLEHDG-FTPSSSIWTKARFGEDSIIANLDTGVWPESKSFSDDEG  167

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP RWKGICQN KD +FHCNRKLIGARYF +GYS+AVG LN++F +PRD+ GHGSHT
Sbjct  168   LGPIPSRWKGICQNDKDATFHCNRKLIGARYFHKGYSAAVGRLNATFDSPRDLDGHGSHT  227

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG FVP A+VFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI
Sbjct  228   LSTAGGAFVPRASVFGFGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAI  286

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DG DV+SVSLGG+ P P+FNDS+AIGSFHAV+ G+VVV SAGN GP  G+  N+APW I
Sbjct  287   HDGADVISVSLGGE-PSPFFNDSVAIGSFHAVRRGVVVVCSAGNSGPEDGTAANLAPWQI  345

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F S++VLGNKKH+ G+S     L   KFYP++SA++A+ K   + S+ DA
Sbjct  346   TVGASTMDREFASHLVLGNKKHFKGQSLSSSALQHAKFYPIISASTAKAK---NTSSSDA  402

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               CK G+LDP K KGK+LVCL+G N R+EK    ALAG VGM+L N    GN++ ADAH 
Sbjct  403   QLCKLGSLDPVKAKGKILVCLRGLNGRVEKGQTVALAGGVGMVLVNTNVMGNDLTADAHV  462

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATH+TY DG+++  Y+++T+NPVAHIT P T+LG KPAPV+AAFSS+GPN + P+ILK
Sbjct  463   LPATHITYKDGVSLSRYLSQTQNPVAHITPPRTILGTKPAPVVAAFSSKGPNIVTPEILK  522

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI APGV+VIAA+TEA  P++ ++D+R V FN  SGTSMSCPH++G+VGLLKTLYPSWS
Sbjct  523   PDIIAPGVSVIAAYTEAVSPTNEEFDERRVMFNAVSGTSMSCPHISGIVGLLKTLYPSWS  582

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I SAIMTTAT   +    I  + T +  TPF+YGAGH+ PN A DPGLVYDL + DY
Sbjct  583   PAAIHSAIMTTATTMDDIPGPIR-NATDMTATPFSYGAGHVRPNLAMDPGLVYDLTIKDY  641

Query  557   VNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             +NF+C+ GYN T+++   G  + CP+   S    NYPSITVP+L    TV RTLKNVG P
Sbjct  642   LNFLCSLGYNSTQMSVFSGKSFACPNPKPSALDLNYPSITVPNLSSVVTVKRTLKNVGKP  701

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGVLTWSDKK  204
              TY   V +P G SV+V PK LKF K GEE+SF+VTL  KG    A  Y FG L WSDK+
Sbjct  702   GTYAVHVTNPKGVSVSVKPKGLKFTKDGEEKSFRVTLVKKGNGDVAKGYGFGELVWSDKE  761

Query  203   HRVRSPIVVKT  171
             H VRSPIVV+T
Sbjct  762   HYVRSPIVVRT  772



>ref|XP_008384293.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=775

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/735 (63%), Positives = 567/735 (77%), Gaps = 14/735 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV HSHH+ LG++LGS +KA++AI YSY RHINGFA  LEEEEAA+IAK+P+V+SVF
Sbjct  47    DLHRVTHSHHEFLGSFLGSTEKAKEAIIYSYKRHINGFATTLEEEEAAQIAKHPKVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LNR R+L TT SW+F+ LE +G VIH  S+WKKA+FGEDTIIGNLDTGVWPES+SF ++G
Sbjct  107   LNRGRKLHTTHSWDFMLLEKDG-VIHPSSLWKKARFGEDTIIGNLDTGVWPESESFXDKG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSH  1821
              GP+P +WKGICQN     F CNRKLIG RYF +GY++  G P+ SS  + RD  GHGSH
Sbjct  166   IGPVPSKWKGICQNHT-AGFVCNRKLIGTRYFNKGYAAYAGVPVKSSLNSARDHEGHGSH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPP + G +C+DADI+A FD A
Sbjct  225   TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPIN-GSECFDADIMAAFDAA  283

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLS+SLGGD P  YF+D ++IG+FHAVKNGIVVV SAGN GP AG+V+NVAPW+
Sbjct  284   IHDGVDVLSISLGGD-PSDYFSDGVSIGAFHAVKNGIVVVCSAGNSGPAAGTVSNVAPWM  342

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F++ + L N     G S +   LP   FYPL++ A A+     + S +D
Sbjct  343   ITVGASTLDREFETMIELRNGMRLKGTS-LSKPLPDDIFYPLITGAQAKAD---NASAKD  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C  G+LDP+KVKGK+L CL+G + R++K  +A+LAGA GMIL NDE SGNE+IAD H
Sbjct  399   AMLCLGGSLDPKKVKGKILACLRGLSARVDKGQQASLAGAAGMILCNDEASGNELIADPH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+ + Y+DG+A+F+YIN T +P+  IT P   L  KPAP +A+FSS+GPN I P+IL
Sbjct  459   VLPASQINYTDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEIL  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA+T+AT P+D D+DKR V FN ESGTSMSCPHV+GVVGLLKTLYP W
Sbjct  519   KPDITAPGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHW  578

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SP+ IRSAIMTTA  R N+   +    + ++ TPF+YG+GHI PN A DPGL+YDL   D
Sbjct  579   SPSAIRSAIMTTARTRDNTXNPMM-SASFVEATPFSYGSGHIRPNRAMDPGLIYDLTAND  637

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y++F+CA GYNKT I      P YKCP+  SL  FNYPSI+VP L G+ TVTR LKNVGS
Sbjct  638   YLDFLCAIGYNKTTIQLFSEGPNYKCPESASLLDFNYPSISVPRLSGSVTVTRRLKNVGS  697

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK---GENATADYAFGVLTWS  213
             P TY   ++   G SV+V P +L+F+ VGEE+SF+VTLKAK   G  A  DY FG LTWS
Sbjct  698   PGTYAVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAKGDYVFGGLTWS  757

Query  212   DKKHRVRSPIVVKTA  168
             D KH VRSPIVV +A
Sbjct  758   DGKHYVRSPIVVASA  772



>ref|XP_003524185.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/729 (63%), Positives = 560/729 (77%), Gaps = 8/729 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD ++V  SHH+ LG++LGS +  +D+IFYSYTRHINGFAA+LEEE AAEI+K+P+V+SV
Sbjct  47    VDFNQVTQSHHEFLGSFLGSSNTTKDSIFYSYTRHINGFAAILEEEVAAEISKHPKVLSV  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR R+L TTRSW+F+GLE   GVI   SIWKKA+FGE  IIGNLDTGVWPESKSFSEE
Sbjct  107   FENRGRKLHTTRSWDFMGLE-HNGVIQSNSIWKKARFGEGVIIGNLDTGVWPESKSFSEE  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +W+GIC N  D +FHCNRKLIGARYF +GY+S  GPLNSSF +PRD  GHG+H
Sbjct  166   GLGPIPSKWRGICHNGIDHTFHCNRKLIGARYFNKGYASVAGPLNSSFDSPRDNEGHGTH  225

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGN V   +VFG G+GTAKGGSP ARVAAYKVCWPP + G++C+DADILA FD A
Sbjct  226   TLSTAGGNMVARVSVFGQGHGTAKGGSPMARVAAYKVCWPPVA-GDECFDADILAAFDLA  284

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLS+SLGG     +F DS+AIGSFHA K+GIVVV SAGN GP   +  N+APW 
Sbjct  285   IHDGVDVLSLSLGGS-ASTFFKDSVAIGSFHAAKHGIVVVCSAGNSGPADATAENLAPWH  343

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+TMDR+F + V LGN   + GES +   +   KFYP++ A  A++   AS   +D
Sbjct  344   VTVAASTMDRQFPTYVFLGNNITFKGES-LSATILAPKFYPIIKATDAKL---ASARAED  399

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C+ GTLDP KVKGK++VCL+G N R++K  +A LAGAVGM+LAND+ +GNEIIAD H
Sbjct  400   AVLCQNGTLDPNKVKGKIVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPH  459

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG A+F YIN T+ PVA+ITHP T L  KPAP +AAFSS+GPN I P+IL
Sbjct  460   VLPASHINFTDGSAVFTYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTIVPEIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPHV+G+VGLL+ LYP+W
Sbjct  520   KPDITAPGVSVIAAYTEAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTAT   N  + + +   G K TPF+YGAGH+ PN A DPGLVYD  + D
Sbjct  580   SPAAIKSAIMTTATTLDNEVEPLLNATDG-KATPFSYGAGHVQPNRAMDPGLVYDTTIDD  638

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GYN T+I+     PY+C    SL   NYPSITVP L G+ TVTR LKNVGSP
Sbjct  639   YLNFLCALGYNATQISVFTEGPYQCRKKFSLLNLNYPSITVPKLSGSVTVTRRLKNVGSP  698

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY A V++P G +++V P ILKF+ VGEE+SFKVT KA    AT +Y FG L WSD KH
Sbjct  699   GTYIAHVQNPHGITISVKPSILKFKNVGEEKSFKVTFKAMQGKATNNYVFGKLIWSDGKH  758

Query  200   RVRSPIVVK  174
              V SPIVVK
Sbjct  759   YVTSPIVVK  767



>ref|XP_003601486.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES71737.1| subtilisin-like serine protease [Medicago truncatula]
Length=772

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/730 (62%), Positives = 564/730 (77%), Gaps = 8/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD +RV  SH++ LG++LGS   A+++IFYSYTRHINGFAA LEEE AAEIAK+P+V+SV
Sbjct  48    VDFNRVTDSHYEFLGSFLGSSKTAKESIFYSYTRHINGFAATLEEEVAAEIAKHPKVLSV  107

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N  R+L TT SW F+GLE   GVI   SIW KA+FG+  II NLDTGVWPESKSFS+E
Sbjct  108   FENNGRKLHTTHSWGFMGLEDSYGVIPSSSIWNKARFGDGIIIANLDTGVWPESKSFSDE  167

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             GFGPIP +W+GIC   +D SFHCNRKLIGARYF +GY+S +  PLNSSF TPRD  GHGS
Sbjct  168   GFGPIPSKWRGICDKGRDPSFHCNRKLIGARYFNKGYASRLTVPLNSSFETPRDNEGHGS  227

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGN VPG +VFG G GTAKGGSPKARVA+YKVCWPP + G++C+DADILA FD 
Sbjct  228   HTLSTAGGNMVPGVSVFGQGYGTAKGGSPKARVASYKVCWPPIN-GDECFDADILAAFDA  286

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVSLGG      FNDS+AIGSFHA K GIVVV SAGN GP   + +N+APW
Sbjct  287   AIHDGVDVLSVSLGGSASN-LFNDSVAIGSFHAAKKGIVVVCSAGNSGPNDATASNLAPW  345

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
              ITVGA+TMDR F S VVLGN   + GES    +L   KFYP++ A  A++   AS + +
Sbjct  346   YITVGASTMDREFPSYVVLGNNLTFKGESLSAARL-ADKFYPIIKATDAKL---ASATNE  401

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA+ C+ GTLDP+KVKGK+++CL+G N R++K  +A LAGAVGM+LAND+ +GNEIIAD 
Sbjct  402   DAVLCQNGTLDPKKVKGKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTGNEIIADP  461

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA+H+ +SDG+ +F Y+N +++PVA+ITHP T L  KPAP +AAFSS+GPN I P+I
Sbjct  462   HVLPASHINFSDGVEVFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGPNTIIPEI  521

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+VIAA+TEA GP++ ++D R + FN  SGTSMSCPH++G+VGLL++LYPS
Sbjct  522   LKPDITAPGVSVIAAYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGLLRSLYPS  581

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             W+PA I+SAIMTTAT   N  + I  + T  + TPF+YGAGH+ PN A DPGLVYD+   
Sbjct  582   WTPAAIKSAIMTTATTLDNKAEPIM-NATKSQATPFSYGAGHVQPNSAMDPGLVYDITTN  640

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY NF+CA GYN+T+++     PYKC  + S+   NYPSITVP+L G+ TVTRTLKNVG+
Sbjct  641   DYFNFLCALGYNETQMSLFSKGPYKCHKNFSILNLNYPSITVPNLSGSVTVTRTLKNVGA  700

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY   V+SP G +++V P IL+F+KVGEE+ F+V LK K   AT  Y FG + WSD K
Sbjct  701   PGTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGKMIWSDGK  760

Query  203   HRVRSPIVVK  174
             H V+SP+VVK
Sbjct  761   HYVKSPLVVK  770



>ref|XP_006350127.1| PREDICTED: subtilisin-like protease-like, partial [Solanum tuberosum]
Length=760

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/730 (62%), Positives = 555/730 (76%), Gaps = 7/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D DRV + HH+ LG++LGS +KA+DAIFYSYTRHINGFAA+LE+EEAAE++K+P V+S+
Sbjct  31    IDFDRVINFHHEFLGSHLGSIEKAKDAIFYSYTRHINGFAAILEDEEAAELSKHPNVVSI  90

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ ++L TTRSW FLGLE EG  I   S+WKKA+FGED IIGN+D+GVWPES+SFS+E
Sbjct  91    FLNKGKELHTTRSWNFLGLEHEGK-IPKSSLWKKARFGEDIIIGNIDSGVWPESESFSDE  149

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPL-NSSFFTPRDVIGHGS  1824
             G GPIP RWKG CQ   D +F CNRKLIGARYFI+G+++  G L  S F+TPRD +GHGS
Sbjct  150   GMGPIPSRWKGTCQTGSDPTFRCNRKLIGARYFIKGFAAEAGALVTSKFYTPRDTLGHGS  209

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGNFV GAN+FG GNGTAKGGSPKARVAAYK CWPP  P + C DAD+LA FD 
Sbjct  210   HTLSTAGGNFVEGANIFGYGNGTAKGGSPKARVAAYKACWPPIIPSDSCTDADVLAAFDM  269

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVS+GG  P PY  DS+AIGSFHA+K+GIVVV S GN G   G++ N APW
Sbjct  270   AIHDGVDVLSVSMGG-LPVPYAQDSIAIGSFHAIKHGIVVVTSGGNSGAYPGTIANTAPW  328

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             LITVGA+T+DR F S ++LGN K Y G S     LP GK +P+++ ASA++   A+ + +
Sbjct  329   LITVGASTIDREFSSYIILGNNKRYRGVSLSSKALPEGKSFPIITGASAKV---ANATAE  385

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             +A  C  GTLDP+K KG +LVC +G +    K  +A   GAVG+++ N    GNE+ A+ 
Sbjct  386   EANFCIEGTLDPKKAKGTILVCHRGGSPAFNKCTQATSVGAVGIVILNSAFFGNEMYAEP  445

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             +  PATH++YSDGL +  Y+N TR   A+IT P T LG KPAPV+AAFSS GPN + P+I
Sbjct  446   YLCPATHISYSDGLQVSSYVNSTRKATAYITRPTTELGTKPAPVMAAFSSIGPNRVTPEI  505

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+++AA+T   GP++ D D R V FN  +GTSMSCPHVAGVVGLLKTL+P+
Sbjct  506   LKPDITAPGVSILAAYTGVQGPTETDLDNRRVKFNTMTGTSMSCPHVAGVVGLLKTLHPT  565

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMT+A  R N+   +T+  T LK +PFAYG+GHI PN A DPGLVYDL + 
Sbjct  566   WSPAAIKSAIMTSARTRDNTINPMTNS-THLKASPFAYGSGHIWPNRAMDPGLVYDLTIN  624

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY+NF+CAQGY +T+I+      +KCPD IS S  N PSITVP L G+  VTRTLKNVGS
Sbjct  625   DYMNFLCAQGYKETQISFFTQGHFKCPDPISFSNLNLPSITVPKLNGSIVVTRTLKNVGS  684

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A +RSP+G +V V P  L+F+K+GEE+SFK+TLK KG  A  DY FG L WSD K
Sbjct  685   PGTYKAHIRSPIGITVVVEPNTLEFKKIGEEKSFKITLKVKGHKAPKDYVFGHLIWSDNK  744

Query  203   HRVRSPIVVK  174
             H VRSPIVVK
Sbjct  745   HYVRSPIVVK  754



>ref|XP_007213363.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
 gb|EMJ14562.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
Length=740

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/730 (65%), Positives = 562/730 (77%), Gaps = 11/730 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SH + LG++LGS  KA++AI YSY RHINGFAA+LE+EEAAEIAK+P+V+SVF
Sbjct  19    DLHRVTDSHSEFLGSFLGSTQKAKEAIIYSYKRHINGFAAILEDEEAAEIAKHPKVVSVF  78

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ RQL TT SW+F+ LE +G VIH  S+WK+A+FGEDTIIGNLDTGVW ES+SFS+EG
Sbjct  79    LNQGRQLHTTHSWDFMLLEKDG-VIHPTSLWKRARFGEDTIIGNLDTGVWAESESFSDEG  137

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSH  1821
              GPIP +WKGICQN     F CNRKLIGARYF +GY+S  G PL SSF + RD  GHGSH
Sbjct  138   IGPIPAKWKGICQNDT-TGFPCNRKLIGARYFNKGYASYAGAPLRSSFNSARDHEGHGSH  196

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GNFV GANVFGLGNGTAKGGSPKARVAAYKVCWPP + G +C+DADI+A FD A
Sbjct  197   TLSTAAGNFVAGANVFGLGNGTAKGGSPKARVAAYKVCWPPIN-GSECFDADIMAAFDAA  255

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD P  Y +D L+IG+FHAVKNGIVVV SAGN GP AG+V+NVAPW+
Sbjct  256   IHDGVDVLSVSLGGD-PSNYLDDGLSIGAFHAVKNGIVVVCSAGNSGPAAGTVSNVAPWM  314

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR FQ+ V L N     G S +   LP  +FYPL++ A A+    A+ S  D
Sbjct  315   ITVGASTLDREFQAIVQLRNGLRLKGTS-LSKPLPEDRFYPLITGAQAK---AANASAHD  370

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C  GTLDP+KVKGK+L CL+G+  RI+K  +AALAGAVGMIL ND+ SGNEIIAD H
Sbjct  371   AMLCIGGTLDPQKVKGKILACLRGDTARIDKGEQAALAGAVGMILCNDKASGNEIIADPH  430

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+ + Y+DG+A+  YIN T +P   IT P   L  KPAP +A+FSS+GPN I P+IL
Sbjct  431   VLPASQINYTDGIAVVSYINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEIL  490

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA+T+AT P++  +DKR ++FN ESGTSMSCPHV+GVVGLLKTLYP W
Sbjct  491   KPDITAPGVNIIAAYTQATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDW  550

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SP+ IRSAIMTTA  R N+   +  + + ++ TPF+YGAGHI PN A DPGL+YDL + D
Sbjct  551   SPSAIRSAIMTTARTRDNTANPM-KNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVND  609

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y++F+CA GYNKT +     +P YKCP   SL  FNYPSI VP L G+ TVTR +KNVGS
Sbjct  610   YLDFLCAIGYNKTMMQLFSESPNYKCPKSASLLDFNYPSIVVPELSGSVTVTRRVKNVGS  669

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY      P+G SVTV P ILKF+ +GEE+SFKVTLKAKG   T DY FG L WSD K
Sbjct  670   PGTYAVRAHKPLGVSVTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKDYVFGGLIWSDGK  729

Query  203   HRVRSPIVVK  174
             H VRSPIV K
Sbjct  730   HYVRSPIVFK  739



>ref|XP_007153620.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 ref|XP_007153621.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25614.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25615.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
Length=778

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/730 (63%), Positives = 555/730 (76%), Gaps = 9/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD + V  SH++ LG++LGS + A+++IFYSYTRHINGFAA+LEEE A +IAK+PEV+SV
Sbjct  49    VDFNEVTQSHYEFLGSFLGSPNTAKESIFYSYTRHINGFAAILEEEVATQIAKHPEVLSV  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F+N  R+L TTRSWEF+GLE   G+I   SIWKKA+FGE  IIGNLDTGVWPESKSFSEE
Sbjct  109   FVNSGRKLHTTRSWEFMGLE-HNGMIPSSSIWKKARFGEGVIIGNLDTGVWPESKSFSEE  167

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +W+GIC N  D +F CNRKLIGARYF +GY SA GPLNSSF +PRD  GHGSH
Sbjct  168   GLGPIPSKWRGICDNGVDHTFQCNRKLIGARYFNKGYESAAGPLNSSFHSPRDKEGHGSH  227

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GN V G +VFG G GTAKGG+PKARVAAYKVCWPP + G++C+DADILA FD A
Sbjct  228   TLSTAAGNAVAGVSVFGQGFGTAKGGAPKARVAAYKVCWPPVA-GDECFDADILAAFDAA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG       NDS+AIGSFHA K GIVVV SAGN GP   +  N+APW 
Sbjct  287   IHDGVDVLSVSLGGS-ASSLLNDSVAIGSFHAAKRGIVVVCSAGNSGPADATAENLAPWH  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+TMDR F + VVLG+     GES    +L   KFYP++ A  A++    S  T+D
Sbjct  346   VTVAASTMDREFPAYVVLGDNITLKGESLSAARLAQ-KFYPIIKATDAQL---GSARTED  401

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C+ GTLDP+KVKGK++VCL+G N R++K  +A LAGAVGM+LAND+ SGNEIIAD H
Sbjct  402   AVLCQNGTLDPKKVKGKIVVCLRGINARVDKGEQALLAGAVGMVLANDKASGNEIIADPH  461

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG+A+F+YIN TR PVA+ITHP T L  KPAP +AAFSS+GPN + P+IL
Sbjct  462   VLPASHINFTDGIAVFNYINSTRFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTVVPEIL  521

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPD++APGV+VIAA+TEA GP++  +DKR + +N  SGTSMSCPHVAG+V LL+  YPSW
Sbjct  522   KPDVTAPGVSVIAAYTEAQGPTNQVFDKRRIPYNSVSGTSMSCPHVAGIVALLRASYPSW  581

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTAT   N  + + +   G + TPF+YGAGH+ PN A DPGLVYD  + D
Sbjct  582   SPAAIKSAIMTTATTLDNEVEPLLNATDG-RATPFSYGAGHVQPNTAMDPGLVYDTTIGD  640

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+NF+CA GYN T+I+     P Y C    SL   NYPSITVP+L G+ TVTRTLKNVGS
Sbjct  641   YLNFLCALGYNGTKISVFTEGPSYVCRKKFSLLNLNYPSITVPNLSGSVTVTRTLKNVGS  700

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A V++P G +V+V P IL F KVGEE+ FKVT K     AT +Y FG L WSD K
Sbjct  701   PRTYIAHVQNPKGITVSVKPSILNFTKVGEEKRFKVTFKIVKGKATNNYVFGKLIWSDGK  760

Query  203   HRVRSPIVVK  174
             H VRSPIVVK
Sbjct  761   HYVRSPIVVK  770



>emb|CDY65487.1| BnaA03g57660D [Brassica napus]
Length=775

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/729 (61%), Positives = 556/729 (76%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ +H+  LG++ GS + A DAIFYSYT+HINGFAA L+ + A+ I+K+PEV+SVF 
Sbjct  53    MDRVRETHYDFLGSFTGSREIATDAIFYSYTKHINGFAAHLDHDLASAISKHPEVVSVFP  112

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+F+GLE     +   SIW+KA+FGED+II NLDTGVWPESKSFS+EG 
Sbjct  113   NKALKLHTTRSWDFMGLE-HNSYVPSSSIWRKARFGEDSIIANLDTGVWPESKSFSDEGL  171

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  172   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFDSPRDIDGHGSHTL  231

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FVPGANVFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  232   STAGGAFVPGANVFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  290

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  +F DS+AIGSFHA K GIVVV SAGN GP   +V+NVAPW IT
Sbjct  291   DGADVISVSLGGE-PASFFKDSVAIGSFHAAKKGIVVVCSAGNSGPADSTVSNVAPWQIT  349

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+T DR F SN++LGN KHY G+S  P  LP  KFYP+++A+ A+ K   +++  DA 
Sbjct  350   VGASTTDREFASNLILGNGKHYKGQSLAPSSLPHAKFYPIIAASDAKAK---NVTASDAQ  406

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  407   LCKIGSLDPQKAKGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVL  466

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +++ D L++  YI++T+ P+AHIT   T+LG KPAPV+AAFSS+GP+++ P+ILKP
Sbjct  467   PATQISFKDSLSLSRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKP  526

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  527   DITAPGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  586

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I +  T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  587   AAIRSAIMTTATTMDDIPGPILNS-TYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  645

Query  554   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  646   NFLCSLGYNASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP  705

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TYT  V +P G SV V P  L F KVGE+++FKVT+  +       Y FG L WSDKKH
Sbjct  706   STYTVRVNNPEGVSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKH  765

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  766   RVRSPIVVK  774



>ref|XP_002524587.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37795.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=771

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/730 (64%), Positives = 570/730 (78%), Gaps = 9/730 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D   V  SH+  LG++LGS D A D+IFYSYTRHINGFAA +E+E AAEIAK+P+V+SVF
Sbjct  47    DQKLVTESHYSFLGSFLGSRDIAEDSIFYSYTRHINGFAANIEDEVAAEIAKHPKVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LNR ++L TT SW FLGLE + GV+   S+WKKA++G+D IIGNLDTGVWPESKSFS+ G
Sbjct  107   LNRGKKLHTTHSWSFLGLE-QDGVVPSNSLWKKARYGQDIIIGNLDTGVWPESKSFSDGG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GPIP +W+GICQN  D   HCNRKLIGARYF +GY+S VG LNS+F +PRD  GHG+HT
Sbjct  166   YGPIPSKWRGICQNGSDPYLHCNRKLIGARYFNKGYASVVGHLNSTFDSPRDREGHGTHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+VFGLG G AKGGSPKARVAAYKVC+PP   G +C+DADILA FD AI
Sbjct  226   LSTAGGNFVAGASVFGLGKGKAKGGSPKARVAAYKVCYPPVG-GNECFDADILAAFDTAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG+     FNDS+AIGSFHAVK+GIVV+ SAGN GP  G+ +N+APW I
Sbjct  285   SDGVDVLSVSLGGE-AAQLFNDSVAIGSFHAVKHGIVVICSAGNSGPADGTASNLAPWQI  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T+DR F S VVLGN   Y GES     LP  KFYPL+SAA AR    A+ S +DA
Sbjct  344   TVGASTIDREFPSYVVLGNNISYKGESLSKKALPKNKFYPLMSAADAR---AANASVEDA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               CK G+LD +K KGK+LVCL+G N R++K  +AA AGAVGM+L ND+DSGNEI+AD H 
Sbjct  401   KLCKAGSLDRKKAKGKILVCLRGVNARVDKGQQAARAGAVGMVLVNDKDSGNEILADVHI  460

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+H+ Y++G+AI +YIN T+ P+AH+T P T +G KPAP +AAFSSRGPN I P+ILK
Sbjct  461   LPASHLNYTNGVAILNYINSTKYPIAHVTRPETHIGTKPAPFMAAFSSRGPNTITPEILK  520

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV++IAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+VGLLK L+P+WS
Sbjct  521   PDITAPGVSIIAAYTQAAGPTNEDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKILHPTWS  580

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  R N+ + I  + T  K  PF+YGAGHI PN A +PGLVYDL   DY
Sbjct  581   PAAIKSAIMTTAMTRDNNREPIL-NATYSKANPFSYGAGHIRPNQAMEPGLVYDLTANDY  639

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             +NF+CA GYN+T+I +    PYKCP+  ++L+ FNYPSITVP  KG+ TVTR +KNVGSP
Sbjct  640   LNFLCALGYNETQILSFSQAPYKCPNKLVNLANFNYPSITVPKFKGSITVTRRVKNVGSP  699

Query  380   -ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
              +TY  S+R P G SV+V P+IL F ++GEE++FKVTLK K   A  +Y FG LTWSD  
Sbjct  700   SSTYKVSIRKPTGISVSVEPEILNFREIGEEKTFKVTLKGKKFKARKEYVFGELTWSDSI  759

Query  203   HRVRSPIVVK  174
             HRVRSPIVVK
Sbjct  760   HRVRSPIVVK  769



>ref|XP_006377976.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
 gb|ERP55773.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
Length=775

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/729 (63%), Positives = 556/729 (76%), Gaps = 7/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D+DRV  SH++LLG +  S +KA++ IFYSYT  INGFAA+LEEEEA+ +AK+P+V+SVF
Sbjct  48    DIDRVTDSHYELLGLFTESKEKAKEKIFYSYTNSINGFAAVLEEEEASALAKHPDVVSVF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+AR+L TT SW FLGLE +G V+   S+WKKA++GED IIGNLDTGVWPESKSFS+EG
Sbjct  108   LNKARKLHTTHSWSFLGLEKDG-VVPPSSLWKKARYGEDVIIGNLDTGVWPESKSFSDEG  166

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +W+GICQN   +   CNRKLIGARYF +GY S  G LNSSF T RD+ GHG+HT
Sbjct  167   LGPVPSKWRGICQNATKEGVPCNRKLIGARYFNKGYGSIGGHLNSSFQTARDIEGHGTHT  226

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED-CYDADILAGFDRA  1641
             LSTA GNFVPGANVFG G GTAKGGSP+ARVAAYKVCWP     E  CY+ADILAGFD A
Sbjct  227   LSTAAGNFVPGANVFGNGKGTAKGGSPRARVAAYKVCWPAVGVNEGGCYEADILAGFDVA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG     Y +D++AIGSFHA K GI VVASAGN GP  GSV+NVAPWL
Sbjct  287   ISDGVDVLSVSLGG-AIDEYSDDAIAIGSFHAFKKGITVVASAGNSGPGPGSVSNVAPWL  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F   V LGN+KH  G S     LP  KFYPL+S A A+    ++ S +D
Sbjct  346   ITVGASTLDRAFTIYVALGNRKHLKGVSLSQKSLPARKFYPLISGARAKA---SNQSEED  402

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CKPGTLD +KVKGK+LVCL+G N R+EK H A LAGAVGMILANDE+SGN I+ADAH
Sbjct  403   ANLCKPGTLDSKKVKGKILVCLRGVNPRVEKGHVALLAGAVGMILANDEESGNGILADAH  462

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA H+  +DG A+F Y+N T++P A+IT+  T LG KPAP +A+FSSRGPN +   IL
Sbjct  463   VLPAAHIISTDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESIL  522

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAAFT ATGP+D  YDKR + FN ESGTSMSCPHV+G+VGLLK+L+P W
Sbjct  523   KPDITAPGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDW  582

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMTTAT R N+G  I D  +  + TPFAYGAGH+ PN AADPGLVYDL + D
Sbjct  583   SPAAIRSAIMTTATTRDNNGDPILDS-SNTRATPFAYGAGHVQPNRAADPGLVYDLTVND  641

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++N++C++GY   ++      PY CP   SL+ FNYPSI+  +L  T TVTR +KNVGSP
Sbjct  642   FLNYLCSRGYTAKDLKLFTDKPYTCPKSFSLTDFNYPSISAINLNDTITVTRRVKNVGSP  701

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
               Y   VR P G  V+V P  L+F+K+GEE++FKVT K   +    DY FG+LTWSD KH
Sbjct  702   GKYYIHVREPTGVLVSVAPTTLEFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGKH  761

Query  200   RVRSPIVVK  174
              VRSP+VV+
Sbjct  762   FVRSPLVVR  770



>ref|XP_009136129.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=775

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/729 (61%), Positives = 555/729 (76%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ +H+  LG++ GS + A DAIFYSYT+HINGFAA L+ + A+ I+K+PEV+SVF 
Sbjct  53    MDRVRETHYDFLGSFTGSREIATDAIFYSYTKHINGFAAHLDHDLASAISKHPEVVSVFP  112

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+F+GLE     +   SIW+KA+FGED+II NLDTGVWPESKSFS+EG 
Sbjct  113   NKALKLHTTRSWDFMGLE-HNSYVPSSSIWRKARFGEDSIIANLDTGVWPESKSFSDEGL  171

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  172   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFDSPRDIDGHGSHTL  231

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             ST GG FVP ANVFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  232   STPGGAFVPRANVFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  290

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  +F DS+AIGSFHA K GIVVV SAGN GP   +V+NVAPW IT
Sbjct  291   DGADVISVSLGGE-PASFFKDSVAIGSFHAAKKGIVVVCSAGNSGPADSTVSNVAPWQIT  349

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN++LGN KHY G+S  P  LP  KFYP+++A+ A+ K   +++  DA 
Sbjct  350   VGASTMDREFASNLILGNGKHYKGQSLAPSSLPHAKFYPIIAASDAKAK---NVTASDAQ  406

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  407   LCKIGSLDPQKAKGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVL  466

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +++ D L++  YI++T+ P+AHIT   T+LG KPAPV+AAFSS+GP+++ P+ILKP
Sbjct  467   PATQISFKDSLSLSRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKP  526

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  527   DITAPGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  586

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I +  T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  587   AAIRSAIMTTATTMDDIPGPILNS-TYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  645

Query  554   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  646   NFLCSLGYNASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP  705

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TYT  V +P G SV V P  L F KVGE+++FKVT+  +       Y FG L WSDKKH
Sbjct  706   STYTVRVNNPEGVSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKH  765

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  766   RVRSPIVVK  774



>emb|CDY15084.1| BnaC03g44450D [Brassica napus]
Length=775

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/729 (61%), Positives = 556/729 (76%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ +H+  LG++ GS + A DAIFYSYT+HINGFAA L+ + A+ I+K+PEV+SVF 
Sbjct  53    MDRVRETHYDFLGSFTGSREIATDAIFYSYTKHINGFAAHLDHDLASAISKHPEVVSVFP  112

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+F+GLE     +   SIW+KA+FGED+II NLDTGVWPESKSFS+EG 
Sbjct  113   NKALKLHTTRSWDFMGLE-HNSYVPSSSIWRKARFGEDSIIANLDTGVWPESKSFSDEGL  171

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  172   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFDSPRDIDGHGSHTL  231

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FVPGANVFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  232   STAGGAFVPGANVFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  290

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  +FNDS+AIGSFHA + GIVVV SAGN GP   +V+NVAPW IT
Sbjct  291   DGADVISVSLGGE-PASFFNDSVAIGSFHAAEKGIVVVCSAGNSGPADSTVSNVAPWQIT  349

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F S+++LGN KHY G+S  P  LP  KFYP+++A+ A+ K   +++  DA 
Sbjct  350   VGASTMDREFASSLILGNGKHYKGQSLAPSSLPHAKFYPIIAASEAKAK---NVTASDAQ  406

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K +GK+LVCL+G N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  407   LCKIGSLDPQKARGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVL  466

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +++ D LA+  YI++T+ P+AHIT   T+LG K APV+AAFSS+GP+++ P+ILKP
Sbjct  467   PATQISFKDSLALSRYISQTKKPIAHITPSRTVLGTKQAPVMAAFSSKGPSSVAPEILKP  526

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  527   DITAPGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  586

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I +  T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  587   AAIRSAIMTTATTMDDIPGPILNS-TYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  645

Query  554   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  646   NFLCSLGYNASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP  705

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TYT  V +P G  V V P  L F KVGE+++FKVT+  +       Y FG L WSDKKH
Sbjct  706   STYTVRVNNPEGVYVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKH  765

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  766   RVRSPIVVK  774



>ref|XP_008224681.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/727 (64%), Positives = 558/727 (77%), Gaps = 11/727 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SH + LG++LGS  KA++AI YSY RHINGFAA LE+EEA EIAK+P+V+SVF
Sbjct  47    DLHRVTDSHSEFLGSFLGSTQKAKEAIIYSYKRHINGFAATLEDEEAGEIAKHPKVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ RQL TT SW+F+ LE +G VIH  S+WK+A+FGEDTIIGNLDTGVW ES+SFS+EG
Sbjct  107   LNQGRQLHTTHSWDFMLLEKDG-VIHPTSLWKRARFGEDTIIGNLDTGVWAESESFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSH  1821
              GPIP +WKGICQN     F CNRKLIGARYF +GY+S  G PL SSF + RD  GHGSH
Sbjct  166   IGPIPAKWKGICQNDT-AGFPCNRKLIGARYFNKGYASYAGAPLRSSFNSARDHEGHGSH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GNFV GANVFGLGNGTAKGGSPKARVAAYKVCWPP + G +C+DADI+A FD A
Sbjct  225   TLSTAAGNFVAGANVFGLGNGTAKGGSPKARVAAYKVCWPPIN-GSECFDADIMAAFDAA  283

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD P  Y +D L+IG+FHAVK+GIVVV SAGN GP AG+V+NVAPW+
Sbjct  284   IHDGVDVLSVSLGGD-PSNYLDDGLSIGAFHAVKHGIVVVCSAGNSGPAAGTVSNVAPWM  342

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR FQ+ V L N     G S +   LP  +FYPL++ A A+    A+ S QD
Sbjct  343   ITVGASTLDREFQAIVQLRNGLRLKGTS-LSKPLPEDRFYPLITGAQAK---AANASAQD  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C  GTLDP+KVKGK+L CL+G+  R +K  +AALAGAVGMIL ND+ SGNEIIAD H
Sbjct  399   AMLCIGGTLDPQKVKGKILACLRGDTARADKGEQAALAGAVGMILCNDKASGNEIIADPH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+ + Y+DG+A+  YIN T +P   IT P   L  KPAP +A+FSS+GPN I P+IL
Sbjct  459   VLPASQINYTDGIAVVSYINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEIL  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA+T+AT P++  +DKR ++FN ESGTSMSCPHV+GVVGLLKTLYP W
Sbjct  519   KPDITAPGVNIIAAYTQATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDW  578

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SP+ IRSAIMTTA  R N+   +  + + ++ TPF+YGAGHI PN A DPGL+YDL + D
Sbjct  579   SPSAIRSAIMTTARTRDNTANPM-KNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVND  637

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y++F+CA GYNKT +     +P YKCP   SL  FNYPSI VP L G+ TVTR +KNVGS
Sbjct  638   YLDFLCAIGYNKTMMQLFSESPNYKCPKSASLLDFNYPSIAVPELSGSVTVTRRVKNVGS  697

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY   +  P+G SVTV P ILKF+ +GEE+SFKVTLKAKG   T  Y FG L WSD K
Sbjct  698   PGTYAVRIHKPLGVSVTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKGYVFGGLIWSDGK  757

Query  203   HRVRSPI  183
             H VRSPI
Sbjct  758   HYVRSPI  764



>ref|XP_011000330.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=775

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/729 (63%), Positives = 554/729 (76%), Gaps = 7/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D+DRV  SH++LLG +  S +KA++ IFYSYT  INGFAA+LEE+EA+ +AK+P+VISVF
Sbjct  48    DIDRVTDSHYELLGLFTESKEKAKEKIFYSYTNSINGFAAVLEEDEASALAKHPDVISVF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+AR+L TT SW FLGLE +G V+   S+WKKA++GED IIGNLDTGVWPESKSFS+EG
Sbjct  108   LNKARKLHTTHSWGFLGLEKDG-VVPPSSLWKKARYGEDVIIGNLDTGVWPESKSFSDEG  166

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +W+GICQN   +   CNRKLIGARYF +GY S  G LNSSF T RD+ GHG+HT
Sbjct  167   LGPVPSKWRGICQNATKEGVPCNRKLIGARYFNKGYGSLGGHLNSSFQTARDIEGHGTHT  226

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED-CYDADILAGFDRA  1641
             LSTA GNFVPGANVFG G GTAKGGSP+ARVAAYKVCWP     E  CY+ADILAGFD A
Sbjct  227   LSTAAGNFVPGANVFGNGKGTAKGGSPRARVAAYKVCWPAVGVNEGGCYEADILAGFDVA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG     Y +D++AIGSFHA K GI VVASAGN GP  GSV+NVAPWL
Sbjct  287   ISDGVDVLSVSLGG-AIDEYSDDAIAIGSFHAFKKGITVVASAGNSGPGPGSVSNVAPWL  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F   V LGN+KH  G S     LP  KFYPL+S A A+    ++ S +D
Sbjct  346   ITVGASTLDRAFTIYVALGNRKHLKGVSLSQKSLPARKFYPLISGARAKA---SNQSEED  402

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CKPGTLD +KVKGK+LVCL+G N R+EK H A LAGAVGMILANDE+SGN I+ADAH
Sbjct  403   ANLCKPGTLDSKKVKGKILVCLRGINPRVEKGHVALLAGAVGMILANDEESGNGILADAH  462

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA H+   DG A+F Y+N T++P A+IT+  T LG KPAP +A+FSSRGPN +   IL
Sbjct  463   VLPAAHIISKDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESIL  522

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAAFT ATGP+D  YDKR + FN ESGTSMSCPHV+G+VGLLK+L+P W
Sbjct  523   KPDITAPGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDW  582

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMTTAT R N+G  I D  +  + TPFAYGAGH+ PN A+DPGLVYDL + D
Sbjct  583   SPAAIRSAIMTTATTRDNNGDPILDS-SNTRATPFAYGAGHVQPNRASDPGLVYDLTVND  641

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++N++C++GY   ++      PY CP   SL+ FNYPSI+  +L  T TV+R +KNVGSP
Sbjct  642   FLNYLCSRGYTAKDLKLFTDKPYTCPKSFSLTDFNYPSISAINLNDTITVSRRVKNVGSP  701

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
               Y   VR P G  V+V P  L F+K+GEE++FKVT K   +    DY FG+LTWSD KH
Sbjct  702   GKYYIHVREPTGVLVSVTPTTLDFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGKH  761

Query  200   RVRSPIVVK  174
              VRSP+VV+
Sbjct  762   FVRSPLVVR  770



>ref|NP_001267495.1| SUB1 homolog precursor [Glycine max]
 gb|AAQ23176.1| subtilisin-like protease [Glycine max]
 gb|AFV08660.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/729 (63%), Positives = 558/729 (77%), Gaps = 8/729 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD ++V  SHH  LG++LGS + A+D+IFYSYTRHINGFAA L+EE A EIAK+P+V+SV
Sbjct  47    VDFNQVTQSHHDFLGSFLGSSNTAKDSIFYSYTRHINGFAATLDEEVAVEIAKHPKVLSV  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR R+L TTRSW+F+ LE   GVI   SIWKKA+FGE  IIGNLDTGVWPESKSFSE+
Sbjct  107   FENRGRKLHTTRSWDFMELE-HNGVIQSSSIWKKARFGEGVIIGNLDTGVWPESKSFSEQ  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +W+GIC N  D +FHCNRKLIGARYF +GY+S  GPLNSSF +PRD  GHG+H
Sbjct  166   GLGPIPSKWRGICDNGIDHTFHCNRKLIGARYFNKGYASVAGPLNSSFDSPRDNEGHGTH  225

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGN V   +VFG G GTAKGGSP ARVAAYKVCWPP   GE+C+DADILA FD A
Sbjct  226   TLSTAGGNMVARVSVFGQGQGTAKGGSPMARVAAYKVCWPPVG-GEECFDADILAAFDLA  284

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG     +F DS+AIGSFHA K G+VVV SAGN GP   +  N+APW 
Sbjct  285   IHDGVDVLSVSLGGSS-STFFKDSVAIGSFHAAKRGVVVVCSAGNSGPAEATAENLAPWH  343

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+TMDR+F + VVLGN   + GES    KL   KFYP++ A  A++   AS   +D
Sbjct  344   VTVAASTMDRQFPTYVVLGNDITFKGESLSATKL-AHKFYPIIKATDAKL---ASARAED  399

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C+ GTLDP K KGK++VCL+G N R++K  +A LAGAVGM+LAND+ +GNEIIAD H
Sbjct  400   AVLCQNGTLDPNKAKGKIVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPH  459

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG A+F+YIN T+ PVA+ITHP T L  KPAP +AAFSS+GPN + P+IL
Sbjct  460   VLPASHINFTDGSAVFNYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTMVPEIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPHV+G+VGLL+ LYP+W
Sbjct  520   KPDITAPGVSVIAAYTEAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             S A I+SAIMTTAT   N  + + +   G K TPF+YGAGH+ PN A DPGLVYD+ + D
Sbjct  580   STAAIKSAIMTTATTLDNEVEPLLNATDG-KATPFSYGAGHVQPNRAMDPGLVYDITIDD  638

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GYN+T+I+     PYKC    SL   NYPSITVP L G+ TVTRTLKNVGSP
Sbjct  639   YLNFLCALGYNETQISVFTEGPYKCRKKFSLLNLNYPSITVPKLSGSVTVTRTLKNVGSP  698

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY A V++P G +V+V P ILKF+ VGEE+SFK+T KA    AT +YAFG L WSD KH
Sbjct  699   GTYIAHVQNPYGITVSVKPSILKFKNVGEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKH  758

Query  200   RVRSPIVVK  174
              V SPIVVK
Sbjct  759   YVTSPIVVK  767



>ref|XP_011005797.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=773

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/729 (63%), Positives = 551/729 (76%), Gaps = 8/729 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD D V  SH + LG++LGS +KARDAI YSY RHINGFAAMLEEEEA E A++P V+SV
Sbjct  46    VDTDAVADSHQEFLGSFLGSSEKARDAIIYSYDRHINGFAAMLEEEEAGENAQHPNVVSV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SW+F+ LE +G V+   S+WK+A+FGED+II NLDTGVWPES+SFSEE
Sbjct  106   FLNQGRKLHTTHSWDFMLLEKDG-VVDPSSLWKRARFGEDSIIANLDTGVWPESRSFSEE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GP+P +WKG C+N       CNRKLIGARYF +GY +  G L SS  + RD  GHG+H
Sbjct  165   GIGPVPSKWKGTCENDTAVGVPCNRKLIGARYFNRGYIAYAGGLTSSDNSARDKDGHGTH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVA+YKVCWPP + G +C+DADI+  FD A
Sbjct  225   TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVASYKVCWPPVN-GSECFDADIMKAFDMA  283

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG+ P  YFND LAIG+FHAV NGI VV SAGN GP+ G+V N APW+
Sbjct  284   IHDGVDVLSVSLGGE-PTDYFNDGLAIGAFHAVSNGIPVVCSAGNSGPMDGTVTNNAPWI  342

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F++ V L N K   G S + + LP  KFYPL++   A+    A+ ST D
Sbjct  343   ITVGASTLDREFETFVELRNGKRLQGTS-LSIPLPEKKFYPLITGEQAKA---ANASTAD  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CKP +LD EK KGKV+VCL+GE  R++K ++AAL GA GMIL ND+ SGNEIIAD H
Sbjct  399   ALLCKPKSLDHEKAKGKVVVCLRGETGRMDKGYQAALVGAAGMILCNDKASGNEIIADPH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA  +TY+DGLA+F YIN T + + +I+ P   LG KPAP +AAFSSRGPN + P+IL
Sbjct  459   VLPAAQITYTDGLAVFAYINSTDHALGYISAPTAKLGTKPAPSMAAFSSRGPNTVTPEIL  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAAF+EA  P+D D+DKR   F  ESGTSMSCPHVAGVVGLLKTL+P W
Sbjct  519   KPDITAPGVNIIAAFSEAISPTDFDFDKRKSPFITESGTSMSCPHVAGVVGLLKTLHPDW  578

Query  740   SPAEIRSAIMTTATVRANSGKAI-TDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             SPA IRSA+MTTA  RAN+   I  D + GL+ TPF+YG+GHI PN A DPGLVYDL + 
Sbjct  579   SPAAIRSAMMTTARTRANTMTPILVDGRDGLEATPFSYGSGHIRPNRAQDPGLVYDLSIN  638

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY++F+CA GYN T I      PYKCP+  S+  FN PSIT+  L+ + +V R +KNVG 
Sbjct  639   DYLDFLCASGYNSTMIEHFSDGPYKCPESTSIFDFNNPSITIRQLRNSMSVIRKVKNVGL  698

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A VR P G SV+V P IL FE  G+E+SF+VT KAK +  T DY FG LTW+D +
Sbjct  699   PGTYAAHVREPYGISVSVEPNILTFENKGDEKSFEVTFKAKWDGVTEDYEFGTLTWTDGR  758

Query  203   HRVRSPIVV  177
             H VRSPIVV
Sbjct  759   HYVRSPIVV  767



>ref|XP_010063229.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70437.1| hypothetical protein EUGRSUZ_F03662 [Eucalyptus grandis]
Length=769

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/730 (62%), Positives = 556/730 (76%), Gaps = 11/730 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             +++   +SH+ LLG+YLGS +KA++AIFYSYT HINGFAA+L+E++AAE+AK+P+V+SVF
Sbjct  47    EIESATNSHYDLLGSYLGSNEKAQEAIFYSYTHHINGFAAILDEDQAAEVAKHPDVLSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++ R+L TTRSW FLGLE   GVIH  SI +KA+FGEDTIIGNLDTGVWPESKSFS+EG
Sbjct  107   LSKGRKLHTTRSWHFLGLE-RNGVIHKNSILRKARFGEDTIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +W+GICQ      F CNRKLIGARYF +GY++  G LNS+F+T RD  GHGSHT
Sbjct  166   MGPIPGKWRGICQRGIKDGFSCNRKLIGARYFNKGYAAYAGLLNSTFYTARDHDGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED--CYDADILAGFDR  1644
             LSTAGG+ VPGA+VFG GNGT+KGGSPKARV AYKVCWPP    ED  C+DAD+LAGFD 
Sbjct  226   LSTAGGSLVPGASVFGYGNGTSKGGSPKARVVAYKVCWPPL---EDVGCFDADVLAGFDA  282

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVSLG D P  +F D + IGSFHA +NGIVVV+SAGN GP  G+V NVAPW
Sbjct  283   AISDGVDVLSVSLG-DEPAEFFMDGIVIGSFHAARNGIVVVSSAGNSGPQPGTVLNVAPW  341

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F + + LGNK+H  G S    +LP+ KFYPL+S A A+    A++S  
Sbjct  342   MITVAASTIDREFTTYIALGNKQHLKGSSLSANELPSNKFYPLISGADAQA---ANVSAA  398

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             +AL CK GTLD +KVKGK+L CL  +N RI    +AALAGAVGM+LANDE +GN+++ADA
Sbjct  399   EALLCKAGTLDRKKVKGKILACLLVDNKRIVVGQQAALAGAVGMVLANDEANGNDVVADA  458

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA H+++ DG  +F YIN T  P+A+IT   T+L   PAP +A+FSSRGPN + P I
Sbjct  459   HVLPAAHISFVDGKVLFAYINSTAFPMAYITRVKTMLNTTPAPFMASFSSRGPNIVEPAI  518

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APG+N+IAA+T A GP+  D+DKR   F+ ESGTSMSCPHVAG+VGLLKTLYPS
Sbjct  519   LKPDITAPGLNIIAAYTLAVGPAGQDFDKRKTPFSAESGTSMSCPHVAGIVGLLKTLYPS  578

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMTTA  R N  + + D     K TPF+YGAGHI PN A +PGLVYDL   
Sbjct  579   WSPAAIQSAIMTTARTRDNKLEPMLDASFA-KATPFSYGAGHIRPNRAMNPGLVYDLTAN  637

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY++F+CA+GYN++++       ++CP H   S  NYPSITVP L GT  VTR +KNVG+
Sbjct  638   DYLDFLCARGYNESQLRLFTNETHRCPKHFKTSDLNYPSITVPDLNGTMVVTRRMKNVGT  697

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY+A +++P G S++V P+ LKFEK GEE+ FKV LK K      D+ FG L WSD  
Sbjct  698   PGTYSAHIKAPAGVSLSVQPQNLKFEKCGEEKEFKVVLKPKVAGKPVDHVFGKLIWSDGV  757

Query  203   HRVRSPIVVK  174
             H VRSP+VVK
Sbjct  758   HYVRSPLVVK  767



>ref|XP_004167057.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=673

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/677 (65%), Positives = 533/677 (79%), Gaps = 7/677 (1%)
 Frame = -2

Query  2201  NPEVISVFLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPE  2022
             +P+V+SVFLNR R+L TTRSWEF+GLE E GVI+  SIWKKA+FGEDTIIGNLDTGVW E
Sbjct  1     HPKVVSVFLNRGRKLHTTRSWEFMGLENENGVINSESIWKKARFGEDTIIGNLDTGVWAE  60

Query  2021  SKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRD  1842
             SKSFS++ +GPIP RWKGICQNQKD SFHCNRKLIGARYF +GY+S VGPLNSSF +PRD
Sbjct  61    SKSFSDDEYGPIPHRWKGICQNQKDPSFHCNRKLIGARYFNKGYASVVGPLNSSFHSPRD  120

Query  1841  VIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADI  1662
               GHGSHTLSTAGGNFV GA+VFGLG GTAKGGSP+ARVAAYKVCWPP + G +C+DADI
Sbjct  121   KEGHGSHTLSTAGGNFVAGASVFGLGKGTAKGGSPRARVAAYKVCWPPKA-GNECFDADI  179

Query  1661  LAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSV  1482
             LA FD AI DGVDVLSVSLGGD P P FNDS+AIGSFHA+K+GIVV+ SAGN GP AG+V
Sbjct  180   LAAFDFAIHDGVDVLSVSLGGD-PNPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTV  238

Query  1481  NNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKIN  1302
              NVAPW ITVGA+TMDR+F S VVLGN+K   GES     LP+ K YPL++AA  R+   
Sbjct  239   TNVAPWQITVGASTMDRKFPSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRL---  295

Query  1301  ASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGN  1122
             A+ S  +A  CK GTL+P K KGK+LVCL+G+N R++K  +A LAGA GMILAN+E SGN
Sbjct  296   ANASVHEAQLCKAGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGN  355

Query  1121  EIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPN  942
             EI+AD H LPA+H+ ++DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN
Sbjct  356   EILADPHVLPASHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPN  415

Query  941   AINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLL  762
              + P+ILKPDI+APG++VIAA+TEA GP++ ++D R + FN  SGTSMSCPHV+G+ GLL
Sbjct  416   TVTPEILKPDITAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLL  475

Query  761   KTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLV  582
             KTLYP WSPA I+SAIMTTA++  N+ + + +    +  +PF YGAGH++PNGAADPGLV
Sbjct  476   KTLYPHWSPAAIKSAIMTTASILDNNFEPLLNASYSV-ASPFNYGAGHVHPNGAADPGLV  534

Query  581   YDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRT  402
             YD+++ +Y++F+CA GYNK +I+     P+ C D IS +  NYPSITVP L  + T+TR 
Sbjct  535   YDIEVNEYLSFLCALGYNKAQISQFSNGPFNCSDPISPTNLNYPSITVPKLSRSITITRR  594

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGV  225
             LKNVGSP TY A +R P G SV V PK L F ++GEE SFKV +K K    A  +Y +G 
Sbjct  595   LKNVGSPGTYKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGD  654

Query  224   LTWSDKKHRVRSPIVVK  174
             L WSD KH VRSPIVVK
Sbjct  655   LIWSDGKHHVRSPIVVK  671



>ref|XP_006297035.1| hypothetical protein CARUB_v10013025mg [Capsella rubella]
 gb|EOA29933.1| hypothetical protein CARUB_v10013025mg [Capsella rubella]
Length=770

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/730 (62%), Positives = 554/730 (76%), Gaps = 11/730 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRVK +H+  LG++ GS +KA + IFYSYT+HINGFAA L+ + A  I+K+PEV+SVF 
Sbjct  48    MDRVKETHYDFLGSFTGSLEKATNDIFYSYTKHINGFAAHLDHDLAYAISKHPEVVSVFP  107

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIWKKA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  108   NKALKLHTTRSWDFLGLE-HNSYVPSSSIWKKARFGEDTIIANLDTGVWPESKSFRDEGL  166

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNS+F +PRD+ GHGSHTL
Sbjct  167   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSTFESPRDLDGHGSHTL  226

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G FVPG +VF  GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  227   STAAGAFVPGVSVFSQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  285

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+    +FNDS+AIGSFHA K  IVVV SAGN GPV GSV+NVAPW IT
Sbjct  286   DGADVISVSLGGEATS-FFNDSVAIGSFHAAKKRIVVVCSAGNSGPVDGSVSNVAPWQIT  344

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++S+  A+ K   + S  DA 
Sbjct  345   VGASTMDRVFASNLVLGNGKHYKGQSLSSTVLPHAKFYPIMSSIRAKAK---NASALDAQ  401

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G+N R+EK    ALAG VGM+L N   +GN++IAD H L
Sbjct  402   LCKIGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLIADPHVL  461

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T +D LA+  YI++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  462   PATQLTSTDSLAVSRYISQTKNPIAHITPSRTDLGLKPAPVMASFSSKGPSTVAPEILKP  521

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  522   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  581

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  582   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGVKDYL  640

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTA-TVTRTLKNVGSP  381
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  T++RT+KNVG P
Sbjct  641   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKITISRTVKNVGRP  700

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTL-KAKGENATADYAFGVLTWSDKK  204
             +TYT  V +P G  V V P  L F KVGE+++FKVTL K KG N   DY FG L WSDKK
Sbjct  701   STYTVRVTNPQGVYVAVKPTSLNFTKVGEQKTFKVTLVKVKG-NVAKDYVFGELVWSDKK  759

Query  203   HRVRSPIVVK  174
             HRVRSPIVVK
Sbjct  760   HRVRSPIVVK  769



>ref|XP_002885743.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62002.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/729 (61%), Positives = 548/729 (75%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRVK +H+  LG ++GS + A DAIFYSYT+HINGFAA L+ + A  I+K+PEV+SVF 
Sbjct  51    MDRVKETHYDFLGIFIGSREIATDAIFYSYTKHINGFAAHLDHDLAYAISKHPEVVSVFP  110

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  111   NKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKARFGEDTIIANLDTGVWPESKSFRDEGL  169

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  170   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFESPRDLDGHGSHTL  229

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G+FVPG ++FG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD++A FD AI 
Sbjct  230   STAAGDFVPGVSIFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVMAAFDAAIH  288

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  +FNDS+AIGSFHA K  IVVV SAGN GP   +V+NVAPW IT
Sbjct  289   DGADVISVSLGGE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPADSTVSNVAPWQIT  347

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  +FYP++++ +A+ K   + S  DA 
Sbjct  348   VGASTMDREFASNLVLGNGKHYKGQSLSSTALPHAEFYPIMASVNAKAK---NASALDAQ  404

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP K KGK+LVCL+G+N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  405   LCKLGSLDPIKAKGKILVCLRGQNPRVEKGRVVALAGGVGMVLENTNVTGNDLTADPHVL  464

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T  DG A+  YI++T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  465   PATQLTSKDGFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSTVAPQILKP  524

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P+D  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  525   DITAPGVSVIAAYTAAVSPTDQQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  584

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGL+YDL + DY+
Sbjct  585   AAIRSAIMTTATTMDDIPGPI-QNATSMKATPFSFGAGHVQPNLAVNPGLIYDLGIKDYL  643

Query  554   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+  YN ++I+   G  + C  H  SL   NYPSITVP+L     TV+RT+KNVG P
Sbjct  644   NFLCSLRYNASQISVFSGNNFTCSSHKTSLVNLNYPSITVPNLSSNKVTVSRTVKNVGRP  703

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TYT  V +P G  VTV P  L F KVGE+++FKV L     N    Y FG L WSDKKH
Sbjct  704   STYTVRVANPQGVYVTVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGELVWSDKKH  763

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  764   RVRSPIVVK  772



>ref|XP_009374900.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Pyrus x bretschneideri]
Length=775

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/735 (63%), Positives = 568/735 (77%), Gaps = 14/735 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV HSHH+ LG++LGS +KA++AI YSY RHINGFA  LEEE+AA+IAK+P+V+SVF
Sbjct  47    DLHRVTHSHHEFLGSFLGSTEKAKEAIIYSYKRHINGFATTLEEEQAAQIAKHPKVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TT SW+F+ LE +G VIH  S+WKKA+FGEDTIIGNLDTGVWPES+SFS++G
Sbjct  107   LNQGRKLHTTHSWDFMLLEKDG-VIHPSSLWKKARFGEDTIIGNLDTGVWPESESFSDKG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSH  1821
              GP+P +WKGICQN     F CNRKLIG RYF +GY++  G P+ SS  + RD  GHGSH
Sbjct  166   IGPVPSKWKGICQNHT-TGFVCNRKLIGTRYFNKGYAAYAGVPVKSSLNSARDHEGHGSH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPP + G +C+DADI+A FD A
Sbjct  225   TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPIN-GSECFDADIMAAFDAA  283

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLS+SLGGD P  YF D ++IG+FHAVKNGIVVV SAGN GP AG+V+NVAPW+
Sbjct  284   IHDGVDVLSISLGGD-PSDYFRDGVSIGAFHAVKNGIVVVCSAGNSGPAAGTVSNVAPWM  342

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F++ + L N     G S +    P   FYPL++ A A+    A+ S +D
Sbjct  343   ITVGASTLDREFETMIELRNGMRLKGTS-LSKPXPDDIFYPLITGAQAK---AANASAKD  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C  G+LDP+KVKGK+L CL+G + R++K  +A+LAGAVGMIL NDE SGNE+IAD H
Sbjct  399   AMLCLGGSLDPKKVKGKILACLRGLSARVDKGQQASLAGAVGMILCNDEASGNELIADPH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+ + Y+DG+A+F+YIN T +P+  IT P   L  KPAP +A+FSS+GPN I P+IL
Sbjct  459   VLPASQINYTDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEIL  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPD++APGVN+IAA+T+AT P+D D+DKR V FN ESGTSMSCPHV+GVVGLLKTLYP W
Sbjct  519   KPDVTAPGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHW  578

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SP+ IRSAIMTTA  R N+   +  + + ++ TPF+YG+GHI PN A DPGL+YDL   D
Sbjct  579   SPSAIRSAIMTTARTRDNTVNPMM-NASFVEATPFSYGSGHIRPNRAMDPGLIYDLTAND  637

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y++F+CA GYNKT I      P YKCP+  SL  FNYPSI+VP L G+ TVTR LKNVG+
Sbjct  638   YLDFLCAIGYNKTTIQLFSEGPNYKCPESASLLDFNYPSISVPRLSGSVTVTRRLKNVGA  697

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK---GENATADYAFGVLTWS  213
             P TY   ++   G SV+V P +L+F+ VGEE+SF+VTLKAK   G  A  DY FG LTWS
Sbjct  698   PGTYAVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAKGDYVFGGLTWS  757

Query  212   DKKHRVRSPIVVKTA  168
             D KH VRSP VV +A
Sbjct  758   DGKHYVRSPFVVASA  772



>gb|AFV08661.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/729 (63%), Positives = 556/729 (76%), Gaps = 8/729 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD ++V  SHH  LG++LGS + A+D+IFYSYTRHINGFAA L+EE A EIAK+P+V+S 
Sbjct  47    VDFNQVTQSHHDFLGSFLGSSNTAKDSIFYSYTRHINGFAATLDEEVAVEIAKHPKVLSA  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR R+L TTRSW+F+ LE   GVI   SIWKKA+FGE  IIGNLDTGVWPESKSFSE+
Sbjct  107   FENRGRKLHTTRSWDFMELE-HNGVIQSSSIWKKARFGEGVIIGNLDTGVWPESKSFSEQ  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GPIP +W+GIC N  D +FHCNRKLIGARYF +GY+S  GPLNSSF +PRD  GHG+H
Sbjct  166   GLGPIPSKWRGICDNGIDHTFHCNRKLIGARYFNKGYASVAGPLNSSFDSPRDNEGHGTH  225

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGN V   +VFG G GTAKGGSP ARVAAYKVCWPP   GE+C+DADILA FD A
Sbjct  226   TLSTAGGNMVARVSVFGQGQGTAKGGSPMARVAAYKVCWPPVG-GEECFDADILAAFDLA  284

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG     +F DS+AIGSFHA K G+VVV SAGN GP   +  N+APW 
Sbjct  285   IHDGVDVLSVSLGGSS-STFFKDSVAIGSFHAAKRGVVVVCSAGNSGPAEATAENLAPWH  343

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+TMDR+F + VVLGN   + GES    KL   KFYP++ A  A++   AS   +D
Sbjct  344   VTVAASTMDRQFPTYVVLGNDITFKGESLSATKL-AHKFYPIIKATDAKL---ASARAED  399

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C+ GTLDP K KGK++VCL+G N R++K  +A LAGAVGM+LAND+ +GNEIIAD H
Sbjct  400   AVLCQNGTLDPNKAKGKIVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPH  459

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG A+F+YIN T+ PVA+ITHP T L  KPAP +AAFSS+GPN + P+IL
Sbjct  460   VLPASHINFTDGSAVFNYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTMVPEIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPHV+G+VGLL+ LYP+W
Sbjct  520   KPDITAPGVSVIAAYTEAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             S A I+SAIMTTAT   N  + + +   G K TPF+YGAGH+ PN A DPGLVYD+ + D
Sbjct  580   STAAIKSAIMTTATTLDNEVEPLLNATDG-KATPFSYGAGHVQPNRAMDPGLVYDITIDD  638

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GYN+T+I+     PYKC    SL   NYP ITVP L G+ TVTRTLKNVGSP
Sbjct  639   YLNFLCALGYNETQISVFTEGPYKCRKKFSLLNLNYPLITVPKLSGSVTVTRTLKNVGSP  698

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY A V++P G +V+V P ILKF+ VGEE+SFK+T KA    AT +YAFG L WSD KH
Sbjct  699   GTYIAHVQNPYGITVSVKPSILKFKNVGEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKH  758

Query  200   RVRSPIVVK  174
              V SPIVVK
Sbjct  759   YVTSPIVVK  767



>ref|XP_008348301.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=775

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/732 (63%), Positives = 569/732 (78%), Gaps = 8/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L++V  +HH+ LG++LGS + A++++FYSYTRHINGFAA LEEEEAA+IAK+P+V+SV
Sbjct  51    LELNQVTDNHHEFLGSFLGSXEVAKESMFYSYTRHINGFAATLEEEEAAQIAKHPKVVSV  110

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TTRSW+FLGLE + GV+   SIWKKA++GED+IIGNLDTG WPESKSFS+E
Sbjct  111   FLNQGRKLHTTRSWDFLGLE-QDGVVSPNSIWKKARYGEDSIIGNLDTGAWPESKSFSDE  169

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP +WKGICQN+ D  FHCNRKLIGARYF +GY++A G LNSSF +PRD  GHGSH
Sbjct  170   GYGPIPSKWKGICQNEIDSEFHCNRKLIGARYFNKGYAAAAGXLNSSFBSPRDBDGHGSH  229

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAYKVCWPP   G  C+ ADILA FD A
Sbjct  230   TLSTAGGNFVTGASVFGFGNGTAKGGSPKARVAAYKVCWPPVD-GTKCFHADILAAFDAA  288

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I+DGVDVLSVSLGGD P  +F+DS++IG+FHAVK+GIVVV SAGN GP  G+V+N++PW 
Sbjct  289   IDDGVDVLSVSLGGD-PTTFFSDSVSIGAFHAVKHGIVVVCSAGNSGPAEGTVSNISPWQ  347

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+TMDR F S V LGN KH  G+S     L   KFY L+SAA A+    A+ S ++
Sbjct  348   ITVGASTMDREFPSYVTLGNWKHLKGQSLSSXALXXKKFYQLISAADAK---AANASAKE  404

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLDP+KVKGK+L CL+G+N  ++K  +A LAGAVGMILAN+  +GNEII+D H
Sbjct  405   ALLCKAGTLDPKKVKGKILACLRGDNAXVDKGEQALLAGAVGMILANNAJNGNEIISDPH  464

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+ ++DG+ +F YIN T++P A+I    T LG KP+P +A FSS+GPN I P IL
Sbjct  465   VLPASHINFTDGILVFAYINSTKSPRAYIKRAITELGTKPSPFMAXFSSKGPNTITPGIL  524

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+T+A GP++  +D+R + FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  525   KPDITAPGVSVIAAYTKARGPTNQMFDQRRIPFNSASGTSMSCPHISGICGLLKTLYPHW  584

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA  R NS   +  + +  + TPF+YGAGH++PN A DPGLVYDL L D
Sbjct  585   SPAAIKSAIMTTAITRDNSMGPLL-NASFYEATPFSYGAGHVBPNSAMDPGLVYDLSLND  643

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+NF+CA GYN+TE+       Y+CP   IS +  NYPSIT+P L G   VTRT+KNVGS
Sbjct  644   YLNFLCAMGYNETEMEMFSEDTYECPKPAISPTNLNYPSITIPKLSGXLEVTRTVKNVGS  703

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A ++SP G S +V PK LKF K+GEE+SFKV L+ K      +Y  G L  SD K
Sbjct  704   PGTYKAXIQSPDGVSXSVEPKKLKFXKIGEEKSFKVLLQVKEAXQAKNYVXGKLIXSDGK  763

Query  203   HRVRSPIVVKTA  168
             H VRSPIVVK +
Sbjct  764   HXVRSPIVVKAS  775



>ref|XP_006418604.1| hypothetical protein EUTSA_v10002408mg [Eutrema salsugineum]
 gb|ESQ37040.1| hypothetical protein EUTSA_v10002408mg [Eutrema salsugineum]
Length=773

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/729 (61%), Positives = 553/729 (76%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ +H++ LG+++GS + A +AIFYSYT+HINGFAA L+ + A+ I+K+PEV+SVF 
Sbjct  51    MDRVRETHYEFLGSFIGSHEIAANAIFYSYTKHINGFAAHLDHDLASAISKHPEVVSVFP  110

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGED+II NLDTGVWPESKSF +EG 
Sbjct  111   NKALKLHTTRSWDFLGLE-HNSFVPSSSIWRKARFGEDSIIANLDTGVWPESKSFRDEGL  169

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  170   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFDSPRDLDGHGSHTL  229

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G+FVPGA+VFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  230   STAAGSFVPGASVFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  288

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  + NDS+AIGSFHAVK  IVVV SAGN GP  G+V NVAPW IT
Sbjct  289   DGADVISVSLGGE-PTSFLNDSVAIGSFHAVKKRIVVVCSAGNSGPGDGTVANVAPWQIT  347

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN++LGN KHY G+S     LP  KFY +++A+ A+ K   +++  DA 
Sbjct  348   VGASTMDREFASNLILGNGKHYKGQSLSSTSLPHAKFYTVMAASKAKAK---NVTASDAQ  404

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G+N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  405   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  464

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +++ D LA+  YI++T  P+AHIT   T+LG KPAPV+AAFSS+GP+++ P+ILKP
Sbjct  465   PATQLSFKDSLALSRYISQTNKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKP  524

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  525   DITAPGVSVIAAYTGAVSPTNEQFDARRLLFNAVSGTSMSCPHISGIAGLLKTRYPSWSP  584

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  585   AAIRSAIMTTATTMDDIPGPI-QNSTNMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  643

Query  554   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKG-TATVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L     TV+RT+KNVG P
Sbjct  644   NFLCSLGYNASQISVFSGKNFACKSRKTSLYNLNYPSITVPNLSSRKVTVSRTVKNVGRP  703

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TYT    +P G  V V P  L F KVGE+++FKVTL  +       Y FG L WSDKKH
Sbjct  704   STYTVQANNPHGVYVAVKPTSLNFTKVGEQKTFKVTLVKRKGKVAKGYVFGELVWSDKKH  763

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  764   RVRSPIVVK  772



>ref|XP_010514315.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=772

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/729 (61%), Positives = 551/729 (76%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ +H+  LG++ GS +KA D IFYSYT+HINGFAA L+ + A  I+K+PEV+SVF 
Sbjct  50    MDRVRETHYDFLGSFTGSREKATDDIFYSYTKHINGFAAHLDHDLAYAISKHPEVVSVFP  109

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  110   NKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKARFGEDTIIANLDTGVWPESKSFRDEGL  168

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKL+GARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  169   GPIPSRWKGICQNQKDATFHCNRKLVGARYFHKGYAAAVGPLNSSFDSPRDLDGHGSHTL  228

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FVPG +VFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  229   STAGGAFVPGVSVFGQGNGTAKGGSPRARVAAYKVCWPPMK-GNECYDADVLAAFDAAIH  287

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLG + P  +FNDS+AIGSFHA K  IVVV SAGN GP  G+V+N APW IT
Sbjct  288   DGADVISVSLGSE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVSNAAPWQIT  346

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++++ +A+ K  +++   DA 
Sbjct  347   VGASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGSAL---DAQ  403

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G+N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  404   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  463

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  464   PATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKP  523

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  584   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYL  642

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TYT  V +P G  V VNP  L F KVGE+++FKVTL     N    Y FG L WSDKKH
Sbjct  703   STYTVRVTNPRGVYVAVNPTSLNFTKVGEKKTFKVTLVKDKGNKAKGYVFGELVWSDKKH  762

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  763   RVRSPIVVK  771



>ref|XP_010488664.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Camelina 
sativa]
Length=772

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/729 (61%), Positives = 550/729 (75%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ +H+  LG++ GS +KA D IFYSYT+HINGFAA L+ + A  I+K+PEV+SVF 
Sbjct  50    MDRVRETHYDFLGSFTGSREKATDDIFYSYTKHINGFAAHLDHDLAYAISKHPEVVSVFP  109

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  110   NKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKARFGEDTIIANLDTGVWPESKSFRDEGL  168

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  169   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFDSPRDLDGHGSHTL  228

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FVPG +VFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  229   STAGGAFVPGVSVFGQGNGTAKGGSPRARVAAYKVCWPPIK-GNECYDADVLAAFDAAIH  287

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLG + P  +FNDS+AIGSFHA K  IVVV SAGN GP  G+V+N APW IT
Sbjct  288   DGADVISVSLGSE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVSNAAPWQIT  346

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++++ +A+ K  +++   DA 
Sbjct  347   VGASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGSAL---DAQ  403

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G+N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  404   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  463

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  464   PATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKP  523

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  584   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYL  642

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ++YT  V  P G  V VNP  L F KVGE+++FKVTL     N    Y FG L WSDKKH
Sbjct  703   SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKH  762

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  763   RVRSPIVVK  771



>ref|XP_004251819.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=772

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/730 (60%), Positives = 553/730 (76%), Gaps = 7/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D DRV + HH+ LG +L S +KA++AIFYSYTRHINGFAA+LE+EEA E++K+P+VIS+
Sbjct  43    IDFDRVINFHHEFLGLHLRSIEKAKEAIFYSYTRHINGFAAILEDEEAEELSKHPKVISI  102

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ ++L TTRSW FLGLE EG  I   S+WKKA+FGED IIGN+D+GVWPES+SFS+E
Sbjct  103   FLNKGKELHTTRSWNFLGLEHEGK-IPKNSLWKKARFGEDIIIGNIDSGVWPESESFSDE  161

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPL-NSSFFTPRDVIGHGS  1824
             G GPIP RWKG CQ   D +F CNRKLIGARYFI+G+++  G L  S F+TPRD +GHGS
Sbjct  162   GMGPIPSRWKGTCQTGSDPTFRCNRKLIGARYFIKGFAAEAGALVTSKFYTPRDTLGHGS  221

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGNFV GAN+FG GNGTAKGGSP+ARVA+YK CWPP  P + C DAD+LA FD 
Sbjct  222   HTLSTAGGNFVEGANIFGYGNGTAKGGSPRARVASYKACWPPIIPSDSCTDADVLAAFDM  281

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLS+S+GG  P PY  DS+AIGSFHA+K GIVVV S GN G   G++ N APW
Sbjct  282   AIHDGVDVLSLSMGG-LPVPYAQDSIAIGSFHAMKRGIVVVTSGGNSGAYPGTIANTAPW  340

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             LITVGA+T+DR F S +VLGN K Y G S     LP GK +P+++ ASA++   A+ + +
Sbjct  341   LITVGASTIDREFSSYIVLGNNKRYRGVSLSSKALPKGKSFPIITGASAKV---ANATAE  397

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             +A  C  GTLDP+K KG +LVC +G +    K  +A   GAVG+++ N    G+E+ A+ 
Sbjct  398   EANFCIEGTLDPKKAKGTILVCHRGGSAAFSKCIQATSVGAVGIVILNSAFFGDEMYAEP  457

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             +  PAT ++YSDGL +  Y++ TR   A+IT P T LG KPAPV+A+FSS GPN + P+I
Sbjct  458   YLCPATFISYSDGLQVSSYVSSTRKATAYITRPTTELGTKPAPVMASFSSIGPNRVTPEI  517

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+++AA+T   GP+D++ D R V FN  +GTSMSCPHVAGVVGLLK+L+P+
Sbjct  518   LKPDITAPGVSILAAYTGVQGPADSELDNRRVKFNTMTGTSMSCPHVAGVVGLLKSLHPT  577

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMT+A  R N+   +T+  T LK +PFAYG+GHI PN A DPGLVYDL + 
Sbjct  578   WSPAAIKSAIMTSARTRDNTINPMTNS-THLKVSPFAYGSGHIWPNRAMDPGLVYDLTID  636

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY+NF+CAQGYN+T+I+      +KCPD IS S  N PSITVP LKG+  VTRTLKNVG+
Sbjct  637   DYMNFLCAQGYNETQISFFTQGHFKCPDPISFSNLNLPSITVPKLKGSIVVTRTLKNVGT  696

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A +RSP+G +V V P  L+F K+GEE+SFK+TLK  G+ A  DY FG L WSD K
Sbjct  697   PGTYKAHIRSPIGITVVVEPNTLEFRKIGEEKSFKITLKVNGQKAPKDYVFGHLIWSDNK  756

Query  203   HRVRSPIVVK  174
             H VRSPIVVK
Sbjct  757   HYVRSPIVVK  766



>ref|XP_010488663.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Camelina 
sativa]
Length=772

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/729 (61%), Positives = 549/729 (75%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRV+ +H+  LG++ GS +KA D IFYSYT+HINGFAA L+ + A  I+K+PEV+SVF 
Sbjct  50    MDRVRETHYDFLGSFTGSREKATDDIFYSYTKHINGFAAHLDHDLAYAISKHPEVVSVFP  109

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  110   NKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKARFGEDTIIANLDTGVWPESKSFRDEGL  168

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  169   GPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFDSPRDLDGHGSHTL  228

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FVPG +VFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  229   STAGGAFVPGVSVFGQGNGTAKGGSPRARVAAYKVCWPPIK-GNECYDADVLAAFDAAIH  287

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLG + P  +FNDS+AIGSFHA K  IVVV SAGN GP  G+V+N APW IT
Sbjct  288   DGADVISVSLGSE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVSNAAPWQIT  346

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++++ +A+ K  +++   DA 
Sbjct  347   VGASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGSAL---DAQ  403

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G+N R+EK    ALAG VGM+L N   +GN++ AD H L
Sbjct  404   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  463

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  464   PATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKP  523

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  584   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYL  642

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ++YT  V  P G  V VNP  L F KVGE+++FKVTL     N    Y FG L WSDKKH
Sbjct  703   SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKH  762

Query  200   RVRSPIVVK  174
             RVRSPIV K
Sbjct  763   RVRSPIVAK  771



>ref|XP_010063228.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X1 [Eucalyptus 
grandis]
Length=778

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/739 (61%), Positives = 556/739 (75%), Gaps = 20/739 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             +++   +SH+ LLG+YLGS +KA++AIFYSYT HINGFAA+L+E++AAE+AK+P+V+SVF
Sbjct  47    EIESATNSHYDLLGSYLGSNEKAQEAIFYSYTHHINGFAAILDEDQAAEVAKHPDVLSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++ R+L TTRSW FLGLE   GVIH  SI +KA+FGEDTIIGNLDTGVWPESKSFS+EG
Sbjct  107   LSKGRKLHTTRSWHFLGLE-RNGVIHKNSILRKARFGEDTIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +W+GICQ      F CNRKLIGARYF +GY++  G LNS+F+T RD  GHGSHT
Sbjct  166   MGPIPGKWRGICQRGIKDGFSCNRKLIGARYFNKGYAAYAGLLNSTFYTARDHDGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED--CYDADILAGFDR  1644
             LSTAGG+ VPGA+VFG GNGT+KGGSPKARV AYKVCWPP    ED  C+DAD+LAGFD 
Sbjct  226   LSTAGGSLVPGASVFGYGNGTSKGGSPKARVVAYKVCWPPL---EDVGCFDADVLAGFDA  282

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVSL GD P  +F D + IGSFHA +NGIVVV+SAGN GP  G+V NVAPW
Sbjct  283   AISDGVDVLSVSL-GDEPAEFFMDGIVIGSFHAARNGIVVVSSAGNSGPQPGTVLNVAPW  341

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F + + LGNK+H  G S    +LP+ KFYPL+S A A+    A++S  
Sbjct  342   MITVAASTIDREFTTYIALGNKQHLKGSSLSANELPSNKFYPLISGADAQA---ANVSAA  398

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             +AL CK GTLD +KVKGK+L CL  +N RI    +AALAGAVGM+LANDE +GN+++ADA
Sbjct  399   EALLCKAGTLDRKKVKGKILACLLVDNKRIVVGQQAALAGAVGMVLANDEANGNDVVADA  458

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA H+++ DG  +F YIN T  P+A+IT   T+L   PAP +A+FSSRGPN + P I
Sbjct  459   HVLPAAHISFVDGKVLFAYINSTAFPMAYITRVKTMLNTTPAPFMASFSSRGPNIVEPAI  518

Query  923   LK---------PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVV  771
             LK         PDI+APG+N+IAA+T A GP+  D+DKR   F+ ESGTSMSCPHVAG+V
Sbjct  519   LKHLIVVGVLQPDITAPGLNIIAAYTLAVGPAGQDFDKRKTPFSAESGTSMSCPHVAGIV  578

Query  770   GLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADP  591
             GLLKTLYPSWSPA I+SAIMTTA  R N  + + D     K TPF+YGAGHI PN A +P
Sbjct  579   GLLKTLYPSWSPAAIQSAIMTTARTRDNKLEPMLDASFA-KATPFSYGAGHIRPNRAMNP  637

Query  590   GLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATV  411
             GLVYDL   DY++F+CA+GYN++++       ++CP H   S  NYPSITVP L GT  V
Sbjct  638   GLVYDLTANDYLDFLCARGYNESQLRLFTNETHRCPKHFKTSDLNYPSITVPDLNGTMVV  697

Query  410   TRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAF  231
             TR +KNVG+P TY+A +++P G S++V P+ LKFEK GEE+ FKV LK K      D+ F
Sbjct  698   TRRMKNVGTPGTYSAHIKAPAGVSLSVQPQNLKFEKCGEEKEFKVVLKPKVAGKPVDHVF  757

Query  230   GVLTWSDKKHRVRSPIVVK  174
             G L WSD  H VRSP+VVK
Sbjct  758   GKLIWSDGVHYVRSPLVVK  776



>ref|NP_565309.2| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 sp|Q9ZSP5.1|AIR3_ARATH RecName: Full=Subtilisin-like protease SBT5.3; AltName: Full=Auxin-induced 
in root cultures protein 3; AltName: Full=Subtilase 
subfamily 5 member 3; Short=AtSBT5.3; AltName: Full=Subtilisin-like 
protease AIR3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD12260.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEC05801.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=772

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/729 (61%), Positives = 549/729 (75%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRVK +H+  LG++ GS ++A DAIFYSYT+HINGFAA L+ + A EI+K+PEV+SVF 
Sbjct  50    MDRVKETHYDFLGSFTGSRERATDAIFYSYTKHINGFAAHLDHDLAYEISKHPEVVSVFP  109

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  110   NKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKARFGEDTIIANLDTGVWPESKSFRDEGL  168

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVG LNSSF +PRD+ GHGSHTL
Sbjct  169   GPIPSRWKGICQNQKDATFHCNRKLIGARYFNKGYAAAVGHLNSSFDSPRDLDGHGSHTL  228

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G+FVPG ++FG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  229   STAAGDFVPGVSIFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  287

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  +FNDS+AIGSFHA K  IVVV SAGN GP   +V+NVAPW IT
Sbjct  288   DGADVISVSLGGE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPADSTVSNVAPWQIT  346

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++++ +A+ K   + S  DA 
Sbjct  347   VGASTMDREFASNLVLGNGKHYKGQSLSSTALPHAKFYPIMASVNAKAK---NASALDAQ  403

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP K KGK+LVCL+G+N R+EK    AL G +GM+L N   +GN+++AD H L
Sbjct  404   LCKLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVL  463

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T  D  A+  YI++T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  464   PATQLTSKDSFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKP  523

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT+  +    I  + T +K TPF++GAGH+ PN A +PGLVYDL + DY+
Sbjct  584   AAIRSAIMTTATIMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYL  642

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C    ISL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             + YT  V +P G  V V P  L F KVGE+++FKV L     N    Y FG L WSDKKH
Sbjct  703   SMYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGELVWSDKKH  762

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  763   RVRSPIVVK  771



>ref|XP_008218932.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/734 (62%), Positives = 551/734 (75%), Gaps = 14/734 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLD V +SH+ LLG+ LGS ++A++AIFYSY R+INGFAA+L++EEAA+IA++P V+SV
Sbjct  46    VDLDSVTNSHYNLLGSVLGSNERAQEAIFYSYNRNINGFAAILDDEEAAQIARDPNVLSV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR R+L TTRSW+FLGLE E G +  GSIWKKA+FG +TIIGNLDTGVWPESKSFS+E
Sbjct  106   FPNRGRKLHTTRSWDFLGLE-ENGEVRRGSIWKKAQFGANTIIGNLDTGVWPESKSFSDE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-----TPRDVI  1836
             G GPIP +W+GICQ       HCNRKLIGARYF +GY +    +NSS         RD  
Sbjct  165   GIGPIPSKWRGICQLDTKNGSHCNRKLIGARYFSKGYLAYASTVNSSAAKTIQPNARDFG  224

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHGSHTLSTA GNFVP A+VFG GNGTAKGGSPKARVAAYKVCWPP + G +C+DADI+A
Sbjct  225   GHGSHTLSTAAGNFVPRASVFGNGNGTAKGGSPKARVAAYKVCWPPIN-GNECFDADIMA  283

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
              FD AI DGVDVLSVSLGG     +F+D +AIGSFHAVK GI VV+SAGN GP  G+V+N
Sbjct  284   AFDAAISDGVDVLSVSLGG-QAAEFFSDGIAIGSFHAVKKGISVVSSAGNSGPTPGTVSN  342

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             V+PWL+TVGA+T+DR F S V LGNKKH  G S     LP+  FYPL+SA   +    A+
Sbjct  343   VSPWLLTVGASTIDREFSSYVALGNKKHLKGASLSSGALPSKMFYPLISAVDGKA---AN  399

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
              S+ DA  CK G+L+ +KV+GK+LVC++GEN R +K  +A LAGAVGMIL ND+ SGNEI
Sbjct  400   ASSSDAQLCKAGSLEKKKVEGKILVCIRGENARADKGQQAVLAGAVGMILVNDKLSGNEI  459

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             IAD H LP +HV YSDG A+F YI  T+ PVA++T   T +G KPAP +A+FSSRGPN I
Sbjct  460   IADPHLLPTSHVNYSDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPAPFMASFSSRGPNTI  519

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
                ILKPDI+APGV++IAA+T A GP+D  +DKR VSFN ESGTSMSCPHV+G+VGLLKT
Sbjct  520   EQSILKPDITAPGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSMSCPHVSGIVGLLKT  579

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+PSWSPA I+SAIMTTA  R N+ +A+ D     + TPFAYGAGH+ PN A DPGLVYD
Sbjct  580   LHPSWSPAAIKSAIMTTARKRDNNKEAMQDSSKA-RATPFAYGAGHVQPNRAMDPGLVYD  638

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTL  399
             L   DY+NF+CA+GYN T +      P+ CP   SL+ FNYPS+TVP L      VTR +
Sbjct  639   LTTDDYLNFLCARGYNATLLKVFSNEPHTCPKAYSLADFNYPSVTVPDLHDKPVAVTRRV  698

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLT  219
             KNVGSP TY   ++ P G SV+V P  L+F+ VGEE+ FKV LK K +  T DY FG L 
Sbjct  699   KNVGSPGTYVVHIKEPAGVSVSVKPSSLQFKTVGEEKKFKVVLKPKVQ-GTQDYVFGELN  757

Query  218   WSDKKHRVRSPIVV  177
             WSD KH VRSPIVV
Sbjct  758   WSDGKHNVRSPIVV  771



>ref|XP_010466978.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=773

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/730 (61%), Positives = 549/730 (75%), Gaps = 9/730 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D+DRV+  H+  LG++ GS +KA D IFYSYT+HINGFAA L+ + A  I+K+PEV+SVF
Sbjct  50    DMDRVREIHYDFLGSFTGSREKATDDIFYSYTKHINGFAAHLDHDLAYAISKHPEVVSVF  109

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+A +L TTRSW+FLGLE     +   SIW+K +FGEDTII NLDTGVWPESKSF +EG
Sbjct  110   PNKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKTRFGEDTIIANLDTGVWPESKSFRDEG  168

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHT
Sbjct  169   LGPIPSRWKGICQNQKDATFHCNRKLIGARYFHKGYAAAVGPLNSSFDSPRDLDGHGSHT  228

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG FVPG +VFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI
Sbjct  229   LSTAGGAFVPGVSVFGQGNGTAKGGSPRARVAAYKVCWPPIK-GNECYDADVLAAFDAAI  287

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DG DV+SVSLG + P  +FNDS+AIGSFHA K  IVVV SAGN GP  G+V+N APW I
Sbjct  288   HDGADVISVSLGSE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVSNAAPWQI  346

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++++ +A+ K  +++   DA
Sbjct  347   TVGASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGSAL---DA  403

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               CK G+LDP+K KGK+LVCL+G+N R+EK    ALAG VGM+L N   +GN++ AD H 
Sbjct  404   QLCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHV  463

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILK
Sbjct  464   LPATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILK  523

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWS
Sbjct  524   PDITAPGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWS  583

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGLVYD  + DY
Sbjct  584   PAAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDY  642

Query  557   VNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGS  384
             +NF+C+ GY+ ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+K V  
Sbjct  643   LNFLCSLGYHASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKTVER  702

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P+TYT  V +P G  VTVNP  L F KVGE+++FKVTL     N    Y FG L WSDKK
Sbjct  703   PSTYTVRVTNPRGVYVTVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKK  762

Query  203   HRVRSPIVVK  174
             HRVRSPIVVK
Sbjct  763   HRVRSPIVVK  772



>ref|XP_010252985.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
 ref|XP_010252986.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=777

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/738 (64%), Positives = 560/738 (76%), Gaps = 13/738 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DLD V+HSH + LG++LGS+ KA DAIFYSY RHINGFAA LEEEEAAEIAKNP VISV
Sbjct  46    LDLDEVRHSHCEFLGSFLGSYKKAEDAIFYSYKRHINGFAATLEEEEAAEIAKNPRVISV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN  R+L TTRSW+FLGL+     I   SIW KA+FGEDTIIGNLDTGVWPESKSFS++
Sbjct  106   FLNEGRKLHTTRSWDFLGLQERDSSISSESIWSKARFGEDTIIGNLDTGVWPESKSFSDD  165

Query  2000  GFGPIPKRWKGICQNQ--KDKSFHCNRKLIGARYFIQGYSSAVGPLNSS---FFTPRDVI  1836
             G+GPIP +WKG CQ          CNRKLIGARYF +GY+SA G L  S     T RD  
Sbjct  166   GYGPIPPKWKGFCQQSGTNKDVVRCNRKLIGARYFNKGYASAAGTLLKSSLTLATARDDD  225

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTLSTAGGNFVPGANV G GNGTAKGG+P+ARVAAY+VCWPP + G +CYDADILA
Sbjct  226   GHGTHTLSTAGGNFVPGANVLGFGNGTAKGGAPRARVAAYRVCWPPIN-GSECYDADILA  284

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
              FD AI DGVD++SVSLGG  P  YF D ++IG+FHAVKNGIVVV SAGN GP AGSV+N
Sbjct  285   AFDAAIHDGVDIISVSLGG-APSDYFQDGISIGAFHAVKNGIVVVTSAGNSGPDAGSVSN  343

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             V+PWL TVGA+T+DR F   V LGNK    G+S     LP  K+YPL+S A A+    A+
Sbjct  344   VSPWLFTVGASTIDREFPVYVKLGNKVQLKGQSLSASSLPAAKYYPLISGAKAK---AAN  400

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
              S +DAL CK GTLDPEKVKGK+L CL+G N R++K  +AALAGAVGMILANDE +GNEI
Sbjct  401   ASAKDALLCKAGTLDPEKVKGKILACLRGVNGRVQKGIQAALAGAVGMILANDEINGNEI  460

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             I D H LPA H+ Y DGL +F YIN T++P+A+IT P T + VKPAP +A+FSSRGPN I
Sbjct  461   IVDTHVLPAAHIIYKDGLDLFAYINSTKSPIAYITRPVTQMAVKPAPFMASFSSRGPNTI  520

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
              P+ILKPDI+APGV++IAA+T+ATGP+    D+R V FN ESGTSMSCPHVAG+ GLLKT
Sbjct  521   TPEILKPDITAPGVSIIAAYTQATGPTGEKSDERRVQFNSESGTSMSCPHVAGISGLLKT  580

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+P WSP+ IRSAIMT+A  R N  + + +    +K  PF YGAGH+ PN A DPGLVYD
Sbjct  581   LHPDWSPSAIRSAIMTSARTRDNKREPMLNSSY-VKANPFDYGAGHVRPNRAMDPGLVYD  639

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLK  396
             L + DY+NF+CA GYN+T+I +    PY+CP+H+ L  FNYPSITVP L G  T++RT+K
Sbjct  640   LTVKDYLNFLCALGYNETKIKSFWEEPYECPNHVRLLDFNYPSITVPRLSGPTTISRTVK  699

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSF--KVTLKAKGENATADYAFGVL  222
             NVG+P TY A  R P G SV+V P  LKF+K+GEE+SF   + LKAK   A ++Y FG L
Sbjct  700   NVGTPGTYKARFRPPPGISVSVEPLTLKFDKLGEEKSFKLTLKLKAKKAPAASNYVFGRL  759

Query  221   TWSDKKHRVRSPIVVKTA  168
              WSD  H VRSPIVVK A
Sbjct  760   IWSDGNHYVRSPIVVKAA  777



>ref|XP_008353281.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=773

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/733 (63%), Positives = 555/733 (76%), Gaps = 15/733 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLD V +SH+ LLGT LGS ++A++AIFYSYTR+INGFAA+L++EEA +I K+P V+SVF
Sbjct  47    DLDSVTNSHYNLLGTVLGSNERAQEAIFYSYTRNINGFAAILDDEEAVQIEKDPNVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NR R+L TTRSW+FLGLE E G    GSI KKA+FG +TIIGNLDTGVWPESKSFS+EG
Sbjct  107   PNRGRKLHTTRSWDFLGLE-ENGETRPGSILKKARFGANTIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-----TPRDVIG  1833
              GPIP +W+GICQ  K+ S  CNRKLIGARYF +GY +    +NS+         RD  G
Sbjct  166   MGPIPSKWRGICQLTKNGS-RCNRKLIGARYFSKGYLAYASMVNSTAAKSIQPNARDYAG  224

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFVP A+VFG GNGTAKGGSPKARVAAYKVCWPP +  E C+DADILA 
Sbjct  225   HGSHTLSTAGGNFVPRASVFGNGNGTAKGGSPKARVAAYKVCWPPINDNE-CFDADILAA  283

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLGG+    +FND +AIGSFHAVK GI VV+SAGN GP  GSV+NV
Sbjct  284   FEAAISDGVDVLSVSLGGEAV-EFFNDGIAIGSFHAVKKGITVVSSAGNSGPTPGSVSNV  342

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
             APW++TVGA+T+DR F + V LGNKKH  G S     LP  KFYPL+SA+ A+   NAS 
Sbjct  343   APWMLTVGASTIDREFSNYVALGNKKHLKGASLSSTGLPAEKFYPLISASDAK-ATNASA  401

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +A  CKP TLD +K +GK+LVC++GEN R  K  +A LAGAVGMIL ND+ SGNEII
Sbjct  402   S--EAQLCKPSTLDKKKAEGKILVCVRGENARANKGQQAILAGAVGMILVNDKLSGNEII  459

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
             AD H LPA+HV +SD  ++F YI  T+ P+A+IT   T LG KPAP +A+FSSRGPN + 
Sbjct  460   ADPHLLPASHVNFSDXESVFAYIKSTKIPMAYITRVKTELGTKPAPFMASFSSRGPNPVE  519

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
               ILKPDI+APGV++IAA+T+ATGP+D ++D R V FN ESGTSMSCPHV+G+VGLLKTL
Sbjct  520   QSILKPDITAPGVSIIAAYTQATGPTDGEFDTRRVPFNTESGTSMSCPHVSGIVGLLKTL  579

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P+W+PA I+SAIMTTA  R N+ K    D +  + TPFAYGAGH+ PN A DPGLVYDL
Sbjct  580   HPTWTPAAIKSAIMTTARKRDNN-KGTMLDSSKARATPFAYGAGHVQPNXAMDPGLVYDL  638

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLK  396
                DY+NF+CA+GYN T +      P+KCP   SLS FNYPSITVP+L+ T  TVTR +K
Sbjct  639   TTDDYLNFLCARGYNATLLKVFSKEPHKCPKAYSLSDFNYPSITVPNLRDTPVTVTRRVK  698

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NVGSP TY   V+ PVG SVTV P  L+F+  GEE+ FKV LKA+ +    DY FG L W
Sbjct  699   NVGSPGTYVVRVKEPVGVSVTVKPGTLQFKSNGEEKKFKVVLKARVQ-GPQDYIFGELNW  757

Query  215   SDKKHRVRSPIVV  177
             +D KH VRSPIVV
Sbjct  758   TDGKHNVRSPIVV  770



>gb|KDO78650.1| hypothetical protein CISIN_1g048642mg [Citrus sinensis]
Length=782

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/733 (62%), Positives = 548/733 (75%), Gaps = 11/733 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  SHH+ LG++LGS +KARDAIFYSY  HINGFAA LEEEEAAEIAK+P+V+S+F
Sbjct  50    DLDRVTDSHHEFLGSFLGSTEKARDAIFYSYQNHINGFAATLEEEEAAEIAKHPDVVSIF  109

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ ++L TTRSW+F+ LE  G VIH  S W K +FGED II NLDTGVWPESKSFS+EG
Sbjct  110   PNKGKKLHTTRSWDFMLLENNG-VIHSSSAWGKGRFGEDIIIANLDTGVWPESKSFSDEG  168

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF---TPRDVIGHG  1827
             +GP+P RWKG CQN   +   CNRKLIGARYF + Y++ V   N S     T RD  GHG
Sbjct  169   YGPVPSRWKGTCQNSTKEGVRCNRKLIGARYFNRAYAAYVKQHNISVNFNNTARDHEGHG  228

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             +HTLSTAGGN VPG NVFG+GNGTAKGGSPKARVAAYKVCWP  S G+ C+DADIL GFD
Sbjct  229   THTLSTAGGNLVPGVNVFGMGNGTAKGGSPKARVAAYKVCWPQVSDGQ-CFDADILKGFD  287

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDV+SVSLGGD P  YFND  AIG+FHAVK+GIVVV SA N GP  G+V NV+P
Sbjct  288   MAIHDGVDVISVSLGGD-PADYFNDGTAIGAFHAVKHGIVVVCSAANSGPELGTVTNVSP  346

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W+ITVGA+T+DR FQ+ V L N + + G S +   LP   FYPL++   A+    A+   
Sbjct  347   WIITVGASTLDREFQNFVELRNGQRFKGTS-LSKSLPNDTFYPLITGLQAKA---ANADD  402

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
               A  CK G LD EKVKGK+LVCL+G+  R++K  +AA+AGAVGMIL ND+ SGNEI AD
Sbjct  403   TAASLCKNGALDHEKVKGKILVCLRGDTARVDKGRQAAVAGAVGMILCNDKSSGNEITAD  462

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              HFLPA+ +TY DG+ + DYI  + NP+ +IT P+T L  KP+P +A+FSS GPN I P+
Sbjct  463   PHFLPASQITYKDGVKVLDYIKSSDNPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPE  522

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGVN+IAAFT A G ++  YD R + +N+ SGTSMSCPHVAGVVGLLKT +P
Sbjct  523   ILKPDITAPGVNIIAAFTGAIGATELPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHP  582

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSP+ IRSAIMTTA  R N+   + D  +  K TPF+YG+GHI PN A DPGLVYDL  
Sbjct  583   DWSPSAIRSAIMTTARTRDNTANPMRDG-SFKKATPFSYGSGHIRPNRAMDPGLVYDLSE  641

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY++F+C+ GYN+T I    GT Y+C    +L  FNYPSI+VP + G+ T++R LKNVG
Sbjct  642   DDYLDFLCSIGYNQTTIKRFFGTQYECSKSANLEDFNYPSISVPMISGSVTLSRKLKNVG  701

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP+ Y ASVR P+G SV+V PKIL F+K+GEE+SFKVTLK K   A  +Y FG LTW+D 
Sbjct  702   SPSNYAASVREPLGISVSVEPKILAFKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDG  761

Query  206   KHRVRSPIVVKTA  168
             KH VRSPIVV  A
Sbjct  762   KHYVRSPIVVNQA  774



>ref|XP_006468177.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=784

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/733 (62%), Positives = 548/733 (75%), Gaps = 11/733 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  SHH+ LG++LGS +KARDAIFYSY  HINGFAA LEEEEAAEIAK+P+V+S+F
Sbjct  52    DLDRVTDSHHEFLGSFLGSTEKARDAIFYSYQNHINGFAATLEEEEAAEIAKHPDVVSIF  111

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ ++L TTRSW+F+ LE  G VIH  S W K +FGED II NLDTGVWPESKSFS+EG
Sbjct  112   PNKGKKLHTTRSWDFMLLENNG-VIHSSSAWGKGRFGEDIIIANLDTGVWPESKSFSDEG  170

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF---TPRDVIGHG  1827
             +GP+P RWKG CQN   +   CNRKLIGARYF + Y++ V   N S     T RD  GHG
Sbjct  171   YGPVPSRWKGTCQNSTKEGVRCNRKLIGARYFNRAYAAYVKQHNISVNFNNTARDHEGHG  230

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             +HTLSTAGGN VPG NVFG+GNGTAKGGSPKARVAAYKVCWP  S G+ C+DADIL GFD
Sbjct  231   THTLSTAGGNLVPGVNVFGMGNGTAKGGSPKARVAAYKVCWPQVSDGQ-CFDADILKGFD  289

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDV+SVSLGGD P  YFND  AIG+FHAVK+GIVVV SA N GP  G+V NV+P
Sbjct  290   MAIHDGVDVISVSLGGD-PADYFNDGTAIGAFHAVKHGIVVVCSAANSGPELGTVTNVSP  348

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W+ITVGA+T+DR FQ+ V L N + + G S +   LP   FYPL++   A+    A+   
Sbjct  349   WIITVGASTLDREFQNFVELRNGQRFKGTS-LSKSLPNDTFYPLITGLQAKA---ANADD  404

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
               A  CK G LD EKVKGK+LVCL+G+  R++K  +AA+AGAVGMIL ND+ SGNEI AD
Sbjct  405   TAASLCKNGALDHEKVKGKILVCLRGDTARVDKGRQAAVAGAVGMILCNDKSSGNEITAD  464

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              HFLPA+ +TY DG+ + DYI  + NP+ +IT P+T L  KP+P +A+FSS GPN I P+
Sbjct  465   PHFLPASQITYKDGVKVLDYIKSSDNPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPE  524

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGVN+IAAFT A G ++  YD R + +N+ SGTSMSCPHVAGVVGLLKT +P
Sbjct  525   ILKPDITAPGVNIIAAFTGAIGATELPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHP  584

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSP+ IRSAIMTTA  R N+   + D  +  K TPF+YG+GHI PN A DPGLVYDL  
Sbjct  585   DWSPSAIRSAIMTTARTRDNTANPMRDG-SFKKATPFSYGSGHIRPNRAMDPGLVYDLSE  643

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY++F+C+ GYN+T I    GT Y+C    +L  FNYPSI+VP + G+ T++R LKNVG
Sbjct  644   DDYLDFLCSIGYNQTTIKRFFGTQYECSKSANLEDFNYPSISVPMISGSVTLSRKLKNVG  703

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP+ Y ASVR P+G SV+V PKIL F+K+GEE+SFKVTLK K   A  +Y FG LTW+D 
Sbjct  704   SPSNYAASVREPLGISVSVEPKILAFKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDG  763

Query  206   KHRVRSPIVVKTA  168
             KH VRSPIVV  A
Sbjct  764   KHYVRSPIVVNQA  776



>ref|XP_008384613.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=776

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/733 (62%), Positives = 548/733 (75%), Gaps = 14/733 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLD V +SH+ LLGT LGS ++A+++IFYSYTR+INGFAA+L++EEAA+IAK+P V+SVF
Sbjct  47    DLDSVTNSHYNLLGTVLGSNERAQESIFYSYTRNINGFAAILDDEEAAQIAKDPNVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NR R+L TTRSW+FL LE E G I  GSIWKKA+ G +TIIGNLDTGVWPESKSFS+EG
Sbjct  107   PNRGRKLXTTRSWDFLRLE-ENGEIRAGSIWKKARLGANTIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-----TPRDVIG  1833
              GPIP +W+GICQ        CNRKLIGARYF +GY+     +NSS         RD  G
Sbjct  166   MGPIPSKWRGICQLDTKDGSRCNRKLIGARYFSKGYAVYASTVNSSAAKSIQPNARDHAG  225

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFVP A+VFG GNGTAKGGSPKARVAAYKVCWPP   G +C+DADILA 
Sbjct  226   HGSHTLSTAGGNFVPRASVFGNGNGTAKGGSPKARVAAYKVCWPPID-GNECFDADILAA  284

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLGG+    + +D +AIGSFHAVK GI VV+SAGN GP  GSV+NV
Sbjct  285   FEAAINDGVDVLSVSLGGE-AAEFLSDGIAIGSFHAVKKGITVVSSAGNSGPTPGSVSNV  343

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
             +PW++TVGA+T+DR F S V LGNKKH  G S     LP  KFYPL+SA  A+    A+ 
Sbjct  344   SPWMLTVGASTIDREFSSYVTLGNKKHLKGASLSSTALPAKKFYPLISACDAKA---ANA  400

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +A  CKPGTLD +K KGK+LVC++G+N R  K  +A LAGAVGMIL ND+ SGNEII
Sbjct  401   SGSEAHLCKPGTLDKKKAKGKILVCVRGQNPRANKGQQAILAGAVGMILVNDKLSGNEII  460

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
             AD H LPA+HV YSDG ++  YI  T+NP+A+I    T  G KPAP +A+FSSRGPN I 
Sbjct  461   ADPHLLPASHVNYSDGKSVXAYIKSTKNPMAYINRVKTEQGTKPAPFMASFSSRGPNXIE  520

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
               ILKPDI+APGV++IAA+T+ATGP+   +D R VSFN +SGTSMSCPHV+G+VGLLKTL
Sbjct  521   QSILKPDITAPGVSIIAAYTQATGPTGQKFDNRRVSFNTQSGTSMSCPHVSGIVGLLKTL  580

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P+WSPA I+SAIMTTA+ R NS K    D +  + TPFAYGAGH+ PN A DPGLVYDL
Sbjct  581   HPTWSPAAIKSAIMTTASKRDNS-KGTMLDSSKARATPFAYGAGHVQPNRAMDPGLVYDL  639

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLK  396
                DY+NF+CA+GYN T +      P+KC    SL  FNYPSITVP+L+ T  TVTR +K
Sbjct  640   TTDDYLNFLCARGYNATLLKVFSKEPHKCSKAYSLFDFNYPSITVPNLRDTPVTVTRRVK  699

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NVGSP TY   ++ PVG SVTV P  L+F+  GEE+ FKV LK K +    DY FG L W
Sbjct  700   NVGSPGTYVVRIKEPVGVSVTVKPSTLQFKNSGEEKKFKVVLKPKVQ-GPEDYVFGELNW  758

Query  215   SDKKHRVRSPIVV  177
             +D KH VRSPIVV
Sbjct  759   TDGKHNVRSPIVV  771



>ref|XP_010063230.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
 gb|KCW70440.1| hypothetical protein EUGRSUZ_F03665 [Eucalyptus grandis]
Length=769

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/728 (62%), Positives = 563/728 (77%), Gaps = 7/728 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++ V +SH+ LLG+YLGS +KA++AIFYSYT HINGFAA+LEE+EAAEIAK+P V+SVF
Sbjct  47    DIESVTNSHYDLLGSYLGSNEKAQEAIFYSYTHHINGFAAILEEDEAAEIAKHPNVLSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++ R+L TTRSW+FLGLE +G VIH  SI  KA+FGE+TIIGNLDTGVWPESKSFS+EG
Sbjct  107   LSKGRKLHTTRSWQFLGLESDG-VIHKSSILSKARFGEETIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +W+GICQ     +F CNRKLIGARYF +GYS+  G LN +F+T RD  GHGSHT
Sbjct  166   LGPIPGKWRGICQRGIKDNFSCNRKLIGARYFNKGYSAYAGRLNYTFYTARDNQGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG++VPGANVFG GNGTA GGSP+ARV AYKVCWPP    E C+DADILAGFD AI
Sbjct  226   LSTAGGSYVPGANVFGSGNGTANGGSPRARVVAYKVCWPPIDQNE-CFDADILAGFDAAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVS+GG+    +F D +AIGSFHA +NGIVVV+SAGN GP  G+V+NVAPW+I
Sbjct  285   RDGVDVLSVSVGGE-AAEFFKDGIAIGSFHAARNGIVVVSSAGNSGPELGTVSNVAPWMI  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR F + V LG+++H  G S   + LP+ KFYPL+S A A+    A+ S   A
Sbjct  344   TVAASTIDREFTTYVALGDRQHLKGSSLSSIGLPSDKFYPLISGADAK---AANASASQA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L C  GTLDP+KVKGK+L C++GEN R+EK ++AALAGAVGMILANDE +GNE++ADAH 
Sbjct  401   LLCLAGTLDPKKVKGKILACVRGENARVEKGYQAALAGAVGMILANDEANGNELLADAHV  460

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA H++++DG  +F YIN T+ P A++T   T+L  KPAP IA+FSSRGPN + P ILK
Sbjct  461   LPAAHISFADGKILFSYINSTKFPGAYLTRVKTILNTKPAPFIASFSSRGPNMVEPAILK  520

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV++IAA+T A  P++  +DKR   FNVESGTSMSCPHV+G+VGLLKTLYPSWS
Sbjct  521   PDITAPGVDIIAAYTLAVAPTNLGFDKRRTPFNVESGTSMSCPHVSGIVGLLKTLYPSWS  580

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTTA  R N  + + D  + +K TPF+YGAGHI PN AADPGLVYDL + DY
Sbjct  581   PAAIRSAIMTTAKTRDNRNETLLDS-SFVKATPFSYGAGHIRPNRAADPGLVYDLTVKDY  639

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             ++F+CA+GY ++++       + CP H + +  NYPSIT+P+L GT  VTR ++NVG+P 
Sbjct  640   LDFLCARGYKESQLRLFTNETHICPKHFNTADLNYPSITIPNLNGTVVVTRRVRNVGTPG  699

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY+  V++P G SV+V P+ L FE+  EE+ FKV  K        DY FG LTWSD  H 
Sbjct  700   TYSVQVKAPAGVSVSVQPQSLVFERFDEEKEFKVVFKPYVAGKPVDYVFGRLTWSDGTHY  759

Query  197   VRSPIVVK  174
             VRSP+VVK
Sbjct  760   VRSPLVVK  767



>ref|XP_009394968.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/727 (61%), Positives = 547/727 (75%), Gaps = 8/727 (1%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             +RV +SH++ LG++LGS +KA+DAIFYSYT++INGFAA LEEEEA EI+K+  VISVF N
Sbjct  50    ERVVNSHYEFLGSFLGSKEKAQDAIFYSYTKYINGFAADLEEEEATEISKHAGVISVFPN  109

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
             R   L TTRSW+FLGLE   G +   SIW +++FGED IIGNLDTG WPES+SF +EG G
Sbjct  110   RGHALHTTRSWDFLGLE-RNGRVPPSSIWARSRFGEDVIIGNLDTGAWPESESFKDEGMG  168

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLS  1812
             PIP +WKGICQN  DK   CNRKLIG RYF +GY SAVG +  +  TPRD  GHG+HTLS
Sbjct  169   PIPPKWKGICQNDIDKGIRCNRKLIGLRYFNKGYRSAVGAVGLAAETPRDTDGHGTHTLS  228

Query  1811  TAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIED  1632
             TA G FVPGANVFGLGNGTAKGG+P ARVAAYKVCWPP + G +C+DADILA FD AI D
Sbjct  229   TAAGRFVPGANVFGLGNGTAKGGAPNARVAAYKVCWPPVN-GSECFDADILAAFDAAIHD  287

Query  1631  GVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITV  1452
             GV VLSVSLGG  P  YF D +AIGSFHAVK+GI VV SAGN GP +G+V+N APW++TV
Sbjct  288   GVHVLSVSLGGG-PTNYFKDGVAIGSFHAVKHGITVVCSAGNSGPKSGTVSNTAPWIVTV  346

Query  1451  GANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALH  1272
             GA+TMDR F + + L +KK   G+S  P+ LP   FYP++S+  A  +   + S + A  
Sbjct  347   GASTMDREFPAYLSLRSKKQIKGQSLSPMALPDKMFYPIISSREATAR---NASQESAKL  403

Query  1271  CKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLP  1092
             C   +LDPEKV+GK++VCL+GEN R+EK      AG +GM+LANDE +GNEIIADAH LP
Sbjct  404   CLKRSLDPEKVRGKIVVCLRGENARVEKGDVVHQAGGIGMVLANDESTGNEIIADAHVLP  463

Query  1091  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  912
             ATH++Y DGLAI  Y+N +++   +IT P T++G KPAPV+AAFSS+GPN +NP+ILKPD
Sbjct  464   ATHISYDDGLAILSYLNSSKSLFGYITSPKTIIGTKPAPVMAAFSSQGPNTVNPEILKPD  523

Query  911   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  732
             I+APGV++IAAF+EATGP+   +D R V FN ESGTSMSCPH+AG+ GLLK L+P WS +
Sbjct  524   ITAPGVSIIAAFSEATGPTGLTFDDRRVLFNSESGTSMSCPHIAGIAGLLKALHPDWSHS  583

Query  731   EIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVN  552
              I+SAIMTTA  R N  + + +  + +KT+PF+YG+GH+ PN A DPGLVYDL   DY+N
Sbjct  584   AIKSAIMTTARTRDNMKEPMFNS-SFVKTSPFSYGSGHVQPNRAMDPGLVYDLTTNDYLN  642

Query  551   FICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  375
             F+CA GYN T+I      P+ CP   + +   NYPSIT+P+L G +T+TRT+KNVG P+T
Sbjct  643   FLCALGYNSTQIATFSTEPFVCPSKPLKIEDLNYPSITIPNLSGASTITRTIKNVGLPST  702

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  195
             Y   V  P G SVTV P+ LKF+K+GEE+ F V LK K  N   +Y FG LTWSD KH V
Sbjct  703   YKVRVEEPAGVSVTVKPRKLKFKKLGEEKKFTVALKDKRSNLAREYTFGGLTWSDGKHYV  762

Query  194   RSPIVVK  174
             RSPIVVK
Sbjct  763   RSPIVVK  769



>gb|KFK31799.1| hypothetical protein AALP_AA6G160400 [Arabis alpina]
Length=774

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/729 (60%), Positives = 544/729 (75%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             + RV+ +H+  LG++ GS + A DAIFYSYT+HINGFAA L+ + A  I+++PEV+SVF 
Sbjct  52    MARVRETHYDFLGSFTGSREGATDAIFYSYTKHINGFAAHLDHDLALAISQHPEVVSVFP  111

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+  +L TTRSW+FLGLE    ++   SIW+KA+FGED+II NLDTGVWPESKSF +EG 
Sbjct  112   NKGLKLHTTRSWDFLGLE-HNSLVPSSSIWRKARFGEDSIIANLDTGVWPESKSFRDEGL  170

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQN +D +F CN+KLIGARYF +GY++AVGPLNSSF +PRD+ GHGSHTL
Sbjct  171   GPIPSRWKGICQNHQDATFQCNKKLIGARYFHKGYAAAVGPLNSSFDSPRDLDGHGSHTL  230

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G FVPGA+VFG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  231   STAAGAFVPGASVFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  289

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+    +FNDS+AIGSFHA K  IVVV SAGN GP  G+V NVAPW IT
Sbjct  290   DGADVISVSLGGE-ASSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVTNVAPWQIT  348

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN++LGN KHY G+S     LP  KFYP++SA  A+ K   ++S  DA 
Sbjct  349   VGASTMDREFASNLILGNGKHYKGQSLSSSALPHAKFYPIMSALGAKAK---NVSALDAQ  405

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP+K KGK+LVCL+G+N R+EK     LAG VGM+L N   +GN++ AD H L
Sbjct  406   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVVLAGGVGMVLDNSNLNGNDLTADPHVL  465

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T  D LA+  YI +T+ P+AHIT   T+LG KPAPV+A+FSS+GP+ + P ILKP
Sbjct  466   PATQLTLKDSLALARYITQTKKPIAHITPARTVLGTKPAPVMASFSSKGPSKLAPQILKP  525

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  526   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAVSGTSMSCPHISGIAGLLKTRYPSWSP  585

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ P+ A +PGLVYDL + DY+
Sbjct  586   AAIRSAIMTTATTMDDIPGPI-QNSTNMKATPFSFGAGHVRPSLAVNPGLVYDLGIRDYL  644

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTA-TVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L     TV+RT+KNVG P
Sbjct  645   NFLCSLGYNASQISVFSGKHFTCSSPKTSLFNLNYPSITVPNLSSRKFTVSRTVKNVGRP  704

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TYT  V +P G  V V P  LKF KVGE+++F+VTL     N    Y FG L WSDKKH
Sbjct  705   STYTVQVDNPEGVVVAVKPTSLKFTKVGEQKTFRVTLVKHNGNVAKGYVFGKLVWSDKKH  764

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  765   RVRSPIVVK  773



>gb|AAC62611.1| subtilisin-like protease, partial [Arabidopsis thaliana]
Length=758

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/729 (60%), Positives = 545/729 (75%), Gaps = 9/729 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRVK +H+  LG++ GS ++A DAIFYSYT+HINGFAA L+ + A EI+K+PEV+SVF 
Sbjct  36    MDRVKETHYDFLGSFTGSRERATDAIFYSYTKHINGFAAHLDHDLAYEISKHPEVVSVFP  95

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  96    NKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKARFGEDTIIANLDTGVWPESKSFRDEGL  154

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVG LNSSF +PRD+ GHGSHTL
Sbjct  155   GPIPSRWKGICQNQKDATFHCNRKLIGARYFNKGYAAAVGHLNSSFDSPRDLDGHGSHTL  214

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G+FVPG ++FG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  215   STAAGDFVPGVSIFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  273

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  +FNDS+AIGSFHA K  IVVV SAGN GP   +V+NVAPW IT
Sbjct  274   DGADVISVSLGGE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPADSTVSNVAPWQIT  332

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++++ +A+ K   + S  DA 
Sbjct  333   VGASTMDREFASNLVLGNGKHYKGQSLSSTALPHAKFYPIMASVNAKAK---NASALDAQ  389

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP K KGK+LVCL+G+N R+EK    AL G +GM+L N   +GN+++AD H L
Sbjct  390   LCKLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVL  449

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             P+T +T  D  A+  Y+ +T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  450   PSTQLTSKDSFAVSRYMTQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKP  509

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  510   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  569

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT   +    I  + T +K TPF++GAGH+ PN A +PGLVYDL + DY+
Sbjct  570   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYL  628

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C    ISL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  629   NFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  688

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             + YT  V +P G  V + P  L F KVGE ++FKV L     N    Y FG L WS KKH
Sbjct  689   SMYTVKVNNPHGVYVALKPTSLNFTKVGELKTFKVILVKSKGNVAKGYMFGELVWSAKKH  748

Query  200   RVRSPIVVK  174
             RVRSPIVVK
Sbjct  749   RVRSPIVVK  757



>ref|XP_009339280.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=815

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/733 (62%), Positives = 547/733 (75%), Gaps = 14/733 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLD V +SH+ LLGT LGS ++A+++IFYSYTR+INGFAA+L++EEAA+IA++P V+SVF
Sbjct  86    DLDSVTNSHYNLLGTVLGSNERAQESIFYSYTRNINGFAAILDDEEAAQIAEDPNVVSVF  145

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NR R L TTRSW+FL LE E G I  GSIWK A+ G +TIIGNLDTGVWPESKSFS+EG
Sbjct  146   PNRGRTLHTTRSWDFLQLE-ENGEIRAGSIWKNARLGANTIIGNLDTGVWPESKSFSDEG  204

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-----TPRDVIG  1833
              GPIP +W+GICQ        CNRKLIGARYF +GY++    +NS+         RD  G
Sbjct  205   MGPIPVKWRGICQLDTKDVSRCNRKLIGARYFSKGYAAYASMVNSTAAKSIQPNARDHSG  264

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFVP  +VFG GNGTAKGGSPKARVAAYKVCWPP + G +C+DADILA 
Sbjct  265   HGSHTLSTAGGNFVPRVSVFGNGNGTAKGGSPKARVAAYKVCWPPIN-GNECFDADILAA  323

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLGG     + +D +AIGSFHAV+ GI VV+SAGN GP  GSV+NV
Sbjct  324   FEAAINDGVDVLSVSLGG-AAAEFLSDGIAIGSFHAVQKGITVVSSAGNSGPTPGSVSNV  382

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
             +PW++TVGA+T+DR F S V LGNKKH  G S     LP  KFYPL+SA  A+    A+ 
Sbjct  383   SPWMLTVGASTIDREFTSYVTLGNKKHLKGASLSSAALPAKKFYPLISACDAKA---ANA  439

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +A  CKPGTLD +K KGK+LVC++G+N R +K  +A LAGAVGMIL ND+ SGNEII
Sbjct  440   SGSEAHLCKPGTLDKKKAKGKILVCVRGQNPRADKGQQAILAGAVGMILVNDKLSGNEII  499

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
             AD H LPA+HV YSDG ++F Y+  T+NP+A+I    T  G KPAP +A+FSSRGPNAI 
Sbjct  500   ADPHLLPASHVNYSDGKSVFAYMKSTKNPMAYINRVKTEQGTKPAPFMASFSSRGPNAIE  559

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
               ILKPDI+APGV++IAA+T+ATGP+   +D R VSFN +SGTSMSCPHV+G+VGLLKTL
Sbjct  560   QSILKPDITAPGVSIIAAYTQATGPTGQKFDNRRVSFNTQSGTSMSCPHVSGIVGLLKTL  619

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P+WSPA I+SAIMTTA+ R NS K    D +  + TPFAYGAGH  PN A DPGLVYDL
Sbjct  620   HPTWSPAAIKSAIMTTASKRDNS-KGTMLDSSKARATPFAYGAGHFQPNRAMDPGLVYDL  678

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLK  396
                DY+NF+CA+GYN T +      P+KC    SLS FNYPSITVP+L+ T  TVTR +K
Sbjct  679   TTDDYLNFLCARGYNATLLKVFSKEPHKCSKAYSLSDFNYPSITVPNLRDTPVTVTRRVK  738

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NVGSP TY   ++ PVG SVTV P  L+F+  GEE+ F V LK K +    DY FG L W
Sbjct  739   NVGSPGTYVVRIKEPVGVSVTVKPSTLQFKSSGEEKKFNVVLKPKVQ-GPEDYVFGELNW  797

Query  215   SDKKHRVRSPIVV  177
              D KH VRSPIVV
Sbjct  798   MDGKHNVRSPIVV  810



>ref|XP_010059708.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=781

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/730 (61%), Positives = 546/730 (75%), Gaps = 9/730 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
              DRV  SHH+ LG++LGS +KA++AIFYSYTRHINGFAA+LEEE+A EIAK+P VISVF 
Sbjct  54    FDRVTRSHHEFLGSFLGSREKAKEAIFYSYTRHINGFAAILEEEDALEIAKHPRVISVFP  113

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             ++ R L TT SW+F+ LE +G VI   S+W KAK GE+ IIGNLDTGVWPES+SFS+ G+
Sbjct  114   DQGRHLHTTHSWDFMLLEKDG-VIPRSSLWGKAKLGENVIIGNLDTGVWPESQSFSDPGY  172

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYS--SAVGPLNSSFFTPRDVIGHGSH  1821
             GP P +WKGIC+N       CN KLIGARYF +G++  S +  LN+S+ T RD+ GHG+H
Sbjct  173   GPPPLKWKGICENNTAAGVPCNGKLIGARYFNKGFAAYSGIKKLNASYETARDLEGHGTH  232

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GAN+FG+ NGTAKGGSP+ARVA+YKVCW P +   +CYD DILA FD A
Sbjct  233   TLSTAGGNFVYGANIFGVANGTAKGGSPRARVASYKVCWTPVNNSGECYDTDILAAFDMA  292

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG  PG YF D L+IGSFHAVK GI VV SAGN GPVAGSV NV+PW+
Sbjct  293   IHDGVDVLSVSLGG-LPGEYFKDGLSIGSFHAVKQGIAVVCSAGNSGPVAGSVANVSPWI  351

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLK--LPTGKFYPLLSAASARIKINASIST  1287
             +TVGA+T+DR F++ V L    H T      L   LP  KFYPL++ A A+    A+ S 
Sbjct  352   LTVGASTLDREFEAFVELPIGVHGTRLKGTSLSKPLPEDKFYPLITGAQAKA---ANASV  408

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
              D++ CKPGTLDP+K KGK++VCL+G+  R++K  ++  AGAVGMIL ND  SGNEIIAD
Sbjct  409   NDSMLCKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVGMILCNDVLSGNEIIAD  468

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPA+ +TY DGL +F YIN T NPV  IT P   L  KPAP +AAFSSRGPN + P+
Sbjct  469   PHLLPASQLTYKDGLQVFAYINSTANPVGFITAPTAKLNTKPAPFMAAFSSRGPNLVTPE  528

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPD++APGVN+IAAF+EA  P+D D+D R V FN ESGTSMSCPHVAGVVGLL+ L+P
Sbjct  529   ILKPDVTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSMSCPHVAGVVGLLRALHP  588

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WS + IRSAIMTTA  R N+ +A+ D  + L+ TPF +G+GH+ PN A DPGLVYDL  
Sbjct  589   DWSVSAIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGHMRPNRAMDPGLVYDLST  648

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              +Y +F+CA GYN+T + +    PY+CP   SL  FNYPSI VP+L G+ATVTR +KNVG
Sbjct  649   DNYFDFLCALGYNRTLMRSFSKDPYECPKSFSLLDFNYPSIMVPNLHGSATVTRRVKNVG  708

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP TY A V  P G SV+V P+ L F++VGEE+SFKVTLKAK      +Y FG L WSD 
Sbjct  709   SPGTYAAQVIEPPGISVSVEPRTLTFDRVGEEKSFKVTLKAKSARHATEYVFGGLRWSDG  768

Query  206   KHRVRSPIVV  177
             +H VRSPIVV
Sbjct  769   RHYVRSPIVV  778



>gb|KCW75459.1| hypothetical protein EUGRSUZ_E04225 [Eucalyptus grandis]
Length=751

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/730 (61%), Positives = 546/730 (75%), Gaps = 9/730 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
              DRV  SHH+ LG++LGS +KA++AIFYSYTRHINGFAA+LEEE+A EIAK+P VISVF 
Sbjct  24    FDRVTRSHHEFLGSFLGSREKAKEAIFYSYTRHINGFAAILEEEDALEIAKHPRVISVFP  83

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             ++ R L TT SW+F+ LE +G VI   S+W KAK GE+ IIGNLDTGVWPES+SFS+ G+
Sbjct  84    DQGRHLHTTHSWDFMLLEKDG-VIPRSSLWGKAKLGENVIIGNLDTGVWPESQSFSDPGY  142

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYS--SAVGPLNSSFFTPRDVIGHGSH  1821
             GP P +WKGIC+N       CN KLIGARYF +G++  S +  LN+S+ T RD+ GHG+H
Sbjct  143   GPPPLKWKGICENNTAAGVPCNGKLIGARYFNKGFAAYSGIKKLNASYETARDLEGHGTH  202

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GAN+FG+ NGTAKGGSP+ARVA+YKVCW P +   +CYD DILA FD A
Sbjct  203   TLSTAGGNFVYGANIFGVANGTAKGGSPRARVASYKVCWTPVNNSGECYDTDILAAFDMA  262

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG  PG YF D L+IGSFHAVK GI VV SAGN GPVAGSV NV+PW+
Sbjct  263   IHDGVDVLSVSLGG-LPGEYFKDGLSIGSFHAVKQGIAVVCSAGNSGPVAGSVANVSPWI  321

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLK--LPTGKFYPLLSAASARIKINASIST  1287
             +TVGA+T+DR F++ V L    H T      L   LP  KFYPL++ A A+    A+ S 
Sbjct  322   LTVGASTLDREFEAFVELPIGVHGTRLKGTSLSKPLPEDKFYPLITGAQAKA---ANASV  378

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
              D++ CKPGTLDP+K KGK++VCL+G+  R++K  ++  AGAVGMIL ND  SGNEIIAD
Sbjct  379   NDSMLCKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVGMILCNDVLSGNEIIAD  438

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPA+ +TY DGL +F YIN T NPV  IT P   L  KPAP +AAFSSRGPN + P+
Sbjct  439   PHLLPASQLTYKDGLQVFAYINSTANPVGFITAPTAKLNTKPAPFMAAFSSRGPNLVTPE  498

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPD++APGVN+IAAF+EA  P+D D+D R V FN ESGTSMSCPHVAGVVGLL+ L+P
Sbjct  499   ILKPDVTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSMSCPHVAGVVGLLRALHP  558

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WS + IRSAIMTTA  R N+ +A+ D  + L+ TPF +G+GH+ PN A DPGLVYDL  
Sbjct  559   DWSVSAIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGHMRPNRAMDPGLVYDLST  618

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              +Y +F+CA GYN+T + +    PY+CP   SL  FNYPSI VP+L G+ATVTR +KNVG
Sbjct  619   DNYFDFLCALGYNRTLMRSFSKDPYECPKSFSLLDFNYPSIMVPNLHGSATVTRRVKNVG  678

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP TY A V  P G SV+V P+ L F++VGEE+SFKVTLKAK      +Y FG L WSD 
Sbjct  679   SPGTYAAQVIEPPGISVSVEPRTLTFDRVGEEKSFKVTLKAKSARHATEYVFGGLRWSDG  738

Query  206   KHRVRSPIVV  177
             +H VRSPIVV
Sbjct  739   RHYVRSPIVV  748



>ref|XP_004502100.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=772

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/731 (62%), Positives = 555/731 (76%), Gaps = 10/731 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VD +RV  SH++ LG++LGS + A+++IFYSYTRHINGFAA LEEE AAEI K+P+V+SV
Sbjct  48    VDFNRVTDSHYEFLGSFLGSSNIAKESIFYSYTRHINGFAANLEEEVAAEITKHPKVLSV  107

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR R+L TT SWEF+GLE E GVI   S+W KA+FGE  II NLDTGVWPESKSFS+E
Sbjct  108   FENRGRKLHTTHSWEFMGLE-ENGVIPSTSVWNKARFGEGVIIANLDTGVWPESKSFSDE  166

Query  2000  GFGPIPKRWKGICQN--QKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHG  1827
             GFGPIP +W+GIC        +FHCNRKLIGARYF +GY+SA GPLNS+F +PRD  GHG
Sbjct  167   GFGPIPSKWRGICDKGYHHHHAFHCNRKLIGARYFNKGYASAAGPLNSTFESPRDNEGHG  226

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLSTAGGN V G +VFG G GTAKGGSPKARVA+YKVCWPP   G +C++ADILAGFD
Sbjct  227   SHTLSTAGGNMVSGISVFGQGYGTAKGGSPKARVASYKVCWPPID-GNECFEADILAGFD  285

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDVLSVSLGG      FNDS+AIGSFHA K GIVVV SAGN GP   +  N+AP
Sbjct  286   MAIHDGVDVLSVSLGGSSSS-LFNDSVAIGSFHAAKKGIVVVCSAGNSGPSDATAENLAP  344

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W ITVGA+TMDR F S VVLGN     GES    +L   KFYP + A  A++    S + 
Sbjct  345   WYITVGASTMDREFPSYVVLGNNISLKGESLSATRL-ADKFYPSILATDAKL---GSATA  400

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             +DA  C   TLDP KVKGK+++CL+G N R++K  +A LAGAVGM+L ND+ +GNE+IAD
Sbjct  401   EDAKLCMNRTLDPSKVKGKIVICLRGINARVDKGEQALLAGAVGMVLVNDKINGNEVIAD  460

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPATH+T+SDGLA+F+YIN +++PV +ITHP T L  KPAP +AAFSS+GPN I P+
Sbjct  461   PHVLPATHITFSDGLALFNYINSSKSPVVYITHPTTRLHTKPAPFMAAFSSKGPNTIVPE  520

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGV+VIAA+TEA GP++ ++D R + +N  SGTSMSCPH++G+ GLLKTL+P
Sbjct  521   ILKPDITAPGVSVIAAYTEAEGPTNQEFDYRRIPYNSVSGTSMSCPHISGIAGLLKTLHP  580

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
             SWSPA I+SAIMTTAT   N  + I  + T  + TPF+YGAGH+ PN A DPGLVYD  +
Sbjct  581   SWSPAAIKSAIMTTATTLDNEAEPIL-NATESQATPFSYGAGHVQPNKAMDPGLVYDTTV  639

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY+NF+CA GY++T+I+     P+ C  + SL   NYPSITVP+L G+ TVTRTLKNVG
Sbjct  640   NDYLNFLCALGYDETQISVFSKAPHPCHKNFSLINLNYPSITVPNLSGSVTVTRTLKNVG  699

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SPATY A V++P G +V+V P IL+F+ VGEE+ F++ LK +       Y FG L WSD 
Sbjct  700   SPATYIARVQNPNGITVSVKPNILEFKNVGEEKRFEIRLKVRKGKGKEKYVFGKLIWSDG  759

Query  206   KHRVRSPIVVK  174
             KH V+SPIVVK
Sbjct  760   KHYVKSPIVVK  770



>ref|XP_008810184.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=775

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/727 (61%), Positives = 545/727 (75%), Gaps = 9/727 (1%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             DRV  SH+++LG+ LGS +KA+DAIFYSYTR INGFAA L+EEEA EI+K+P VISVF N
Sbjct  51    DRVVDSHYEILGSVLGSKEKAQDAIFYSYTRSINGFAANLDEEEAREISKHPGVISVFPN  110

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
             R  +L TTRSW+F+GLE +G V+ + SIW KA+FGED IIGNLDTGVWPES+SF ++  G
Sbjct  111   RGHKLHTTRSWDFMGLERDG-VVPESSIWTKARFGEDVIIGNLDTGVWPESESFKDDDMG  169

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLS  1812
             PIP  WKG CQN+ DK F CNRKLIGARYF +GY S VGPL+    +PRD  GHG+HTLS
Sbjct  170   PIPSNWKGTCQNETDKQFRCNRKLIGARYFNKGYQSLVGPLSPELNSPRDNEGHGTHTLS  229

Query  1811  TAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIED  1632
             TA G  VPGA +FG   G AKGG+P ARVAAYKVCWPP   G +C+DADILA FD AI D
Sbjct  230   TAAGRIVPGATLFGYSTGMAKGGAPNARVAAYKVCWPPVD-GSECFDADILAAFDAAIHD  288

Query  1631  GVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITV  1452
             GV VLSVSLGGD P  YF D LAIGSFHAVKNG+ VV SAGN GP  G+V+NVAPW++TV
Sbjct  289   GVHVLSVSLGGD-PVDYFYDGLAIGSFHAVKNGLTVVCSAGNSGPFLGTVSNVAPWILTV  347

Query  1451  GANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALH  1272
             GA+T+DR F S V L N+K   G+S  P+ L    F+PL+S+  A+     ++S++DA  
Sbjct  348   GASTIDREFPSYVQLRNRKQMKGQSLSPVGLQQ-NFHPLISSKEAKA---TNMSSEDATQ  403

Query  1271  CKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLP  1092
             C  G+L+P KV+GKV+VCL+G N R+EK      AG VGMILANDE +GNEIIADAH LP
Sbjct  404   CLLGSLEPAKVRGKVVVCLRGNNGRVEKGEAVRQAGGVGMILANDESTGNEIIADAHVLP  463

Query  1091  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  912
             ATH++YSDG+A+  YIN T++P+ +IT P T+L   PAP +AAFSSRGPN INP+ILKPD
Sbjct  464   ATHISYSDGVALLSYINSTKSPLGYITTPKTMLDTYPAPFMAAFSSRGPNTINPEILKPD  523

Query  911   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  732
             I+APGV++IAA+T A+GP+   +D R V FN ESGTSMSCPHV+G+ GLLK L+P WSP+
Sbjct  524   ITAPGVSIIAAYTGASGPTGLPFDSRRVLFNSESGTSMSCPHVSGIAGLLKALHPDWSPS  583

Query  731   EIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVN  552
              I+SAI+T+A  + N+ + ++ + + +K  PF+YG+GH+ PN A DPGLVYDL   DY+N
Sbjct  584   AIKSAIVTSARTQDNTLEPMS-NSSFVKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLN  642

Query  551   FICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  375
             F+C+ GYN T+       PY CP   +++   NYPSI++P+L G  +V RT+KNVG+P T
Sbjct  643   FLCSLGYNSTQNALFNVEPYLCPSRPLNIGDLNYPSISIPYLSGAVSVIRTVKNVGTPGT  702

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  195
             Y   V  P G SV+V P  LKF KVGEE+ FKVTLKAK  +A  DYAFG L WSD  H V
Sbjct  703   YRVRVIEPAGISVSVKPTSLKFMKVGEEKKFKVTLKAKSRDAAGDYAFGKLIWSDGMHYV  762

Query  194   RSPIVVK  174
             RSPIVVK
Sbjct  763   RSPIVVK  769



>gb|KDP29034.1| hypothetical protein JCGZ_16423 [Jatropha curcas]
Length=782

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/737 (62%), Positives = 546/737 (74%), Gaps = 20/737 (3%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L  V +SH++ L ++LGS +KA+DAIFYSY R+INGFAA LEEEEAAEIAK+P+V+SVFL
Sbjct  54    LHAVTNSHYEFLSSFLGSTEKAKDAIFYSYQRNINGFAAFLEEEEAAEIAKHPKVVSVFL  113

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             NRARQL TT SWEF+ LE + GVIH  S+WKKA+FGEDTII NLDTGVWPESKSFS+E F
Sbjct  114   NRARQLHTTHSWEFMLLE-KSGVIHPSSLWKKARFGEDTIIANLDTGVWPESKSFSDEEF  172

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYF----IQGYSSAVGPLNSSFFTPRDVIGHG  1827
             GP+P RWKGIC+N       CNRKLIGARYF    I+ Y   VG  + S  TPRD+ GHG
Sbjct  173   GPVPSRWKGICENGTTSGVPCNRKLIGARYFNKGYIEEYKLKVGRWDPSLNTPRDIEGHG  232

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED-----CYDADI  1662
             +HTLSTA GNFVP A+V G+G+GTAKGG+PKARVAAYKVCW   S  ED     CYDADI
Sbjct  233   THTLSTAAGNFVPKASVVGIGSGTAKGGAPKARVAAYKVCW---SAVEDKDIDGCYDADI  289

Query  1661  LAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSV  1482
             + GFD AI DGVDVLSVSLGGD    YFND +AIGSFHAVK GIVVV SAGN GP  G+V
Sbjct  290   IEGFDAAIHDGVDVLSVSLGGDQTD-YFNDGIAIGSFHAVKKGIVVVVSAGNSGPEPGTV  348

Query  1481  NNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKIN  1302
             +NVAPW+ITVGA+T+DR+ Q+ V LGN  H  G S +   +P  K YPL+S+  A+    
Sbjct  349   SNVAPWMITVGASTIDRKIQTIVELGNGHHLKGTS-ISKAMPENKLYPLISSVQAKA---  404

Query  1301  ASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGN  1122
             A+ S +DA  C PGTLDP KVKGK+L CL+GE  R++K  +AALAGAVGMIL NDE  G+
Sbjct  405   ANASVKDAELCLPGTLDPAKVKGKILACLRGETARVDKGAQAALAGAVGMILCNDESDGD  464

Query  1121  EIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPN  942
              I  DAH LPA+H+TY DGLA+F YIN TR+P+  IT  + + G KPAP +AAFSS GPN
Sbjct  465   SINTDAHLLPASHITYKDGLALFSYINSTRDPLGFITPTSEIFGTKPAPFMAAFSSVGPN  524

Query  941   AINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLL  762
              + P ILKPDI+APGV++IA++T ++ P+  D+DKR   F   SGTSMSCPHVAGVV LL
Sbjct  525   TVTPQILKPDITAPGVDIIASYTGSSSPTGLDFDKRRTPFITMSGTSMSCPHVAGVVALL  584

Query  761   KTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLV  582
             KTL+P WSPA I+SAIMTTA  R N+ + + D  + +K TPF YG+GHI PN A +PGLV
Sbjct  585   KTLHPEWSPAAIKSAIMTTARTRDNTPQPLLDGSS-VKATPFNYGSGHIRPNRAMNPGLV  643

Query  581   YDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRT  402
             YDL + DY++F+CA GYN++ I A     +KCP   SL  FNYPSIT+P L G+ TV+R 
Sbjct  644   YDLSVNDYLDFLCAIGYNQSSIDA-FSADHKCPKSASLLDFNYPSITIPKLSGSVTVSRK  702

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVL  222
             LKNVGS   Y   ++ P G SV+V P  L FEK GEE+SFK T KAK E A  +Y FG L
Sbjct  703   LKNVGSAGKYAVRIKEPYGISVSVEPSALTFEKTGEEKSFKATFKAKWEGAAKNYEFGGL  762

Query  221   TWSDKKHRVRSPIVVKT  171
             TW+D  H VRSPIVV T
Sbjct  763   TWTDGVHYVRSPIVVST  779



>emb|CDP06171.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/738 (62%), Positives = 547/738 (74%), Gaps = 38/738 (5%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             V+ +RV++SH  LLG++LGS +KA+++IFYSYTRHINGFAA+L+E E  EI+K+P+VISV
Sbjct  46    VEYERVRNSHFTLLGSFLGSEEKAQESIFYSYTRHINGFAAVLDEAEVDEISKHPDVISV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSI---WKKAKFGEDTIIGNLDTGVWPESKSF  2010
             FLNR ++L TTRSWEF+GLE      HDG I   W +A+FGED II NLDTGVWPESKSF
Sbjct  106   FLNRPKKLHTTRSWEFMGLE------HDGQIQPSWTEARFGEDAIIANLDTGVWPESKSF  159

Query  2009  SEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFF-TPRDVI  1836
             S+EGFGPIP RWKGICQN +D +F CNRKLIGAR+F +GY +AVG  +NSS F +PRD  
Sbjct  160   SDEGFGPIPPRWKGICQNGQDPTFKCNRKLIGARFFNKGYFAAVGGTVNSSIFDSPRDTE  219

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHGSHTLSTAGGNFVPGA++FGLGNGTAKGGSPKARVAAYKVC P T  G  CYDADILA
Sbjct  220   GHGSHTLSTAGGNFVPGASLFGLGNGTAKGGSPKARVAAYKVCGPMTFEGS-CYDADILA  278

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
             GFD AI DGVDV+SVSLGG  P PY  DS+AIGSFHAVK+GIVVV SAGN GP   +V+N
Sbjct  279   GFDMAISDGVDVISVSLGG-RPQPYEEDSIAIGSFHAVKHGIVVVCSAGNAGPDLATVSN  337

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             VAPWLITVGA+TMDR+  + + LGN      E    L  P+                  S
Sbjct  338   VAPWLITVGASTMDRKLATFLNLGNNISLVAEIIPYLLFPS------------------S  379

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
              ST     C  G LDP K KGK++VCL GEN  +EK   AA AGAVGM+LAND   GNEI
Sbjct  380   CST----FCMAGCLDPIKAKGKIVVCLTGENGIVEKGINAASAGAVGMVLANDVSDGNEI  435

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKT-RNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  939
              +DAH LPA  + Y+DG A+F YIN T RNP A+I+ P+TLLG+KPAPV+A FSSRGPN 
Sbjct  436   SSDAHVLPAVQIRYTDGAAVFAYINSTVRNPTAYISPPSTLLGIKPAPVMAPFSSRGPNT  495

Query  938   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  759
             + P+ILKPDI+APGV+VIAA++EA GP+   +DKR   + V+SGTSMSCPHV+G+ GLLK
Sbjct  496   VTPEILKPDITAPGVDVIAAYSEAQGPTGESFDKRRTPYFVDSGTSMSCPHVSGIAGLLK  555

Query  758   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVY  579
             TL+P WSPA IRSAIMT+   R N+ + ITDD   +K TPFAYGAGH++P+ A DPGL+Y
Sbjct  556   TLHPDWSPAAIRSAIMTSGKTRDNAVERITDDGH-IKATPFAYGAGHVHPSQAMDPGLIY  614

Query  578   DLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTL  399
             DL   DY+ F+C+ GYN+T I       + CP  ISL   NYPSI VP L G+ TVTRT+
Sbjct  615   DLTNQDYLTFLCSLGYNETTILLFTHETFTCPKPISLVNLNYPSIAVPKLNGSITVTRTV  674

Query  398   KNVG-SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVL  222
             KNVG SPATYTA V +P G SV V PK L F  +G+++SF VT+ A    A  DY FG+L
Sbjct  675   KNVGSSPATYTALVVNPPGLSVDVQPKTLAFATIGDQKSFNVTITATKAGANRDYVFGML  734

Query  221   TWSDKKHRVRSPIVVKTA  168
             TWSD KH VRS I VKT+
Sbjct  735   TWSDGKHYVRSQIAVKTS  752



>ref|XP_007207992.1| hypothetical protein PRUPE_ppa015005mg, partial [Prunus persica]
 gb|EMJ09191.1| hypothetical protein PRUPE_ppa015005mg, partial [Prunus persica]
Length=746

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/734 (63%), Positives = 553/734 (75%), Gaps = 14/734 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLD V +SH+ LLG+ LGS ++A++AIFYSY R+INGFAA+L+EEEAA+IAK+P V+SV
Sbjct  18    VDLDSVTNSHYNLLGSVLGSNERAQEAIFYSYNRNINGFAAILDEEEAAQIAKDPNVLSV  77

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR R+L TTRSW+FLGLE  G V H GSIWKKA+FG +TIIGNLDTGVWPESKSFS+E
Sbjct  78    FPNRGRKLHTTRSWDFLGLEENGEVRH-GSIWKKAQFGANTIIGNLDTGVWPESKSFSDE  136

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-----TPRDVI  1836
             G GPIP +W+GICQ       HCNRKLIGARYF +GY +    +NSS         RD  
Sbjct  137   GIGPIPSKWRGICQLDTKNGSHCNRKLIGARYFSKGYLAYASTVNSSAAKTIQPNARDFG  196

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHGSHTLSTA GNFVP A+VFG GNGTAKGGSPKARVAAYKVCWPP + G +C+DADI+A
Sbjct  197   GHGSHTLSTAAGNFVPRASVFGNGNGTAKGGSPKARVAAYKVCWPPIN-GNECFDADIIA  255

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
              FD AI DGVDVLSVSLGG+    +F+D +AIGSFHAVK GI VV+SAGN GP  G+V+N
Sbjct  256   AFDAAISDGVDVLSVSLGGE-AAEFFSDGIAIGSFHAVKKGISVVSSAGNSGPTPGTVSN  314

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             V+PWL+TVGA+T+DR F S V LGNKKH  G S     LP+  FYPL+SA  A+    A+
Sbjct  315   VSPWLLTVGASTIDREFSSYVALGNKKHLKGASLSSGALPSKMFYPLISAVDAK---GAN  371

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
              S+ DA  CK G+L+ +KV+GK+LVC++GEN R +K  +A LAGAVGMIL ND+ SGNEI
Sbjct  372   ASSSDAQLCKAGSLEKKKVEGKILVCIRGENARADKGQQAVLAGAVGMILVNDKLSGNEI  431

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             IAD H LP +HV YSDG A+F YI  T+ PVA++T   T +G KPAP +A+FSSRGPN I
Sbjct  432   IADPHLLPTSHVNYSDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPAPFMASFSSRGPNTI  491

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
                ILKPDI+APGV++IAA+T A GP+D  +DKR VSFN ESGTSMSCPHV+G+VGLLKT
Sbjct  492   EQSILKPDITAPGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSMSCPHVSGIVGLLKT  551

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+PSWSPA I+SAIMTTA  R N  +A+  D +  + TPFAYGAGH+ PN A DPGLVYD
Sbjct  552   LHPSWSPAAIKSAIMTTARKRDNKKEAM-QDSSKARATPFAYGAGHVQPNRAMDPGLVYD  610

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTL  399
             L   DY+NF+C +GYN T +      P+ CP   SL+ FNYPSITVP L     TVTR +
Sbjct  611   LTTDDYLNFLCFRGYNATLLKVFSNEPHTCPKAYSLADFNYPSITVPDLHDKPVTVTRRV  670

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLT  219
             KNVGSP TY   ++ P G SV+V P  L+F+ +GEE+ FKV LK K + A  DY FG L 
Sbjct  671   KNVGSPGTYVVHIKEPAGVSVSVKPGSLQFKTIGEEKKFKVVLKPKVQGAQ-DYVFGELN  729

Query  218   WSDKKHRVRSPIVV  177
             WSD KH VRSPIVV
Sbjct  730   WSDGKHNVRSPIVV  743



>ref|XP_010092373.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51049.1| Subtilisin-like protease [Morus notabilis]
Length=745

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/737 (59%), Positives = 549/737 (74%), Gaps = 14/737 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL+ V  SH+ LLG+YLGS +KA+DAI YSYTRHING  A+L++ EAAEIAK+P+V+SV
Sbjct  13    VDLESVTTSHYTLLGSYLGSDEKAKDAILYSYTRHINGLTAILDDAEAAEIAKHPDVVSV  72

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN  ++L TTRSW+FL LE   GVI   SIW KA++GED IIGNLDTG+WPES SFS+E
Sbjct  73    FLNNGKKLHTTRSWDFLRLE-RNGVIPSKSIWNKARYGEDIIIGNLDTGIWPESMSFSDE  131

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYS-------SAVGPL-NSSFFTPR  1845
             G G +P +W+GICQ+      HCNRKLIGARYF +GY+       S + P+ NS+ FT R
Sbjct  132   GIGHVPLKWQGICQHCVKDKVHCNRKLIGARYFNKGYAAYLKTKNSTLSPIHNSTLFTTR  191

Query  1844  DVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDAD  1665
             D +GHG++TLS AGGNFV GANVFG GNGTAKGGSPKA VAAYKVCWPP    E+CYDAD
Sbjct  192   DYVGHGTYTLSIAGGNFVRGANVFGNGNGTAKGGSPKAHVAAYKVCWPPVG-NEECYDAD  250

Query  1664  ILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGS  1485
             ILA F+ +I DGVDVLS+S+G D P  +F ++++IG+FHAVKNGIV V SAGN GP  G+
Sbjct  251   ILAAFEASISDGVDVLSLSIGNDKPMEFFKEAISIGAFHAVKNGIVAVTSAGNSGPDPGT  310

Query  1484  VNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKI  1305
             V + +PW +TVGA+T+DR F + V LGNKKH  G S     LP+ KFYPL   A+A+   
Sbjct  311   VWDSSPWTLTVGASTIDREFTTYVALGNKKHLKGGSLSSKALPSNKFYPLTGGANAKA--  368

Query  1304  NASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSG  1125
              A +S  DAL+CKPG LDP+KVKGK+LVCL  E   IE   +AALAGAVGMILAND +SG
Sbjct  369   -AKVSALDALYCKPGALDPKKVKGKILVCLWKEMTSIEMGEQAALAGAVGMILANDIESG  427

Query  1124  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  945
             N + AD H LP +H+TY+DG  + DY+N ++NP+A++T   T +GV+PAP++A+FSSRGP
Sbjct  428   NRVNADLHVLPVSHITYNDGKLVLDYLNSSKNPMAYMTGVKTEVGVRPAPLMASFSSRGP  487

Query  944   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  765
             N I P ILKPDI+APGV++IAA+++A  P+    D R VSF  +SGTS SCPHV+G+ GL
Sbjct  488   NTIEPAILKPDITAPGVDIIAAYSKAAPPTYLTSDTRRVSFIAQSGTSTSCPHVSGIAGL  547

Query  764   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGL  585
             LKTL+P WSPA I+SAIMTTA  R N+ + + +     + TPFAYGAGHI PN A DPGL
Sbjct  548   LKTLHPDWSPAAIKSAIMTTARARDNNMEPMLNSSMK-RETPFAYGAGHIRPNRAMDPGL  606

Query  584   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTR  405
             VYDL + DY++F+CA GYN+T +      P+KC    +++ FNYPSI VP+L  +  VTR
Sbjct  607   VYDLTIDDYLDFLCAHGYNQTLVRKFSDKPHKCSKSFTMANFNYPSIAVPNLSKSVIVTR  666

Query  404   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  225
              LKNVG+P TY A V++P+G S+ V PK LKF+++GEE+ FK+ +K K    + DY FG 
Sbjct  667   KLKNVGTPGTYKAYVKAPIGVSIYVKPKSLKFDRIGEEKRFKIVVKPKAVGKSKDYVFGH  726

Query  224   LTWSDKKHRVRSPIVVK  174
             L WSD KH VRSPIVVK
Sbjct  727   LKWSDGKHFVRSPIVVK  743



>ref|XP_007020377.1| Xylem serine proteinase 1, putative [Theobroma cacao]
 gb|EOY11902.1| Xylem serine proteinase 1, putative [Theobroma cacao]
Length=770

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/729 (62%), Positives = 555/729 (76%), Gaps = 8/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL +  +SH+ LLG+ +GS D A++ IFYSYT++INGFAA+L+EEEAAEIAK+PEV+SVF
Sbjct  47    DLHQATNSHYDLLGSLVGSTDIAKEKIFYSYTQNINGFAAVLDEEEAAEIAKHPEVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TTRSW+FLGLE +G VIH  SIWKK++FG DTIIGNLDTGVWPESKSFS+EG
Sbjct  107   LNKGRKLHTTRSWDFLGLENDG-VIHSSSIWKKSRFGGDTIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAV-GPLNSSFFTPRDVIGHGSH  1821
              GPIP RWKG CQN  D   HCNRKLIGA+YF +GY++ + G LN++  T RD  GHG+H
Sbjct  166   MGPIPSRWKGSCQNDPDDGVHCNRKLIGAKYFNKGYAAVLDGKLNATLETARDNQGHGTH  225

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGG+FVPGANV G GNGTAKGGSPKARVAAYKVCWPP   G +C+DADILA FD A
Sbjct  226   TLSTAGGSFVPGANVLGFGNGTAKGGSPKARVAAYKVCWPPID-GNECFDADILAAFDAA  284

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG+    +F D  +IGSFHA++ GI VVASAGN+GP   +V NV+PW+
Sbjct  285   ISDGVDVLSVSLGGETT-EFFEDGTSIGSFHAMRKGISVVASAGNDGPDPETVTNVSPWV  343

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
              T+GA+T+DR F S V LGN K   G S     L +  FYPL+SA +A+    A+    D
Sbjct  344   FTIGASTLDRDFISYVELGNDKRLKGASMATSSLSSRSFYPLISAETAK---AANAKAAD  400

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C+PGTLDP+KVKGK++VC++G N R +KS +A LAGAVGMILANDE SGN I+AD H
Sbjct  401   AILCQPGTLDPKKVKGKIIVCVRGVNARTDKSQQALLAGAVGMILANDEKSGNGIMADPH  460

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPATH++++DG  +F YIN T+ P A+IT   T LG KPAP +A+FSSRGPN I P IL
Sbjct  461   LLPATHISFTDGETVFAYINSTKKPTAYITPAKTELGSKPAPFMASFSSRGPNVIEPSIL  520

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV++IAAF+EA GPS+   DKR + F   SGTSMSCPHV+G+VGLLK+L+P W
Sbjct  521   KPDITAPGVSIIAAFSEAVGPSEETSDKRRMPFTSMSGTSMSCPHVSGIVGLLKSLHPDW  580

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SP+ I+SAIMT+A  R N+G  +  D T  K TPFAYG GH+ PN A DPGLVYDL + D
Sbjct  581   SPSAIKSAIMTSARTRDNTGNPMV-DSTNKKATPFAYGGGHVRPNRAMDPGLVYDLTVDD  639

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+N++C++GYN++ I      PY CP   SLS FNYPSI+V    G+ATV+R +KNVGSP
Sbjct  640   YLNYLCSRGYNQSMIRLFSDKPYTCPKSFSLSDFNYPSISVDKFGGSATVSRKVKNVGSP  699

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY A VRSP G +V+VNP  L FEK GEE+ F+VT KAK     A + FG L WS+  H
Sbjct  700   GTYRARVRSPAGVTVSVNPSTLTFEKKGEEKKFEVTFKAKSNGQPAGFVFGQLIWSNGHH  759

Query  200   RVRSPIVVK  174
              VRSP+VVK
Sbjct  760   YVRSPLVVK  768



>ref|XP_010689355.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/732 (60%), Positives = 549/732 (75%), Gaps = 12/732 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL +VK SH+ LLG++LGS D A+DAIFYSYTRHINGFAA+LEEE A EIA +P V+SVF
Sbjct  40    DLHQVKESHYDLLGSFLGSHDTAKDAIFYSYTRHINGFAAILEEELALEIANHPNVVSVF  99

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ R+L TTRSW FLGLE +G  I   S W+KA++GEDTII NLDTGVWPESKSF +EG
Sbjct  100   QNKGRKLHTTRSWSFLGLETDGE-IFPSSAWEKARYGEDTIIANLDTGVWPESKSFGDEG  158

Query  1997  FGPIPKRWKGICQNQKD-KSFHCNRKLIGARYFIQGYSSAVGPLNSSFF----TPRDVIG  1833
             FGPI  RWKGICQN      F CNRKLIGARYF +GY +A+   NSS      +PRD  G
Sbjct  159   FGPIQPRWKGICQNNTSVGGFKCNRKLIGARYFNKGYLAALSTSNSSHTTTINSPRDYDG  218

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HG+HTLSTAGG+FV  A+VFG G G AKGGSP+ARVA YKVCWPP + G++CYDAD+LA 
Sbjct  219   HGTHTLSTAGGSFVRDASVFGFGKGIAKGGSPRARVATYKVCWPPIN-GDECYDADVLAA  277

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             FD AI DGVD++S S+GG+ P PYFND+LAIGSFHA K GI+VV SAGN GP+ G+V NV
Sbjct  278   FDMAIADGVDIISASIGGN-PSPYFNDTLAIGSFHATKKGILVVCSAGNSGPMDGTVVNV  336

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
             +PW+ TVGA+TMDR F   V+LGN K+  GES  P  L  GK+YPL+SAA  +  +NAS+
Sbjct  337   SPWIFTVGASTMDREFSDWVLLGNGKYIKGESLAPKSLQAGKYYPLVSAAQVK-ALNASV  395

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
               ++A  CK  T+DP K +GK++VC++G+N R++K  + ALAG VGMILAND D+ NEI+
Sbjct  396   --EEAKLCKSRTIDPRKARGKIVVCIRGDNARVDKGQQVALAGGVGMILANDHDTANEIL  453

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
             AD H LPA+H+ YS+G+ +  YIN T+ P A IT  +T LG+ PAP +AAFSS+GPN I 
Sbjct  454   ADPHVLPASHINYSNGILVSTYINSTKFPKASITRTSTRLGINPAPFMAAFSSKGPNTIT  513

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
             P+ILKPDI+APGV+VIAA+TEA GP++  +DKR V FN  SGTSMSCPH++G+VGLLKTL
Sbjct  514   PEILKPDITAPGVSVIAAYTEAQGPTNQVFDKRRVQFNSISGTSMSCPHISGIVGLLKTL  573

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             YP WSPA I+SAIMTTA+V  N  + IT + + ++  PF YGAGH+ PN A DPGLVYD+
Sbjct  574   YPHWSPAAIKSAIMTTASVIDNVHEPIT-NASNIQANPFHYGAGHVQPNRAVDPGLVYDM  632

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKN  393
               TDY+NF+CA GYN+  I       Y CP + S+   NYPSITVP LK T TVTRT+KN
Sbjct  633   TTTDYLNFLCALGYNEKSIALFHAGHYLCPKNFSILDLNYPSITVPRLKNTITVTRTVKN  692

Query  392   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  213
             VGSP  Y A V++P G S+ V+P IL+F  + +E+SF +TL+      + +YAFG + WS
Sbjct  693   VGSPGKYKAHVQNPRGISIFVSPPILEFTTLCQEKSFHLTLEVVKGKISKNYAFGRIIWS  752

Query  212   DKKHRVRSPIVV  177
             D  H V SPIVV
Sbjct  753   DGYHNVSSPIVV  764



>gb|KDP32632.1| hypothetical protein JCGZ_13182 [Jatropha curcas]
Length=769

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/730 (60%), Positives = 542/730 (74%), Gaps = 10/730 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL  V+H  + LL +   S + + D I YSYT++INGFAA+LEEEEA E++K+P+V+SVF
Sbjct  47    DLKYVEH--YALLESLTNSKENSGDKILYSYTKNINGFAAILEEEEAEELSKHPDVLSVF  104

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ + L TT SW FLGLE  G V  + SIW KA+FGED IIGNLDTGVWPESKSF +EG
Sbjct  105   LNKGKHLHTTHSWNFLGLERHGAVPFE-SIWTKARFGEDAIIGNLDTGVWPESKSFGDEG  163

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +W+GICQN       CNRKLIGAR+F +GY+S VGPLNS+F T RD  GHG+HT
Sbjct  164   IGPLPSKWRGICQNDT-TGVRCNRKLIGARHFNKGYASFVGPLNSTFNTARDHSGHGTHT  222

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG FV GANVFG GNGTAKGGSP ARVAAYKVCWPP +   +C+DADI+AGF+ AI
Sbjct  223   LSTAGGGFVAGANVFGNGNGTAKGGSPFARVAAYKVCWPPVNGSGECFDADIIAGFEAAI  282

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLG + P  Y  D +AIG+FHAV  G VVVASAGN GP   +V+N APW+I
Sbjct  283   SDGVDVLSVSLGAE-PTEYSEDLIAIGAFHAVMKGTVVVASAGNSGPEPQTVSNTAPWII  341

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T+DR F + V LG+K+H  G S     LP  KFYP+++   A+   N ++S  +A
Sbjct  342   TVGASTIDREFTTYVALGSKRHLKGTSLSERGLPAEKFYPMITGEHAK---NPNVSALEA  398

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             + C P  LDP+KVKGK+LVCL+GE  R+ K  +A LAGAVGM+L NDE SGNEI+AD H 
Sbjct  399   MLCLPEALDPKKVKGKILVCLRGEIGRVNKGQQALLAGAVGMVLINDEKSGNEILADPHV  458

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA HV +SDG A+  YIN T+ P+A++T   T    KPAPV+AAFSSRGP+ ++P ILK
Sbjct  459   LPAAHVNFSDGEAVLAYINSTKVPMAYMTRSRTQFDTKPAPVMAAFSSRGPSYVDPSILK  518

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV++IAAF+ A  P++ D+DKR ++FN ESGTSMSCPHV+G+VGLLKTL+P WS
Sbjct  519   PDITAPGVSIIAAFSLAVSPTEEDFDKRRIAFNTESGTSMSCPHVSGIVGLLKTLHPDWS  578

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSA+MTTA  R N+ + I D  T  + TPF YGAGH+NPN A DPGL+YDL   DY
Sbjct  579   PAAIRSALMTTARTRGNNMEPIIDSSTNKEATPFDYGAGHVNPNKAMDPGLIYDLTENDY  638

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKNVGS-  384
             +NF+CA+GYNKT+I      PY CP    ++ FNYPSIT+P L      VTR +KNVGS 
Sbjct  639   LNFLCAKGYNKTQIRLFSSKPYSCPKSFKIADFNYPSITIPSLISLGGPVTRRVKNVGSG  698

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P+ Y A+V++P G SV V PK L+FEK GEE+ FKV LK+  +N   DY FG L WSD K
Sbjct  699   PSKYCANVKAPHGVSVLVEPKCLEFEKTGEEKIFKVALKSLVKNEVKDYVFGKLIWSDGK  758

Query  203   HRVRSPIVVK  174
             H VRSPIVV+
Sbjct  759   HYVRSPIVVR  768



>ref|XP_010096499.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB64619.1| Subtilisin-like protease [Morus notabilis]
Length=771

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/732 (62%), Positives = 551/732 (75%), Gaps = 14/732 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  SH++LL ++LGS +KA+++IF SY R+INGFAA LEEEEAA+IAK+P V+SVF
Sbjct  47    DLDRVADSHYELLSSFLGSKEKAKESIFLSYKRNINGFAAFLEEEEAAQIAKHPGVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TT SW F+ LE + G     SIW+KAKFG+DTII NLDTGVWP SKSF ++G
Sbjct  107   LNQGRKLHTTHSWNFMMLEDQKGFPIRNSIWRKAKFGKDTIIANLDTGVWPTSKSFDDKG  166

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GPIP RWKG CQ  KD  F CNRKLIGARYF +GY +    LNS+  T RD  GHGSHT
Sbjct  167   YGPIPSRWKGTCQKSKD-GFACNRKLIGARYFSEGYEAWGRKLNSTERTARDHSGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GA+V G+GNGTAKGGSP+ARVAAYKVCWPP   GE C+DADI+A FD AI
Sbjct  226   LSTAGGNFVHGASVLGVGNGTAKGGSPRARVAAYKVCWPPVDGGE-CFDADIMAAFDMAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDV+S+S+GG  P  Y+ D ++IG+FHA K GIVVVASAGN GP AGSV NV+PW+I
Sbjct  285   HDGVDVISMSVGGK-PAGYWEDGMSIGAFHAAKKGIVVVASAGNSGPNAGSVTNVSPWMI  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR FQ+ V L N     G S  P  L   KFYPL++ A A+ + NASI   DA
Sbjct  344   TVAASTLDREFQAFVELKNGLRLKGTSLSP-ALRAKKFYPLINGAQAK-EANASI--DDA  399

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             + CK GTLDP KVKGK+L CL+GEN R+EK   AA AGAVGMIL ND+ SGN ++ADAHF
Sbjct  400   ILCKTGTLDPTKVKGKILACLRGENARVEKGLNAARAGAVGMILCNDDLSGNGVLADAHF  459

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+H+TY DG ++  YIN T+NP A +  P    G KPAP +A+FSS GPN + P+ILK
Sbjct  460   LPASHLTYEDGQSLLQYINTTKNPQATLLPPIATFGSKPAPSMASFSSTGPNTVTPEILK  519

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV++IAA++EA  P+  ++DKR   FNVESGTSMSCPHVAGVVGLL+T++  WS
Sbjct  520   PDITAPGVSIIAAYSEAVSPTGLEFDKRRFPFNVESGTSMSCPHVAGVVGLLRTIHRDWS  579

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGL--KTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             PA IRSAI+TTA  R N+G +    KT L  K +PF YG GHI PN A DPGLVYDL   
Sbjct  580   PAAIRSAIVTTARTRDNTGNSA---KTALKQKASPFNYGNGHIRPNRAMDPGLVYDLGTN  636

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCP-DHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYNKT+I A+   P+KCP  ++++  FNYPS+T P+L G+ TVTRT+KNVG
Sbjct  637   DYLNFLCSLGYNKTQIQALNDKPHKCPAKNVTVLDFNYPSVTAPNLSGSVTVTRTVKNVG  696

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
              P TY   V  PVG SV+V PKIL+F+  GEE+SF++TLK +G      Y FGV  W+D 
Sbjct  697   QPGTYVVKVHEPVGVSVSVEPKILEFKHHGEEKSFRITLKDRGYGLKG-YHFGVFVWTDG  755

Query  206   KHRVRSPIVVKT  171
             KH VRSPIVV+T
Sbjct  756   KHYVRSPIVVQT  767



>gb|KCW70438.1| hypothetical protein EUGRSUZ_F03663 [Eucalyptus grandis]
Length=752

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/729 (61%), Positives = 551/729 (76%), Gaps = 9/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ LLG+YLGS  KA++AIFYSYT HINGFAA+LEE++AAEIAK+P+V+SVF
Sbjct  30    DIESATNSHYDLLGSYLGSNKKAQEAIFYSYTHHINGFAAILEEDQAAEIAKHPDVLSVF  89

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++ R+LQTTRSW FLGLE   GVIH  SI +KA+FGEDTIIGNLDTGVWPESKSFS+EG
Sbjct  90    LSKGRKLQTTRSWHFLGLE-RNGVIHQSSILRKARFGEDTIIGNLDTGVWPESKSFSDEG  148

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +W+GICQ      F CNRKLIGARYF +GY++  G LN +F+T RD  GHGSHT
Sbjct  149   MGPIPGKWRGICQRGIKDDFSCNRKLIGARYFNKGYAAYAGRLNYTFYTARDHKGHGSHT  208

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FVPGANVFG GNGTAKGGSP+ARV AYKVCWPP    + C+DADIL GFD AI
Sbjct  209   LSTAGGSFVPGANVFGYGNGTAKGGSPRARVVAYKVCWPPIHQ-KKCFDADILLGFDAAI  267

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSL GD P  +F DS+AIGSFHA +NGIVVV+SAGN GP  G+V NVAPW+I
Sbjct  268   SDGVDVLSVSLVGD-PEEFFMDSIAIGSFHAARNGIVVVSSAGNSGPQPGTVCNVAPWMI  326

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR F + V LG+K+   G S     LP+ K YPL+S A A+I    ++S   A
Sbjct  327   TVAASTIDREFTTYVALGDKQRLKGSSLSANGLPSNKLYPLISGADAKI---TNVSAAKA  383

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI-IADAH  1101
             L C  GTLD +KVKGK+L CL+ E   +++ H+AALAGAVGM+LANDE SGN+I +A A+
Sbjct  384   LRCLAGTLDHKKVKGKILACLR-EYGTVDEGHQAALAGAVGMVLANDEASGNDIFVAQAY  442

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA H+++ DG  +F YIN T+ PVAHIT   T+L   PAP++A+FSSRGPN + P IL
Sbjct  443   VLPAAHISFLDGKVLFTYINSTKFPVAHITRVKTMLNTTPAPIMASFSSRGPNTVEPAIL  502

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA T A GP+  ++DKR   F   SGTSMSCPHV+G+VGLLKTLYP W
Sbjct  503   KPDITAPGVNIIAANTLAVGPTGEEFDKRRTPFKAASGTSMSCPHVSGIVGLLKTLYPGW  562

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+ R N  + + D    +K TPF+YGAGHI P+ A DPGLVYDL + D
Sbjct  563   SPAAIQSAIMTTASTRDNKVEPVHDSSL-VKATPFSYGAGHIQPSRAMDPGLVYDLTVND  621

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y++F+CA+GY+++++ +     + CP H +++  NYPSITVP+L GT  VTR ++NVG+P
Sbjct  622   YLDFLCARGYDESQLRSFTNEIHACPKHFNVADMNYPSITVPNLNGTVVVTRRVRNVGTP  681

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY   +++P G  V+V P+ L FE+  EE+ FKV LK K      DY FG L WSD  H
Sbjct  682   GTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAGKPVDYVFGRLIWSDGVH  741

Query  200   RVRSPIVVK  174
              VRSP+VVK
Sbjct  742   YVRSPLVVK  750



>ref|XP_002525223.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37189.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=761

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/717 (61%), Positives = 536/717 (75%), Gaps = 7/717 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL  V  SH++ LG++LGS D+A DA+ YSY   INGF+AMLEEEEAAEIAK+P+V+SVF
Sbjct  47    DLHAVTDSHYEFLGSFLGSPDEATDALIYSYRNQINGFSAMLEEEEAAEIAKHPKVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+A+QL T  SWEF+ LE  GGV    S+WKKAK GED II NLDTGVWPESKSFS+EG
Sbjct  107   LNQAKQLHTIHSWEFMMLERNGGV-QPKSLWKKAKLGEDIIIANLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GP+  RWKG C+N       CNRKLIGA+ + +GY S VG LNSS    RD  GHGSHT
Sbjct  166   YGPVSSRWKGSCENTTSAGVPCNRKLIGAKSYSRGYISYVGSLNSSLNNARDHEGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPG NV+GL N T KGGSPKARVA+YKVCWP  +    C+D+D++  FD AI
Sbjct  226   LSTAGGNFVPGTNVYGLANVTPKGGSPKARVASYKVCWPAVNNTGGCFDSDMMKAFDDAI  285

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVS+GGD P  YFND +AIGSFHAVK G+VVV SAGN GP  G+V+NVAPW+I
Sbjct  286   HDGVDVLSVSVGGD-PIDYFNDGIAIGSFHAVKKGVVVVCSAGNSGPTPGTVSNVAPWII  344

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T+DR FQ+ V L N +   G S +   +P  K YPL+S A  +    AS   +DA
Sbjct  345   TVGASTLDREFQTFVELHNGRRLKGTS-LSKGMPESKLYPLISGAQGKA---ASAFEKDA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               CKPG+LDP+KVKGK+L CL+G+N R++K  +AA AGA GMIL ND+ SGNE+IAD H 
Sbjct  401   ELCKPGSLDPKKVKGKILACLRGDNARVDKGRQAAEAGAAGMILCNDKASGNEVIADPHV  460

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+H+ Y+DGLA+  YIN + NP+A+IT P    GVKPAP +AAFSS GPN + P+ILK
Sbjct  461   LPASHLNYADGLAVLTYINTSSNPLAYITTPTAATGVKPAPFMAAFSSIGPNTVTPEILK  520

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVN+IAAFTEAT P+D ++DKR V +   SGTSMSCPHV+GV GLLK L+P WS
Sbjct  521   PDITAPGVNIIAAFTEATSPTDLEFDKRRVPYTTMSGTSMSCPHVSGVAGLLKKLHPDWS  580

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSA+ TTA  R N+   + D  T  K+TPF++G+GHI PN A DPGLVYDL + DY
Sbjct  581   PAAIRSALTTTARSRDNTVHPMLDGSTFEKSTPFSHGSGHIRPNRAMDPGLVYDLGVNDY  640

Query  557   VNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GYN+T I A+  G PY+CP   SL  FNYPS+TVP L+G+ T TR LKNVGSP
Sbjct  641   LDFLCALGYNETSIKALNDGEPYECPKSASLLDFNYPSMTVPKLRGSVTATRKLKNVGSP  700

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
               Y   V+ P G SV+V P+ L F+K+GEE+SFKVT +AK E A  DY FG LTW+D
Sbjct  701   GKYQVVVKQPYGISVSVEPRALTFDKIGEEKSFKVTFRAKWEGAAKDYEFGGLTWTD  757



>ref|XP_010063227.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=769

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/729 (61%), Positives = 551/729 (76%), Gaps = 9/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ LLG+YLGS  KA++AIFYSYT HINGFAA+LEE++AAEIAK+P+V+SVF
Sbjct  47    DIESATNSHYDLLGSYLGSNKKAQEAIFYSYTHHINGFAAILEEDQAAEIAKHPDVLSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++ R+LQTTRSW FLGLE   GVIH  SI +KA+FGEDTIIGNLDTGVWPESKSFS+EG
Sbjct  107   LSKGRKLQTTRSWHFLGLE-RNGVIHQSSILRKARFGEDTIIGNLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP +W+GICQ      F CNRKLIGARYF +GY++  G LN +F+T RD  GHGSHT
Sbjct  166   MGPIPGKWRGICQRGIKDDFSCNRKLIGARYFNKGYAAYAGRLNYTFYTARDHKGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FVPGANVFG GNGTAKGGSP+ARV AYKVCWPP    + C+DADIL GFD AI
Sbjct  226   LSTAGGSFVPGANVFGYGNGTAKGGSPRARVVAYKVCWPPIHQ-KKCFDADILLGFDAAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSL GD P  +F DS+AIGSFHA +NGIVVV+SAGN GP  G+V NVAPW+I
Sbjct  285   SDGVDVLSVSLVGD-PEEFFMDSIAIGSFHAARNGIVVVSSAGNSGPQPGTVCNVAPWMI  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR F + V LG+K+   G S     LP+ K YPL+S A A+I    ++S   A
Sbjct  344   TVAASTIDREFTTYVALGDKQRLKGSSLSANGLPSNKLYPLISGADAKI---TNVSAAKA  400

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI-IADAH  1101
             L C  GTLD +KVKGK+L CL+ E   +++ H+AALAGAVGM+LANDE SGN+I +A A+
Sbjct  401   LRCLAGTLDHKKVKGKILACLR-EYGTVDEGHQAALAGAVGMVLANDEASGNDIFVAQAY  459

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA H+++ DG  +F YIN T+ PVAHIT   T+L   PAP++A+FSSRGPN + P IL
Sbjct  460   VLPAAHISFLDGKVLFTYINSTKFPVAHITRVKTMLNTTPAPIMASFSSRGPNTVEPAIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA T A GP+  ++DKR   F   SGTSMSCPHV+G+VGLLKTLYP W
Sbjct  520   KPDITAPGVNIIAANTLAVGPTGEEFDKRRTPFKAASGTSMSCPHVSGIVGLLKTLYPGW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+ R N  + + D    +K TPF+YGAGHI P+ A DPGLVYDL + D
Sbjct  580   SPAAIQSAIMTTASTRDNKVEPVHDSSL-VKATPFSYGAGHIQPSRAMDPGLVYDLTVND  638

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y++F+CA+GY+++++ +     + CP H +++  NYPSITVP+L GT  VTR ++NVG+P
Sbjct  639   YLDFLCARGYDESQLRSFTNEIHACPKHFNVADMNYPSITVPNLNGTVVVTRRVRNVGTP  698

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY   +++P G  V+V P+ L FE+  EE+ FKV LK K      DY FG L WSD  H
Sbjct  699   GTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAGKPVDYVFGRLIWSDGVH  758

Query  200   RVRSPIVVK  174
              VRSP+VVK
Sbjct  759   YVRSPLVVK  767



>gb|AAM15483.1| subtilisin-like serine protease AIR3 [Arabidopsis thaliana]
Length=755

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/713 (60%), Positives = 534/713 (75%), Gaps = 9/713 (1%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             +DRVK +H+  LG++ GS ++A DAIFYSYT+HINGFAA L+ + A EI+K+PEV+SVF 
Sbjct  50    MDRVKETHYDFLGSFTGSRERATDAIFYSYTKHINGFAAHLDHDLAYEISKHPEVVSVFP  109

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+A +L TTRSW+FLGLE     +   SIW+KA+FGEDTII NLDTGVWPESKSF +EG 
Sbjct  110   NKALKLHTTRSWDFLGLE-HNSYVPSSSIWRKARFGEDTIIANLDTGVWPESKSFRDEGL  168

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             GPIP RWKGICQNQKD +FHCNRKLIGARYF +GY++AVG LNSSF +PRD+ GHGSHTL
Sbjct  169   GPIPSRWKGICQNQKDATFHCNRKLIGARYFNKGYAAAVGHLNSSFDSPRDLDGHGSHTL  228

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G+FVPG ++FG GNGTAKGGSP+ARVAAYKVCWPP   G +CYDAD+LA FD AI 
Sbjct  229   STAAGDFVPGVSIFGQGNGTAKGGSPRARVAAYKVCWPPVK-GNECYDADVLAAFDAAIH  287

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DG DV+SVSLGG+ P  +FNDS+AIGSFHA K  IVVV SAGN GP   +V+NVAPW IT
Sbjct  288   DGADVISVSLGGE-PTSFFNDSVAIGSFHAAKKRIVVVCSAGNSGPADSTVSNVAPWQIT  346

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+TMDR F SN+VLGN KHY G+S     LP  KFYP++++ +A+ K   + S  DA 
Sbjct  347   VGASTMDREFASNLVLGNGKHYKGQSLSSTALPHAKFYPIMASVNAKAK---NASALDAQ  403

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              CK G+LDP K KGK+LVCL+G+N R+EK    AL G +GM+L N   +GN+++AD H L
Sbjct  404   LCKLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVL  463

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PAT +T  D  A+  YI++T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  464   PATQLTSKDSFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKP  523

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             A IRSAIMTTAT+  +    I  + T +K TPF++GAGH+ PN A +PGLVYDL + DY+
Sbjct  584   AAIRSAIMTTATIMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYL  642

Query  554   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  381
             NF+C+ GYN ++I+   G  + C    ISL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVL  222
             + YT  V +P G  V V P  L F KVGE+++FKV L     N    Y FG L
Sbjct  703   SMYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGEL  755



>gb|KCW70439.1| hypothetical protein EUGRSUZ_F03664 [Eucalyptus grandis]
Length=767

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/729 (60%), Positives = 551/729 (76%), Gaps = 11/729 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D + V  SH+ LLG+YLGS +KA++AIFYSYT HINGFAA+LEE+EAAEIAK+  V+SVF
Sbjct  47    DFESVTDSHYDLLGSYLGSNEKAQEAIFYSYTHHINGFAAILEEDEAAEIAKHANVLSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++ R+L TTRSW FLGLE   GVIH  SI +KA+FGEDTIIG+LDTGVWPESKSFS+EG
Sbjct  107   LSKRRELHTTRSWHFLGLE-RNGVIHKSSILRKARFGEDTIIGSLDTGVWPESKSFSDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP++W+GICQ      F CNRKLIGARYF +GY++  G L+ +F+T RD  GHGSHT
Sbjct  166   MGPIPRKWRGICQRGIKDGFSCNRKLIGARYFNKGYAARGGHLDYTFYTARDHEGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FVPGA+ FG GNGTAKGGSP+ARVAAYKVCWP      +C+DADILAGFD AI
Sbjct  226   LSTAGGSFVPGASFFGYGNGTAKGGSPRARVAAYKVCWPE----NECFDADILAGFDAAI  281

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG+ P  YF DS+A+GSFHA +NGIVVV+SAGN GP  G+V NVAPW+I
Sbjct  282   SDGVDVLSVSLGGN-PEEYFMDSIAVGSFHAARNGIVVVSSAGNRGPPLGTVGNVAPWMI  340

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR F + V LG+K+   G S    +LP+ KFYPL+S A A+I    ++S  +A
Sbjct  341   TVAASTIDREFTTYVALGDKQRLKGSSLSANRLPSNKFYPLISGADAKI---TNVSAAEA  397

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI-IADAH  1101
             L C  GTLD +KVKGK+L CL G  + + K H+AALAGAVGM+LANDE +G +I +A+AH
Sbjct  398   LRCLAGTLDHKKVKGKILTCLSGAYEAVNKGHQAALAGAVGMVLANDEANGKDIFVAEAH  457

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LP  H+++ DG  +F YIN T+ PVAHIT   T+L   PAP++ +FSSRGPN + P IL
Sbjct  458   VLPTAHISFLDGKVLFTYINSTKFPVAHITRAKTMLNTTPAPIMTSFSSRGPNTVEPAIL  517

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA++   GP+  ++DKR   F  ++GTSM+CPHV+G+ GLLKTLYPSW
Sbjct  518   KPDIAAPGVNIIAAYSLVVGPTGQEFDKRRTPFKADTGTSMACPHVSGIAGLLKTLYPSW  577

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+ R N  + + +  + +K TPF+YGAGHI PN A DPGLVYDL + D
Sbjct  578   SPAAIQSAIMTTASTRDNKVEPVLNS-SFVKATPFSYGAGHIRPNRAMDPGLVYDLTVHD  636

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y++FICA+GY+++++       + CP H +++  NYPSITVP+L GT  VTR ++NVG+P
Sbjct  637   YLDFICARGYDESQLRLFTNEIHTCPKHFNVADMNYPSITVPNLNGTVVVTRRVRNVGTP  696

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY   +++P G  V+V P+ L FE+  EE+ FKV LK K      DY FG L WSD  H
Sbjct  697   GTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAGKPVDYVFGRLIWSDGVH  756

Query  200   RVRSPIVVK  174
              VRSP+VVK
Sbjct  757   YVRSPLVVK  765



>gb|KGN55998.1| hypothetical protein Csa_3G045120 [Cucumis sativus]
Length=760

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/732 (59%), Positives = 545/732 (74%), Gaps = 12/732 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D      SH  LLG++LGS ++A++AIFYSY RHINGFAA+++++ A ++AK+P+V+SV 
Sbjct  34    DAQIATESHFNLLGSFLGSNEEAKEAIFYSYNRHINGFAAVVDQKVAEDLAKHPDVVSVL  93

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ R+L TT SW+FLGLE  G  I   S+W  A FGE TIIGNLDTGVWPESKSFS++ 
Sbjct  94    ENKGRKLHTTNSWKFLGLENNGA-IPSNSLWNLASFGESTIIGNLDTGVWPESKSFSDKE  152

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GPIP RWKG C+      F+CNRKLIGARY+ +GY++ VGPLNSS+ + RD  GHG+HT
Sbjct  153   YGPIPSRWKGSCEG--GSKFYCNRKLIGARYYNKGYAAIVGPLNSSYESARDHEGHGTHT  210

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FVP AN+FG GNGTAKGGSPKA VAAYKVCWP      +C+DADILAGF+ AI
Sbjct  211   LSTAGGHFVPNANLFGYGNGTAKGGSPKALVAAYKVCWPQVLFFGECFDADILAGFEAAI  270

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG  P  +  DS++IGSFHAV+NGIVVV SAGN GP  GSV+NVAPW+I
Sbjct  271   GDGVDVLSVSLGGS-PSDFAKDSISIGSFHAVQNGIVVVCSAGNSGPTPGSVSNVAPWII  329

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T DR + S V +G+K+H+ G S    KLP  KFYPL+S+  A+ K   +++  DA
Sbjct  330   TVGASTTDRLYTSYVAIGDKRHFKGASVSDKKLPVQKFYPLISSLDAKAK---NVTDNDA  386

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L C+ G+LDP+KV GK+++CL+G+N R+ K + AA AGAVGMILAN E++G+EI+ADAH 
Sbjct  387   LLCEEGSLDPKKVNGKIIICLRGDNARVAKGYVAAKAGAVGMILANAEENGDEILADAHL  446

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+H+TYSDG  ++ YIN T+ P+A++TH  T  G+KPAPV+A+FSSRGPN ++P ILK
Sbjct  447   LPASHITYSDGQLVYQYINSTKIPMAYMTHVRTEEGIKPAPVMASFSSRGPNTVDPSILK  506

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APG N++AA++    P+  D+DKR V FNVESGTSMSCPHV+G+VGLLKTLYP WS
Sbjct  507   PDITAPGENILAAYSRDASPTGTDFDKRRVPFNVESGTSMSCPHVSGIVGLLKTLYPKWS  566

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTTA  +AN    I       K   FAYGAGH++PN AADPGLVYDL   DY
Sbjct  567   PAAIRSAIMTTAGTKANDLTPILSTNQE-KANAFAYGAGHVSPNRAADPGLVYDLSTKDY  625

Query  557   VNFICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKGTATV--TRTLKNVG  387
             +N++CAQGYN  +I      T + C     L+  NYPSI++P L+    V   R LKNVG
Sbjct  626   LNYLCAQGYNTAQIKQFSNDTSFVCSKSFKLTDLNYPSISIPILEYDVAVKIKRKLKNVG  685

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATA-DYAFGVLTWSD  210
             SP TY   V+ P+G SV+V P  LKF  + EE+SF+V LK+   N +   Y FG L WSD
Sbjct  686   SPGTYVVQVKEPLGVSVSVEPTSLKFTGIDEEKSFRVVLKSYEPNGSGPKYLFGKLEWSD  745

Query  209   KKHRVRSPIVVK  174
              KHRVRSPIVV+
Sbjct  746   GKHRVRSPIVVR  757



>ref|XP_010064971.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=754

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/729 (60%), Positives = 551/729 (76%), Gaps = 11/729 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D + V  SH+ LLG+YLGS +KA++AIFYSYT HINGFAA+LEE+EAAEIAK+  V+SVF
Sbjct  34    DFESVTDSHYDLLGSYLGSNEKAQEAIFYSYTHHINGFAAILEEDEAAEIAKHANVLSVF  93

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++ R+L TTRSW FLGLE   GVIH  SI +KA+FGEDTIIG+LDTGVWPESKSFS+EG
Sbjct  94    LSKRRELHTTRSWHFLGLE-RNGVIHKSSILRKARFGEDTIIGSLDTGVWPESKSFSDEG  152

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP++W+GICQ      F CNRKLIGARYF +GY++  G L+ +F+T RD  GHGSHT
Sbjct  153   MGPIPRKWRGICQRGIKDGFSCNRKLIGARYFNKGYAARGGHLDYTFYTARDHEGHGSHT  212

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FVPGA+ FG GNGTAKGGSP+ARVAAYKVCWP      +C+DADILAGFD AI
Sbjct  213   LSTAGGSFVPGASFFGYGNGTAKGGSPRARVAAYKVCWPE----NECFDADILAGFDAAI  268

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG+ P  YF DS+A+GSFHA +NGIVVV+SAGN GP  G+V NVAPW+I
Sbjct  269   SDGVDVLSVSLGGN-PEEYFMDSIAVGSFHAARNGIVVVSSAGNRGPPLGTVGNVAPWMI  327

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR F + V LG+K+   G S    +LP+ KFYPL+S A A+I    ++S  +A
Sbjct  328   TVAASTIDREFTTYVALGDKQRLKGSSLSANRLPSNKFYPLISGADAKI---TNVSAAEA  384

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI-IADAH  1101
             L C  GTLD +KVKGK+L CL G  + + K H+AALAGAVGM+LANDE +G +I +A+AH
Sbjct  385   LRCLAGTLDHKKVKGKILTCLSGAYEAVNKGHQAALAGAVGMVLANDEANGKDIFVAEAH  444

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LP  H+++ DG  +F YIN T+ PVAHIT   T+L   PAP++ +FSSRGPN + P IL
Sbjct  445   VLPTAHISFLDGKVLFTYINSTKFPVAHITRAKTMLNTTPAPIMTSFSSRGPNTVEPAIL  504

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA++   GP+  ++DKR   F  ++GTSM+CPHV+G+ GLLKTLYPSW
Sbjct  505   KPDIAAPGVNIIAAYSLVVGPTGQEFDKRRTPFKADTGTSMACPHVSGIAGLLKTLYPSW  564

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+ R N  + + +  + +K TPF+YGAGHI PN A DPGLVYDL + D
Sbjct  565   SPAAIQSAIMTTASTRDNKVEPVLNS-SFVKATPFSYGAGHIRPNRAMDPGLVYDLTVHD  623

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y++FICA+GY+++++       + CP H +++  NYPSITVP+L GT  VTR ++NVG+P
Sbjct  624   YLDFICARGYDESQLRLFTNEIHTCPKHFNVADMNYPSITVPNLNGTVVVTRRVRNVGTP  683

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TY   +++P G  V+V P+ L FE+  EE+ FKV LK K      DY FG L WSD  H
Sbjct  684   GTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAGKPVDYVFGRLIWSDGVH  743

Query  200   RVRSPIVVK  174
              VRSP+VVK
Sbjct  744   YVRSPLVVK  752



>ref|XP_008794749.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=776

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/728 (61%), Positives = 548/728 (75%), Gaps = 9/728 (1%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             RV+ SHH+LL + LG+ +KA+DA+FYSYTR+INGFAA LEEEEA EI+K P V+SVF NR
Sbjct  53    RVRDSHHELLASVLGNKEKAQDALFYSYTRYINGFAANLEEEEAMEISKYPGVVSVFPNR  112

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSW+FL LE +G V  + S+W KA+FGED IIGNLDTGVWPES+SF ++G GP
Sbjct  113   GYKLHTTRSWDFLRLERDGRVPKE-SLWTKARFGEDIIIGNLDTGVWPESESFKDDGMGP  171

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +WKGICQ  +DKSF CNRKLIGARY+ +GY+SA GPLN++F TPRD +GHG+HTLST
Sbjct  172   VPSKWKGICQIGEDKSFSCNRKLIGARYYNKGYASAAGPLNATFETPRDEVGHGTHTLST  231

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             AGG FVPGAN+ G GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+A FD AI DG
Sbjct  232   AGGGFVPGANILGYGNGTAKGGSPRARVAAYKVCWPPIN-GSECFDADIIAAFDAAIHDG  290

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLSVSLGGD P  YF D LAIGSFHAVKNGI VV SAGN GP  GSV+N APW+ITVG
Sbjct  291   VDVLSVSLGGD-PTDYFLDGLAIGSFHAVKNGITVVCSAGNSGPRPGSVSNTAPWIITVG  349

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TMDR F + +   N K   GES     LP  + YP++S+  AR    ++ S  DA  C
Sbjct  350   ASTMDREFPAYINF-NNKSIKGESLSQKGLPGNELYPMISSKEARA---SNASAHDAELC  405

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDPEKV+GK++VCL+G   R+EK      AG  GM+L ND+ SGNEIIADAH LPA
Sbjct  406   YLGSLDPEKVRGKIVVCLRGITARVEKGEAVLQAGGSGMVLVNDQSSGNEIIADAHLLPA  465

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             TH+TY+DG ++F Y+  T++P+ +IT P T L  KPAP +AAFSS+GPN +N +ILKPDI
Sbjct  466   THITYNDGFSLFSYLKSTKSPLGYITTPITQLDTKPAPFMAAFSSQGPNTVNAEILKPDI  525

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGV+V+AA+T A GP+   +D R V+FN +SGTSMSCPH++GVVGLLK+L+P WSP+ 
Sbjct  526   TAPGVSVLAAYTGAAGPTGLAFDTRRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWSPSA  585

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  + +  + + +    +K TPF+YG+GH+ PN A DPGLVYDL   DY+NF
Sbjct  586   IKSAIMTTARTQDSMDEPVLNSSY-VKATPFSYGSGHVQPNRAMDPGLVYDLTTNDYLNF  644

Query  548   ICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  372
             +CA GYN T+I       + CP     L   NYPSIT+P L G+ TVTR +KNVGSP TY
Sbjct  645   LCALGYNSTQIAIFSNDSFSCPSKPPKLEDLNYPSITIPDLSGSITVTRAMKNVGSPGTY  704

Query  371   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVR  192
                VR P G SV+VNP  L ++K+GEE+ F+VTLK K  +A+ DY FG L WSD KH VR
Sbjct  705   IVRVREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVKKGHASTDYVFGGLIWSDGKHYVR  764

Query  191   SPIVVKTA  168
             +PIVV  A
Sbjct  765   TPIVVSAA  772



>gb|KEH32715.1| subtilisin-like serine protease [Medicago truncatula]
Length=770

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/731 (60%), Positives = 548/731 (75%), Gaps = 16/731 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D D+V  +HH+ L +Y+GS +KA++A+ YSYT++INGFAA LEE+EAA+IA++P V+SV 
Sbjct  47    DFDQVTKTHHEFLQSYVGSHEKAKEAMIYSYTKNINGFAAFLEEKEAADIAEHPNVVSVL  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LNR R+L TT SWEF+ LE   GV    S+  KA++GED IIGNLDTGVWPES SF +EG
Sbjct  107   LNRGRKLHTTHSWEFMSLE-HNGVAPSHSLLTKARYGEDVIIGNLDTGVWPESPSFRDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSS-AVGPL---NSSFFTPRDVIGH  1830
              GPIP RWKG CQ+     F CNRKLIGARYF +GY++ A G +   N +  T RD  GH
Sbjct  166   IGPIPSRWKGTCQSDH-TGFRCNRKLIGARYFNKGYAAYAAGSMVLQNGTLDTARDNEGH  224

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLST GGNFV G NVFGLGNGTAKGGSPKARVAAYKVCWP       C+DADI+A F
Sbjct  225   GSHTLSTIGGNFVSGVNVFGLGNGTAKGGSPKARVAAYKVCWPAID-HNGCFDADIMAAF  283

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             D AI DGVDVLS+SLGGD    YF+D L+I +FHAVK GI V+ SAGN GP  G+V+NVA
Sbjct  284   DMAIHDGVDVLSLSLGGD-ASDYFDDGLSIAAFHAVKEGITVLCSAGNSGPTPGTVSNVA  342

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW++TV A+T+DR F ++V L N +H+ G+S + + LP  K YPL++AA AR+   A   
Sbjct  343   PWILTVAASTIDRDFDASVQLHNGQHFRGDS-LSIALPENKLYPLITAAEARL---AEAP  398

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
              ++A  C  GT+DPEK +G++LVCL+G + R+EKS  A  A AVGMIL ND+ +GNE+IA
Sbjct  399   VENATLCMNGTIDPEKARGRILVCLRGISARVEKSFVALEAEAVGMILCNDQSNGNELIA  458

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D HFLPAT +TY+DG+A+F YIN T+NP+ +I  P T L +KPAP +AAFSSRGPN I P
Sbjct  459   DPHFLPATQITYADGVALFAYINSTKNPLGYIHPPTTKLNIKPAPSMAAFSSRGPNPITP  518

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +ILKPD++APGVN+IAA++ A  P++ D+DKR V F   SGTSMSCPHVAGVVGLLKTL+
Sbjct  519   EILKPDVTAPGVNIIAAYSGAISPTELDFDKRRVPFITMSGTSMSCPHVAGVVGLLKTLH  578

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P+WSP+ I+SAIMTTA  R N+ K I DD T +K TPFAYG+GHI PN A DPGLVY+L 
Sbjct  579   PNWSPSAIKSAIMTTARTRDNTHKPILDD-TNVKATPFAYGSGHIRPNRAMDPGLVYELN  637

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNV  390
             + DY+NF+C  GYN+ +IT   GTPY C D I++  FNYP+IT+P L G+ T++R LKNV
Sbjct  638   INDYLNFLCFLGYNQAQITMFSGTPYHCED-INILDFNYPTITIPKLYGSVTLSRKLKNV  696

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             G P TYTAS+R PVG S++V PK LKF+K+GEE+SF +T++           FG LTWSD
Sbjct  697   GPPGTYTASLRVPVGLSISVQPKKLKFDKIGEEKSFSLTIEVTRSGMAT--VFGGLTWSD  754

Query  209   KKHRVRSPIVV  177
               H VRSPI V
Sbjct  755   GTHYVRSPIAV  765



>ref|XP_006400913.1| hypothetical protein EUTSA_v10015943mg [Eutrema salsugineum]
 gb|ESQ42366.1| hypothetical protein EUTSA_v10015943mg [Eutrema salsugineum]
Length=761

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/729 (60%), Positives = 541/729 (74%), Gaps = 15/729 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L+ V H+H   L ++LGS  +A DAIFYS+ RHINGFAA+L E EAAEIAK+P+V+SVFL
Sbjct  45    LNGVAHAHRTFLASFLGSHKRANDAIFYSFKRHINGFAAVLHENEAAEIAKHPDVVSVFL  104

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW F+ LE + GV+H  S+W KA FGEDTII NLDTGVWPESKSF++EG+
Sbjct  105   NKGRKLHTTHSWNFMLLE-KNGVVHKSSLWHKAGFGEDTIIANLDTGVWPESKSFTDEGY  163

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C     K   CNRKLIGA+YF +GY +  G P N+SF TPRD  GHGSHT
Sbjct  164   GSVPARWKGSCH----KDVSCNRKLIGAKYFNKGYLAYTGFPSNASFETPRDHDGHGSHT  219

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGANVFGLGNGTA GGSP AR AAYKVCWPP + G +C+DAD+LA FD AI
Sbjct  220   LSTAAGNFVPGANVFGLGNGTASGGSPNARTAAYKVCWPPAN-GAECFDADMLAAFDEAI  278

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDV+SVS+GGD  G Y ND +AIGSFHAVKNG+ VV SAGN GP  GSV+NVAPW+I
Sbjct  279   GDGVDVISVSVGGD-AGDYMNDGIAIGSFHAVKNGVTVVCSAGNSGPKPGSVSNVAPWII  337

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N + + G S +   LP  K Y L++A  A+    A+ ST++A
Sbjct  338   TVGASSMDREFQAFVELKNGQRFKGTS-LSKPLPEEKMYDLINAGDAKA---ANASTKEA  393

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK  +LDPEKVKGK++VCL+G+N R++K  +AA AGAVGMIL ND+ SGNEI++DAH 
Sbjct  394   LLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEILSDAHV  453

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG A+F Y+N T+ P  +I+ P + L  KPAP +A+FSSRGPN + P ILK
Sbjct  454   LPASQIDYEDGEAVFSYLNSTKEPKGYISPPASKLNTKPAPFMASFSSRGPNTVTPGILK  513

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVNVIAAFTEAT P+D D D R   +N ESGTSMSCPH++G+VGLLKTL+P WS
Sbjct  514   PDITAPGVNVIAAFTEATSPTDLDSDNRRTPYNTESGTSMSCPHISGIVGLLKTLHPQWS  573

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMT++  R N  K + D     K+TPF+YG+GH+ PN A+ PGLVYDL   DY
Sbjct  574   PAAIRSAIMTSSRTRDNRRKPMVDQSFN-KSTPFSYGSGHVQPNKASHPGLVYDLTTGDY  632

Query  557   VNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GYN T +        Y C    +L  FNYPSITVP+L  + TVTR LKNVG P
Sbjct  633   LDFLCAIGYNNTIVQLFAEDRHYICRQGANLLDFNYPSITVPNLTDSVTVTRKLKNVGPP  692

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TY A  R P+G SV+V PK LKF ++GE + F++TL+ K   +   Y FG L W+D KH
Sbjct  693   STYNAHFREPLGVSVSVEPKQLKFNEIGEVKMFQMTLRPKSSKSLG-YVFGELKWTDSKH  751

Query  200   RVRSPIVVK  174
              VRSPIVVK
Sbjct  752   YVRSPIVVK  760



>ref|XP_010539197.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Tarenaya hassleriana]
Length=774

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/729 (62%), Positives = 543/729 (74%), Gaps = 8/729 (1%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  SHH  L +++GS ++A+D+IFYSY RHINGFAA LEEEEAAEIAK+P+V+SVF
Sbjct  48    DLDRVTLSHHNFLSSFVGSQERAKDSIFYSYQRHINGFAANLEEEEAAEIAKHPDVLSVF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TTRSW+F+ L  +G V H  S+W KA++G+DTIIGN+DTGVWPESKSFS+EG
Sbjct  108   LNKGRKLHTTRSWDFMLLRKDGVVRHS-SLWSKAQYGQDTIIGNIDTGVWPESKSFSDEG  166

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSH  1821
             +GP P +WKG CQN   +   CNRKLIGA+YF +GY S  G P N++F T RD  GHGSH
Sbjct  167   YGPPPAKWKGKCQNDTKEGVPCNRKLIGAKYFNKGYFSGTGVPSNATFETARDNNGHGSH  226

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAG NFV GANVFG GNGTA GGSPKARVAAYKVCWP    G  C+DADILA FD A
Sbjct  227   TLSTAGXNFVQGANVFGNGNGTASGGSPKARVAAYKVCWPQVLDGGGCFDADILAAFDAA  286

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I+DGVDVLSVS+GGD P  Y N+ +AIGSFHAVK GI VV SAGN GP  GSV+NVAPW+
Sbjct  287   IDDGVDVLSVSVGGD-PDEYLNEGMAIGSFHAVKAGITVVCSAGNSGPQNGSVSNVAPWI  345

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TVGA+++DR FQ+ V L N + + G S +   L   K Y L+S A A+    A+ S  D
Sbjct  346   LTVGASSIDREFQAFVELENGQRFKGTS-LSDPLSEEKMYTLISGAEAK---AANASATD  401

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ C  G+LDP+ VKGK++VCL+GEN R+EK  +AA AGA GMIL N+E SGNEII+DAH
Sbjct  402   AMVCMKGSLDPKMVKGKIIVCLRGENARVEKGAQAAAAGAAGMILCNEEASGNEIISDAH  461

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LP +H+ Y DGL +F Y+N TRNP  ++  PN+ L  KPAP +A+FSSRGPN I PDIL
Sbjct  462   VLPTSHINYQDGLKVFSYLNSTRNPKGYLRPPNSKLNTKPAPFMASFSSRGPNTITPDIL  521

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAAFTEAT P+D D DKR   FN ESGTSMSCPH++GVVGLLKTL+P W
Sbjct  522   KPDITAPGVNIIAAFTEATSPTDLDSDKRKTPFNTESGTSMSCPHISGVVGLLKTLHPDW  581

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMTTA  R N    I D  T  K TPFAYG+GH+ PN A DPGLVYDL   D
Sbjct  582   SPAAIRSAIMTTARSRDNRMAPILDG-TFEKATPFAYGSGHVRPNRAGDPGLVYDLSTGD  640

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             Y+NF+CA GY +T I      PYKC +  +L  FNYPSITV  L G+ TVTR LKNVG  
Sbjct  641   YLNFLCAVGYTETMIRKFAEQPYKCREGANLLDFNYPSITVASLTGSVTVTRRLKNVGGA  700

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
               Y A VR+PVG SV+V P  L+F ++GEE+ F++TL  K    ++ Y FG LTW+D  H
Sbjct  701   GKYMARVRAPVGVSVSVKPTQLEFGELGEEKVFQMTLSPKPNWRSSGYVFGSLTWTDGHH  760

Query  200   RVRSPIVVK  174
              VRSPI V+
Sbjct  761   YVRSPITVQ  769



>ref|XP_006469402.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=771

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/732 (60%), Positives = 542/732 (74%), Gaps = 11/732 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL R   SH++ LG+YLGS +   +AIFYSYTRHINGFAA L++  AAEIAK+P+V+SV
Sbjct  46    VDLKRATQSHYEFLGSYLGSNENPEEAIFYSYTRHINGFAAKLDDAVAAEIAKHPKVLSV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FL++ ++L TT SWEFLGLE + G I   SIW+KA++GED IIGN+D+GVWPESKSFS+E
Sbjct  106   FLSKEKKLHTTHSWEFLGLE-QNGRIPPNSIWEKARYGEDAIIGNIDSGVWPESKSFSDE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             GFGPIP +WKGICQN KD  FHCNRKLIGARYF   ++   GPLNS F++PRD+ GHG+H
Sbjct  165   GFGPIPSKWKGICQNDKDSRFHCNRKLIGARYFNHEFAVHKGPLNSFFYSPRDIDGHGTH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG G GTAKGGSPKARVAAYKVCW  +     C+D DI+A FD A
Sbjct  225   TLSTAGGNFVAGASVFGFGKGTAKGGSPKARVAAYKVCWEGSG---GCFDGDIIAAFDMA  281

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG+ P     D +AIGSFHAV++GIVVV SAGNEGP   + +NVAPW 
Sbjct  282   IHDGVDVLSVSLGGEKPSQLLEDGIAIGSFHAVQHGIVVVTSAGNEGPADSTASNVAPWQ  341

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             I VGA+T DR F + VVLGN K + G+S     LP+ K +P +SA  A++   A+ S ++
Sbjct  342   IVVGASTTDRDFANYVVLGNNKRFKGQSLSMKGLPSDKLFPFISAEDAKL---ANASVEN  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLDP+KVKGK+LVCL      ++K  +AALAGA G++L N  + GN+ + D H
Sbjct  399   ALICKKGTLDPKKVKGKILVCLDVNTRSVDKGLQAALAGAAGIVLVNLPEYGNDRMTDPH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+ + ++D +++F YI   ++PV +IT P T  G KPAP +AAFSS+GPN I P+IL
Sbjct  459   VLPASDINFNDSVSLFSYITSIKHPVGYITRPTTEFGTKPAPFMAAFSSKGPNIITPEIL  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APG N+IAA+TEA  P+  +YDKR   FN  SGTSMSCPH++G+  LLK L+P W
Sbjct  519   KPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSMSCPHISGIASLLKILHPDW  578

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+   N+ + I  + +  + TPF+YGAGH+ PN A DPGLVYDL   D
Sbjct  579   SPAAIQSAIMTTASTHDNNKQQIL-NASFAEATPFSYGAGHVQPNLAMDPGLVYDLTAND  637

Query  560   YVNFICAQGYNKTEITAVLGT-PYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             Y+NF+C  GYNK EI        Y CP H ISL  FNYPSITVP L G+ TVTR +KNVG
Sbjct  638   YLNFLCTLGYNKKEIFWFSKNYTYTCPKHTISLVDFNYPSITVPKLSGSITVTRKVKNVG  697

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS-D  210
             SP TY A ++SP G SVT+ PK LKF  VGEE+SFKV  KA+  + T DYAFG L WS D
Sbjct  698   SPGTYQALLKSPKGVSVTIAPKSLKFINVGEEKSFKVIFKAQNASVTKDYAFGELIWSDD  757

Query  209   KKHRVRSPIVVK  174
             K H+VRSPIVVK
Sbjct  758   KHHQVRSPIVVK  769



>ref|XP_009394691.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=784

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/729 (59%), Positives = 538/729 (74%), Gaps = 10/729 (1%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             R   SH++LLG+ L   +K +DAIFYSYT +INGFAA LEE+ A +I+K P V+SVF NR
Sbjct  58    RATESHYELLGSVLEDKEKVQDAIFYSYTHNINGFAAYLEEQVALKISKYPGVVSVFPNR  117

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TT SWEFLGLE +G V    S+W+KA+FGEDTII NLD+GVWPE++SF ++G GP
Sbjct  118   GYKLHTTHSWEFLGLERDGRVPKQ-SLWRKARFGEDTIIANLDSGVWPEAQSFKDDGLGP  176

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             IP +WKGICQN  D+SF CNRKLIGARYF +GY + VGPLN++F +PRD  GHG+HTLST
Sbjct  177   IPSKWKGICQNDFDESFSCNRKLIGARYFNKGYEALVGPLNATFKSPRDYDGHGTHTLST  236

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             AGG FVP AN+FG GNGTAKGGSP ARVAAYKVCWPP + G +C+DADILA FD AI DG
Sbjct  237   AGGGFVPSANIFGYGNGTAKGGSPWARVAAYKVCWPPVN-GSECFDADILAAFDAAIRDG  295

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             +DV+SVSLGGD P  YF D LAIGSFHAVK GI VV+SAGN GP   +V+N++PW+ TVG
Sbjct  296   IDVISVSLGGD-PVDYFQDGLAIGSFHAVKKGITVVSSAGNSGPNLATVSNLSPWMFTVG  354

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TMDR+F S +V  +K+   GES  P  LP  + YPL+S+A A++ +NAS   + A  C
Sbjct  355   ASTMDRQFPSVIVFDDKR-IKGESLSPKGLPGKRLYPLISSAEAKL-VNAS--ARQARLC  410

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDP KVKGK++VCL+G   R+EK      AG +GM+LAND D+GNEI+ADAH LPA
Sbjct  411   YLGSLDPAKVKGKIVVCLRGITARVEKGEAVHQAGGIGMVLANDVDNGNEIVADAHVLPA  470

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             TH+TYSDGL +F Y+  T++P+ +IT P T LG KPAP +AAFSS+GPN I P+ILKPD+
Sbjct  471   THITYSDGLTLFSYLGATKSPLGYITRPKTKLGAKPAPFMAAFSSKGPNTITPEILKPDV  530

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGV+V+AA++ A GP+   +D R V+FN ESGTSMSCPH++GV GLLKTL+P WSPA 
Sbjct  531   TAPGVSVLAAYSGAVGPTGLVFDGRRVAFNAESGTSMSCPHISGVAGLLKTLHPDWSPAA  590

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  R N  + + +     K TP  YG+GH+ PN A DPGLVYD+  TDY++F
Sbjct  591   IKSAIMTTARTRDNMKEPMLNSSFN-KATPLGYGSGHVRPNHAMDPGLVYDMTTTDYLDF  649

Query  548   ICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  372
             +C+ GY   ++    G PY CP   + +   NYPSIT+P L+ +  V R +KNVG P TY
Sbjct  650   LCSLGYTTAQLAMFNGEPYACPSTPLHIRDLNYPSITIPDLQSSTKVARVVKNVGPPGTY  709

Query  371   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAFGVLTWSDKKHRV  195
                V  P G SVTV+P  L FEKVGEE+ F+VT   K G+     Y FG L WSD KH V
Sbjct  710   VVRVVEPRGVSVTVSPASLTFEKVGEEKRFEVTAGIKEGKTDGGGYVFGGLIWSDGKHYV  769

Query  194   RSPIVVKTA  168
             RSP+VVK +
Sbjct  770   RSPLVVKCS  778



>gb|AIC80771.1| subtilase [Cicer arietinum]
Length=757

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/731 (59%), Positives = 541/731 (74%), Gaps = 17/731 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D DRV  +HH+ L +YLGS++KA+DA+ YSYTR+INGFAA+LEE+ A++IA++P V+SV 
Sbjct  35    DFDRVTETHHEFLQSYLGSYEKAKDAMIYSYTRNINGFAAILEEKHASQIAEHPNVVSVL  94

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LNR R+L TT SWEF+ +E + GV    S+++KA++GEDTIIGNLDTGVWPES SF +EG
Sbjct  95    LNRGRKLHTTHSWEFMSME-QNGVTPSESLFRKARYGEDTIIGNLDTGVWPESPSFRDEG  153

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP---LNSSFFTPRDVIGHG  1827
              GPIP RWKG C+      F CNRKLIGARYF +GY++  GP    N +  T RD  GHG
Sbjct  154   IGPIPSRWKGTCEGDI-TGFRCNRKLIGARYFNRGYAAYAGPKTIQNHTLNTARDYEGHG  212

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLST GGNFV GAN+FGLGNGTAKGGSPKARVA YKVCWPP   G +C+DADI+A FD
Sbjct  213   SHTLSTIGGNFVQGANIFGLGNGTAKGGSPKARVATYKVCWPPID-GNECFDADIMAAFD  271

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDVLS+SLGG     YF D L+I +FHAVK GI V+ SAGN GP   +V+N+AP
Sbjct  272   MAIHDGVDVLSLSLGGSAFN-YFEDGLSISAFHAVKKGITVLCSAGNSGPTPATVSNIAP  330

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W++TV A+T+DR F + V L N + + G S +   LP  K YPL+SAA A++   A  S 
Sbjct  331   WILTVAASTLDREFHTGVQLHNGQRFKGAS-LSKALPENKLYPLISAAEAKL---AEASV  386

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             +DA+ C  GT+DP+K +G++LVCL+GE  R+EKS  A  AGA GMIL ND  SGNE+I+D
Sbjct  387   EDAILCMEGTIDPKKARGQILVCLRGETARVEKSLVAFEAGAAGMILCNDMTSGNELISD  446

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              HFLP +H+ Y DG+A++ YIN T+NP+ +I  P T L +K +P +A FSSRGPN I P+
Sbjct  447   PHFLPTSHINYEDGVAVYAYINSTKNPLGYIHPPITKLNIKHSPSMATFSSRGPNTITPE  506

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPD++APGVN+IAA++ A  P++ ++DKR V F   SGTSMSCPHVAG+VGLLKTL+P
Sbjct  507   ILKPDVTAPGVNIIAAYSGAVSPTEMEFDKRRVPFITMSGTSMSCPHVAGIVGLLKTLHP  566

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSP+ I+SAIMTTA  R N+ K I D+   +K TPFAYG+GHI PN A DPGLVY+L +
Sbjct  567   DWSPSAIKSAIMTTARTRDNTAKPILDNNN-MKATPFAYGSGHIRPNRAMDPGLVYELNI  625

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY+NF+C  GYNKT+I    G  Y C D I++  FNYPSITVP L G+ T+TR LKNVG
Sbjct  626   NDYLNFLCFLGYNKTQIKMFSGNHYHCHD-INILDFNYPSITVPKLYGSVTLTRKLKNVG  684

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSD  210
              P TY AS+R P G  + V P ILKF+ +GEE+SFKV ++ A+   AT    FG LTWSD
Sbjct  685   PPGTYVASLRVPKGLFIFVEPNILKFDNIGEEKSFKVIIEVARSGVAT---VFGGLTWSD  741

Query  209   KKHRVRSPIVV  177
              KH VRSPIVV
Sbjct  742   GKHYVRSPIVV  752



>ref|XP_006447860.1| hypothetical protein CICLE_v10014355mg [Citrus clementina]
 gb|ESR61100.1| hypothetical protein CICLE_v10014355mg [Citrus clementina]
Length=771

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/732 (60%), Positives = 541/732 (74%), Gaps = 11/732 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL R   SH++ LG+YLGS +   +AIFYSYTRHINGFAA L++  AAEIAK+P+V+SV
Sbjct  46    VDLKRATQSHYEFLGSYLGSNENPEEAIFYSYTRHINGFAAKLDDAVAAEIAKHPKVLSV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FL++ ++L TT SWEFLGLE + G I   SIW+KA++GED IIGN+D+GVWPESKSFS+E
Sbjct  106   FLSKEKKLHTTHSWEFLGLE-QNGRIPPNSIWEKARYGEDAIIGNIDSGVWPESKSFSDE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             GFGPIP +WKGICQN KD  FHCNRKLIGARYF   ++   GPLNS F++PRD+ GHG+H
Sbjct  165   GFGPIPSKWKGICQNDKDSRFHCNRKLIGARYFNHEFAVHKGPLNSFFYSPRDIDGHGTH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG G GTAKGGSPKARVAAYKVCW  +     C+D DI+A FD A
Sbjct  225   TLSTAGGNFVAGASVFGFGKGTAKGGSPKARVAAYKVCWEGSG---GCFDGDIIAAFDMA  281

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGG+ P     D +AIGSFHAV++GIVVV SAGNEGP   + +NVAPW 
Sbjct  282   IHDGVDVLSVSLGGEKPSQLLEDGIAIGSFHAVQHGIVVVTSAGNEGPADSTASNVAPWQ  341

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             I VGA+T DR F + VVLGN K + G+S     LP+ K +P +SA  A++   A+ S ++
Sbjct  342   IVVGASTTDRDFANYVVLGNNKRFKGQSLSMKGLPSDKLFPFISAEDAKL---ANASVEN  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL CK GTLDP+KVKGK+LVCL      ++K  +AALAGA G++L N  + GN+ + D H
Sbjct  399   ALICKKGTLDPKKVKGKILVCLDVNTRSVDKGLQAALAGAAGIVLVNLPEYGNDRMTDPH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+ + ++D +++F YI   ++PV +IT P T  G KPAP +AAFSS+GPN I P+IL
Sbjct  459   VLPASDINFNDSVSLFSYITSIKHPVGYITRPTTEFGTKPAPFMAAFSSKGPNIITPEIL  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APG N+IAA+TEA  P+  +YDKR   FN  SGTSMSCPH++G+  LLK L+P W
Sbjct  519   KPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSMSCPHISGIASLLKILHPDW  578

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA+   N+ + I  + +  + TPF+YGAGH+ PN A DPGLVYDL   D
Sbjct  579   SPAAIQSAIMTTASTHDNNKQQIL-NASFAEATPFSYGAGHVQPNLAMDPGLVYDLTAND  637

Query  560   YVNFICAQGYNKTEITAVLGT-PYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             Y+NF+C  GYNK EI        Y CP H ISL  FNYPSITVP L G+ TVTR +KNVG
Sbjct  638   YLNFLCTLGYNKKEIFWFSKNYTYTCPKHTISLVDFNYPSITVPKLSGSITVTRKVKNVG  697

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS-D  210
             SP TY A ++SP G SVT+ PK L F  VGEE+SFKV  KA+  + T DYAFG L WS D
Sbjct  698   SPGTYQALLKSPKGVSVTIAPKSLTFINVGEEKSFKVIFKAQNASVTKDYAFGELIWSDD  757

Query  209   KKHRVRSPIVVK  174
             K H+VRSPIVVK
Sbjct  758   KHHQVRSPIVVK  769



>ref|XP_004499342.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/731 (59%), Positives = 541/731 (74%), Gaps = 17/731 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D DRV  +HH+ L +YLGS++KA+DA+ YSYTR+INGFAA+LEE+ A++IA++P V+SV 
Sbjct  46    DFDRVTETHHEFLQSYLGSYEKAKDAMIYSYTRNINGFAAILEEKHASQIAEHPNVVSVL  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LNR R+L TT SWEF+ +E + GV    S+++KA++GEDTIIGNLDTGVWPES SF +EG
Sbjct  106   LNRGRKLHTTHSWEFMSME-QNGVTPSESLFRKARYGEDTIIGNLDTGVWPESPSFRDEG  164

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP---LNSSFFTPRDVIGHG  1827
              GPIP RWKG C+      F CNRKLIGARYF +GY++  GP    N +  T RD  GHG
Sbjct  165   IGPIPSRWKGTCEGDI-TGFRCNRKLIGARYFNRGYAAYAGPKTIQNHTLNTARDYEGHG  223

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLST GGNFV GAN+FGLGNGTAKGGSPKARVA YKVCWPP   G +C+DADI+A FD
Sbjct  224   SHTLSTIGGNFVQGANIFGLGNGTAKGGSPKARVATYKVCWPPID-GNECFDADIMAAFD  282

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDVLS+SLGG     YF D L+I +FHAVK GI V+ SAGN GP   +V+N+AP
Sbjct  283   MAIHDGVDVLSLSLGGSAFN-YFEDGLSISAFHAVKKGITVLCSAGNSGPTPATVSNIAP  341

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W++TV A+T+DR F + V L N + + G S +   LP  K YPL+SAA A++   A  S 
Sbjct  342   WILTVAASTLDREFHTGVQLHNGQRFKGAS-LSKALPENKLYPLISAAEAKL---AEASV  397

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             +DA+ C  GT+DP+K +G++LVCL+GE  R+EKS  A  AGA GMIL ND  SGNE+I+D
Sbjct  398   EDAILCMEGTIDPKKARGQILVCLRGETARVEKSLVAFEAGAAGMILCNDMTSGNELISD  457

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              HFLP +H+ Y DG+A++ YIN T+NP+ +I  P T L +K +P +A FSSRGPN I P+
Sbjct  458   PHFLPTSHINYEDGVAVYAYINSTKNPLGYIHPPITKLNIKHSPSMATFSSRGPNTITPE  517

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPD++APGVN+IAA++ A  P++ ++DKR V F   SGTSMSCPHVAG+VGLLKTL+P
Sbjct  518   ILKPDVTAPGVNIIAAYSGAVSPTEMEFDKRRVPFITMSGTSMSCPHVAGIVGLLKTLHP  577

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSP+ I+SAIMTTA  R N+ K I D+   +K TPFAYG+GHI PN A DPGLVY+L +
Sbjct  578   DWSPSAIKSAIMTTARTRDNTAKPILDNNN-MKATPFAYGSGHIRPNRAMDPGLVYELNI  636

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY+NF+C  GYNKT+I    G  Y C D I++  FNYPSITVP L G+ T+TR LKNVG
Sbjct  637   NDYLNFLCFLGYNKTQIKMFSGNHYHCHD-INILDFNYPSITVPKLYGSVTLTRKLKNVG  695

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSD  210
              P TY AS+R P G  + V P ILKF+ +GEE+SFKV ++ A+   AT    FG LTWSD
Sbjct  696   PPGTYVASLRVPKGLFIFVEPNILKFDNIGEEKSFKVIIEVARSGVAT---VFGGLTWSD  752

Query  209   KKHRVRSPIVV  177
              KH VRSPIVV
Sbjct  753   GKHYVRSPIVV  763



>ref|XP_007206786.1| hypothetical protein PRUPE_ppa025514mg [Prunus persica]
 gb|EMJ07985.1| hypothetical protein PRUPE_ppa025514mg [Prunus persica]
Length=772

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/732 (60%), Positives = 541/732 (74%), Gaps = 10/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLD V+  H+  LG++L S   A+D IFYSYTRHINGFAA+LEEEEAA+IA++P VISV
Sbjct  46    VDLDSVRKFHYDFLGSFLRSNKSAKDVIFYSYTRHINGFAAILEEEEAADIAEHPNVISV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +L+TTRSW FLGLE   G+I   SIW KA+ GEDTII N+DTGVWPESKSFS+E
Sbjct  106   FLNKGSKLETTRSWNFLGLE-RNGLIPSYSIWMKARLGEDTIIANIDTGVWPESKSFSDE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GP+P +W+GICQ+   K   CNRKLIG RYF  G +   GPLNSSF T RD  GHGSH
Sbjct  165   GLGPVPSKWRGICQHDT-KRVRCNRKLIGTRYFNNGLAMYAGPLNSSFSTARDYDGHGSH  223

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TL+TA GNFVPG +VFG GNGTAKGGSP+ARVAAYKVCW P   G  C+DAD+LA FD A
Sbjct  224   TLATAAGNFVPGVSVFGNGNGTAKGGSPRARVAAYKVCWAPYE-GVQCFDADVLAAFDAA  282

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVD++SVSLGG     +F +S++IG+FHAVK+GIVVV++AGN GP  G+V N++PWL
Sbjct  283   ISDGVDIISVSLGGG-AQEFFKNSISIGAFHAVKHGIVVVSAAGNSGPNPGTVLNLSPWL  341

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TVGA T+DR F S V LGNKKH  G S     LP+ KFYPL+SAA A+   +A+ ST +
Sbjct  342   LTVGAGTIDREFTSYVSLGNKKHLKGVSLSAKGLPSEKFYPLVSAAEAK---HANASTAE  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGEND--RIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             A+ C+ GTLDP KVKGK+LVCLQ  ND  R EKS +A +AGAVGMIL NDE SGN+++AD
Sbjct  399   AIICQGGTLDPRKVKGKILVCLQEYNDNARTEKSWQADMAGAVGMILVNDEQSGNDVVAD  458

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H L  +HV Y+DG  IFDYI  T+ P+A++T   T  G KPAP +A FSSRGPN +   
Sbjct  459   PHVLLVSHVNYTDGKYIFDYIKSTKTPMAYLTRVKTEFGSKPAPFVATFSSRGPNLLEQG  518

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI APGV++IAA+TEA GP+    D R V FNV++G+SM+CPH +G+ GLL+TL+P
Sbjct  519   ILKPDIIAPGVSIIAAYTEAAGPTSQISDTRRVPFNVQTGSSMACPHASGIAGLLRTLHP  578

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SAIMTTAT   +S + I DD + +K TPFAYG+GHI PN A DPGLVY+L  
Sbjct  579   DWSPAAIKSAIMTTATTEDDSMEPIPDDSSYVKATPFAYGSGHIQPNKAMDPGLVYNLTT  638

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL-KGTATVTRTLKNV  390
              DY+NF+CA+GYN+T I +   + YKC    SL+ FNYPSI+VP+L + + T+ R + NV
Sbjct  639   LDYLNFLCARGYNETMIKSFSNSIYKCSKSFSLADFNYPSISVPNLSEDSVTINRKVTNV  698

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             GSP TY   V+ P    V V P+ LKF+++GE + FKV LKAK +     Y FG L WSD
Sbjct  699   GSPGTYKVHVKEPSEVEVLVKPRRLKFKRIGEVKMFKVILKAKVKGKPQGYVFGELIWSD  758

Query  209   KKHRVRSPIVVK  174
               H V+SP+ VK
Sbjct  759   GSHYVKSPLAVK  770



>ref|XP_010942942.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=771

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/728 (58%), Positives = 538/728 (74%), Gaps = 11/728 (2%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             +RV  SH++ LG++LGS +KA+DAIFYSYT+ INGFAA LEEEEA EI+K+P V SVF N
Sbjct  52    ERVVDSHYEFLGSFLGSKEKAQDAIFYSYTKSINGFAANLEEEEAMEISKHPGVTSVFPN  111

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
             R  +L TTRSWEF+GLE   GV+ + S+W KA FG+D IIGNLDTGVWPES+SF ++  G
Sbjct  112   RGHKLHTTRSWEFMGLE-TNGVVPESSLWTKANFGKDVIIGNLDTGVWPESESFKDDDMG  170

Query  1991  PIPKRWKGICQNQKDKS-FHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             PIP +WKGIC N   ++ FHCN+KLIGARYF  GY S V P +    +PRD +GHG+HTL
Sbjct  171   PIPSKWKGICHNNDTQTPFHCNKKLIGARYFNSGYKSVV-PFSHLVDSPRDYVGHGTHTL  229

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G  VPGA +FG G G AKGG+P ARVAAYKVCWPP   G +C+DADILAGFD AI+
Sbjct  230   STAAGAKVPGATLFGYGTGMAKGGAPNARVAAYKVCWPPFL-GNECFDADILAGFDSAID  288

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DGVDVLSVSLGGD P  Y +D++AIGSFHAVK+GI VV SAGN GP++G+V+NVAPW++T
Sbjct  289   DGVDVLSVSLGGD-PVDYLDDAVAIGSFHAVKHGITVVCSAGNSGPMSGTVSNVAPWILT  347

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+T+DR F S V L N++   G+S  P+ L   KFYPL+ +  AR   N + S  DA 
Sbjct  348   VGASTIDREFPSYVHLRNRQQIKGQSLSPVSLQQ-KFYPLIGSEDAR---NPNRSIADAT  403

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              C  G LDP KV GK+++C++G N R+EK      AG  GMILANDE +GNE++ADAH L
Sbjct  404   QCISGALDPAKVTGKIVICIRGTNSRVEKGETVRQAGGTGMILANDESTGNEVLADAHVL  463

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PATH++YSDG+++  YI   ++P+ +IT P T+L   PAP +AAFSSRGPN + P ILKP
Sbjct  464   PATHISYSDGVSLLSYIKSAKSPLGYITDPKTMLDTFPAPFMAAFSSRGPNTVTPGILKP  523

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV++IAA+T + GP+  D+D R V FN ESGTSMSCPHV+G+ GLLK L+P WSP
Sbjct  524   DITAPGVSIIAAYTGSLGPTSLDFDSRRVLFNSESGTSMSCPHVSGISGLLKALHPDWSP  583

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             + I+SAI+T+A  + N+ + I+ + T  K  PF+YG+GH+ PN A DPGLVYDL   DY+
Sbjct  584   SAIKSAIITSARTQDNTLEPIS-NSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYL  642

Query  554   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             NF+C+ GYN T+I    G PY CP   + +   NYPSI + +L+G  ++ RT+KNVG+P 
Sbjct  643   NFLCSLGYNSTQIAGFNGEPYSCPSKPLKIEDLNYPSIAISNLRGAVSLIRTVKNVGTPG  702

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY   V  P G SV+V P+ LKF+KVGEE+ F VTLKAK  +   DYAFG L WSD KH 
Sbjct  703   TYKVRVMEPAGISVSVKPRKLKFDKVGEEKKFVVTLKAKSRDVAGDYAFGKLVWSDGKHY  762

Query  197   VRSPIVVK  174
             VR+PI VK
Sbjct  763   VRTPIAVK  770



>ref|XP_009784573.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana sylvestris]
Length=786

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/738 (59%), Positives = 550/738 (75%), Gaps = 15/738 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL  V  SHH+ LG++LGS +KA+DAIFYSY RHINGFAA+LE+++  EI ++P VIS+F
Sbjct  48    DLHSVVDSHHEFLGSFLGSKEKAKDAIFYSYKRHINGFAAVLEDDQVEEIQRHPSVISIF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+AR+L TT SWEF+ LE + GV+H  S+WKKA+FG+D II NLDTGVWPES+SFS+EG
Sbjct  108   LNKARKLHTTHSWEFMMLE-KNGVVHPSSLWKKARFGQDIIIANLDTGVWPESESFSDEG  166

Query  1997  FGPIPKRWKGICQNQKDKS-FHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             FGPIP RWKGICQN    + F CN+KLIGARYF +GY ++ G +++S  T RD  GHGSH
Sbjct  167   FGPIPSRWKGICQNDNTTAGFSCNKKLIGARYFNKGYIASGGNVSASMSTVRDYDGHGSH  226

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GN V GA+V G+ NGTAKGGSP ARVAAYKVCWPP   G  C DADIL  FD A
Sbjct  227   TLSTAAGNIVHGASVLGVANGTAKGGSPHARVAAYKVCWPPVD-GAGCMDADILKAFDTA  285

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDV+SVSLGG  P  Y  D LAIGSFHAVKNGIVVVASAGN+GP +G+V NVAPW+
Sbjct  286   IHDGVDVISVSLGGT-PSDYLEDGLAIGSFHAVKNGIVVVASAGNDGPDSGTVTNVAPWI  344

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITV A+T+DR  Q++V L N     G S      P   FYPL+SAA A+    A+ ST D
Sbjct  345   ITVAASTLDRNIQNSVQLQNGLLLKGTSLSKPTTPEENFYPLISAAQAK---AANASTND  401

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ CK GTLDP+KVKGK+L CL+GE   I+K H+AALAGAVGMIL N++ +G+EI A  H
Sbjct  402   AIRCKKGTLDPKKVKGKILACLRGETALIDKGHQAALAGAVGMILCNNKTTGSEIFAIPH  461

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA HV Y+DG+ +F+YI  +++P A+IT P T+L  KPAP +A+FSS GPN++ P IL
Sbjct  462   VLPAIHVNYTDGVQVFEYIGSSKDPRAYITTPETVLRTKPAPFMASFSSTGPNSVTPQIL  521

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPD++APGV++IAA++EA  P++ DYDKR  SFN+ SGTSMSCPHVAGVVGLLK+L+P W
Sbjct  522   KPDVTAPGVDIIAAYSEAANPTEEDYDKRKTSFNMISGTSMSCPHVAGVVGLLKSLHPDW  581

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMTTA  R N+G  + D+    K T F YGAGH+ PN A +PGLVYDL + D
Sbjct  582   SPAAIRSAIMTTARTRDNTGNPMRDETEKDKATQFNYGAGHMRPNRAMNPGLVYDLTVND  641

Query  560   YVNFICAQGYNKTEITAVLGT--PYKCPDH--ISLSTFNYPSITVPHLKGTA--TVTRTL  399
             Y++F+C+ GYN+  IT   GT   Y+C     ++L  FN P+IT+P++  +A  T+TRTL
Sbjct  642   YLDFLCSLGYNQKNITKFSGTRSTYQCHKKHGLNLLDFNNPAITIPNISPSAPVTITRTL  701

Query  398   KNVGSPATYTASVRSPVG-FSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGV  225
             KNVGSP  Y A+VR P   FSV+V P +L F+ +G+E+SFK+T++ K   A  D Y  G 
Sbjct  702   KNVGSPGVYAANVRLPRRMFSVSVEPSVLMFDHIGQEKSFKLTIEVKDAKAVKDGYVPGE  761

Query  224   LTWSDKKHRVRSPIVVKT  171
             L W+D+ H VRSPI V +
Sbjct  762   LLWTDRLHYVRSPIAVAS  779



>ref|XP_010942943.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=772

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/728 (59%), Positives = 535/728 (73%), Gaps = 10/728 (1%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             +RV  SH++ LG++LGS +KA+DAIFYSYT+ INGFAA LEEEEA EI+K+P VISVF N
Sbjct  52    ERVVDSHYEFLGSFLGSKEKAQDAIFYSYTKSINGFAANLEEEEAMEISKHPGVISVFPN  111

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
             R  +L TT SWEF+GLE   GV+ + S+W KA FG+D IIGNLDTGVWPES+SF ++G G
Sbjct  112   RGHKLHTTHSWEFMGLE-TNGVVPESSLWTKANFGKDVIIGNLDTGVWPESESFKDDGMG  170

Query  1991  PIPKRWKGICQ-NQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTL  1815
             PIP +WKGICQ N  +  FHCN+KLIGARYF  GY SA+ P      +PRD  GHG+HTL
Sbjct  171   PIPSKWKGICQKNDTNIPFHCNKKLIGARYFNDGYRSALDPFAYVEDSPRDYEGHGTHTL  230

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STA G  VPGA +FG G G AKGG+P ARVAAYKVCWPP   GE C+ AD+LAGFD AI 
Sbjct  231   STAAGAKVPGATLFGYGTGMAKGGAPNARVAAYKVCWPPVLGGE-CFSADVLAGFDSAIH  289

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLIT  1455
             DGVDVLSVSLGGD P  Y  D++AIGSFHAVK+GI VV SAGN GP  G+V+NVAPW++T
Sbjct  290   DGVDVLSVSLGGD-PVDYLEDAVAIGSFHAVKHGITVVCSAGNSGPTLGTVSNVAPWILT  348

Query  1454  VGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDAL  1275
             VGA+T+DR F S V L N++   G+S   + L   KFY L+S   AR K N SI  +DA 
Sbjct  349   VGASTIDREFASYVHLRNRQQIKGQSLSSVSLQQ-KFYSLISPEDAR-KSNRSI--EDAT  404

Query  1274  HCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFL  1095
              C  G LDP KV+GK+++C++G NDR+EK      AG +GMILANDE SGNE+IADAH L
Sbjct  405   QCISGALDPTKVRGKIVICIRGTNDRVEKGEAVRQAGGIGMILANDESSGNEVIADAHVL  464

Query  1094  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  915
             PATH++YSDG+++  Y+   ++P+ +IT P T+L   PAP +AAFSSRGPN I P+ILKP
Sbjct  465   PATHISYSDGVSLLSYVKSAKSPLGYITSPKTMLDAFPAPFMAAFSSRGPNTITPEILKP  524

Query  914   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  735
             DI+APGV++IAA+T A GP+  D+D R V FN +SGTSMSCPHV+GV GLLK L+P WSP
Sbjct  525   DITAPGVSIIAAYTGALGPTSLDFDSRRVLFNTDSGTSMSCPHVSGVAGLLKALHPDWSP  584

Query  734   AEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYV  555
             + I+SAI+T+A  + N+ + ++ + T  K  PF+YG+GH+ PN A DPGLVYDL   DY+
Sbjct  585   SAIKSAIITSARTQDNTLEPMS-NSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYL  643

Query  554   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             NF+C+ GYN T+I      PY CP   + +   NYPSI + +L G  ++ RT+KNVG+P 
Sbjct  644   NFLCSLGYNSTQIAGFNREPYSCPSKPLKIEDLNYPSIAISNLTGAVSLIRTVKNVGTPG  703

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY   V  P G SV+V P+ LKF+KVGEE+ F VTLKAK  +   DYAFG L WSD KH 
Sbjct  704   TYKVRVMEPAGISVSVKPRKLKFDKVGEEKKFVVTLKAKRRDVAGDYAFGKLVWSDGKHY  763

Query  197   VRSPIVVK  174
             VR+PI VK
Sbjct  764   VRTPIAVK  771



>ref|XP_009396094.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=780

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/727 (59%), Positives = 531/727 (73%), Gaps = 10/727 (1%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             R   SH++LLG+ L   +K +DAIFYSYT HINGFAA LE EEA ++++ P V+SV  NR
Sbjct  54    RATESHYELLGSVLEDKEKVQDAIFYSYTHHINGFAAYLEVEEAMKVSEYPGVLSVIPNR  113

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
                L TT SWEFLGLE +G V    S+W+KA+FGEDTII NLDTGVWPE++SF ++  GP
Sbjct  114   GYTLHTTHSWEFLGLERDGRVPKQ-SLWRKARFGEDTIIANLDTGVWPEAQSFKDDDLGP  172

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             IP +WKGICQN  D+SF CNRKLIGARYF + Y   VGPLN++F +PRD  GHG+HTLST
Sbjct  173   IPSKWKGICQNDFDESFSCNRKLIGARYFNKAYEVMVGPLNATFRSPRDYDGHGTHTLST  232

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             A G  VPGAN+FG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+A FD AIEDG
Sbjct  233   AAGGAVPGANIFGYGNGTAKGGSPRARVAAYKVCWPPVN-GSECFDADIVAAFDAAIEDG  291

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDV+SVSLGGD P  YF D LAIGSFHAV+ GI V  SAGN GP   +V+N++PW++TVG
Sbjct  292   VDVISVSLGGD-PVDYFRDGLAIGSFHAVRKGITVACSAGNSGPQLATVSNLSPWMLTVG  350

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TM+R+F S+++L N K   GES  P  LP    YP++S+  A+    A+ S   A  C
Sbjct  351   ASTMNRQFPSSLILDNNKRIQGESLSPKGLPGNNAYPVISSREAKY---ANASEHKARLC  407

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDP K  GK++VCL+G   R+EK      AG VGM+LAND  +GNEI+ADAH LPA
Sbjct  408   YLGSLDPVKATGKIVVCLRGVTARVEKGEAVLQAGGVGMVLANDAFNGNEILADAHVLPA  467

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             TH+TYSDGL +F Y+    +P+ +IT P T LG KPAP +AAFSS GPN I P+ILKPDI
Sbjct  468   THITYSDGLTLFSYLESNESPLGYITSPKTELGTKPAPFMAAFSSLGPNTITPEILKPDI  527

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGV+VIAA++ A GP++ D+D R V+FN  SGTSMSCPHV+G+ GLLKTL+P WSPA 
Sbjct  528   TAPGVSVIAAYSAAVGPTNLDFDTRRVAFNSVSGTSMSCPHVSGIAGLLKTLHPDWSPAA  587

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  R N  + +  + + +K T FAYG+GH+ PN A DPGLVYDL   DY++F
Sbjct  588   IKSAIMTTARTRDNMEEPVL-NSSFVKATSFAYGSGHVRPNRAMDPGLVYDLTTNDYLDF  646

Query  548   ICAQGYNKTEITAVLGTP-YKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  375
             +CA GYN T++        Y CP   + +   NYPSITVP L  +ATVTR +KNVGSP T
Sbjct  647   LCALGYNSTQLAMFSKEEAYSCPPTPLRIEDLNYPSITVPELSVSATVTRVVKNVGSPGT  706

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVLTWSDKKHR  198
             Y A V  P G +V VNP  L FEKVGEE+ F+VT+KAK   +  +DY FG L WSD KH 
Sbjct  707   YVARVIEPSGVAVAVNPARLVFEKVGEEKKFEVTMKAKDRKSWNSDYVFGALIWSDGKHY  766

Query  197   VRSPIVV  177
             VR+P+VV
Sbjct  767   VRTPLVV  773



>ref|XP_011095872.1| PREDICTED: subtilisin-like protease SBT5.4 [Sesamum indicum]
Length=768

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/731 (61%), Positives = 548/731 (75%), Gaps = 12/731 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SH+QLL ++LGS +KA+DAI Y+Y RHINGFAA+LEEEEAAEIAK+P V+SVF
Sbjct  47    DLRRVTDSHNQLLASFLGSEEKAKDAIIYNYKRHINGFAALLEEEEAAEIAKHPHVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+A++L TT SW+FL LE +G VIH  S WKKA+FGEDTII NLDTGVWPESKSFS EG
Sbjct  107   PNQAKKLHTTHSWDFLMLERQG-VIHKLSAWKKARFGEDTIIANLDTGVWPESKSFSGEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GPIP +WKGICQ        CNRKLIGARYF +G+ +  G LNSS+ TPRD  GHGSHT
Sbjct  166   YGPIPSKWKGICQFDDKAGPLCNRKLIGARYFNKGFQAYSGKLNSSYNTPRDTDGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGA+VFG+GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+  FD AI
Sbjct  226   LSTAAGNFVPGASVFGVGNGTAKGGSPRARVAAYKVCWPPIN-GSECFDADIVKAFDTAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG    PY  D LAI +FHAVK G+VVVASAGN GP  GSV+NVAPW+I
Sbjct  285   HDGVDVLSVSLGGA-AVPYSMDGLAIAAFHAVKKGVVVVASAGNSGPFPGSVSNVAPWII  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T+DR+F++NV L N     G S +   LP  K YPL+SA  AR     ++S  DA
Sbjct  344   TVGASTIDRQFEANVQLKNGSMLQGTS-LSAPLPNQKLYPLISAEHARA---GNVSAFDA  399

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             + C   TLD +K KGK++VCL+GEN R+EK HEA  AGA GMIL ND +SGNEIIAD H 
Sbjct  400   ILCLNNTLDSKKAKGKIVVCLRGENARVEKGHEAYRAGAAGMILCNDAESGNEIIADPHI  459

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATH+ ++DG  +FDY+   RNP   IT P    G+KPAP +A+FSSRGPN + P+ILK
Sbjct  460   LPATHINFTDGRIVFDYLKTARNPQGLITTPKAEYGIKPAPFMASFSSRGPNMVTPEILK  519

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PD++APGVN+IAA++EA  P+   +D R   FN ESGTSMSCPHV+GV GL+KT +P WS
Sbjct  520   PDVTAPGVNIIAAYSEAVSPT-GAFDVRKTPFNTESGTSMSCPHVSGVAGLIKTRHPDWS  578

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTTA +R N+  ++ D       TPFAYG+GHI PN A DPGLVYDL + DY
Sbjct  579   PAAIRSAIMTTARIRDNTVNSMRDADY-QAATPFAYGSGHIRPNRALDPGLVYDLTVNDY  637

Query  557   VNFICAQGYNKTEITAVLGTPY-KCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+C  GY++ +I+ V G  Y KCP++ S+  FN PSITV +++GT  VTRT+K VG P
Sbjct  638   LDFLCGIGYSQRQISQVAGIHYHKCPENYSMLNFNNPSITVLNVRGTVNVTRTVKLVGKP  697

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
               Y + VR+P G+S+ V P++L+FEK GEE+SF++++  K   AT  Y FG L WSD  H
Sbjct  698   GIYASRVRAPFGYSLAVEPRLLQFEKTGEEKSFQLSITVK--RATTVYGFGELVWSDSTH  755

Query  200   RVRSPIVVKTA  168
              VRSPIV+  A
Sbjct  756   YVRSPIVLSAA  766



>ref|XP_008794759.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/728 (60%), Positives = 545/728 (75%), Gaps = 11/728 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             RV+ SHH+LL + LG+ +KA+DA+FYSYTR+INGFAA LEEEEA EI+K P V+SVF NR
Sbjct  58    RVRDSHHELLASVLGNKEKAQDALFYSYTRYINGFAANLEEEEAMEISKYPGVLSVFPNR  117

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSW+FLGLE EG V  + S+W KA+FGED IIGNLDTGVWPES+SF ++G GP
Sbjct  118   GYKLHTTRSWDFLGLEREGRVPKE-SLWTKARFGEDIIIGNLDTGVWPESESFKDDGMGP  176

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +WKGICQ  +DKSF CNRKLIGARY+ +GY++A GPLN++F TPRD  GHG+HTLST
Sbjct  177   VPSKWKGICQIGEDKSFSCNRKLIGARYYNEGYAAAAGPLNATFETPRDKDGHGTHTLST  236

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             AGG FVPGAN+FG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+A  D AI DG
Sbjct  237   AGGGFVPGANIFGYGNGTAKGGSPRARVAAYKVCWPPIN-GSECFDADIIAAVDAAIHDG  295

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLSVSLGG  P  YF + +AIGSFHAVKNGI VV SAGN GP  GSV+N APW+ITV 
Sbjct  296   VDVLSVSLGGHSPS-YFLNGIAIGSFHAVKNGITVVCSAGNSGPRRGSVSNTAPWIITVA  354

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TMDR F + V   NK    GES     LP  + YP++S+  AR    ++ S  DA  C
Sbjct  355   ASTMDREFPAYVNFSNKS-IKGESLSQKGLPGNELYPMISSKEARA---SNASAHDAELC  410

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDPEKV+GK++VCL+G   R+EK      AG  GM+L ND+ SGNEI ADAH LPA
Sbjct  411   YLGSLDPEKVRGKIVVCLRGITARVEKGEAVLQAGGSGMVLVNDQSSGNEISADAHLLPA  470

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             TH+TY+DG ++F Y+  T++P+ +IT P T L  KPAP++AAFSS+GPN IN +ILKPDI
Sbjct  471   THITYNDGFSLFSYLKSTKSPLGYITTPITQLDTKPAPLMAAFSSQGPNTINAEILKPDI  530

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGV+V+AAFT A GP+   +D R V+FN+  GTSMSCPH++GVVGLLK+L+P WSP+ 
Sbjct  531   TAPGVSVLAAFTGAAGPTGLAFDTRRVAFNLLYGTSMSCPHISGVVGLLKSLHPDWSPSA  590

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTAT + N  + + +    +K TPF+YG+GH+ PN A DPGLVYDL   DY+NF
Sbjct  591   IKSAIMTTATTQDNMDEPVLNSSY-VKATPFSYGSGHVQPNRAMDPGLVYDLTTNDYLNF  649

Query  548   ICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  372
             +CA GY  T+I  +    + CP     L   NYPSIT+P L G+ TVTR +KNVGSP TY
Sbjct  650   LCALGYTSTQIALISNDSFLCPSKPPKLEDLNYPSITIPDLSGSITVTRAMKNVGSPGTY  709

Query  371   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVR  192
                VR P+G SV+VNP  L ++K+GEE+ F+VTLK    +A  DY FG L WSD KH V+
Sbjct  710   IVRVREPIGISVSVNPTSLTYDKIGEEKKFEVTLKEG--HAPTDYVFGELIWSDGKHYVQ  767

Query  191   SPIVVKTA  168
             +P+VV  A
Sbjct  768   TPLVVSAA  775



>ref|XP_010108994.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20634.1| Subtilisin-like protease [Morus notabilis]
Length=833

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/738 (59%), Positives = 540/738 (73%), Gaps = 15/738 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL+R   SH+  LG+YL S +K RDAIFYSYTRHINGFAA+L++ +AAEIAK+P V+S+F
Sbjct  99    DLERATSSHYSFLGSYLESDEKVRDAIFYSYTRHINGFAAILDDTKAAEIAKHPNVVSIF  158

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L++  +L TTRSW+FL LE  GG+  D SIW KA++GEDTIIGN+D GVWPESKSFS EG
Sbjct  159   LDKGMKLHTTRSWDFLRLETNGGIPSD-SIWNKARYGEDTIIGNIDFGVWPESKSFSGEG  217

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSF--------FTPRD  1842
             FGP+P +W+GICQ+       CNRKLIGARYF +GY +     N +F        F+ RD
Sbjct  218   FGPVPSKWRGICQDGVKDGVRCNRKLIGARYFNKGYIAYSKANNFTFSIQHNPYLFSTRD  277

Query  1841  VIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADI  1662
               GHG+HTLSTAGGNFV  ANVFG GNGTAKGGSP+ARVAAYKVCWP  +  E C++AD+
Sbjct  278   YNGHGTHTLSTAGGNFVRRANVFGYGNGTAKGGSPRARVAAYKVCWPVINEHE-CFEADV  336

Query  1661  LAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSV  1482
             +A FD AI DGVDVLSVSLG D P  +F+ S++IG+FHAV NGI VV SAGNEGP   +V
Sbjct  337   IAAFDAAINDGVDVLSVSLGTDSPSEFFDSSISIGAFHAVANGITVVTSAGNEGPGPETV  396

Query  1481  NNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKIN  1302
              NV PWL+TVGA+T+DR F S + LG+KKH  G S     LP+ KFYPL+S A A+    
Sbjct  397   TNVPPWLVTVGASTIDRDFTSYIALGDKKHLKGASLSSSALPSEKFYPLISGADAKA---  453

Query  1301  ASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGN  1122
             A  ST DA  CK G LDP+KVKG +LVC+ G+  R E   +A  +GAVGMILAND    N
Sbjct  454   AKASTSDAQQCKRGALDPKKVKGNILVCVWGKFARSEMGEQAFHSGAVGMILANDIRRWN  513

Query  1121  EIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPN  942
             ++IAD H LPA+H+ ++DG  IF+Y+N T+ P+A++T   T LGVKPAP++A FSSRGPN
Sbjct  514   DVIADPHLLPASHINFTDGEFIFEYLNSTKTPMAYMTRVKTQLGVKPAPLVAFFSSRGPN  573

Query  941   AINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLL  762
              I P ILKPD++APGV++IAA++E TG  +   D+R V FN++SGTSMSCPH++GV+GLL
Sbjct  574   LIEPTILKPDLTAPGVSIIAAYSEGTGALEVTTDERRVPFNIKSGTSMSCPHISGVIGLL  633

Query  761   KTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLV  582
             KTL+P WSPA +RSAIMTTA  R ++ + + D  T  + TPFAYGAGH+ PN A DPGLV
Sbjct  634   KTLHPYWSPAALRSAIMTTARTRDSNREQMLDAATMQRATPFAYGAGHVQPNRAMDPGLV  693

Query  581   YDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL--KGTATVT  408
             YDL + DY+N +CA GYN+T I      PYKC    +L  FNYPSI VP+L  +    VT
Sbjct  694   YDLTIDDYLNLLCAHGYNETTIKLFSNKPYKCSKSFTLVNFNYPSIAVPNLGSEQVNIVT  753

Query  407   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFG  228
             R +KNVG P TYTA V++P G SV+V PK LKF+++GEE++FK+ +K K      DY FG
Sbjct  754   RKVKNVGIPGTYTAYVKAPAGVSVSVKPKTLKFKRIGEEKTFKIIMKPKIAGKPRDYVFG  813

Query  227   VLTWSDKKHRVRSPIVVK  174
              L WSD KH VRS IVVK
Sbjct  814   WLKWSDGKHCVRSHIVVK  831



>ref|XP_010443761.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=777

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/732 (60%), Positives = 540/732 (74%), Gaps = 15/732 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             V LD V HSH   L +++GS   A++AIFYSY RHINGFAA+L+E EAAEIAK+P+V+SV
Sbjct  55    VHLDGVAHSHRTFLASFVGSHQNAQEAIFYSYKRHINGFAAVLDETEAAEIAKHPDVVSV  114

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SW+F+ LE + GV+H  S+W KA +GEDTII NLDTGVWPESKSFS+E
Sbjct  115   FLNKGRKLHTTHSWKFMLLE-KNGVVHKSSLWNKAGYGEDTIIANLDTGVWPESKSFSDE  173

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G+G +P RWKG C     K   CNRKLIGARYF +GY +  G P N+SF T RD  GHGS
Sbjct  174   GYGAVPARWKGKCH----KDVPCNRKLIGARYFNKGYLAYTGLPSNASFETSRDHDGHGS  229

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTA GNFVPGANVFG+GNGTA GGSPKAR+AAYKVCWPP + G +C+DADILA  + 
Sbjct  230   HTLSTAAGNFVPGANVFGIGNGTASGGSPKARIAAYKVCWPPVN-GAECFDADILAAIEA  288

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI+DGVDV+S S+GGD  G Y  D +AIGSF AVKNG+  VASAGN GP  G+V+NVAPW
Sbjct  289   AIDDGVDVISASVGGD-AGDYMIDGIAIGSFQAVKNGVTFVASAGNSGPKPGTVSNVAPW  347

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITVGA++MDR FQ+ V L N + + G S +   LP  K Y L+SAA  ++ +N S +  
Sbjct  348   IITVGASSMDREFQAFVALNNGQSFKGTS-LSKPLPEDKMYSLISAAEGKV-VNGSAT--  403

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DAL CK G+LDPEKVKGK+LVCL+G+N R+EK  +AA AGAVGMIL ND+ SGNEII+DA
Sbjct  404   DALLCKKGSLDPEKVKGKILVCLRGDNARVEKGQQAAAAGAVGMILCNDKASGNEIISDA  463

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA+ + Y DG A+F Y+N T++P  +I  P + L +KPAP +A+FSSRGPN++ P I
Sbjct  464   HVLPASQIDYKDGEAVFKYLNSTKDPKGYIKAPTSALNIKPAPFMASFSSRGPNSVTPGI  523

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGVN+IAAFTEAT P+D D D R   +N ESGTSMSCPH++G+VGLLKTL+P 
Sbjct  524   LKPDITAPGVNIIAAFTEATSPTDLDSDHRRTPYNTESGTSMSCPHISGIVGLLKTLHPQ  583

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA IRSAIMTT+  R N  K + D+    K  PF+YG+GH+ PN AA PGLVYDL   
Sbjct  584   WSPAAIRSAIMTTSRTRDNRRKPMVDESFK-KANPFSYGSGHVQPNKAAHPGLVYDLTTG  642

Query  563   DYVNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY++F+CA GYN T +        Y C    +L  FNYPSIT+PHL  T TVTR LKNVG
Sbjct  643   DYLDFLCAVGYNNTVVQLFAEDKQYMCRQGANLLDFNYPSITIPHLTDTITVTRKLKNVG  702

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGVLTWSD  210
              PATY A  R P+G SV V PK L F K GE + F++TL+ K    +   Y FG LTW+D
Sbjct  703   PPATYNAHFREPLGVSVDVEPKQLNFNKTGEVKMFQMTLRPKSVKPSGSGYVFGELTWTD  762

Query  209   KKHRVRSPIVVK  174
               H VR PIVV+
Sbjct  763   SHHYVRIPIVVQ  774



>ref|XP_008218944.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/732 (59%), Positives = 542/732 (74%), Gaps = 10/732 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DLD V+  H+  LG++L S + A+D IFYSYTRHINGFAA+LEEEEAA+IA++P VISV
Sbjct  46    LDLDSVRKFHYDFLGSFLRSNNSAKDVIFYSYTRHINGFAAILEEEEAADIAEHPNVISV  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +L+TTRSW FLGLE   G+I   SIW KA+ GEDTII N+DTGVWPESKSFS+E
Sbjct  106   FLNKGSKLETTRSWNFLGLE-RNGLIPSHSIWMKARLGEDTIIANIDTGVWPESKSFSDE  164

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GP+P +W+GICQ+   K   CNRKLIG RYF  G +   GPLNSSF T RD  GHGSH
Sbjct  165   GLGPVPSKWRGICQHDT-KRVRCNRKLIGTRYFNNGLAMYAGPLNSSFSTARDYDGHGSH  223

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TL+TA GNFVPG +VFG G+GTAKGGSP+A VAAYKVCWPP   G  C+DAD+LA FD A
Sbjct  224   TLATAAGNFVPGVSVFGNGDGTAKGGSPRAHVAAYKVCWPPYE-GVQCFDADVLAAFDAA  282

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVD++SVSLGG     +F +S++IG+FHAVK+GIVVV++AGN GP  G+V N++PWL
Sbjct  283   ISDGVDIISVSLGGG-AQEFFKNSISIGAFHAVKHGIVVVSAAGNTGPNPGTVLNLSPWL  341

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TVGA T+DR F S V LGNKKH  G S     LP+ KFYPL+SAA A+   +A+ ST +
Sbjct  342   LTVGAGTIDREFTSYVSLGNKKHLKGVSLSAKGLPSEKFYPLVSAAEAK---HANASTAE  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGEND--RIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             A+ C+ GTLDP KVKGK+LVCL+  ND  R EKS +A +AGAVGMIL NDE SGN+++AD
Sbjct  399   AIICQGGTLDPRKVKGKILVCLREYNDNARTEKSWQAEMAGAVGMILVNDEQSGNDVVAD  458

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H L  +HV Y+DG  IFDYI  T+ P+A++T   T LG KPAP +A FSSRGPN     
Sbjct  459   PHVLLVSHVNYTDGKYIFDYIKSTKTPMAYLTRVKTELGSKPAPFVATFSSRGPNLQEQG  518

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI APGV++IAA+TEA GP+    D R V FNV++G+SM+CPH +G+ GLL+TL+P
Sbjct  519   ILKPDIIAPGVSIIAAYTEAAGPTSQISDTRRVPFNVQTGSSMACPHASGIAGLLRTLHP  578

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SAIMTTAT + +  + I DD + ++ TPFAYG+GHI PN A DPGLVY+L  
Sbjct  579   DWSPAAIKSAIMTTATTQDDHMEPILDDSSYVEATPFAYGSGHIQPNKAMDPGLVYNLTT  638

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL-KGTATVTRTLKNV  390
              DY+NF+CA+GYN+T I +   + YKC    SL+ FNYPSI+VP+L + + T+ R + NV
Sbjct  639   LDYLNFLCARGYNETMIKSFSNSTYKCSKSFSLADFNYPSISVPNLSEDSVTINRKVTNV  698

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             GSP TY   V+ P    V V P+ LKF+++GE + FKV LKAK +     Y FG L WSD
Sbjct  699   GSPGTYKVHVKEPSEVEVLVKPRRLKFKRIGEVKMFKVILKAKVKGKPQGYVFGELIWSD  758

Query  209   KKHRVRSPIVVK  174
               H V+SP+ VK
Sbjct  759   GSHYVKSPLAVK  770



>ref|XP_009610677.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana tomentosiformis]
Length=786

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/738 (59%), Positives = 548/738 (74%), Gaps = 15/738 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL  V  SHH+ LG++LGS +KA+DAIFYSY RHINGFAA+LE+++  EI ++P VIS+F
Sbjct  48    DLHSVVDSHHEFLGSFLGSKEKAKDAIFYSYKRHINGFAAVLEDDQVEEIQRHPSVISIF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+AR+L TT SWEF+ LE + GV+H  S+WKKA+FG+D II NLDTGVWPES+SFS+EG
Sbjct  108   LNKARKLHTTHSWEFMMLE-KNGVVHPSSLWKKARFGQDIIIANLDTGVWPESESFSDEG  166

Query  1997  FGPIPKRWKGICQNQKDKS-FHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             FGPIP +WKGICQN    + F CN+KLIGARYF +GY ++ G +++S  T RD  GHGSH
Sbjct  167   FGPIPSKWKGICQNDNTTAGFSCNKKLIGARYFNKGYIASGGNVSASMSTVRDNDGHGSH  226

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GN V GA+V G+ NGTAKGGSP ARVAAYKVCWPP   G  C DADIL  FD A
Sbjct  227   TLSTAAGNIVHGASVLGVANGTAKGGSPHARVAAYKVCWPPVD-GAGCMDADILKAFDTA  285

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDV+SVSLGG  P  Y  D LAIGSFHAVKNGIVVVASAGN+GP +G+V NVAPW+
Sbjct  286   IHDGVDVISVSLGGS-PSDYLEDGLAIGSFHAVKNGIVVVASAGNDGPDSGTVTNVAPWI  344

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITV A+T+DR  Q++V L N     G S      P   FYPL+SAA A+    A+ ST D
Sbjct  345   ITVAASTLDRNIQNSVQLQNGLLLKGTSLSKPTTPQENFYPLISAAQAK---AANASTDD  401

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ CK GTLDP+KVKGK+L CL+GE   I+K H+AALAGAVGMIL N++ +G+EI A  H
Sbjct  402   AIRCKKGTLDPKKVKGKILACLRGETALIDKGHQAALAGAVGMILCNNKTTGSEIFAIPH  461

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA HV Y+DG+ +FDYI  +++P A+IT P T+L  KPAP +A+FSS GPN++ P IL
Sbjct  462   VLPAIHVNYTDGVQVFDYIASSKDPRAYITTPETVLHKKPAPFMASFSSTGPNSVTPQIL  521

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPD++APGV++IAA++EA  P++ DYDKR  SFN+ SGTSMSCPHVAGVVGLLK+L+P W
Sbjct  522   KPDVTAPGVDIIAAYSEAANPTEEDYDKRKTSFNMISGTSMSCPHVAGVVGLLKSLHPDW  581

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSAIMTTA  R N+G  + D+    K T F YGAGH+ PN A +PGLVYDL + D
Sbjct  582   SPAAIRSAIMTTARTRDNTGNPMRDETEKDKATQFNYGAGHMRPNRAMNPGLVYDLTVND  641

Query  560   YVNFICAQGYNKTEITAVLGT--PYKCPDH--ISLSTFNYPSITVPHLKGT--ATVTRTL  399
             Y++F+C+ GYN+  IT   GT   Y+C     +++  FN P+IT+P++  +   T+TRTL
Sbjct  642   YLDFLCSLGYNQKNITKFSGTGSTYQCHKKHGLNILDFNNPAITIPNISPSVPVTITRTL  701

Query  398   KNVGSPATYTASVRSPVG-FSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGV  225
             KNVGSP  Y A VR P   FSV+V P +L F+ +G+E+SFK+T++ K   A  D Y  G 
Sbjct  702   KNVGSPGVYAAHVRLPRRMFSVSVEPSVLMFDHIGQEKSFKLTIEVKNAKAVKDGYVPGE  761

Query  224   LTWSDKKHRVRSPIVVKT  171
             L W+D+ H VRSPI V +
Sbjct  762   LLWTDRLHYVRSPIAVAS  779



>ref|XP_011039899.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=894

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/733 (60%), Positives = 530/733 (72%), Gaps = 11/733 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D+ ++  SH  LLG+ L S +  +D + YSYTR +NGFAA L E + A +  NP VISV
Sbjct  171   LDVQKMTKSHFDLLGSCLESKENVQDVMIYSYTRCLNGFAAYLNEAQVAAMKGNPGVISV  230

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N+ R L TT SWEF+G E  G    + S+ KKA FGE  II NLDTGVWPESKSF++E
Sbjct  231   FENQERILHTTHSWEFIGFEANGAPTLN-SLQKKANFGEGVIIANLDTGVWPESKSFNDE  289

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAV-GPLNSSFFTPRDVIGHGS  1824
             G GP+P RWKG CQ      F CN+KLIGARYF +G++SA   P+ + + T RD  GHGS
Sbjct  290   GMGPVPSRWKGTCQ--AGGGFKCNKKLIGARYFNKGFASASPTPIPTEWNTARDTEGHGS  347

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG+FVPGA +FG GNGTAKGGSPKA VAAYKVCWP  + G  C+DADILA FD 
Sbjct  348   HTLSTAGGSFVPGAGIFGNGNGTAKGGSPKAHVAAYKVCWPSDNGG--CFDADILAAFDA  405

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDV+S+SLG   P  +  D++AIGSFHA+K GI VVASAGN GP AGSV N APW
Sbjct  406   AIGDGVDVISMSLGPSFPVEFLQDAMAIGSFHAIKKGIPVVASAGNSGPDAGSVANGAPW  465

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             L T+GA+T+DR F + V LGNKK   G S     LP GKFYPL++AA A +    + S+ 
Sbjct  466   LFTIGASTLDRDFSATVTLGNKKFVKGSSVASKSLPAGKFYPLINAAEAGLP---TASSA  522

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  C+ GTLDP+KV GK++VCL+G N R+ K HEA LAGAVGMILAN+E+SG+E+++D 
Sbjct  523   DAQLCQNGTLDPKKVAGKIIVCLRGINSRVVKGHEAELAGAVGMILANNEESGSELLSDP  582

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA H+T++DG A+ DYI  T+NP A I+  +T LGV P PV+AAFSSRGP+ I P I
Sbjct  583   HVLPAAHLTFTDGQAVMDYIKSTKNPTASISPVHTDLGVVPNPVMAAFSSRGPSVIEPAI  642

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPD++APGV+VIAAFTEA GPS+  +DKR   +   SGTSMSCPHV+G+VGLL+ ++P 
Sbjct  643   LKPDVTAPGVDVIAAFTEAIGPSELPFDKRRTPYITMSGTSMSCPHVSGIVGLLRAIHPD  702

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMTTA  ++NS K I  D  G   TPFAYGAGH+NPN AADPGLVYD  + 
Sbjct  703   WSPAAIKSAIMTTAKTKSNSKKRIL-DADGQPATPFAYGAGHVNPNLAADPGLVYDTNVI  761

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY+NF+CA GYN T I    G PYKCP+  SL+ FNYPSITVP L G  TVTR +KNVG+
Sbjct  762   DYLNFLCAHGYNSTFILEFSGVPYKCPEKASLAEFNYPSITVPDLNGPVTVTRRVKNVGA  821

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TYT   ++P   SV V P  L+F+K GEE+ FKVT K        DY FG LTWSD  
Sbjct  822   PGTYTVKAKAPPQVSVVVEPSSLEFKKAGEEKIFKVTFKPVVNGTPKDYTFGHLTWSDSN  881

Query  203   -HRVRSPIVVKTA  168
              HRVRSP+VVK A
Sbjct  882   GHRVRSPLVVKHA  894



>ref|XP_006449983.1| hypothetical protein CICLE_v10018000mg [Citrus clementina]
 gb|ESR63223.1| hypothetical protein CICLE_v10018000mg [Citrus clementina]
Length=760

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/733 (59%), Positives = 530/733 (72%), Gaps = 33/733 (5%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  SHH+ LG++LGS +KARDAIFYSY  HINGFAA LEEEEAAEIAK+P+V+S+F
Sbjct  50    DLDRVTDSHHEFLGSFLGSTEKARDAIFYSYQNHINGFAATLEEEEAAEIAKHPDVVSIF  109

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ ++L TTRSW+F+ LE  G VIH  S W K +FGED II NLDTGVWPESKSFS+EG
Sbjct  110   PNKGKKLHTTRSWDFMLLENNG-VIHSSSAWGKGRFGEDIIIANLDTGVWPESKSFSDEG  168

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF---TPRDVIGHG  1827
             +GP+P RWKG CQN   +   CNRKLIGARYF + Y++ V   N S     T RD  GHG
Sbjct  169   YGPVPSRWKGTCQNSTKEGVRCNRKLIGARYFNKAYAAYVKQHNISVNFNNTARDHEGHG  228

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             +HTLSTAGGN VPG NVFG+GNGTAKGGSPKARVAAYKVCWP  S G+ C+DADIL GFD
Sbjct  229   THTLSTAGGNLVPGVNVFGMGNGTAKGGSPKARVAAYKVCWPQVSDGQ-CFDADILKGFD  287

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDV+SVSLGGD P  YFND  AIG+FHAVK+GIVVV SA N GP  G+V NV+P
Sbjct  288   MAIHDGVDVISVSLGGD-PADYFNDGTAIGAFHAVKHGIVVVCSAANSGPELGTVTNVSP  346

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W+ITVGA+T+DR FQ+ + L N + + G S +   LP   FYPL++              
Sbjct  347   WIITVGASTLDREFQNFIELRNGQRFKGTS-LSKSLPNDTFYPLITG-------------  392

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
                L  K G  D             G+  R++K  +AA+AGAVGMIL ND+ SGNEI AD
Sbjct  393   ---LQAKAGNADDNAA---------GDTARVDKGRQAAVAGAVGMILCNDKSSGNEITAD  440

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              HFLPA+ +TY DG+ + DYI  + +P+ +IT P+T L  KP+P +A+FSS GPN I P+
Sbjct  441   PHFLPASQITYKDGVKVLDYIKSSDDPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPE  500

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGVN+IAAFT A G ++  YD R + +N+ SGTSMSCPHVAGVVGLLKT +P
Sbjct  501   ILKPDITAPGVNIIAAFTGAIGATELPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHP  560

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSP+ IRSAIMTTA  R N+   + D  +  K TPF+YG+GHI PN A DPGLVYDL  
Sbjct  561   DWSPSAIRSAIMTTARTRDNTANPMRDG-SFKKATPFSYGSGHIRPNRAMDPGLVYDLSE  619

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY++F+C+ GYN+T I    G+ Y+C    +L  FNYPSI+VP + G+ T++R LKNVG
Sbjct  620   DDYLDFLCSIGYNQTTIKRFFGSQYECSKSANLEDFNYPSISVPMISGSVTLSRKLKNVG  679

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP+ Y ASVR P+G SV+V PKIL F+K+GEE+SFKVTLK K   A  +Y FG LTW+D 
Sbjct  680   SPSNYAASVREPLGISVSVEPKILTFKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDG  739

Query  206   KHRVRSPIVVKTA  168
             KH VRSPIVV  A
Sbjct  740   KHYVRSPIVVNQA  752



>ref|XP_010693559.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Beta vulgaris subsp. vulgaris]
Length=1098

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/734 (59%), Positives = 536/734 (73%), Gaps = 17/734 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D D+V   HH  L  ++GS ++A+DA+FYSYTRHINGFAA LEE +AAEIA++P V+SVF
Sbjct  373   DFDQVTDYHHNFLANFVGSLEEAKDAMFYSYTRHINGFAANLEEHQAAEIAEHPSVVSVF  432

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ ++L TT SW+F+ LE           W  A+FGEDTIIGNLDTGVWPES+SF+++G
Sbjct  433   LNKGKKLHTTHSWDFMLLENNA---KPSEAWSAARFGEDTIIGNLDTGVWPESESFNDKG  489

Query  1997  FGPIPKRWKGICQ--NQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGS  1824
             FGPIP RWKGIC+  N      HCNRKLIGAR+F +GY +  G + +   + RD  GHGS
Sbjct  490   FGPIPSRWKGICEHNNVTTGRVHCNRKLIGARHFNKGYKAFGGEVENFMESARDYDGHGS  549

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGNFV GAN+ GL  G  KGGSP+ARVA+YKVCW P + G +C+D+DI+A FD 
Sbjct  550   HTLSTAGGNFVSGANMNGLPLGIVKGGSPRARVASYKVCWTPIN-GNECFDSDIMAAFDM  608

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI D VDVLSVSLGGD P  YF D LAIGSFHAV+NGI VV SAGN GP  GSV+NVAPW
Sbjct  609   AIHDRVDVLSVSLGGD-PTDYFEDGLAIGSFHAVQNGIAVVCSAGNSGPTPGSVSNVAPW  667

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             ++TVGA+TMDR FQS V LG+   + G S +   LP    YPL+SAA A++   A+ S  
Sbjct  668   ILTVGASTMDREFQSFVELGDGHRFKGTS-LSKALPKNTLYPLMSAAQAKL---ANASAS  723

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DAL CKPGTLD +KVKGK+L CL+G N R++K  +A LAGA GMIL NDE  GNE+IAD 
Sbjct  724   DALLCKPGTLDEKKVKGKILACLRGGNARVDKGMQAKLAGAAGMILCNDELDGNEVIADL  783

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA H++Y+DG A+F YIN T  P+ ++TH      VKPAP +AAFSS+GPN + P++
Sbjct  784   HVLPAAHISYADGSAVFKYINSTAKPMGYLTHSKATFDVKPAPYMAAFSSKGPNTVTPEL  843

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+VIAA+++A  P+D   D R VS+ ++SGTSMSCPH++G+VGLLKTL+P+
Sbjct  844   LKPDITAPGVDVIAAYSQAVSPTDEPSDHRRVSYMMDSGTSMSCPHISGIVGLLKTLHPT  903

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA IRSAIMTTA  R N+   + +D    K TPF YGAGH+ P  A DPGL+YDL  T
Sbjct  904   WSPAAIRSAIMTTARTRDNTINPM-EDANYAKATPFGYGAGHVRPTRAMDPGLIYDLNAT  962

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCP----DHISLSTFNYPSITVPHLKGTATVTRTLK  396
             DY+ F+C+ GYNKT I       +KC     +  +L  FNYPSITVP L G+ TVTRT+K
Sbjct  963   DYLQFLCSIGYNKTTIETFYNGSHKCSKSSYNKENLLNFNYPSITVPKLSGSVTVTRTVK  1022

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVLT  219
             NVGSP  Y A VR P+  SVTV PK++KFEKVGEE+ FKVTL +K     + +Y FG L 
Sbjct  1023  NVGSPGVYVARVRQPLRVSVTVTPKMMKFEKVGEEKKFKVTLTSKVRGGKSEEYRFGELL  1082

Query  218   WSDKKHRVRSPIVV  177
             WSD KH VRSPIVV
Sbjct  1083  WSDGKHYVRSPIVV  1096



>ref|XP_010657502.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=620

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/626 (67%), Positives = 492/626 (79%), Gaps = 6/626 (1%)
 Frame = -2

Query  2045  LDTGVWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLN  1866
             + TGVWPES SFS+EG GPIP RW+GICQN KD  FHCNRKLIGARYF QGY++AVG LN
Sbjct  1     MTTGVWPESASFSDEGMGPIPSRWRGICQNDKDAGFHCNRKLIGARYFHQGYAAAVGSLN  60

Query  1865  SSFFTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPG  1686
             SSF TPRD  GHGSHTLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAYKVCWPP   G
Sbjct  61    SSFHTPRDTEGHGSHTLSTAGGNFVEGASVFGFGNGTAKGGSPKARVAAYKVCWPPVG-G  119

Query  1685  EDCYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGN  1506
              +C+DADILA FD AI DGVDVLS SLGG  P P+FNDSL+IGSFHAVK+GIVVV SAGN
Sbjct  120   NECFDADILAAFDIAIHDGVDVLSASLGG-LPTPFFNDSLSIGSFHAVKHGIVVVCSAGN  178

Query  1505  EGPVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSA  1326
              GP  G+V+N++PW  TVGA+TMDR+F S +VLGNKK   G S  P  LP  KF+PL+SA
Sbjct  179   SGPADGTVSNISPWQFTVGASTMDRQFPSYLVLGNKKRLEGGSLSPKALPPNKFFPLISA  238

Query  1325  ASARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMIL  1146
             A A+    A+ S  DAL CK GTLD  KVKGK+LVCL+GEN R++K  +AALAGAVGM+L
Sbjct  239   ADAK---AANASADDALLCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVL  295

Query  1145  ANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIA  966
             AN+E +GNE+IAD H LPA+H+ ++DG+A+F Y+N T++P+A+IT   T LG KPAP +A
Sbjct  296   ANNELTGNEVIADPHVLPASHINFTDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMA  355

Query  965   AFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPH  786
             AFSS+GPN I P+ILKPDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPH
Sbjct  356   AFSSKGPNTITPEILKPDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPH  415

Query  785   VAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPN  606
             V+G+VGLLKTL+P WSPA IRSA+MTTA    NS +AI  + +  K TPF+YGAGH+ PN
Sbjct  416   VSGIVGLLKTLHPDWSPAAIRSAMMTTARTMDNSMEAIL-NASYFKATPFSYGAGHVRPN  474

Query  605   GAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK  426
              A +PGLVYDL + DY+NF+CA GYN+T I      PY CP  ISL+ FNYPSITVP L 
Sbjct  475   RAMNPGLVYDLNVNDYLNFLCALGYNQTLIKMFSERPYTCPKPISLTNFNYPSITVPKLH  534

Query  425   GTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENAT  246
             G+ TVTRTLKNVG P TY A +R P G SV+V P  LKF K+GEE++F +TL+A+   A 
Sbjct  535   GSITVTRTLKNVGPPGTYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAA  594

Query  245   ADYAFGVLTWSDKKHRVRSPIVVKTA  168
              DY FG L WSD KH VRSPIVVK A
Sbjct  595   RDYVFGELIWSDAKHFVRSPIVVKAA  620



>ref|XP_010455547.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=777

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/732 (60%), Positives = 541/732 (74%), Gaps = 15/732 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             V LD V HSH   L +++GS   A++AIFYSY RHINGFAA+L+E EAAEIAK+P+V+SV
Sbjct  55    VHLDGVAHSHRTFLASFVGSHQNAQEAIFYSYKRHINGFAAVLDENEAAEIAKHPDVVSV  114

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
              LN+ R+L TT SW+F+ LE + GV+H  S+W KA +GE+TII NLDTGVWPESKSFS+E
Sbjct  115   LLNKGRKLHTTHSWDFMLLE-KNGVVHKSSLWNKAGYGENTIIANLDTGVWPESKSFSDE  173

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G+G +P RWKG C     K   CNRKLIGARYF +GY +  G   N+SF T RD  GHGS
Sbjct  174   GYGAVPARWKGKCH----KDVPCNRKLIGARYFNKGYLAYTGLSSNASFETSRDHDGHGS  229

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTA GNFVPGANVFG+GNGTA GGSPKAR+AAYKVCWPP + G +C+DADILA  + 
Sbjct  230   HTLSTAAGNFVPGANVFGIGNGTASGGSPKARIAAYKVCWPPVN-GAECFDADILAAIEA  288

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI+DGVDV+S S+GGD  G Y ND +AIGSF AVKNG+  VASAGN GP  G+V+NVAPW
Sbjct  289   AIDDGVDVISASVGGD-AGDYMNDGIAIGSFLAVKNGVTFVASAGNSGPKPGTVSNVAPW  347

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITVGA++MDR FQ+ V L N + + G S +   LP  K Y L+SAA A++   A+ +  
Sbjct  348   IITVGASSMDREFQAFVALNNGQSFKGTS-LSKPLPEDKMYSLISAAEAKV---ANGNAT  403

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DAL CK G+LDPEKVKGK++VCL+G+N R+EK  +AA AGAVGMIL ND+ SGNEII+DA
Sbjct  404   DALLCKKGSLDPEKVKGKIVVCLRGDNARVEKGQQAAAAGAVGMILCNDKASGNEIISDA  463

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LPA+ + Y DG A+F Y+N T++P  +I  P + L +KPAP +A+FSSRGPN++ P I
Sbjct  464   HVLPASQIDYKDGEAVFSYLNSTKDPKGYIKAPTSALNIKPAPFMASFSSRGPNSVTPGI  523

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGVN+IAAFTEAT P+D D D R   +N ESGTSMSCPH+AG+VGLLKTL+P 
Sbjct  524   LKPDITAPGVNIIAAFTEATSPTDLDSDHRRTPYNTESGTSMSCPHIAGIVGLLKTLHPQ  583

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA IRSAIMTT+  R N  K + D+ +  K  PF+YG+GH+ PN A+ PGLVYDL   
Sbjct  584   WSPAAIRSAIMTTSRTRDNRRKPMVDE-SFKKANPFSYGSGHVQPNKASHPGLVYDLTTG  642

Query  563   DYVNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY++F+CA GYN T +        Y C    +L  FNYPSIT+P+L  T TVTR LKNVG
Sbjct  643   DYLDFLCAVGYNNTVVQLFAEDKQYMCRQGANLLDFNYPSITIPNLTDTITVTRKLKNVG  702

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGVLTWSD  210
              PATY A  R P+G SV V PK L F K GE + F++TL+ K    +   Y FG LTW+D
Sbjct  703   PPATYNAHFRQPLGVSVNVEPKQLSFNKTGEVKMFQMTLRPKSVKPSGSGYVFGELTWTD  762

Query  209   KKHRVRSPIVVK  174
               H VRSPIVV+
Sbjct  763   SHHYVRSPIVVQ  774



>ref|XP_004296127.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=774

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/733 (60%), Positives = 542/733 (74%), Gaps = 11/733 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL  V++ H+  LG++L S   A+D IFYSYT+HINGFAA+LEEEEAA+IAK+P VISV
Sbjct  47    VDLGYVRNFHYDFLGSFLRSNRSAKDVIFYSYTKHINGFAAILEEEEAAQIAKDPNVISV  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ +QLQTTRSW FLGLE   G+I   SIWKK++FGEDTII N+DTGVWPESKSFS+E
Sbjct  107   FLNKGKQLQTTRSWNFLGLE-RNGLIPSDSIWKKSRFGEDTIIANIDTGVWPESKSFSDE  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GP+P +W G CQ +  K   CNRKLIG RYF  G +   GPLNSS+ T RD  GHGSH
Sbjct  166   GLGPVPSKWHGTCQ-RDTKQVQCNRKLIGTRYFNNGLAMYAGPLNSSYSTVRDHDGHGSH  224

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA G FVPG +VFG GNGTAKGGSP+ARVAAYKVCWP T  G  C +ADILA FD A
Sbjct  225   TLSTAAGGFVPGVSVFGNGNGTAKGGSPQARVAAYKVCWP-TFEGVQCSEADILAAFDAA  283

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDV+SVSLGG     YFND+++IGSFHAVKNGIVVV++AGN GP  G+V N++PWL
Sbjct  284   ISDGVDVISVSLGGGTE-EYFNDAISIGSFHAVKNGIVVVSAAGNSGPNPGTVLNLSPWL  342

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TVGA+T+DR F S+V LGNKK + G S     LP+  FYPL+SAA AR   NA+ ST++
Sbjct  343   VTVGASTVDREFTSSVFLGNKKQFKGASLSAKDLPSEMFYPLISAADAR---NANASTRE  399

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQ--GENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             A  C  G LDP KV GK+LVCL+    N+R EKS +A +AGA+GMIL NDE SGN+++AD
Sbjct  400   AEVCNVGALDPRKVNGKILVCLREYNNNERTEKSQQADIAGALGMILVNDEQSGNDVVAD  459

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H L  +H+ YSDG  +FDYI  T+ PVA++T     LGV+PAP +A FSSRGPN +   
Sbjct  460   PHVLLVSHLNYSDGKHVFDYIKSTKLPVAYLTPVKAELGVRPAPTVAPFSSRGPNLLEQA  519

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI APGV++IAA+TEATGP+    D R VSFNV++GTSM+CPHV+GV GLL+TL+P
Sbjct  520   ILKPDIIAPGVSIIAAYTEATGPTYQSSDTRRVSFNVQTGTSMACPHVSGVAGLLRTLHP  579

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SAIMTTAT + +S + + D    LK TPFAYGAGHI PN A DPGL+Y+L  
Sbjct  580   DWSPAVIKSAIMTTATTQDDSNEQMFDSSAYLKATPFAYGAGHIQPNKAMDPGLIYNLTT  639

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVT-RTLKN  393
              DY++ +CA+GYN+T I +   +P+KCP   SL  FNYP+I VP+L  T  T+T R + N
Sbjct  640   LDYLDLLCARGYNETMIKSFSDSPFKCPKSFSLGDFNYPAIVVPNLGATLVTITRRRVTN  699

Query  392   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  213
             VGSP TY   V++P    V V P+ LKFE +GE + F+V  KAK +     YAFG L WS
Sbjct  700   VGSPGTYKVRVKAPPEVEVLVKPRSLKFESIGEVKKFEVIFKAKVKGKPRGYAFGELMWS  759

Query  212   DKKHRVRSPIVVK  174
             D  H V++P+ VK
Sbjct  760   DGNHHVKTPLAVK  772



>ref|XP_006282063.1| hypothetical protein CARUB_v10028308mg [Capsella rubella]
 gb|EOA14961.1| hypothetical protein CARUB_v10028308mg [Capsella rubella]
Length=781

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/731 (60%), Positives = 539/731 (74%), Gaps = 15/731 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LD V HSH   L +++GS   A +AIFYSY +HINGFAA+L+E EAAEIAK+P+V+SVFL
Sbjct  63    LDGVAHSHRTFLSSFVGSHQNANEAIFYSYKKHINGFAAVLDENEAAEIAKHPDVVSVFL  122

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW F+ LE + GV+H  S+W KA +GEDTII NLDTGVWPESKSFS+EG+
Sbjct  123   NKGRKLHTTHSWNFMLLE-KNGVVHKSSLWNKAGYGEDTIIANLDTGVWPESKSFSDEGY  181

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             GP+P RWKG C     K   CNRKLIGARYF +GY +  G P N+SF T RD  GHG+HT
Sbjct  182   GPVPARWKGKCH----KDVPCNRKLIGARYFNKGYLAYTGLPSNASFETSRDYDGHGTHT  237

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGANVFGLGNGTA GGSPKARVAAYKVCWPP + G +C+DADILA  + AI
Sbjct  238   LSTAAGNFVPGANVFGLGNGTASGGSPKARVAAYKVCWPPVN-GAECFDADILAAIEAAI  296

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
             +DGVDV+S S+GGD  G Y ND +AIGSF+AVKNG+ VV SAGN GP  G+V+NVAPW+I
Sbjct  297   DDGVDVISASVGGD-AGDYLNDGIAIGSFNAVKNGVTVVCSAGNSGPKPGTVSNVAPWII  355

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N + + G S +   LP  K Y L+SAA A     A+ +  DA
Sbjct  356   TVGASSMDREFQAFVKLNNGQSFKGTS-LSKPLPEEKMYSLISAAEAN---VANANATDA  411

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK G+LDP KVKGK++VCL+G+N R+EK  + A AG +GMIL ND+ SGNEII+DAH 
Sbjct  412   LLCKKGSLDPVKVKGKIVVCLRGDNARVEKGQQVAAAGGLGMILCNDKASGNEIISDAHV  471

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG A+F Y+N T++P  +I  P + L  KPAP +A+FSSRGPN + P ILK
Sbjct  472   LPASQIDYKDGEAVFAYLNSTKDPKGYIKAPTSTLNTKPAPFMASFSSRGPNTVTPGILK  531

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVNVIAAFTEAT P+D   D R   FN ESGTSMSCPH+AGVVGLLKTL+P WS
Sbjct  532   PDITAPGVNVIAAFTEATSPTDLASDHRRTPFNTESGTSMSCPHIAGVVGLLKTLHPQWS  591

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             P  IRSAIMTT+  R N  K + D+ +  K  PF+YG+GH+ PN AA PGLVYDL   DY
Sbjct  592   PGAIRSAIMTTSRTRDNRRKPMVDE-SFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGDY  650

Query  557   VNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GYN T +        Y C    +L  FNYPSITVP+L  + TVTR LKNVG+P
Sbjct  651   LDFLCAVGYNNTVVQLFAEDKQYMCRQGANLLDFNYPSITVPNLTDSITVTRKLKNVGTP  710

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ATY A +R P+G SV+V PK LKF KVGE + F++TL+ K    ++ Y FG LTW+D  H
Sbjct  711   ATYIARLREPLGVSVSVEPKQLKFSKVGEVKMFQMTLRPKSAK-SSRYVFGELTWTDSHH  769

Query  200   RVRSPIVVKTA  168
              VRSPI V+ A
Sbjct  770   YVRSPIAVELA  780



>emb|CDY65693.1| BnaA02g06800D [Brassica napus]
Length=763

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/729 (61%), Positives = 540/729 (74%), Gaps = 15/729 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LDRV HSH   L ++LGS   A DAIFYSY RHINGFAA+L++++A+EIAK+P V S+FL
Sbjct  45    LDRVAHSHRTFLASFLGSHQSAEDAIFYSYKRHINGFAAVLDDKKASEIAKHPNVASIFL  104

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW+F+ LE + GV+H  S+WKKA+FGEDTII NLDTGVWPESKSFS+EG+
Sbjct  105   NKGRKLHTTHSWDFMLLE-KHGVVHKSSLWKKARFGEDTIIANLDTGVWPESKSFSDEGY  163

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGY-SSAVGPLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C         CNRKLIGA+YF +GY + A  P NS+F TPRD+ GHG+HT
Sbjct  164   GDVPARWKGSCHGD----VPCNRKLIGAKYFNKGYLAYAKFPSNSTFETPRDLDGHGTHT  219

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPGANVFGLGNGTA GGSPKARVA+YKVCWPP   G +C+DADILA  D AI
Sbjct  220   LSTAGGNFVPGANVFGLGNGTASGGSPKARVASYKVCWPPFK-GAECFDADILAAIDAAI  278

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDV+S S+GGD  G Y ND L+IGSF AVKNG+ VV SAGN GP  G+V+NVAPW+I
Sbjct  279   GDGVDVISASVGGD-AGDYMNDGLSIGSFVAVKNGVTVVCSAGNSGPKPGTVSNVAPWII  337

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N   + G S +   LP  K Y L+SAA  +    A+ S   A
Sbjct  338   TVGASSMDREFQAFVELSNGSRFEGTS-LSTPLPENKMYDLISAADGKA---ANASALQA  393

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK  +LDPEKVKGK++VCL+G+N R++K  +AA AGAVGMIL ND+ SGNEII+DAH 
Sbjct  394   LLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEIISDAHV  453

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG A+F Y+N T++P  +IT PNT L  KPAP +A+FSSRGPN I P ILK
Sbjct  454   LPASQINYKDGEAVFSYLNSTKDPKGYITAPNTQLHTKPAPFMASFSSRGPNTITPGILK  513

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVNV+AA+TEATGP+D + D R   FNVESGTSMSCPH++G+VGLLKTL P WS
Sbjct  514   PDITAPGVNVVAAYTEATGPTDIESDNRRTPFNVESGTSMSCPHISGIVGLLKTLRPQWS  573

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTT+  R N+ K +  D T  K TPF YGAGH+ PN A+ PGLVYDL   DY
Sbjct  574   PAAIRSAIMTTSRTRDNTRKPMV-DATFHKATPFGYGAGHVQPNKASHPGLVYDLNTGDY  632

Query  557   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GY    +      P Y C +  +L  FNYPSITVP L  + T+TR L NVG P
Sbjct  633   LDFLCAIGYENKVVQLFADDPLYTCREGANLLDFNYPSITVPKLTDSVTITRKLTNVGPP  692

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TY +   +P+G  V+V PK L F KVGEE+ F++T+ A  E A   Y FG LTW+D KH
Sbjct  693   STYRSYFHAPLGVEVSVEPKQLTFSKVGEEKMFQMTIGATSEKALG-YVFGELTWTDSKH  751

Query  200   RVRSPIVVK  174
              VR+PIVV+
Sbjct  752   YVRTPIVVQ  760



>ref|XP_004515893.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=767

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/738 (58%), Positives = 539/738 (73%), Gaps = 22/738 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D      SH+  LG+Y+GS +KA++AIFYSY R+INGFAA+L+E+EAA +AK+P V+S+
Sbjct  44    LDSKLATDSHYDFLGSYVGSTEKAKEAIFYSYNRYINGFAAILDEDEAANVAKHPNVVSI  103

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +L TTRSWEFLGLE  GG   D S+W K+  GED IIGNLDTGVWPES+SFS++
Sbjct  104   FLNKKYELHTTRSWEFLGLERNGGFPKD-SLWHKS-LGEDVIIGNLDTGVWPESQSFSDK  161

Query  2000  GFGPIPKRWKGICQ---NQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGH  1830
             GFGPIPK+W+G CQ   N KDK FHCNRKLIGARYF +GY ++ G  N+S  + RD  GH
Sbjct  162   GFGPIPKKWRGFCQVAQNNKDK-FHCNRKLIGARYFSKGYEASQGK-NASINSARDFDGH  219

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLSTAGGNFV G NVFG GNGTA GGSPKARVAAYKVCW      + CYDADILAGF
Sbjct  220   GSHTLSTAGGNFVNGVNVFGYGNGTASGGSPKARVAAYKVCW------DGCYDADILAGF  273

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             + AI DGVDV+S+SLGGD P  YF + ++IGSFHAV   IVVV S GN GP   SV+N+ 
Sbjct  274   EAAIHDGVDVISMSLGGD-PQEYFQNGISIGSFHAVSKNIVVVGSGGNSGPTPASVSNLE  332

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW++T  A+T+DR F S V LGNKK Y G S     LP  K YPL+SAA A++    ++S
Sbjct  333   PWMLTTAASTIDRNFASYVTLGNKKIYMGASLSDTALPPHKMYPLISAADAKLD---NVS  389

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
              +DAL CK G +DP KV GK+LVCL+G + R++K  +A+ AGA+GMILANDE SG E+IA
Sbjct  390   AEDALLCKEGAIDPHKVNGKILVCLRGGSGRVDKGVQASRAGAIGMILANDEASGGEVIA  449

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D H LPA+HV ++ G  IFDYIN T+ PVA+I+   T LGV+P P++A+FSSRGPN I P
Sbjct  450   DPHLLPASHVNFTIGNYIFDYINSTKLPVAYISRVKTKLGVRPTPIMASFSSRGPNYIAP  509

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
              +LKPDI+APGVN+IAA+++AT PS+   DKR + F   SGTSMSCPHV G+VGLLK+L+
Sbjct  510   SLLKPDITAPGVNIIAAYSKATSPSEEASDKRRIPFTTMSGTSMSCPHVTGLVGLLKSLH  569

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P WSPA I+SAIMTTAT + N    + D     K TPFAYGAGHI PN AADPGLVYDL 
Sbjct  570   PDWSPAAIKSAIMTTATTKDNIDSQMLDSSLD-KATPFAYGAGHIRPNRAADPGLVYDLN  628

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVP--HLKGTATVTRTLK  396
             +TDY+NF+C +GY  +++T   G PY CP+  +L  FNYP+IT+P  ++  +  VTR L 
Sbjct  629   ITDYLNFLCRRGYTSSQLTLFYGRPYDCPESFNLVDFNYPAITIPTFNVGHSLNVTRILT  688

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKV--TLKAKGENATADYAFGVL  222
             NVGSP+ Y   +++P  F V+V P  L+F K GE++ FKV  TLK        DY FG L
Sbjct  689   NVGSPSKYRVRIQAPSEFLVSVEPSRLRFVKKGEKKEFKVTFTLKPNYSKYITDYVFGKL  748

Query  221   TWSDKKHRVRSPIVVKTA  168
              WS+ KHRV + I ++ A
Sbjct  749   VWSNGKHRVATRISIRYA  766



>ref|XP_009759676.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=623

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/622 (65%), Positives = 485/622 (78%), Gaps = 6/622 (1%)
 Frame = -2

Query  2036  GVWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSF  1857
             G WPESKSF +E  GPIP +W+GICQN  D +F CNRKLIGARYF QGY++  G LNSSF
Sbjct  7     GAWPESKSFIDEELGPIPSKWRGICQNDSDHTFQCNRKLIGARYFNQGYATLAGSLNSSF  66

Query  1856  FTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDC  1677
              TPRD  GHGSHTLSTAGGNFV GA+VFG GNGTAKGGSPKARVAAY+VCWPP   G +C
Sbjct  67    NTPRDTDGHGSHTLSTAGGNFVQGASVFGYGNGTAKGGSPKARVAAYRVCWPPIM-GNEC  125

Query  1676  YDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGP  1497
             +D+DILA FD AI DGVDVLSVSLGGD  G Y NDS+AIGSFHAVK+GIVVV SAGN GP
Sbjct  126   FDSDILAAFDMAIHDGVDVLSVSLGGDA-GAYVNDSVAIGSFHAVKHGIVVVTSAGNSGP  184

Query  1496  VAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASA  1317
               G+V+NVAPWLITVGA+TMDR+F S ++LGNKK Y GES     LP GK +P+++AASA
Sbjct  185   GPGTVSNVAPWLITVGASTMDRQFPSYIILGNKKQYKGESLSVETLPKGKLFPIINAASA  244

Query  1316  RIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILAND  1137
             +       ST DA  CK G LDP+KVKG +LVCL+G+N R++K  +AALAGAVGM+LAND
Sbjct  245   KAP---HASTDDAQLCKAGALDPKKVKGTILVCLRGDNARVDKGQQAALAGAVGMVLAND  301

Query  1136  EDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFS  957
               SGNEIIAD H LPAT ++Y+DGL +F Y+N TR P A ITHP T LG KPAPV+AAFS
Sbjct  302   YASGNEIIADPHVLPATQISYTDGLELFAYVNSTRTPTASITHPKTQLGTKPAPVMAAFS  361

Query  956   SRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAG  777
             S GPN + P+ LKPDI+APGV+VIAA+T A GP++ D+DKR V FN  SGTSMSCPHV+G
Sbjct  362   SIGPNTVTPEFLKPDITAPGVSVIAAYTGAEGPTNQDFDKRRVKFNSVSGTSMSCPHVSG  421

Query  776   VVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAA  597
             +VGLLKTLYP+WSP+ I+SAIMTTA  R N+ + +  + + +KT+PFAYGAGH+ PN A 
Sbjct  422   IVGLLKTLYPTWSPSAIKSAIMTTARTRDNAIEPML-NASYIKTSPFAYGAGHVRPNRAM  480

Query  596   DPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA  417
             DPGLVYDL + DY++F+CAQGYN+T+I      P+KCP+ I+    N PSITVP+L G+ 
Sbjct  481   DPGLVYDLTIDDYLSFLCAQGYNETQIKTFTQGPFKCPEPINFINMNLPSITVPNLNGSV  540

Query  416   TVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADY  237
             TVTRTLKNVGSP TY A +R P+G S  V P  L+F+ +GE++SFK+TLK KG     DY
Sbjct  541   TVTRTLKNVGSPGTYKACIRRPIGISAVVEPNSLEFKNIGEKKSFKLTLKVKGSKGPKDY  600

Query  236   AFGVLTWSDKKHRVRSPIVVKT  171
              FG L WS  KH VRSPIVVK+
Sbjct  601   VFGQLIWSYGKHYVRSPIVVKS  622



>ref|XP_010942535.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X4 [Elaeis 
guineensis]
Length=775

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/728 (60%), Positives = 550/728 (76%), Gaps = 9/728 (1%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             RV+ SH++LL + LG+ +KA D++FYSYT +INGFAA LEEEEA EI++ P VISVF NR
Sbjct  52    RVRDSHYELLASVLGNKEKAHDSLFYSYTSYINGFAANLEEEEAMEISRYPGVISVFPNR  111

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSWEFLGLE +G V  + S+W KA+FGED IIGNLDTGVWPES+SF ++G GP
Sbjct  112   GYKLHTTRSWEFLGLERDGRVPKE-SLWTKARFGEDIIIGNLDTGVWPESESFKDDGLGP  170

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +WKGICQ   DKSF CNRK+IGARY+ +GY++A G LN++F TPRD  GHG+HTLST
Sbjct  171   VPSKWKGICQIGVDKSFSCNRKVIGARYYNKGYAAAGGTLNATFETPRDNDGHGTHTLST  230

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             AGG FVPGAN+FG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+A FD AI DG
Sbjct  231   AGGGFVPGANIFGYGNGTAKGGSPRARVAAYKVCWPPIN-GSECFDADIIAAFDAAIHDG  289

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLSVSLGGD P  Y  D LAIGSFHAVKNGI VV SAGN GP+ GSV+N APW+ITVG
Sbjct  290   VDVLSVSLGGD-PITYSLDGLAIGSFHAVKNGITVVCSAGNSGPLPGSVSNTAPWIITVG  348

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TMDR F + +   N K   G S     LP  + YP++++  A+     + +  DA  C
Sbjct  349   ASTMDREFPAYINF-NNKSIKGASLSQKGLPGNQLYPMINSKEAKA---PNATEHDAELC  404

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDPEKV+GK++VCL+G   R+EK     LAG  GM+L ND+ SGNEIIADAH LPA
Sbjct  405   YLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLLPA  464

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             TH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILKPDI
Sbjct  465   THITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKPDI  524

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGV+V+AA++EA GP+   +D R V+FN +SGTSMSCPH++GVVGLLK+L+P W+P+ 
Sbjct  525   TAPGVSVLAAYSEAVGPTGLPFDTRRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWNPSA  584

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  + N  + + +    +K TPF+YG+GH+ PN A DPGLVYDL   DY+NF
Sbjct  585   IKSAIMTTARTQDNMDEPVLNSSY-VKATPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNF  643

Query  548   ICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  372
             +C+ GYN T+I       + CP     L   NYPSIT+P+L G+ TVTRTLKNVGSP TY
Sbjct  644   LCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITIPYLFGSITVTRTLKNVGSPGTY  703

Query  371   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVR  192
                +R P G SV+VNP  L ++K+GEE+ F+VTLK K  +A+ DY FG L WSD KH VR
Sbjct  704   IIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVKKGHASMDYVFGGLIWSDGKHYVR  763

Query  191   SPIVVKTA  168
             +P+VV  A
Sbjct  764   TPLVVSAA  771



>ref|XP_010942534.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Elaeis 
guineensis]
Length=782

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/728 (60%), Positives = 550/728 (76%), Gaps = 9/728 (1%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             RV+ SH++LL + LG+ +KA D++FYSYT +INGFAA LEEEEA EI++ P VISVF NR
Sbjct  59    RVRDSHYELLASVLGNKEKAHDSLFYSYTSYINGFAANLEEEEAMEISRYPGVISVFPNR  118

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSWEFLGLE +G V  + S+W KA+FGED IIGNLDTGVWPES+SF ++G GP
Sbjct  119   GYKLHTTRSWEFLGLERDGRVPKE-SLWTKARFGEDIIIGNLDTGVWPESESFKDDGLGP  177

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +WKGICQ   DKSF CNRK+IGARY+ +GY++A G LN++F TPRD  GHG+HTLST
Sbjct  178   VPSKWKGICQIGVDKSFSCNRKVIGARYYNKGYAAAGGTLNATFETPRDNDGHGTHTLST  237

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             AGG FVPGAN+FG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+A FD AI DG
Sbjct  238   AGGGFVPGANIFGYGNGTAKGGSPRARVAAYKVCWPPIN-GSECFDADIIAAFDAAIHDG  296

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLSVSLGGD P  Y  D LAIGSFHAVKNGI VV SAGN GP+ GSV+N APW+ITVG
Sbjct  297   VDVLSVSLGGD-PITYSLDGLAIGSFHAVKNGITVVCSAGNSGPLPGSVSNTAPWIITVG  355

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TMDR F + +   NK    G S     LP  + YP++++  A+     + +  DA  C
Sbjct  356   ASTMDREFPAYINFNNKS-IKGASLSQKGLPGNQLYPMINSKEAKA---PNATEHDAELC  411

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDPEKV+GK++VCL+G   R+EK     LAG  GM+L ND+ SGNEIIADAH LPA
Sbjct  412   YLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLLPA  471

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             TH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILKPDI
Sbjct  472   THITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKPDI  531

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGV+V+AA++EA GP+   +D R V+FN +SGTSMSCPH++GVVGLLK+L+P W+P+ 
Sbjct  532   TAPGVSVLAAYSEAVGPTGLPFDTRRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWNPSA  591

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  + N  + + +    +K TPF+YG+GH+ PN A DPGLVYDL   DY+NF
Sbjct  592   IKSAIMTTARTQDNMDEPVLNSSY-VKATPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNF  650

Query  548   ICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  372
             +C+ GYN T+I       + CP     L   NYPSIT+P+L G+ TVTRTLKNVGSP TY
Sbjct  651   LCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITIPYLFGSITVTRTLKNVGSPGTY  710

Query  371   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVR  192
                +R P G SV+VNP  L ++K+GEE+ F+VTLK K  +A+ DY FG L WSD KH VR
Sbjct  711   IIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVKKGHASMDYVFGGLIWSDGKHYVR  770

Query  191   SPIVVKTA  168
             +P+VV  A
Sbjct  771   TPLVVSAA  778



>ref|XP_003528716.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/730 (59%), Positives = 537/730 (74%), Gaps = 12/730 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D D V   HH+ + +Y+GS +KA++AI YSYTRHINGFAAMLEE+EAA+IAK+P+V+SVF
Sbjct  48    DFDLVTQIHHEFVKSYVGSSEKAKEAIIYSYTRHINGFAAMLEEKEAADIAKHPDVVSVF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TT SWEF+ LEG  GVI   S+++KAK+GEDTII N DTGVWPES SF +EG
Sbjct  108   LNKGRKLHTTHSWEFMDLEGNDGVIPSDSLFRKAKYGEDTIIANFDTGVWPESPSFRDEG  167

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP---LNSSFFTPRDVIGHG  1827
              GPIP RWKG CQ+     F CNRKLIGARYF +GY +  G     N S  T RD  GHG
Sbjct  168   MGPIPSRWKGTCQHDH-TGFRCNRKLIGARYFNKGYMAHAGADAKFNRSLNTARDYEGHG  226

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLST GG FVPGANVFGLGNGTA+GGSP+ARVA YKVCWPP   G +C+DADI+A FD
Sbjct  227   SHTLSTIGGTFVPGANVFGLGNGTAEGGSPRARVATYKVCWPPID-GNECFDADIMAAFD  285

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDVLS+SLGG+    YF+D L+IG+FHA   GI V+ SAGN GP   +V NVAP
Sbjct  286   MAIHDGVDVLSLSLGGNATD-YFDDGLSIGAFHANMKGIPVICSAGNYGPTPATVFNVAP  344

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W++TVGA+T+DR+F S V L N + + G S +   +P  K YPL++AA A+    A+   
Sbjct  345   WILTVGASTLDRQFDSVVELHNGQRFMGAS-LSKAMPEDKLYPLINAADAK---AANKPV  400

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             ++A  C  GT+DPEK +GK+LVCL+G   R+EKS  A  AGA GMIL NDE SGNE+IAD
Sbjct  401   ENATLCMRGTIDPEKARGKILVCLRGVTARVEKSLVALEAGAAGMILCNDELSGNELIAD  460

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPA+ + Y DGLA++ ++N T+NP+ +I  P T L +KPAP +AAFSSRGPN + P+
Sbjct  461   PHLLPASQINYKDGLAVYAFMNSTKNPLGYIYPPKTKLQIKPAPAMAAFSSRGPNTVTPE  520

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPD+ APGVN+IAA++E   P++  +DKR V F   SGTSMSCPHVAGVVGLLKTL+P
Sbjct  521   ILKPDVIAPGVNIIAAYSEGVSPTNLGFDKRRVPFITMSGTSMSCPHVAGVVGLLKTLHP  580

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SA+MTTA  R N+GK + D     K TPFAYG+GHI PN A DPGLVYDL  
Sbjct  581   DWSPAVIKSALMTTARTRDNTGKPMLDGGNDAKATPFAYGSGHIRPNRAMDPGLVYDLTN  640

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY+NF+C   YN+++I    G  Y+CPD I++  FNYP+IT+P L G+ +VTR +KNVG
Sbjct  641   NDYLNFLCFSIYNQSQIEMFNGARYRCPDIINILDFNYPTITIPKLYGSVSVTRRVKNVG  700

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
              P TYTA ++ P   S++V P +LKF+ +GEE+SFK+T++      T   AFG +TWSD 
Sbjct  701   PPGTYTARLKVPARLSISVEPNVLKFDNIGEEKSFKLTVEVTRPGETT--AFGGITWSDG  758

Query  206   KHRVRSPIVV  177
             K +VRSPIVV
Sbjct  759   KRQVRSPIVV  768



>gb|KEH35216.1| subtilisin-like serine protease [Medicago truncatula]
Length=649

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/654 (62%), Positives = 503/654 (77%), Gaps = 8/654 (1%)
 Frame = -2

Query  2132  LGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGPIPKRWKGICQNQ  1953
             +GLE   GVI   SIW KA+FG+  II NLDTGVWPESKSFS+EGFGPIP +W+GIC   
Sbjct  1     MGLEDSYGVIPSSSIWNKARFGDGIIIANLDTGVWPESKSFSDEGFGPIPSKWRGICDKG  60

Query  1952  KDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTLSTAGGNFVPGANV  1776
             +D SFHCNRKLIGARYF +GY+S +  PLNSSF TPRD  GHGSHTLSTAGGN VPG +V
Sbjct  61    RDPSFHCNRKLIGARYFNKGYASRLTVPLNSSFETPRDNEGHGSHTLSTAGGNMVPGVSV  120

Query  1775  FGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDGVDVLSVSLGGD  1596
             FG G GTAKGGSPKARVA+YKVCWPP + G++C+DADILA FD AI DGVDVLSVSLGG 
Sbjct  121   FGQGYGTAKGGSPKARVASYKVCWPPIN-GDECFDADILAAFDAAIHDGVDVLSVSLGGS  179

Query  1595  HPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVGANTMDRRFQSN  1416
                  FNDS+AIGSFHA K GIVVV SAGN GP   + +N+APW ITVGA+TMDR F S 
Sbjct  180   ASN-LFNDSVAIGSFHAAKKGIVVVCSAGNSGPNDATASNLAPWYITVGASTMDREFPSY  238

Query  1415  VVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHCKPGTLDPEKVK  1236
             VVLGN   + GES    +L   KFYP++ A  A++   AS + +DA+ C+ GTLDP+KVK
Sbjct  239   VVLGNNLTFKGESLSAARL-ADKFYPIIKATDAKL---ASATNEDAVLCQNGTLDPKKVK  294

Query  1235  GKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPATHVTYSDGLAI  1056
             GK+++CL+G N R++K  +A LAGAVGM+LAND+ +GNEIIAD H LPA+H+ +SDG+ +
Sbjct  295   GKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTGNEIIADPHVLPASHINFSDGVEV  354

Query  1055  FDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDISAPGVNVIAAF  876
             F Y+N +++PVA+ITHP T L  KPAP +AAFSS+GPN I P+ILKPDI+APGV+VIAA+
Sbjct  355   FHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGPNTIIPEILKPDITAPGVSVIAAY  414

Query  875   TEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATV  696
             TEA GP++ ++D R + FN  SGTSMSCPH++G+VGLL++LYPSW+PA I+SAIMTTAT 
Sbjct  415   TEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGLLRSLYPSWTPAAIKSAIMTTATT  474

Query  695   RANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEI  516
               N  + I  + T  + TPF+YGAGH+ PN A DPGLVYD+   DY NF+CA GYN+T++
Sbjct  475   LDNKAEPIM-NATKSQATPFSYGAGHVQPNSAMDPGLVYDITTNDYFNFLCALGYNETQM  533

Query  515   TAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSV  336
             +     PYKC  + S+   NYPSITVP+L G+ TVTRTLKNVG+P TY   V+SP G ++
Sbjct  534   SLFSKGPYKCHKNFSILNLNYPSITVPNLSGSVTVTRTLKNVGAPGTYIVHVQSPSGITI  593

Query  335   TVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVK  174
             +V P IL+F+KVGEE+ F+V LK K   AT  Y FG + WSD KH V+SP+VVK
Sbjct  594   SVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGKMIWSDGKHYVKSPLVVK  647



>ref|XP_004515894.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/736 (58%), Positives = 538/736 (73%), Gaps = 14/736 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D++ V +SH+ LL +Y+GS +KA++A+FYSY+++ NGFAA+L+E++AA +AKNP V+S+
Sbjct  44    LDVEAVANSHYDLLSSYVGSAEKAKEAVFYSYSKYFNGFAAVLDEDQAAMVAKNPNVVSI  103

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SW+FLGL      I + SIW K++ GED IIGNLDTGVWPESKSFS+E
Sbjct  104   FLNKPRELHTTHSWDFLGLIERNDAIPNDSIWSKSQ-GEDIIIGNLDTGVWPESKSFSDE  162

Query  2000  GFGPIPKRWKGIC---QNQKDKSFHCNRKLIGARYFIQGYSSAVGPL-NSSFFTPRDVIG  1833
             G GP+P RW+G C   +N  D +FHCNRKLIGARYF +GY +A+G + N SF + RDV G
Sbjct  163   GMGPVPTRWRGECVVDENNTD-NFHCNRKLIGARYFYKGYLAALGDIGNVSFNSARDVEG  221

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGN V G NVFG GNGTA GGSPKARVA YKVCWP       CY+ADILAG
Sbjct  222   HGSHTLSTAGGNAVNGVNVFGYGNGTASGGSPKARVATYKVCWPKVEGAGGCYEADILAG  281

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDV+SVSLGG  PG YF  S++ GSFHA+  GIVVV+SAGN GP   SV+N+
Sbjct  282   FEAAISDGVDVISVSLGG-APGEYFQSSISTGSFHAIAKGIVVVSSAGNSGPAPSSVSNL  340

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
              PW++TVGA+T+DR F + V LG+ K   G S     LP  KFYPL+S++ A+       
Sbjct  341   EPWVLTVGASTIDRAFTNYVTLGDNKVLKGVSLSESYLPPKKFYPLISSSQAKAD---GA  397

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
                DAL CK G+LDPEKVKGK++VCL+GE  R +K  + A AG VGMIL + E+S N ++
Sbjct  398   FLLDALVCKGGSLDPEKVKGKIVVCLRGETGRTDKGEQVARAGGVGMILTSAEESDNSVL  457

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
             AD H LPA+HV + DG  IF+YIN+T++P+A I+   T LGVKPAPV+A+FSSRGPN ++
Sbjct  458   ADPHVLPASHVNFKDGRYIFNYINQTKSPIASISRVETELGVKPAPVMASFSSRGPNIVD  517

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
             P ILKPDI APGV++IAA++E   PSD   DKR  SF   SGTSMSCPHV+GVVGLLK+L
Sbjct  518   PTILKPDIIAPGVDIIAAYSEVQSPSDLPSDKRKTSFITMSGTSMSCPHVSGVVGLLKSL  577

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P WSPA I+SAIMTTAT+  N+GK + D       TPFAYGAG I PN AADPGLVYDL
Sbjct  578   HPDWSPAAIKSAIMTTATITGNTGKQLMDSSLE-SATPFAYGAGQIRPNRAADPGLVYDL  636

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTL  399
              +TDY+N++C  GY    ++   G PY CP+  SL  FNYP+IT+P LK   +  VTRTL
Sbjct  637   NVTDYMNYLCNHGYEGDRLSIFYGKPYTCPESFSLVDFNYPTITIPDLKTGSSLNVTRTL  696

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVL  222
              NVG+P+ Y   + +P  F V+V PKIL F+  GE++ F+VTL  +  N  T DY FG+L
Sbjct  697   TNVGAPSIYRVHIEAPPEFLVSVEPKILNFKNKGEKKEFRVTLSLRPLNKLTNDYVFGML  756

Query  221   TWSDKKHRVRSPIVVK  174
              W+D KH VRS I +K
Sbjct  757   DWTDGKHHVRSSIAIK  772



>gb|KHN40225.1| Subtilisin-like protease [Glycine soja]
Length=739

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/730 (59%), Positives = 537/730 (74%), Gaps = 12/730 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D D V   HH+ + +Y+GS +KA++AI YSYTRHINGFAAMLEE+EAA+IAK+P+V+SVF
Sbjct  14    DFDLVTQIHHEFVKSYVGSSEKAKEAIIYSYTRHINGFAAMLEEKEAADIAKHPDVVSVF  73

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+ R+L TT SWEF+ LEG  GVI   S+++KAK+GEDTII N DTGVWPES SF +EG
Sbjct  74    LNKGRKLHTTHSWEFMDLEGNDGVIPSDSLFRKAKYGEDTIIANFDTGVWPESPSFRDEG  133

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP---LNSSFFTPRDVIGHG  1827
              GPIP RWKG CQ+     F CNRKLIGARYF +GY +  G     N +  T RD  GHG
Sbjct  134   MGPIPSRWKGTCQHDH-TGFRCNRKLIGARYFNKGYMAHAGADAKFNRTLNTARDYEGHG  192

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLST GG FVPGANVFGLGNGTA+GGSP+ARVA YKVCWPP   G +C+DADI+A FD
Sbjct  193   SHTLSTIGGTFVPGANVFGLGNGTAEGGSPRARVATYKVCWPPID-GNECFDADIMAAFD  251

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDVLS+SLGG+    YF+D L+IG+FHA   GI V+ SAGN GP   +V NVAP
Sbjct  252   MAIHDGVDVLSLSLGGNATD-YFDDGLSIGAFHANMKGIPVICSAGNYGPTPATVFNVAP  310

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W++TVGA+T+DR+F S V L N + + G S +   +P  K YPL++AA A+    A+   
Sbjct  311   WILTVGASTLDRQFDSVVELHNGQRFMGAS-LSKAMPEDKLYPLINAADAK---AANKPV  366

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             ++A  C  GT+DPEK +GK+LVCL+G   R+EKS  A  AGA GMIL NDE SGNE+IAD
Sbjct  367   ENATLCMRGTIDPEKARGKILVCLRGVTARVEKSLVALEAGAAGMILCNDELSGNELIAD  426

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPA+ + Y DGLA++ ++N T+NP+ +I  P T L +KPAP +AAFSSRGPN + P+
Sbjct  427   PHLLPASQINYKDGLAVYAFMNSTKNPLGYIYPPKTKLQIKPAPAMAAFSSRGPNTVTPE  486

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPD+ APGVN+IAA++E   P++  +DKR V F   SGTSMSCPHVAGVVGLLKTL+P
Sbjct  487   ILKPDVIAPGVNIIAAYSEGVSPTNLGFDKRRVPFITMSGTSMSCPHVAGVVGLLKTLHP  546

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SA+MTTA  R N+GK + D     K TPFAYG+GHI PN A DPGLVYDL  
Sbjct  547   DWSPAVIKSALMTTARTRDNTGKPMLDGGNDAKATPFAYGSGHIRPNRAMDPGLVYDLTN  606

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY+NF+C   YN+++I    G  Y+CPD I++  FNYP+IT+P L G+ +VTR +KNVG
Sbjct  607   NDYLNFLCFSIYNQSQIEMFNGARYRCPDIINILDFNYPTITIPKLYGSVSVTRRVKNVG  666

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
              P TYTA ++ P   S++V P +LKF+ +GEE+SFK+T++      T   AFG +TWSD 
Sbjct  667   PPGTYTARLKVPARLSISVEPNVLKFDNIGEEKSFKLTVEVTRPGETT--AFGGITWSDG  724

Query  206   KHRVRSPIVV  177
             K +VRSPIVV
Sbjct  725   KRQVRSPIVV  734



>ref|XP_009126658.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X1 [Brassica 
rapa]
Length=763

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/729 (60%), Positives = 539/729 (74%), Gaps = 15/729 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LDRV HSH   L ++LGS   A DAIFYSY RHINGFAA+L++++A+EIAK+P V S+FL
Sbjct  45    LDRVAHSHRTFLASFLGSHQSAEDAIFYSYKRHINGFAAVLDDKKASEIAKHPNVASIFL  104

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW+F+ LE + GV+H  S+WKKA+FGEDTII NLDTGVWPESKSFS+EG+
Sbjct  105   NKGRKLHTTHSWDFMLLE-KHGVVHKSSLWKKARFGEDTIIANLDTGVWPESKSFSDEGY  163

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGY-SSAVGPLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C         CNRKLIGA+YF +GY + A  P NS+F TPRD+ GHG+HT
Sbjct  164   GDVPARWKGSCHGD----VPCNRKLIGAKYFNKGYLAYAKFPSNSTFETPRDLDGHGTHT  219

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPGANVFGLGNGTA GGSPKARVA+YKVCWPP   G +C+DADILA  D AI
Sbjct  220   LSTAGGNFVPGANVFGLGNGTASGGSPKARVASYKVCWPPFK-GAECFDADILAAIDAAI  278

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDV+S S+GGD  G Y ND L+IGSF AVKNG+ VV SAGN GP  G+V+NVAPW+I
Sbjct  279   GDGVDVISASVGGD-AGDYMNDGLSIGSFVAVKNGVTVVCSAGNSGPKPGTVSNVAPWII  337

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N   + G S +   LP  K Y L+SAA  +    A+ S   A
Sbjct  338   TVGASSMDREFQAFVELSNGSRFEGTS-LSTPLPENKMYDLISAADGKA---ANASALQA  393

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK  +LDPEKVKGK++VCL+G+N R++K  +AA AGAVGMIL ND+ SGNEII+DAH 
Sbjct  394   LLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEIISDAHV  453

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG A+F Y+N T++P  +IT PNT L  KPAP +A+FSSRGPN I P ILK
Sbjct  454   LPASQINYKDGEAVFSYLNSTKDPKGYITAPNTQLHTKPAPFMASFSSRGPNTITPGILK  513

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVNV+AA+TEATGP+D + D R   FNVESGTSMSCPH++G+VGLLKTL P WS
Sbjct  514   PDITAPGVNVVAAYTEATGPTDIESDNRRTPFNVESGTSMSCPHISGIVGLLKTLRPQWS  573

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTT+  R N+ K +  D T  K TPF YG+GH+ PN A+ PGLVYDL   DY
Sbjct  574   PAAIRSAIMTTSRTRDNTRKPMV-DATFHKATPFGYGSGHVQPNKASHPGLVYDLNTGDY  632

Query  557   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GY    +      P Y C    +L  FNYPSITVP L  + T+TR L NVG P
Sbjct  633   LDFLCAIGYENKVVQLFADDPLYTCRQGANLLDFNYPSITVPKLTDSVTITRKLTNVGPP  692

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TY +   +P+G  V+V PK L F KVGEE+ F++T+ A  E A   Y FG LTW+D K+
Sbjct  693   STYRSYFHAPLGVEVSVEPKQLTFSKVGEEKMFQMTIGATSEKALG-YVFGELTWTDSKY  751

Query  200   RVRSPIVVK  174
              VR+PIVV+
Sbjct  752   YVRTPIVVQ  760



>ref|XP_003625338.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES81556.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/731 (59%), Positives = 536/731 (73%), Gaps = 17/731 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D DRV  +HH+ L +Y+GS +KA++A+ YSYT++INGFAA+LEE+EAA+IA++P V+SV 
Sbjct  44    DFDRVTDTHHEFLQSYVGSHEKAKEAMIYSYTKNINGFAALLEEKEAADIAEHPNVVSVL  103

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LNR R+L TT SWEF+ +E   GV    S+++KA++GED IIGNLD+GVWPES SF +EG
Sbjct  104   LNRGRKLHTTHSWEFMSME-HNGVAPSHSLFRKARYGEDVIIGNLDSGVWPESPSFGDEG  162

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP---LNSSFFTPRDVIGHG  1827
              GPIP RWKG CQN     F CNRKLIGARYF +GY++  G     N +  TPRD  GHG
Sbjct  163   IGPIPSRWKGTCQNDH-TGFRCNRKLIGARYFNKGYATYAGSEVVQNGTLDTPRDNKGHG  221

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLST GGNFV GAN  GLGNGTAKGGSPKARVAAYKVCWPP   G +C+DADI+A FD
Sbjct  222   SHTLSTLGGNFVSGANFVGLGNGTAKGGSPKARVAAYKVCWPPID-GSECFDADIMAAFD  280

Query  1646  RAIEDGVDVLSVSLGGDHPG-PYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
              AI DGVDVLS+SLG   P   YF+D+L+I +FHAVK GI V+ SAGN GP  G+V+NVA
Sbjct  281   MAIHDGVDVLSISLGS--PAVDYFDDALSIAAFHAVKKGITVLCSAGNSGPTFGTVSNVA  338

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW++TV A+T+DR F + V L N +H+ G S +   LP  K YPL++AA A++   A   
Sbjct  339   PWILTVAASTLDREFDTVVQLHNGQHFKGAS-LSTALPENKLYPLITAAEAKL---AEAP  394

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
              ++A  C  GT+DPEK  G++LVCL+G N ++EKS  A  A AVGMIL ND   GNE+  
Sbjct  395   VENATLCMNGTIDPEKASGRILVCLRGINGKVEKSLVALEAKAVGMILFNDRSHGNELTD  454

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D HFLP  H+ Y DG+A+F YIN T+NP+ +I  P T L +KPAP +A FSSRGPN I P
Sbjct  455   DPHFLPTAHIIYEDGVAVFAYINSTKNPLGYIHPPTTKLKIKPAPSMAVFSSRGPNTITP  514

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +ILKPD++APGVN+IAA++ A  P+  D DKR V F   SGTSMSCPHVAGVVGLLKTL+
Sbjct  515   EILKPDVTAPGVNIIAAYSGAVSPTKLDSDKRRVPFMTMSGTSMSCPHVAGVVGLLKTLH  574

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P+WSP+ I+SAIMTTA  R N+ K I DD   +K TPF YG+GHI PN A DPGLVY+L 
Sbjct  575   PTWSPSAIKSAIMTTARTRDNTVKPIVDD-INVKATPFDYGSGHIRPNRAMDPGLVYELN  633

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNV  390
             + DY+NF+C  GYN+T+I+   GT + C D I++  FNYP+IT+P L G+ T++R LKNV
Sbjct  634   INDYINFLCFLGYNQTQISMFSGTNHHC-DGINILDFNYPTITIPILYGSVTLSRKLKNV  692

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             G P TYTAS+R P G S++V PK LKF+K+GEE+SF +T++           FG LTWSD
Sbjct  693   GPPGTYTASLRVPAGLSISVQPKKLKFDKIGEEKSFNLTIEVTRSGGAT--VFGGLTWSD  750

Query  209   KKHRVRSPIVV  177
              KH VRSPI V
Sbjct  751   GKHHVRSPITV  761



>ref|XP_002308740.2| hypothetical protein POPTR_0006s00370g [Populus trichocarpa]
 gb|EEE92263.2| hypothetical protein POPTR_0006s00370g [Populus trichocarpa]
Length=686

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/676 (62%), Positives = 505/676 (75%), Gaps = 7/676 (1%)
 Frame = -2

Query  2204  KNPEVISVFLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWP  2025
             ++P V+SVFLN+ R+L TT SW+F+ LE +G V+   S+WK+A+FGED+II NLDTGVWP
Sbjct  12    RHPNVVSVFLNQGRKLHTTHSWDFMLLEKDG-VVDPSSLWKRARFGEDSIIANLDTGVWP  70

Query  2024  ESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPR  1845
             ES SFSEEG GP+P +WKG C+N       CNRKLIGARYF +GY +  G L SS  + R
Sbjct  71    ESLSFSEEGIGPVPSKWKGTCENDTAVGVPCNRKLIGARYFNRGYIAYAGGLTSSDNSAR  130

Query  1844  DVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDAD  1665
             D  GHG+HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVA+YKVCWPP + G +C+DAD
Sbjct  131   DKDGHGTHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVASYKVCWPPVN-GSECFDAD  189

Query  1664  ILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGS  1485
             I+  FD AI DGVDVLSVSLGG+ P  YFND LAIG+FHAVKNGI VV SAGN GP+ G+
Sbjct  190   IMKAFDMAIHDGVDVLSVSLGGE-PTDYFNDGLAIGAFHAVKNGISVVCSAGNSGPMDGT  248

Query  1484  VNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKI  1305
             V N APW+ITVGA+T+DR F++ V L N K   G S +   LP  KFYPL++   A+   
Sbjct  249   VTNNAPWIITVGASTLDREFETFVELRNGKRLQGTS-LSSPLPEKKFYPLITGEQAK---  304

Query  1304  NASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSG  1125
              A+ S  DAL CKP +LD EK KGKV+VCL+GE  R++K ++AAL GA GMIL ND+ SG
Sbjct  305   AANASAADALLCKPKSLDHEKAKGKVVVCLRGETGRMDKGYQAALVGAAGMILCNDKASG  364

Query  1124  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  945
             NEIIAD H LPA  +TY+DGLA+F YIN T + + +I+ P   LG KPAP IAAFSSRGP
Sbjct  365   NEIIADPHVLPAAQITYTDGLAVFAYINSTDHALGYISAPTAKLGTKPAPSIAAFSSRGP  424

Query  944   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  765
             N + P+ILKPDI+APGVN+IAAF+EA  P+D D+DKR   F  ESGTSMSCPHVAG VGL
Sbjct  425   NTVTPEILKPDITAPGVNIIAAFSEAISPTDFDFDKRKSPFITESGTSMSCPHVAGAVGL  484

Query  764   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGL  585
             LKTL+P WSPA IRSAIMTTA  RAN+   + D + GL+ TPF+YG+GHI PN A DPGL
Sbjct  485   LKTLHPDWSPAAIRSAIMTTARTRANTMTPMVDGRDGLEATPFSYGSGHIRPNRAQDPGL  544

Query  584   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTR  405
             VYDL + DY++F+CA GYN T I      PYKCP+  S+  FN PSIT+  L+ + +V R
Sbjct  545   VYDLSINDYLDFLCASGYNSTMIEPFSDGPYKCPESTSIFDFNNPSITIRQLRNSMSVIR  604

Query  404   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  225
              +KNVG   TY A VR P G  V+V P IL FE  G+E+SFKVT +AK +  T D+ FG 
Sbjct  605   KVKNVGLTGTYAAHVREPYGILVSVEPSILTFENKGDEKSFKVTFEAKWDGVTEDHEFGT  664

Query  224   LTWSDKKHRVRSPIVV  177
             LTW+D +H VRSPIVV
Sbjct  665   LTWTDGRHYVRSPIVV  680



>ref|NP_200789.2| Subtilase 5.4 [Arabidopsis thaliana]
 sp|F4JXC5.1|SBT54_ARATH RecName: Full=Subtilisin-like protease SBT5.4; AltName: Full=Subtilase 
subfamily 5 member 4; Short=AtSBT5.4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED97236.1| Subtilase family protein [Arabidopsis thaliana]
Length=778

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/729 (60%), Positives = 536/729 (74%), Gaps = 15/729 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LD V HSH   L +++GS + A++AIFYSY RHINGFAA+L+E EAAEIAK+P+V+SVF 
Sbjct  60    LDGVAHSHRTFLASFVGSHENAKEAIFYSYKRHINGFAAILDENEAAEIAKHPDVVSVFP  119

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW F+ L  + GV+H  S+W KA +GEDTII NLDTGVWPESKSFS+EG+
Sbjct  120   NKGRKLHTTHSWNFM-LLAKNGVVHKSSLWNKAGYGEDTIIANLDTGVWPESKSFSDEGY  178

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C     K   CNRKLIGARYF +GY +  G P N+S+ T RD  GHGSHT
Sbjct  179   GAVPARWKGRCH----KDVPCNRKLIGARYFNKGYLAYTGLPSNASYETCRDHDGHGSHT  234

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGANVFG+GNGTA GGSPKARVAAYKVCWPP   G +C+DADILA  + AI
Sbjct  235   LSTAAGNFVPGANVFGIGNGTASGGSPKARVAAYKVCWPPVD-GAECFDADILAAIEAAI  293

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
             EDGVDVLS S+GGD  G Y +D +AIGSFHAVKNG+ VV SAGN GP +G+V+NVAPW+I
Sbjct  294   EDGVDVLSASVGGD-AGDYMSDGIAIGSFHAVKNGVTVVCSAGNSGPKSGTVSNVAPWVI  352

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N + + G S +   LP  K Y L+SAA A +   A+ +  DA
Sbjct  353   TVGASSMDREFQAFVELKNGQSFKGTS-LSKPLPEEKMYSLISAADANV---ANGNVTDA  408

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK G+LDP+KVKGK+LVCL+G+N R++K  +AA AGA GM+L ND+ SGNEII+DAH 
Sbjct  409   LLCKKGSLDPKKVKGKILVCLRGDNARVDKGMQAAAAGAAGMVLCNDKASGNEIISDAHV  468

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN I P ILK
Sbjct  469   LPASQIDYKDGETLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNTITPGILK  528

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVN+IAAFTEATGP+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P WS
Sbjct  529   PDITAPGVNIIAAFTEATGPTDLDSDNRRTPFNTESGTSMSCPHISGVVGLLKTLHPHWS  588

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTT+  R N  K + D+    K  PF+YG+GH+ PN AA PGLVYDL   DY
Sbjct  589   PAAIRSAIMTTSRTRNNRRKPMVDESFK-KANPFSYGSGHVQPNKAAHPGLVYDLTTGDY  647

Query  557   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GYN T +      P Y C    +L  FNYPSITVP+L G+ TVTR LKNVG P
Sbjct  648   LDFLCAVGYNNTVVQLFAEDPQYTCRQGANLLDFNYPSITVPNLTGSITVTRKLKNVGPP  707

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ATY A  R P+G  V+V PK L F K GE + F++TL+      +  Y FG LTW+D  H
Sbjct  708   ATYNARFREPLGVRVSVEPKQLTFNKTGEVKIFQMTLRPLPVTPSG-YVFGELTWTDSHH  766

Query  200   RVRSPIVVK  174
              VRSPIVV+
Sbjct  767   YVRSPIVVQ  775



>ref|XP_004296137.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=774

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/737 (60%), Positives = 542/737 (74%), Gaps = 21/737 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             V+LD    SH+ LLGT LGS ++A++A+FYSYT  INGFAA+L+EEEA++IAK+P V+SV
Sbjct  47    VELDAATTSHYDLLGTVLGSNERAQEAMFYSYTGQINGFAAVLDEEEASQIAKDPNVVSV  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NR  +L TT SWEF+GLE + G+   GS+WKKAKF E+TIIGNLDTGVWPES+SF+++
Sbjct  107   FPNRKLKLHTTHSWEFMGLEDKVGLPRHGSLWKKAKFAENTIIGNLDTGVWPESESFNDQ  166

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSS------FFTPRDV  1839
             GFGPIP +W+G C         CNRKLIGARYF +GY  A   LN++        +PRD 
Sbjct  167   GFGPIPSKWRGACHFDTKDKVRCNRKLIGARYFNKGY-LAYAKLNNATIPPNVMVSPRDQ  225

Query  1838  IGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWP--PTSPGEDCYDAD  1665
              GHGSHTLSTAGG+FV GANVFG GNGTAKGGSPKARVAAYKVCWP  P +    C+ AD
Sbjct  226   EGHGSHTLSTAGGSFVHGANVFGHGNGTAKGGSPKARVAAYKVCWPSFPGTTEGGCFTAD  285

Query  1664  ILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGS  1485
             ILA FD AI DGVDVLS+S+GGD    +  D +AIGSFHA KNGIVVV SAGN GP   +
Sbjct  286   ILAAFDAAISDGVDVLSLSVGGDAV-EFSEDGIAIGSFHADKNGIVVVCSAGNSGPAPST  344

Query  1484  VNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKI  1305
             V+NVAPW++TVGA+T+DR F S +  G  KH  G+S     LP+ KFYP++S A+A    
Sbjct  345   VSNVAPWMLTVGASTLDREFSSYISFGKGKHMKGKSLSSRSLPSRKFYPVISGANANA--  402

Query  1304  NASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSG  1125
              A+ S +D+L C  GTLDP+KVKGK+LVC +G+N R EK   AALAGAVGM+L NDE SG
Sbjct  403   -ATASPEDSLLCLNGTLDPKKVKGKILVCQRGKNARTEKGEMAALAGAVGMVLVNDEASG  461

Query  1124  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  945
             NEIIAD H LPATH+TY+DG  +F      + P AHIT   T+ G KPAP +AAFSSRGP
Sbjct  462   NEIIADPHVLPATHLTYADGKRVF------QTPFAHITPVKTVYGTKPAPFMAAFSSRGP  515

Query  944   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  765
             +AI P ILKPD++APGV++IAA+T A GP+++  DKR   +  ESGTSMSCPHV+G+VGL
Sbjct  516   SAIEPSILKPDVTAPGVDIIAAYTGAAGPTESKSDKRRPRYITESGTSMSCPHVSGIVGL  575

Query  764   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGL  585
             LKTLYPSWSPA IRSAI+TTA  R N+ ++I D  T  + TP AYGAGH+NPN AA+PGL
Sbjct  576   LKTLYPSWSPAAIRSAIITTARRRDNNEESILDS-TKEQATPLAYGAGHVNPNRAANPGL  634

Query  584   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA-TVT  408
             VYDL   DY+NF+CA+GYN + +      P KC +  S++  NYP+I +P L+    TVT
Sbjct  635   VYDLTTDDYLNFLCARGYNASLLKLFSDKPVKCSNTSSIADLNYPTIAIPDLQDKPITVT  694

Query  407   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFG  228
             R +KNVG+P TY A V +P G S++V P+ L+F+ VGEE+ FKVTLKA G+    DY FG
Sbjct  695   RRVKNVGTPGTYVAHVHTPAGVSISVKPQKLEFKSVGEEKEFKVTLKANGKVGNPDYVFG  754

Query  227   VLTWSDKKHRVRSPIVV  177
              L WSD KH VRSPI V
Sbjct  755   ELKWSDGKHSVRSPIAV  771



>ref|XP_008449186.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103491136 
[Cucumis melo]
Length=1529

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/742 (58%), Positives = 547/742 (74%), Gaps = 14/742 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL+    SH+ LLG+ LGS + A++AIFYSY RHINGFAA+L+++   ++A+NP V S+ 
Sbjct  49    DLEIATESHYSLLGSLLGSNEAAKEAIFYSYNRHINGFAAILDQKVVEDLARNPAVASIH  108

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ R+L TT SW+FLG+E + G+ H+ SIW +A FGE TIIGNLDTGVWPESKSF++EG
Sbjct  109   ENKGRKLHTTSSWKFLGVEHDDGIPHN-SIWNRASFGESTIIGNLDTGVWPESKSFNDEG  167

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GP+P RWKG C+      FHCNRKLIGARYF +GY++  G LN+S+ T RD  GHG+HT
Sbjct  168   YGPVPTRWKGSCEG--GSKFHCNRKLIGARYFNKGYAAYAGSLNASYETARDNEGHGTHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNF+ GANVFG GNGTAKGGSPKA VAAYKVCWP    G  C+DADILA  + AI
Sbjct  226   LSTAGGNFISGANVFGNGNGTAKGGSPKALVAAYKVCWPQVDSGGGCFDADILAAIEAAI  285

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVD+LS+SLGG     +  D  AIG+FHAV+ GI+VV SAGN GP  G++ N APW++
Sbjct  286   SDGVDILSLSLGGG-AKDFSEDVTAIGAFHAVQQGIIVVCSAGNSGPAPGTIENGAPWIL  344

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T++R F S V LGNKKH  G S     LP  KFYPL++AA A+     ++S+  A
Sbjct  345   TVGASTINRDFTSYVALGNKKHIKGASLSDKILPEQKFYPLINAADAKAN---NVSSDVA  401

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C+ G+LDP+KVKGK+++CL+GEN R++K + AA AGAVGMILAN E +G+E+IADAH 
Sbjct  402   QLCQAGSLDPKKVKGKIILCLRGENARVDKGYAAAQAGAVGMILANAEQNGDELIADAHL  461

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LP +HV+Y+DG +I+ YIN T+ P+A++TH  T LG+KPAPV+A+FSSRGPN I   ILK
Sbjct  462   LPVSHVSYTDGQSIYQYINFTKTPMAYMTHVRTELGIKPAPVMASFSSRGPNTIEESILK  521

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVN++AA++E   PS + +D R + FN+ SGTSMSCPH++G+VGLLKTLYP+WS
Sbjct  522   PDITAPGVNILAAYSEDASPSGSLFDNRRIPFNIVSGTSMSCPHISGIVGLLKTLYPTWS  581

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  RAN    I  +   LK  PFAYGAGH+ PN A +PGLVYDL   DY
Sbjct  582   PAAIKSAIMTTAETRANDLHPIL-NTVNLKANPFAYGAGHVQPNRAMNPGLVYDLTTNDY  640

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSP  381
             +NF+CAQGYNK++I+    T + C     L+ FNYPSI++P +K G  T+ R +KNVG P
Sbjct  641   MNFLCAQGYNKSQISKFSATSFVCSKSFKLTDFNYPSISIPDMKSGVVTINRRVKNVGKP  700

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TY A V+ P G SV+V P+ LKF  + EE+SFKV + +   N    Y FG L W D KH
Sbjct  701   STYVARVKVPQGVSVSVEPRTLKFTGIDEEKSFKVVIGSVANNKHRGYVFGSLIWEDGKH  760

Query  200   RVRSPIVVKTA*MNICSYILGL  135
              VRSPIVV     N+ SYI+ L
Sbjct  761   HVRSPIVV-----NLGSYIVYL  777


 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/743 (57%), Positives = 535/743 (72%), Gaps = 19/743 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D      SH+ LLG+ LGS ++A++AIFYSY RHINGFAA+++++ A ++AK+P+V+SV
Sbjct  789   IDAQIATESHYNLLGSLLGSNEEAKEAIFYSYNRHINGFAAVVDQKVAEDLAKHPDVVSV  848

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
               N+ R+L TT SW FLG+E  G VI   SIW  A FGE TIIGNLDTGVWPE+KSF ++
Sbjct  849   LENKGRKLHTTNSWSFLGVESNG-VIPSNSIWNLASFGESTIIGNLDTGVWPEAKSFDDK  907

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
              +GPIP RWKG C+   +  F CNRKLIGARY+ +GY+   GPLNSS+ + RD  GHG+H
Sbjct  908   EYGPIPSRWKGSCEGGSN--FQCNRKLIGARYYNKGYAEIAGPLNSSYESARDHEGHGTH  965

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFVP AN+FG GNGTAKGGSPKA VAAYKVCWP      +C+DADILAGF+ A
Sbjct  966   TLSTAGGNFVPNANLFGYGNGTAKGGSPKALVAAYKVCWPKLWLFGECFDADILAGFEAA  1025

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLGGD P  +  DS+AIGSFHAV+NGI VV SAGN GP  G+V+NVAPW+
Sbjct  1026  IADGVDVLSVSLGGD-PSDFGQDSIAIGSFHAVQNGITVVCSAGNSGPAPGTVSNVAPWI  1084

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIK---------  1308
             ITVGA+T DR + + V +G+K+H+ G S     LP  KFYPL+++  A+++         
Sbjct  1085  ITVGASTADRLYTNYVAIGDKRHFKGASLSEKGLPVQKFYPLINSVDAKVQNFSNKYAXQ  1144

Query  1307  INASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDS  1128
             I           C+  +LDPEKVKGK++VCL+G+N R EK +  A AG VGMILAN E++
Sbjct  1145  IXMCCYNYCRQLCEIESLDPEKVKGKIVVCLRGDNARTEKGYVVAKAGGVGMILANAEEN  1204

Query  1127  GNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRG  948
             G++I ADAH LPA+H+TYSDG  ++ YIN T+ P+A++THP T  GVKPAP++A+FSSRG
Sbjct  1205  GDDISADAHLLPASHITYSDGQLVYQYINSTKIPMAYLTHPRTESGVKPAPIMASFSSRG  1264

Query  947   PNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVG  768
             PN+I+P ILKPDI+APG N++AA++E   PS   +DKR V FNVESGTSMSCPHV+G+VG
Sbjct  1265  PNSIDPSILKPDITAPGENILAAYSEDGSPSGLYFDKRRVPFNVESGTSMSCPHVSGIVG  1324

Query  767   LLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPG  588
             LLKTLYP WSPA IRSAIMTTA  +AN    I   K   K   +AYGAGH+ PN AADPG
Sbjct  1325  LLKTLYPKWSPAAIRSAIMTTAGTKANDLNPILSTKQE-KANEWAYGAGHVRPNKAADPG  1383

Query  587   LVYDLKLTDYVNFICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKGTAT-  414
             LVYDL   DY+N++CA GY   +I      T + C     ++  NYPSI++P+L+     
Sbjct  1384  LVYDLSTEDYLNYLCALGYKIKQIKQFSNDTSFVCSKSFKITDLNYPSISIPNLESDVAL  1443

Query  413   -VTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TAD  240
              + R LKNVGSP TY   V +P+G SV+V P  LKF  + EE+SF+V LK+   N    +
Sbjct  1444  KIKRRLKNVGSPGTYVVQVNAPLGVSVSVEPTSLKFTGIDEEKSFRVVLKSNVPNGFHPE  1503

Query  239   YAFGVLTWSD-KKHRVRSPIVVK  174
             Y FG L WSD   HRVRSPIVVK
Sbjct  1504  YVFGKLEWSDGNNHRVRSPIVVK  1526



>dbj|BAB08348.1| serine protease-like protein [Arabidopsis thaliana]
Length=760

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/729 (60%), Positives = 537/729 (74%), Gaps = 15/729 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LD V HSH   L +++GS + A++AIFYSY RHINGFAA+L+E EAAEIAK+P+V+SVF 
Sbjct  42    LDGVAHSHRTFLASFVGSHENAKEAIFYSYKRHINGFAAILDENEAAEIAKHPDVVSVFP  101

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW F+ L  + GV+H  S+W KA +GEDTII NLDTGVWPESKSFS+EG+
Sbjct  102   NKGRKLHTTHSWNFM-LLAKNGVVHKSSLWNKAGYGEDTIIANLDTGVWPESKSFSDEGY  160

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C     K   CNRKLIGARYF +GY +  G P N+S+ T RD  GHGSHT
Sbjct  161   GAVPARWKGRCH----KDVPCNRKLIGARYFNKGYLAYTGLPSNASYETCRDHDGHGSHT  216

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGANVFG+GNGTA GGSPKARVAAYKVCWPP   G +C+DADILA  + AI
Sbjct  217   LSTAAGNFVPGANVFGIGNGTASGGSPKARVAAYKVCWPPVD-GAECFDADILAAIEAAI  275

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
             EDGVDVLS S+GGD  G Y +D +AIGSFHAVKNG+ VV SAGN GP +G+V+NVAPW+I
Sbjct  276   EDGVDVLSASVGGD-AGDYMSDGIAIGSFHAVKNGVTVVCSAGNSGPKSGTVSNVAPWVI  334

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N + + G S +   LP  K Y L+SAA A +   A+ +  DA
Sbjct  335   TVGASSMDREFQAFVELKNGQSFKGTS-LSKPLPEEKMYSLISAADANV---ANGNVTDA  390

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK G+LDP+KVKGK+LVCL+G+N R++K  +AA AGA GM+L ND+ SGNEII+DAH 
Sbjct  391   LLCKKGSLDPKKVKGKILVCLRGDNARVDKGMQAAAAGAAGMVLCNDKASGNEIISDAHV  450

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN I P ILK
Sbjct  451   LPASQIDYKDGETLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNTITPGILK  510

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVN+IAAFTEATGP+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P WS
Sbjct  511   PDITAPGVNIIAAFTEATGPTDLDSDNRRTPFNTESGTSMSCPHISGVVGLLKTLHPHWS  570

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTT+  R N  K + D+ +  K  PF+YG+GH+ PN AA PGLVYDL   DY
Sbjct  571   PAAIRSAIMTTSRTRNNRRKPMVDE-SFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGDY  629

Query  557   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GYN T +      P Y C    +L  FNYPSITVP+L G+ TVTR LKNVG P
Sbjct  630   LDFLCAVGYNNTVVQLFAEDPQYTCRQGANLLDFNYPSITVPNLTGSITVTRKLKNVGPP  689

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ATY A  R P+G  V+V PK L F K GE + F++TL+      +  Y FG LTW+D  H
Sbjct  690   ATYNARFREPLGVRVSVEPKQLTFNKTGEVKIFQMTLRPLPVTPSG-YVFGELTWTDSHH  748

Query  200   RVRSPIVVK  174
              VRSPIVV+
Sbjct  749   YVRSPIVVQ  757



>ref|XP_006447864.1| hypothetical protein CICLE_v10017839mg [Citrus clementina]
 gb|ESR61104.1| hypothetical protein CICLE_v10017839mg [Citrus clementina]
Length=716

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/732 (59%), Positives = 532/732 (73%), Gaps = 40/732 (5%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDL+RV   HH+ LG++LGS +   DAIFYSYTRHINGFAA L++  AAEIAK+P+V+SV
Sbjct  20    VDLNRVTQYHHEFLGSFLGSNENPEDAIFYSYTRHINGFAAKLDDAVAAEIAKHPKVVSV  79

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FL++  +L TT SWEFLGLE + G I   SIW+KA++GED +IGN+DTGVWPESKSFS+E
Sbjct  80    FLSKENKLHTTHSWEFLGLE-QNGRIPPNSIWEKARYGEDVVIGNIDTGVWPESKSFSDE  138

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             GFGPIP +WKGICQN KD  FHCNRKLIGARYF Q Y+   GPLNSSF++PRD+ GHG+H
Sbjct  139   GFGPIPSKWKGICQNDKDSRFHCNRKLIGARYFNQDYAVHKGPLNSSFYSPRDINGHGTH  198

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFV GA+VFG G GTAKGGSPKARVAAYKVCW        CYD DI+A FD A
Sbjct  199   TLSTAGGNFVAGASVFGFGKGTAKGGSPKARVAAYKVCWEGLG---GCYDCDIIAAFDMA  255

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLG   P  +F D +AIGSFHAV++GIVVV SAGN+GP   +V NVAP  
Sbjct  256   IHDGVDVLSVSLGVKRP-TFFGDGVAIGSFHAVQHGIVVVCSAGNKGPADSTVENVAP--  312

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
                                       +S     LP+ K +P +SA  A++  NASI  ++
Sbjct  313   --------------------------DSLSEKGLPSDKLFPFISAEDAKLA-NASI--EN  343

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CK GTLDP+KVKGK+LVCL      ++K  +AALAGAVG++L N +D G +  AD H
Sbjct  344   AFECKKGTLDPKKVKGKILVCLDVNTSSVDKGLQAALAGAVGVVLINIQDFGYDRTADPH  403

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+ ++++DG ++  Y+N T++PV  IT P T  G KP+P +AAFSS+GPN I P+IL
Sbjct  404   VLPASAISFNDGDSLLGYVNSTKHPVGFITRPTTEFGAKPSPFMAAFSSKGPNHITPEIL  463

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APG N+IAA+TEA  P++ + DK  + FN  SGTSMSCPH++G+ GLLKTL+P W
Sbjct  464   KPDITAPGENIIAAYTEAESPTNLNEDKHRIPFNSISGTSMSCPHISGIAGLLKTLHPDW  523

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTAT   N+ + I  + +  + TPF+YGAGH+ PN A DPGLVYDL + D
Sbjct  524   SPAAIQSAIMTTATTLDNNKQQIL-NASFAEATPFSYGAGHVQPNLAMDPGLVYDLTVND  582

Query  560   YVNFICAQGYNKTEITAV-LGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             Y+NF+CA GYNK  I+       Y CP + ISL  FNYP+ITVP L G+ TVTR +KNVG
Sbjct  583   YLNFLCALGYNKNVISLFSTNCSYTCPKNAISLVNFNYPAITVPKLSGSITVTRRVKNVG  642

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD-  210
             SP TY A V++P G SVT+ PK LKF  VGEE+SFKV +KAK  + T DYAFG L WSD 
Sbjct  643   SPGTYQARVKTPEGVSVTIAPKSLKFINVGEEKSFKVIIKAKNASVTKDYAFGELIWSDE  702

Query  209   KKHRVRSPIVVK  174
             K+HRVRSPIVVK
Sbjct  703   KQHRVRSPIVVK  714



>gb|EYU27629.1| hypothetical protein MIMGU_mgv1a001914mg [Erythranthe guttata]
Length=740

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/733 (59%), Positives = 518/733 (71%), Gaps = 42/733 (6%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SH QLL ++LGS +KA+DAIFYSY RHINGF                      
Sbjct  43    DLRRVADSHTQLLASFLGSEEKAKDAIFYSYKRHINGF----------------------  80

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
                A  L+   +          GVI   S+W KA+FG+DTII NLDTGVWPESKSFS +G
Sbjct  81    ---AALLEDEEAARI------AGVIPSSSLWNKARFGQDTIIANLDTGVWPESKSFSGKG  131

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSH  1821
             FGPIP +WKGICQ    +   CNRKLIGARY+ +GY++  G PLNS++ TPRDV GHG+H
Sbjct  132   FGPIPSKWKGICQFDHKEGPLCNRKLIGARYYNKGYAAYAGVPLNSTYNTPRDVDGHGTH  191

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPT--SPGEDCYDADILAGFD  1647
             TLSTA GNFV GANVFG GNGTAKGGSP+ARVAAY+VC+P    S GE CYDADI+ GFD
Sbjct  192   TLSTAAGNFVAGANVFGFGNGTAKGGSPRARVAAYRVCYPKMNESSGE-CYDADIMKGFD  250

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGV VLSVSLG D    Y ND  AIG+FHAVKNGIVVVASAGN GP  GSV NVAP
Sbjct  251   AAIADGVGVLSVSLGSDSVD-YINDGTAIGAFHAVKNGIVVVASAGNSGPTPGSVENVAP  309

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W ITVGA+T+DR+FQ+NV L N   + G S +   LP  K Y L+SAA AR    A +S 
Sbjct  310   WFITVGASTLDRKFQANVQLKNGSIFQGMS-LSKPLPEDKMYTLISAAEARA---ADVSE  365

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
             +DA+ CK  TLD +K KGK++VCL+GEN R+EK  EA  AGA GMIL NDE SGNE+IAD
Sbjct  366   EDAILCKEKTLDSKKAKGKIVVCLRGENARLEKGEEALRAGAAGMILCNDESSGNELIAD  425

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
             AH LPAT + Y+DGL +F Y+  T+NP   IT P ++L VKPAP +A+FSSRGPNAI P 
Sbjct  426   AHILPATQLNYTDGLIVFSYLKNTKNPQGLITEPKSVLNVKPAPFMASFSSRGPNAITPA  485

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGVN++AA++E+T P++   DKR   F +ESGTSM+CPHV+GV GLLKTL+P
Sbjct  486   ILKPDITAPGVNIMAAYSESTSPTEVPSDKRTTPFYIESGTSMACPHVSGVAGLLKTLHP  545

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSP  IRSAIMTTA  R N+G  + D     K TPF YG+GHI PN A +PGLVYDL +
Sbjct  546   DWSPGAIRSAIMTTARTRDNTGSPMKDADY-QKATPFMYGSGHIRPNRAMNPGLVYDLTV  604

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
              DY++F+C  GYN T +    G  Y CP++ ++  FN PSI+VP L  +  VTR LKNVG
Sbjct  605   NDYLDFLCGIGYNSTMVGQFAGAYYDCPNNYNILNFNNPSISVPDLTRSVVVTRKLKNVG  664

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSD  210
              P TY A +RSP G+SVTV P +LKFEK+GEE+SFK+++K  G   A + + FG L WSD
Sbjct  665   KPGTYAARIRSPPGYSVTVKPNLLKFEKIGEEKSFKLSIKVNGRRGAKSVFQFGELLWSD  724

Query  209   KKHRVRSPIVVKT  171
              KH VRSPIVV +
Sbjct  725   GKHYVRSPIVVAS  737



>ref|XP_003608826.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES91023.1| subtilisin-like serine protease [Medicago truncatula]
Length=775

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/736 (57%), Positives = 544/736 (74%), Gaps = 22/736 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ +LG+Y+GS +KA++AIFYSY R+INGFAA+L+E+EAA++AK+P V+S+F
Sbjct  46    DIESATNSHYDILGSYVGSTEKAKEAIFYSYNRYINGFAAILDEDEAAKLAKHPSVVSIF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+  +L TTRSW+FLGLE  GG IH+GS+WK++  GED IIGNLD+GVWPESKSFS+EG
Sbjct  106   LNKKYELDTTRSWDFLGLE-RGGEIHNGSLWKRS-LGEDIIIGNLDSGVWPESKSFSDEG  163

Query  1997  FGPIPKRWKGICQNQKDK--SFHCNRKLIGARYFIQGYSSAVGPL---NSSFFTPRDVIG  1833
             FGPIPK+W+GICQ  K    +FHCNRKLIGARYF +GY +   P+   N +F + RD +G
Sbjct  164   FGPIPKKWRGICQVIKGNPDNFHCNRKLIGARYFYKGYMAVPIPIRNPNETFNSARDSVG  223

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFV  A+VFG GNGTA GGSPKARV+AYKVCW        CYDADILAG
Sbjct  224   HGSHTLSTAGGNFVANASVFGYGNGTASGGSPKARVSAYKVCW------GSCYDADILAG  277

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSL GD P  + + S++IGSFHAV N I+VVAS GN GP + +V N+
Sbjct  278   FEAAISDGVDVLSVSLSGDFPVEFHDSSISIGSFHAVANNIIVVASGGNSGPSSNTVANM  337

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
              PW++TV A+T+DR F S VVLGNKK   G S     LP  K +PL+S A+A +    ++
Sbjct  338   EPWILTVAASTIDRDFTSYVVLGNKKILKGASLSESHLPPHKLFPLISGANANVD---NV  394

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S + AL C  G LDP K  GK+LVCL+GEN ++EK  EA+  GA+GMIL  + +SG E+I
Sbjct  395   SAEQALLCLNGALDPHKAHGKILVCLEGENSKLEKGIEASRVGAIGMILVIERESGGEVI  454

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
             ADAH LPA++V  +DG  IF+Y NKT+ PVA+IT   T LG+KP P +A+FSSRGP+++ 
Sbjct  455   ADAHVLPASNVNVTDGSYIFNYANKTKFPVAYITGVKTQLGIKPTPSMASFSSRGPSSLE  514

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
             P ILKPDI+APGVN+IAA++E+T PS +  DKRI+ F   SGTSMSCPHVAG+VGLLK++
Sbjct  515   PSILKPDITAPGVNIIAAYSESTSPSQSASDKRIIPFMTMSGTSMSCPHVAGLVGLLKSI  574

Query  752   YPSWSPAEIRSAIMTTATVRAN-SGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             +P WSPA I+SAIMTTAT + N  G A+  + +  + TPFAYGAGHI PN  ADPGLVYD
Sbjct  575   HPDWSPAAIKSAIMTTATTKDNVRGSAL--ESSLAEATPFAYGAGHIRPNHVADPGLVYD  632

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRT  402
             L + DY+NF+CA+GYN  ++    G PY CP   ++  FNYP+IT+P  K   +  VTRT
Sbjct  633   LNVIDYLNFLCARGYNNKQLKLFYGRPYTCPKSFNIIDFNYPAITIPDFKIGHSLNVTRT  692

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGV  225
             + NVGSP+TY   V++P  F ++V P+ LKF + GE+  FKVT   + +     DY FG 
Sbjct  693   VTNVGSPSTYRVRVQAPPEFLISVEPRRLKFRQKGEKIEFKVTFTLRPQTKYIEDYVFGR  752

Query  224   LTWSDKKHRVRSPIVV  177
             L W+D KH V +PI +
Sbjct  753   LVWTDGKHSVETPIAI  768



>ref|XP_010538433.1| PREDICTED: subtilisin-like protease SBT5.4 [Tarenaya hassleriana]
Length=767

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/736 (59%), Positives = 540/736 (73%), Gaps = 18/736 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHHQ LG++LGS DKARDAIFYSY RHINGFAA+LEEEEA +I+K+P VISVF
Sbjct  43    DLKRVAESHHQFLGSFLGSHDKARDAIFYSYKRHINGFAAILEEEEAVQISKHPSVISVF  102

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ ++L TT SWEF+ LE +G +I  GS+W  A+FGEDTIIGNLDTGVW ES+SF  +G
Sbjct  103   PNKGKKLHTTHSWEFMQLEKDG-IIPSGSLWLNARFGEDTIIGNLDTGVWSESQSFGTDG  161

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSH  1821
              GP+P RWKG C+  +     CNRKLIG RYF +GY +  G   NSSF +  D  GHG+H
Sbjct  162   IGPVPSRWKGTCKTAE--GVRCNRKLIGTRYFNKGYLAHTGLKTNSSFESACDHEGHGTH  219

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLST GGNFV GA+VFG+GNGTAKGGSP ARVA+YKVCW P + G  C+DADILA FD A
Sbjct  220   TLSTVGGNFVRGASVFGVGNGTAKGGSPLARVASYKVCWTPVN-GSQCFDADILAAFDMA  278

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLS+SLGGD P  YFND LAIGSFHAVK+GI VV SAGN GP   +V+NVAPW+
Sbjct  279   IHDGVDVLSISLGGD-PADYFNDGLAIGSFHAVKHGITVVCSAGNSGPAPSTVSNVAPWI  337

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESA---VPLKLPTGKFYPLLSAASARIKINASIS  1290
             +TV A+T+DR+FQS+V L N + + GES    +P+K   GK YPL++ A A++    + +
Sbjct  338   LTVAASTLDRKFQSSVELANGRRFKGESMSKPLPMK---GKMYPLITGAQAKLANANASA  394

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
                   CK GTLDPEK KGK++VCL+G++ R+EK  +AALAGAVGMIL ND+ +GN+IIA
Sbjct  395   ALL---CKEGTLDPEKAKGKIMVCLRGDSARVEKGRQAALAGAVGMILCNDKSTGNDIIA  451

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D HFLPA+ + Y DGL++F YIN T +P+ +IT P    G+KPAP +A FSS+GPN++ P
Sbjct  452   DPHFLPASQINYVDGLSVFSYINSTHDPMGYITAPTAAYGIKPAPFMADFSSQGPNSVTP  511

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
              ILKPD++APGVN+IAA+T    P+  + D R  ++  ESGTSM+CPHVAGV GLLKT++
Sbjct  512   GILKPDVTAPGVNIIAAYTREQSPTGLESDTRTTAYITESGTSMACPHVAGVAGLLKTMH  571

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             PSWSPA IRSAIMTTA  R N    +  + + +K   F YG+GH+ PN A DPGLVYDL 
Sbjct  572   PSWSPAAIRSAIMTTARTRDNRVSPMM-NASYVKANSFNYGSGHLRPNRAGDPGLVYDLT  630

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKN-  393
               DY++F+CA GYN+T +      PYKCP+  SL  FNYPSITVP+LKG  TVTR LKN 
Sbjct  631   ADDYLDFLCAIGYNQTMMELFSDGPYKCPEGASLLDFNYPSITVPNLKGPVTVTRKLKNV  690

Query  392   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGVLTW  216
              G    Y   VR P G SV V P++L+FE+V + +SF++TLK K + A ++ Y FG L W
Sbjct  691   GGGGGRYVVRVREPYGVSVKVEPRVLEFERVSQVKSFEMTLKPKWDGAASNGYVFGGLIW  750

Query  215   SDKKHRVRSPIVVKTA  168
             SD  H VRSPIVV  A
Sbjct  751   SDGIHFVRSPIVVAAA  766



>gb|KGN55992.1| hypothetical protein Csa_3G045060 [Cucumis sativus]
Length=746

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/729 (58%), Positives = 524/729 (72%), Gaps = 11/729 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++    S + LLG+ +GS   A+DAI YSY ++INGFAA L+E++A ++AKNP+V+SVF
Sbjct  24    DIEVATESQYDLLGSVVGSKLAAKDAIKYSYNKYINGFAATLDEKQAKDLAKNPKVVSVF  83

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ R+L TTRSW FLG+E + G I   SIW   +FGEDTIIGNLDTGVWPESKSF++ G
Sbjct  84    ENKERKLHTTRSWHFLGVESDEG-IPSNSIWNAGRFGEDTIIGNLDTGVWPESKSFNDAG  142

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GP+P RW+G C+   +  F CNRKLIGARYF +G++ A GPLN SF T RD  GHGSHT
Sbjct  143   YGPVPSRWRGACEGGAN--FRCNRKLIGARYFNKGFAMASGPLNISFNTARDKQGHGSHT  200

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPGANVFG GNGTAKGGSPKARVAAYKVCWP TS G  CYDADILAGF+ AI
Sbjct  201   LSTAGGNFVPGANVFGYGNGTAKGGSPKARVAAYKVCWPATS-GGGCYDADILAGFEAAI  259

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLG   P  +  DS++IG+FHAV+ GIVVV SAGN+GP  G+V+N++PW+ 
Sbjct  260   SDGVDVLSVSLG-SKPEEFAYDSMSIGAFHAVQQGIVVVCSAGNDGPGPGTVSNISPWMF  318

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+++DR F S   LGNKKHY G S     L  GKFYPL++A  A+    + I  Q  
Sbjct  319   TVAASSIDRDFTSYASLGNKKHYKGSSISSSALAGGKFYPLINAVDAKAANASEILAQ--  376

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C  G+LDP K KGK++VCL+GEN R+EK      AG VGMIL N ++ G+   ADAH 
Sbjct  377   -LCHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMILVNGKNGGSGTTADAHI  435

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATH++Y+DGLA+  YIN T+ PVAHIT   T LG+KP+PV+A FSSRGPN I   +LK
Sbjct  436   LPATHLSYTDGLAVAQYINSTKTPVAHITPVQTQLGIKPSPVMADFSSRGPNPITEAMLK  495

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+ PG++++A+ T     +   +D R V FNVESGTSMSCPH++GVVGLLKTLYP+WS
Sbjct  496   PDITGPGMSILASVTTDVTATTFPFDTRRVPFNVESGTSMSCPHISGVVGLLKTLYPTWS  555

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  R N+ + I+D+    K TPF YGAGH++PN A DPGLVYD  + DY
Sbjct  556   PAAIKSAIMTTAKTRDNTMRTISDN-VKPKATPFDYGAGHVHPNSAMDPGLVYDTTIDDY  614

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGS  384
             +NF+CA+GYN          P+ C    +L+  NYPSI++P L+  A  TV R +KNVG+
Sbjct  615   LNFLCARGYNSLTFKNFYNKPFVCAKSFTLTDLNYPSISIPKLQFGAPVTVNRRVKNVGT  674

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A V +     VTV P  L+F  VGEE++FKV  + KG      Y FG L WSD K
Sbjct  675   PGTYVARVNASSKILVTVEPSTLQFNSVGEEKAFKVVFEYKGNEQDKGYVFGTLIWSDGK  734

Query  203   HRVRSPIVV  177
             H VRSPIVV
Sbjct  735   HNVRSPIVV  743



>ref|XP_004169297.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=833

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/729 (58%), Positives = 524/729 (72%), Gaps = 11/729 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++    S + LLG+ +GS   A+DAI YSY ++INGFAA L+E++A ++AKNP+V+SVF
Sbjct  111   DIEVATESQYDLLGSVVGSKLAAKDAIKYSYNKYINGFAATLDEKQAKDLAKNPKVVSVF  170

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ R+L TTRSW FLG+E + G I   SIW   +FGEDTIIGNLDTGVWPESKSF++ G
Sbjct  171   ENKERKLHTTRSWHFLGVESDEG-IPSNSIWNAGRFGEDTIIGNLDTGVWPESKSFNDAG  229

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GP+P RW+G C+   +  F CNRKLIGARYF +G++ A GPLN SF T RD  GHGSHT
Sbjct  230   YGPVPSRWRGACEGGAN--FRCNRKLIGARYFNKGFAMASGPLNISFNTARDKQGHGSHT  287

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPGANVFG GNGTAKGGSPKARVAAYKVCWP TS G  CYDADILAGF+ AI
Sbjct  288   LSTAGGNFVPGANVFGYGNGTAKGGSPKARVAAYKVCWPATS-GGGCYDADILAGFEAAI  346

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLG   P  +  DS++IG+FHAV+ GIVVV SAGN+GP  G+V+N++PW+ 
Sbjct  347   SDGVDVLSVSLG-SKPEEFAYDSMSIGAFHAVQQGIVVVCSAGNDGPGPGTVSNISPWMF  405

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+++DR F S   LGNKKHY G S     L  GKFYPL++A  A+    + I  Q  
Sbjct  406   TVAASSIDRDFTSYASLGNKKHYKGSSISSSALAGGKFYPLINAVDAKAANASEILAQ--  463

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C  G+LDP K KGK++VCL+GEN R+EK      AG VGMIL N ++ G+   ADAH 
Sbjct  464   -LCHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMILVNGKNGGSGTTADAHI  522

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATH++Y+DGLA+  YIN T+ PVAHIT   T LG+KP+PV+A FSSRGPN I   +LK
Sbjct  523   LPATHLSYTDGLAVAQYINSTKTPVAHITPVQTQLGIKPSPVMADFSSRGPNPITEAMLK  582

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+ PG++++A+ T     +   +D R V FNVESGTSMSCPH++GVVGLLKTLYP+WS
Sbjct  583   PDITGPGMSILASVTTDVTATTFPFDTRRVPFNVESGTSMSCPHISGVVGLLKTLYPTWS  642

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  R N+ + I+D+    K TPF YGAGH++PN A DPGLVYD  + DY
Sbjct  643   PAAIKSAIMTTAKTRDNTMRTISDN-VKPKATPFDYGAGHVHPNSAMDPGLVYDTTIDDY  701

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGS  384
             +NF+CA+GYN          P+ C    +L+  NYPSI++P L+  A  TV R +KNVG+
Sbjct  702   LNFLCARGYNSLTFKNFYNKPFVCAKSFTLTDLNYPSISIPKLQFGAPITVNRRVKNVGT  761

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A V +     VTV P  L+F  VGEE++FKV  + KG      Y FG L WSD K
Sbjct  762   PGTYVARVNASSKILVTVEPSTLQFNSVGEEKAFKVVFEYKGNEQDKGYVFGTLIWSDGK  821

Query  203   HRVRSPIVV  177
             H VRSPIVV
Sbjct  822   HNVRSPIVV  830



>ref|XP_009587856.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana tomentosiformis]
Length=777

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/737 (58%), Positives = 521/737 (71%), Gaps = 16/737 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L RV   H   L T+LG  DKA+++IFYSY R INGFAA LEE+  A I  +P+VISVF 
Sbjct  48    LQRVSDFHINFLATFLGCKDKAKESIFYSYRRRINGFAADLEEKFVALIQLHPKVISVFP  107

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N  R+L T  SW+FL LE + GV+  GS+W+KAKFG+D IIGNLDTGVWPE+ SF++EG+
Sbjct  108   NERRELHTFHSWDFLSLE-DNGVVTPGSLWEKAKFGQDIIIGNLDTGVWPENPSFNDEGY  166

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF--TPRDVIGHGSH  1821
             GPIP RWKG CQN     F CNRKLIGARYF +GY    G  N+S    +PRD  GHG+H
Sbjct  167   GPIPSRWKGECQNDDKVPFSCNRKLIGARYFHKGYDDLRGNNNTSNIPNSPRDTEGHGTH  226

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GNF P A+V G+ NGTAKGG+PKARVAAYKVCWP    G  C+DADIL  FD A
Sbjct  227   TLSTAAGNFAPNASVIGVYNGTAKGGAPKARVAAYKVCWP-AKQGGGCFDADILKAFDFA  285

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I+DGVDV+S S+GG  P PYF D+ AIG+FHA+K GIVVV SAGN GP+  +V N+APW+
Sbjct  286   IDDGVDVISASVGG-KPRPYFRDAAAIGAFHAMKEGIVVVTSAGNSGPMLSTVGNIAPWM  344

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F+SNV L N     G S +   LP  KFYPL+S   A+    A+ + +D
Sbjct  345   ITVGASTIDREFESNVKLQNGLTIKGTS-ISYPLPEEKFYPLISGEQAKA---ANATVED  400

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CK  TLD  KVKGK+LVCL+G N R++K H+A + GAVGMIL ND+ SGN+IIAD H
Sbjct  401   AKLCKQATLDASKVKGKILVCLRGNNTRVDKGHQAVIGGAVGMILCNDQTSGNDIIADVH  460

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+TY+DGLA+F YIN T N +  IT P  +LG+KPAP +A+FSSRGPN I P IL
Sbjct  461   LLPASHITYNDGLAVFAYINSTNNAMGSITAPKAILGIKPAPTMASFSSRGPNLITPAIL  520

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVNVIAA+TE   PS+  +D R  +FNV SGTSMSCPHV+GVVGLLK ++P W
Sbjct  521   KPDITAPGVNVIAAYTEGNNPSNEVFDNRRTTFNVMSGTSMSCPHVSGVVGLLKAIHPDW  580

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSA+MTTA+   N+GK +  D T    TPFA GAGHI PN A+DPGLVYDL++ D
Sbjct  581   SPAAIRSALMTTASPIDNTGKPLL-DTTKEAATPFASGAGHIRPNLASDPGLVYDLEVND  639

Query  560   YVNFICAQGYNKTEITAVLGTPYKCP--DHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             Y+NF+CA GY+   I      PY CP   + SL  FNYPSITVP L G   VTRTL NVG
Sbjct  640   YLNFLCASGYDSQVIRTFNKAPYICPPLSNSSLLEFNYPSITVPALSGNLIVTRTLTNVG  699

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN----ATADYAFGVLT  219
              P+TYTA V  P G SV V P +L F+  G+++ F + +KA            + +G L 
Sbjct  700   PPSTYTARVGQPPGISVVVEPNVLIFKSQGQKERFSLHIKAVNTTYYLAGVDQHVYGELV  759

Query  218   WSDKKHRVRSPIVVKTA  168
             WSD  H V SPI V+ A
Sbjct  760   WSDGTHTVTSPITVEIA  776



>emb|CDY40408.1| BnaA02g27220D [Brassica napus]
Length=768

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/732 (60%), Positives = 533/732 (73%), Gaps = 15/732 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L RV  SHH+LLG++LGS +KAR+AIFYSY RHINGFAA+LEEEEA  I+K+P VISVFL
Sbjct  49    LKRVAESHHELLGSFLGSHEKARNAIFYSYDRHINGFAAVLEEEEAEAISKHPNVISVFL  108

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             ++ ++L TT SWEF+ LE +G VI   S+W KA+ GEDTIIGN+DTGVW ESKSFS  G 
Sbjct  109   DKGKKLHTTHSWEFMQLEKDG-VIPSSSLWSKARLGEDTIIGNIDTGVWSESKSFSPHGL  167

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             GP+P RWKG C    + S  CNRKLIG RYF +GY  + G   NSSF + RD  GHG+HT
Sbjct  168   GPVPCRWKGSCNTGGNVS--CNRKLIGTRYFNKGYLVSAGLKSNSSFESARDHDGHGTHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FV GA+VFG+GNGTAKGGSP ARVA+YK CWPP + G +C+DADILA FD AI
Sbjct  226   LSTAGGHFVRGASVFGVGNGTAKGGSPMARVASYKACWPPVN-GSECFDADILAAFDMAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P  YF D +AIGSFHAVK+GI VV SAGN GP   +V+NVAPW++
Sbjct  285   HDGVDVLSVSLGGD-PADYFADGIAIGSFHAVKHGITVVCSAGNSGPAPATVSNVAPWIL  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR FQS V L + + + GES +   LP GK + L + A A++   A+ S  DA
Sbjct  344   TVAASTLDREFQSFVQLASGERFKGES-MSKALPAGKMFSLTTGAQAKL---ANASAIDA  399

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             + CK GTLDP K KGK++VCL+G + R+EK  +AA AGA  MIL ND+ SGN+I AD HF
Sbjct  400   MLCKEGTLDPHKAKGKIMVCLRGNSSRVEKGRQAAQAGAAAMILCNDKASGNDITADPHF  459

Query  1097  LPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
             LPATH+ + D  A+F Y+N T   P+  +T P    G+KPAP +A FSS+GPN + P IL
Sbjct  460   LPATHINFFDSQALFSYVNSTYLEPMGTLTAPAAAFGIKPAPYMANFSSQGPNTVTPGIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPD++APGV++IAA+T     S  ++D R  +F +ESGTSMSCPHVAGV GLL+T++PSW
Sbjct  520   KPDVTAPGVDIIAAYTREQSLSGLEFDHRTTAFYIESGTSMSCPHVAGVAGLLRTMHPSW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             S A IRSAIMTTA  R N    + +    +K   F YG+GHI PN A DPGLVYDL + D
Sbjct  580   SSAAIRSAIMTTARTRDNRVSPMLNGSY-VKANSFNYGSGHIRPNRAGDPGLVYDLTVND  638

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y++F+CA GYN+T I     +P YKCP   S+   NYPSITVP L G+ TVTR LKNVGS
Sbjct  639   YLDFLCAVGYNQTMIKLFSESPSYKCPKEASIVDLNYPSITVPKLTGSVTVTRKLKNVGS  698

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
               TY A+VR P G SV V P +LKF++VG+ +SFK+TLK K      DYAFG LTWSD K
Sbjct  699   VGTYAANVREPHGVSVKVEPSVLKFDRVGQVKSFKMTLKPKW--VAKDYAFGGLTWSDGK  756

Query  203   HRVRSPIVVKTA  168
             H VRSPIVV  A
Sbjct  757   HYVRSPIVVSIA  768



>gb|AES91025.2| subtilisin-like serine protease [Medicago truncatula]
Length=747

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/736 (58%), Positives = 536/736 (73%), Gaps = 19/736 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ LLG+YLGS +KA++AIFYSY R+INGFAA+L+E+EAA+++K+P V+S+F
Sbjct  20    DIESATNSHYDLLGSYLGSTEKAKEAIFYSYNRYINGFAAILDEDEAAQLSKHPNVVSIF  79

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN   +L TTRSW+FLGLE  GG   D S+WK++  GED IIGNLD+GVWPESKSFS+EG
Sbjct  80    LNEKYELYTTRSWDFLGLERGGGFPKD-SLWKRS-LGEDIIIGNLDSGVWPESKSFSDEG  137

Query  1997  FGPIPKRWKGICQNQKDK--SFHCNRKLIGARYFIQGYSSAVGPL---NSSFFTPRDVIG  1833
             +GPIPK+W G CQ  K    +FHCNRKLIGARYF +GY +   P+   N +F + RD  G
Sbjct  138   YGPIPKKWHGTCQTTKGNPDNFHCNRKLIGARYFNKGYLAVPIPIRNPNETFNSARDFEG  197

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFV  A+VFG GNGTA GGSPKARVAAYKVCW      + C DADILAG
Sbjct  198   HGSHTLSTAGGNFVANASVFGNGNGTASGGSPKARVAAYKVCW-----DDGCQDADILAG  252

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLG + P  + N S++IGSFHAV N I+VVA+ GN GP   +V N+
Sbjct  253   FEAAISDGVDVLSVSLGRNIPVEFHNSSISIGSFHAVANNIIVVAAGGNSGPSPNTVANL  312

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
              PW +TV A+T+DR F S V+LGNKK + GES    +LP  K YPL+SAA A+      +
Sbjct  313   EPWTLTVAASTIDRDFTSYVILGNKKIFKGESLSEHELPPHKLYPLISAADAKFD---HV  369

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +AL C  G+LD  K KGK+LVCL G N R++K  EA+  GAVGMILAND+ SG EII
Sbjct  370   SAGEALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEII  429

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
              DAH LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + 
Sbjct  430   PDAHVLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILA  489

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
             P ILKPDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK++
Sbjct  490   PSILKPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKSI  549

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P WSPA I+SAIMTTAT + N G  + D     + TP AYGAGH+ PN AADPGLVYDL
Sbjct  550   HPDWSPAAIKSAIMTTATTKNNIGGHVLDSSQE-EATPNAYGAGHVRPNLAADPGLVYDL  608

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTL  399
              +TDY+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT+
Sbjct  609   NITDYLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRTV  668

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVL  222
              NVGSP+ Y   +++PV F V+VNP+ L F+K GE++ FKVTL   KG     DY FG L
Sbjct  669   TNVGSPSKYRVHIQAPVEFLVSVNPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKL  728

Query  221   TWSDKKHRVRSPIVVK  174
              W+D KH+V  PI +K
Sbjct  729   VWTDGKHQVGIPISIK  744



>emb|CDY37334.1| BnaC02g33520D [Brassica napus]
Length=769

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/733 (60%), Positives = 538/733 (73%), Gaps = 16/733 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L RV  SHH+LLG++LGS +KAR+AIFYSY RHINGFAA+LEEEEA  I+K+P VISVFL
Sbjct  49    LKRVAESHHELLGSFLGSHEKARNAIFYSYDRHINGFAAVLEEEEAEAISKHPNVISVFL  108

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             ++ ++L TT SWEF+ LE +G VI   S+W KA+ GEDTIIGN+DTGVW ES+SFS  G 
Sbjct  109   DKGKKLHTTHSWEFMQLEKDG-VIPSSSLWSKARLGEDTIIGNIDTGVWSESQSFSPHGL  167

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             GP+P RWKG C    + S  CNRKLIG RYF +GY  + G   NSSF + RD  GHG+HT
Sbjct  168   GPVPCRWKGSCNTAGNVS--CNRKLIGTRYFNKGYLVSAGLNSNSSFESARDHNGHGTHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FV GA+VFG+GNGTAKGGSP +RVA+YK CWPP + G +C+DADILA FD AI
Sbjct  226   LSTAGGHFVRGASVFGVGNGTAKGGSPLSRVASYKACWPPVN-GSECFDADILAAFDMAI  284

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P  YF D +AIGSFHAVK+GI VV SAGN GP   +V+NVAPW++
Sbjct  285   HDGVDVLSVSLGGD-PADYFADGIAIGSFHAVKHGITVVCSAGNSGPAPATVSNVAPWIL  343

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR FQS V L + + + GES +   LP GK + L + A A++   A+ S  DA
Sbjct  344   TVAASTLDREFQSFVQLASGERFKGES-MSKALPAGKMFSLTAGAQAKL---ANASAIDA  399

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             + CK GTLDP K KGK++VCL+G + R+EK  +AA AGA GMIL ND+ SGN+I AD HF
Sbjct  400   MLCKEGTLDPHKAKGKIMVCLRGNSSRVEKGRQAAQAGAAGMILCNDKASGNDITADPHF  459

Query  1097  LPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
             LPATH+ + D  A+F Y+N T   P+  +T P    G+KPAP +A FSS+GPN + P IL
Sbjct  460   LPATHINFFDSQALFSYVNSTYLEPMGTLTAPAAAFGIKPAPYMANFSSQGPNTVTPGIL  519

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPD++APGV++IAA+T     S  ++D R  +F +ESGTSMSCPHVAGV GLL+T++PSW
Sbjct  520   KPDVTAPGVDIIAAYTREQSLSGLEFDHRTTAFYIESGTSMSCPHVAGVAGLLRTMHPSW  579

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             S A IRSAIMTTA  R N    + +    +K   F YG+GHI PN A DPGLVYDL L D
Sbjct  580   SSAAIRSAIMTTARTRDNRVSPMLNGSY-VKANSFNYGSGHIRPNRAGDPGLVYDLTLND  638

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTA-TVTRTLKNVG  387
             Y++F+CA GYN+T IT    +P YKCP   S+   NYPSITVP+L G++ TVTR LKNVG
Sbjct  639   YLDFLCAVGYNQTMITLFSESPSYKCPKEASVVDLNYPSITVPNLTGSSVTVTRKLKNVG  698

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             S  TY A+VR P G SV V P +LKF++VG+ +SFK+TLK K      DYAFG LTWSD 
Sbjct  699   SVGTYAANVREPHGVSVNVEPSVLKFDRVGQVKSFKMTLKPKW--VAKDYAFGGLTWSDG  756

Query  206   KHRVRSPIVVKTA  168
             KH VRSPIVV TA
Sbjct  757   KHYVRSPIVVSTA  769



>ref|XP_009107091.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=764

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/732 (60%), Positives = 534/732 (73%), Gaps = 15/732 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L RV  SHH+LLG++LGS +KAR+AIFYSY RHINGFAA+LEEEEA  I+K+P VISVFL
Sbjct  45    LKRVAESHHELLGSFLGSHEKARNAIFYSYDRHINGFAAVLEEEEAEAISKHPNVISVFL  104

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             ++ ++L TT SWEF+ LE +G VI   S+W KA+ GEDTIIGN+DTGVW ESKSFS  G 
Sbjct  105   DKGKKLHTTHSWEFMQLEKDG-VIPSSSLWSKARLGEDTIIGNIDTGVWSESKSFSPHGL  163

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             GP+P RWKG C    + S  CNRKLIG RYF +GY  + G   NSSF + RD  GHG+HT
Sbjct  164   GPVPCRWKGSCNTGGNVS--CNRKLIGTRYFNKGYLVSAGLSSNSSFESARDHDGHGTHT  221

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FV GA+VFG+GNGTAKGGSP ARVA+YK CWPP + G +C+DADILA FD AI
Sbjct  222   LSTAGGHFVRGASVFGVGNGTAKGGSPMARVASYKACWPPVN-GSECFDADILAAFDMAI  280

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGGD P  YF D +AIGSFHAVK+GI VV SAGN GP   +V+NVAPW++
Sbjct  281   HDGVDVLSVSLGGD-PADYFADGIAIGSFHAVKHGITVVCSAGNSGPAPATVSNVAPWIL  339

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+T+DR FQS V L + + + GES +   LP GK + L + A A++   A+ S  DA
Sbjct  340   TVAASTLDREFQSFVQLASGERFKGES-MSKALPAGKMFSLTTGAQAKL---ANASAIDA  395

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             + CK GTLDP K KGK++VCL+G + R+EK  +AA AGA  MIL NDE SGN+I AD HF
Sbjct  396   MLCKEGTLDPHKAKGKIMVCLRGNSSRVEKGRQAAQAGAAAMILCNDEASGNDITADPHF  455

Query  1097  LPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
             LPATH+ + D  A+F Y+N T   P+  +T P    G+KPAP +A FSS+GPN + P IL
Sbjct  456   LPATHINFFDSEALFSYVNSTYLEPMGTLTAPAAAFGIKPAPYMANFSSQGPNTVTPGIL  515

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPD++APGV++IAA+T     S  ++D R  +F +ESGTSMSCPHVAGV GLL+T++PSW
Sbjct  516   KPDVTAPGVDIIAAYTREQSLSGLEFDHRTTAFYIESGTSMSCPHVAGVAGLLRTMHPSW  575

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             S A IRSAIMTTA  R N    + +    +K   F YG+GHI PN A DPGLVYDL + D
Sbjct  576   SSAAIRSAIMTTARTRDNRVSPMLNGSY-VKANSFNYGSGHIRPNRAGDPGLVYDLTVND  634

Query  560   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y++F+CA GYN+T I     +P YKCP   S+   NYPSITV +L G+ TVTR LKNVGS
Sbjct  635   YLDFLCAVGYNQTMIKLFSESPSYKCPKEASVVDLNYPSITVSNLTGSVTVTRKLKNVGS  694

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
               TY A+VR P G SV V P +LKF++VG+ +SFK+TLK K      D+AFG LTWSD K
Sbjct  695   VGTYAANVREPHGVSVKVEPSVLKFDRVGQVKSFKMTLKPKW--VGKDHAFGGLTWSDGK  752

Query  203   HRVRSPIVVKTA  168
             H VRSPIVV TA
Sbjct  753   HYVRSPIVVSTA  764



>ref|XP_010942532.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Elaeis 
guineensis]
Length=816

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/762 (57%), Positives = 550/762 (72%), Gaps = 43/762 (6%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             RV+ SH++LL + LG+ +KA D++FYSYT +INGFAA LEEEEA EI++ P VISVF NR
Sbjct  59    RVRDSHYELLASVLGNKEKAHDSLFYSYTSYINGFAANLEEEEAMEISRYPGVISVFPNR  118

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSWEFLGLE +G V  + S+W KA+FGED IIGNLDTGVWPES+SF ++G GP
Sbjct  119   GYKLHTTRSWEFLGLERDGRVPKE-SLWTKARFGEDIIIGNLDTGVWPESESFKDDGLGP  177

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +WKGICQ   DKSF CNRK+IGARY+ +GY++A G LN++F TPRD  GHG+HTLST
Sbjct  178   VPSKWKGICQIGVDKSFSCNRKVIGARYYNKGYAAAGGTLNATFETPRDNDGHGTHTLST  237

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             AGG FVPGAN+FG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+A FD AI DG
Sbjct  238   AGGGFVPGANIFGYGNGTAKGGSPRARVAAYKVCWPPIN-GSECFDADIIAAFDAAIHDG  296

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLSVSLGGD P  Y  D LAIGSFHAVKNGI VV SAGN GP+ GSV+N APW+ITVG
Sbjct  297   VDVLSVSLGGD-PITYSLDGLAIGSFHAVKNGITVVCSAGNSGPLPGSVSNTAPWIITVG  355

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TMDR F + +   NK    G S     LP  + YP++++  A+     + +  DA  C
Sbjct  356   ASTMDREFPAYINFNNKS-IKGASLSQKGLPGNQLYPMINSKEAKA---PNATEHDAELC  411

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDPEKV+GK++VCL+G   R+EK     LAG  GM+L ND+ SGNEIIADAH LPA
Sbjct  412   YLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLLPA  471

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK---  918
             TH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILK   
Sbjct  472   THITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKVYE  531

Query  917   -------------------------------PDISAPGVNVIAAFTEATGPSDNDYDKRI  831
                                            PDI+APGV+V+AA++EA GP+   +D R 
Sbjct  532   KFYYLFLVAHRVLLIRQFNFLLAASYHCTFQPDITAPGVSVLAAYSEAVGPTGLPFDTRR  591

Query  830   VSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGL  651
             V+FN +SGTSMSCPH++GVVGLLK+L+P W+P+ I+SAIMTTA  + N  + + +    +
Sbjct  592   VAFNSDSGTSMSCPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPVLNSSY-V  650

Query  650   KTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDH-I  474
             K TPF+YG+GH+ PN A DPGLVYDL   DY+NF+C+ GYN T+I       + CP    
Sbjct  651   KATPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSKPP  710

Query  473   SLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGE  294
              L   NYPSIT+P+L G+ TVTRTLKNVGSP TY   +R P G SV+VNP  L ++K+GE
Sbjct  711   RLEDLNYPSITIPYLFGSITVTRTLKNVGSPGTYIIRIREPRGISVSVNPTSLTYDKIGE  770

Query  293   EQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVKTA  168
             E+ F+VTLK K  +A+ DY FG L WSD KH VR+P+VV  A
Sbjct  771   EKKFEVTLKVKKGHASMDYVFGGLIWSDGKHYVRTPLVVSAA  812



>ref|XP_010942533.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Elaeis 
guineensis]
Length=809

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/762 (57%), Positives = 550/762 (72%), Gaps = 43/762 (6%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             RV+ SH++LL + LG+ +KA D++FYSYT +INGFAA LEEEEA EI++ P VISVF NR
Sbjct  52    RVRDSHYELLASVLGNKEKAHDSLFYSYTSYINGFAANLEEEEAMEISRYPGVISVFPNR  111

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSWEFLGLE +G V  + S+W KA+FGED IIGNLDTGVWPES+SF ++G GP
Sbjct  112   GYKLHTTRSWEFLGLERDGRVPKE-SLWTKARFGEDIIIGNLDTGVWPESESFKDDGLGP  170

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +WKGICQ   DKSF CNRK+IGARY+ +GY++A G LN++F TPRD  GHG+HTLST
Sbjct  171   VPSKWKGICQIGVDKSFSCNRKVIGARYYNKGYAAAGGTLNATFETPRDNDGHGTHTLST  230

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             AGG FVPGAN+FG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DADI+A FD AI DG
Sbjct  231   AGGGFVPGANIFGYGNGTAKGGSPRARVAAYKVCWPPIN-GSECFDADIIAAFDAAIHDG  289

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLSVSLGGD P  Y  D LAIGSFHAVKNGI VV SAGN GP+ GSV+N APW+ITVG
Sbjct  290   VDVLSVSLGGD-PITYSLDGLAIGSFHAVKNGITVVCSAGNSGPLPGSVSNTAPWIITVG  348

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+TMDR F + +   NK    G S     LP  + YP++++  A+     + +  DA  C
Sbjct  349   ASTMDREFPAYINFNNKS-IKGASLSQKGLPGNQLYPMINSKEAKA---PNATEHDAELC  404

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               G+LDPEKV+GK++VCL+G   R+EK     LAG  GM+L ND+ SGNEIIADAH LPA
Sbjct  405   YLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLLPA  464

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK---  918
             TH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILK   
Sbjct  465   THITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKVYE  524

Query  917   -------------------------------PDISAPGVNVIAAFTEATGPSDNDYDKRI  831
                                            PDI+APGV+V+AA++EA GP+   +D R 
Sbjct  525   KFYYLFLVAHRVLLIRQFNFLLAASYHCTFQPDITAPGVSVLAAYSEAVGPTGLPFDTRR  584

Query  830   VSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGL  651
             V+FN +SGTSMSCPH++GVVGLLK+L+P W+P+ I+SAIMTTA  + N  + + +    +
Sbjct  585   VAFNSDSGTSMSCPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPVLNSSY-V  643

Query  650   KTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDH-I  474
             K TPF+YG+GH+ PN A DPGLVYDL   DY+NF+C+ GYN T+I       + CP    
Sbjct  644   KATPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSKPP  703

Query  473   SLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGE  294
              L   NYPSIT+P+L G+ TVTRTLKNVGSP TY   +R P G SV+VNP  L ++K+GE
Sbjct  704   RLEDLNYPSITIPYLFGSITVTRTLKNVGSPGTYIIRIREPRGISVSVNPTSLTYDKIGE  763

Query  293   EQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVKTA  168
             E+ F+VTLK K  +A+ DY FG L WSD KH VR+P+VV  A
Sbjct  764   EKKFEVTLKVKKGHASMDYVFGGLIWSDGKHYVRTPLVVSAA  805



>ref|XP_002299064.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
 gb|EEE83869.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
Length=810

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/770 (56%), Positives = 526/770 (68%), Gaps = 48/770 (6%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D+  +  SH  LLG+ L S +  +D + YSYT+ INGFAA L E + A +  NP VISV
Sbjct  50    LDVQHMTKSHFDLLGSCLESKENVQDVMIYSYTKCINGFAANLNEAQVAAMKGNPGVISV  109

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTG-----------  2034
             F N+ R L TT SWEF+G E  G      S+ KKA FGE  II NLDTG           
Sbjct  110   FENKERMLHTTHSWEFMGFEANGAPTLS-SLQKKANFGEGVIIANLDTGKVLSLKLQGKN  168

Query  2033  --------------------------VWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHC  1932
                                       VWPESKSF++EG GP+P RWKG CQ      F C
Sbjct  169   LNSVHIGSLPIVILSYIFWLRTITIGVWPESKSFNDEGMGPVPSRWKGTCQ--AGGGFKC  226

Query  1931  NRKLIGARYFIQGYSSAV-GPLNSSFFTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGT  1755
             N+KLIGARYF +G++SA   P+ + + T RD  GHGSHTLSTAGG+FVPGA++FG GNGT
Sbjct  227   NKKLIGARYFNKGFASASPTPIPTEWNTARDTEGHGSHTLSTAGGSFVPGASIFGYGNGT  286

Query  1754  AKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFN  1575
             AKGGSPKA VAAYKVCWP  + G  C+DADILA FD AI DGVDV+S+SLG      +  
Sbjct  287   AKGGSPKAHVAAYKVCWPSDNGG--CFDADILAAFDAAIGDGVDVISMSLGPHQAVEFLQ  344

Query  1574  DSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKK  1395
             D +AIGSF+A+K GI VVASAGN GPVAGSV + APWL T+GA+T+DR F + V LGNKK
Sbjct  345   DGMAIGSFNAIKKGIPVVASAGNSGPVAGSVAHGAPWLFTIGASTLDREFSATVTLGNKK  404

Query  1394  HYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHCKPGTLDPEKVKGKVLVCL  1215
              + G S     LP GKFYPL++AA AR+    +    DA  C+ GTLDP+KV GK++VCL
Sbjct  405   FFKGSSVASKGLPAGKFYPLINAAEARLP---TAPAADAQLCQNGTLDPKKVAGKIIVCL  461

Query  1214  QGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKT  1035
             +G N R+ K HEA LAGAVGMILANDE+SG+EI++D H LPA H+T++DG A+ +YI  T
Sbjct  462   RGINSRVVKGHEAELAGAVGMILANDEESGSEILSDPHMLPAAHLTFTDGQAVMNYIKST  521

Query  1034  RNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPS  855
             +NP A I+  +T LGV P PV+AAFSSRGP+ I P ILKPD++APGV+VIAA+TEA GPS
Sbjct  522   KNPTASISPVHTDLGVVPNPVMAAFSSRGPSLIEPAILKPDVTAPGVDVIAAYTEALGPS  581

Query  854   DNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKA  675
             +  +DKR   +   SGTSMSCPHV+G+VGLL+ ++P WSPA ++SAIMTTA   +NS K 
Sbjct  582   ELPFDKRRTPYITMSGTSMSCPHVSGIVGLLRAIHPDWSPAALKSAIMTTAKTISNSKKR  641

Query  674   ITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTP  495
             I  D  G   TPFAYGAGH+NPN AADPGLVYD    DY+NF+CA GYN T I    G P
Sbjct  642   IL-DADGQPATPFAYGAGHVNPNRAADPGLVYDTNEIDYLNFLCAHGYNSTFIIEFSGVP  700

Query  494   YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKIL  315
             YKCP++ SL+ FNYPSITVP L G  TVTR +KNVG+P TYT   ++P   SV V P  L
Sbjct  701   YKCPENASLAEFNYPSITVPDLNGPVTVTRRVKNVGAPGTYTVKAKAPPEVSVVVEPSSL  760

Query  314   KFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK-HRVRSPIVVKTA  168
             +F+K GEE+ FKVT K        DY FG LTWSD   H V+SP+VVK A
Sbjct  761   EFKKAGEEKIFKVTFKPVVNGMPKDYTFGHLTWSDSNGHHVKSPLVVKHA  810



>ref|XP_009396709.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=770

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/730 (58%), Positives = 524/730 (72%), Gaps = 18/730 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             R   SHH+LL + L   +K  DAIFYSYT +INGFAA L EE+A EI+K P V+SVF NR
Sbjct  53    RATESHHELLASVLKDKEKVEDAIFYSYTHNINGFAAYLGEEDAMEISKYPGVVSVFPNR  112

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
                L TTRSWEFLGLE         S W KA+FGED II NLD+GVWPE +SF ++G+G 
Sbjct  113   GYSLHTTRSWEFLGLERNS---ETHSAWNKARFGEDVIIANLDSGVWPEHQSFKDDGYGA  169

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P RW+GICQ   D+SF CNRKLIGARYF + Y +A GPLN++F++PRD  GHGSHTLST
Sbjct  170   VPSRWRGICQQGSDQSFSCNRKLIGARYFNKAYRAAAGPLNATFYSPRDYDGHGSHTLST  229

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             A GNFVPGA++ G  NGTAKGGSP+ARVAAYKVCWP T  GE C+DADILA FD AI DG
Sbjct  230   AAGNFVPGASILGHANGTAKGGSPRARVAAYKVCWPRTFRGE-CFDADILAAFDAAIHDG  288

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLS+SLGG  P  YF +SL IG+FHAVK GI VV SAGN GP   +V NVAPW++TVG
Sbjct  289   VDVLSLSLGG-RPSAYFENSLDIGAFHAVKKGITVVCSAGNSGPNNSTVTNVAPWILTVG  347

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+T+DR F ++VV GNK+  TG+S +   L   K YPL+++  A    + + S + A  C
Sbjct  348   ASTLDRDFPADVVFGNKR-VTGKS-LSEALTGKKLYPLINSKEAN---HGNASKEKAELC  402

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
              PG+LDP KVKGK++VCL+G + R  K      AG VGM+LAN    GNEIIAD H LPA
Sbjct  403   LPGSLDPAKVKGKIVVCLRGSSAREAKGETVREAGGVGMVLANSGSFGNEIIADVHVLPA  462

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             TH+T+SDGLA++ Y+N T++P+ +I    T LG +PAP +A+FSSRGPN I P ILKPDI
Sbjct  463   THITFSDGLALYSYLNSTKSPLGYIAVHMTKLGAEPAPAMASFSSRGPNTITPGILKPDI  522

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGV+V+AA T    P++ D+D+R V+F ++SGTSMSCPH++GVVGLLK L+P WSPA 
Sbjct  523   TAPGVDVLAASTGDVSPTELDFDRRRVAFMLKSGTSMSCPHISGVVGLLKALHPGWSPAA  582

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA V  N    + D+ T L  +PF YG+GH+ PN A DPGLVYDL  TDY+NF
Sbjct  583   IKSAIMTTARVWDNEKLPLLDEATFLDASPFNYGSGHVRPNRAMDPGLVYDLTTTDYLNF  642

Query  548   ICAQGYNKTEITAVLGTPYKCPD---HISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
             +C  GYN T++       Y CP    HI     NYPSIT+P L  +  VTR +KNVGSP 
Sbjct  643   LCGLGYNSTQLAEFRS--YSCPSKPPHI--KDLNYPSITIPDLSSSTKVTRVVKNVGSPG  698

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGE-NATADYAFGVLTWSDKKH  201
             TY   V  P G SVTV+P  L F++VGEE+ F+VTLK   E  ++A+Y FG L W+D+KH
Sbjct  699   TYAVRVIEPRGISVTVSPTNLTFDEVGEEKKFEVTLKKIKEGESSAEYVFGRLIWTDRKH  758

Query  200   RVRSPIVVKT  171
              VR+P+VVK+
Sbjct  759   YVRTPLVVKS  768



>ref|XP_003608828.1| Subtilisin-like serine protease [Medicago truncatula]
Length=778

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/737 (58%), Positives = 536/737 (73%), Gaps = 20/737 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ LLG+YLGS +KA++AIFYSY R+INGFAA+L+E+EAA+++K+P V+S+F
Sbjct  50    DIESATNSHYDLLGSYLGSTEKAKEAIFYSYNRYINGFAAILDEDEAAQLSKHPNVVSIF  109

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN   +L TTRSW+FLGLE  GG   D S+WK++  GED IIGNLD+GVWPESKSFS+EG
Sbjct  110   LNEKYELYTTRSWDFLGLERGGGFPKD-SLWKRS-LGEDIIIGNLDSGVWPESKSFSDEG  167

Query  1997  FGPIPKRWKGICQNQKDK--SFHCNRKLIGARYFIQGYSSAVGPL---NSSFFTPRDVIG  1833
             +GPIPK+W G CQ  K    +FHCNRKLIGARYF +GY +   P+   N +F + RD  G
Sbjct  168   YGPIPKKWHGTCQTTKGNPDNFHCNRKLIGARYFNKGYLAVPIPIRNPNETFNSARDFEG  227

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFV  A+VFG GNGTA GGSPKARVAAYKVCW      + C DADILAG
Sbjct  228   HGSHTLSTAGGNFVANASVFGNGNGTASGGSPKARVAAYKVCW-----DDGCQDADILAG  282

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLG + P  + N S++IGSFHAV N I+VVA+ GN GP   +V N+
Sbjct  283   FEAAISDGVDVLSVSLGRNIPVEFHNSSISIGSFHAVANNIIVVAAGGNSGPSPNTVANL  342

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
              PW +TV A+T+DR F S V+LGNKK + GES    +LP  K YPL+SAA A+      +
Sbjct  343   EPWTLTVAASTIDRDFTSYVILGNKKIFKGESLSEHELPPHKLYPLISAADAKFD---HV  399

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +AL C  G+LD  K KGK+LVCL G N R++K  EA+  GAVGMILAND+ SG EII
Sbjct  400   SAGEALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEII  459

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
              DAH LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + 
Sbjct  460   PDAHVLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILA  519

Query  932   PDILK-PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
             P ILK PDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK+
Sbjct  520   PSILKVPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKS  579

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             ++P WSPA I+SAIMTTAT + N G  + D     + TP AYGAGH+ PN AADPGLVYD
Sbjct  580   IHPDWSPAAIKSAIMTTATTKNNIGGHVLDSSQE-EATPNAYGAGHVRPNLAADPGLVYD  638

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRT  402
             L +TDY+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT
Sbjct  639   LNITDYLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRT  698

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGV  225
             + NVGSP+ Y   +++PV F V+VNP+ L F+K GE++ FKVTL   KG     DY FG 
Sbjct  699   VTNVGSPSKYRVHIQAPVEFLVSVNPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGK  758

Query  224   LTWSDKKHRVRSPIVVK  174
             L W+D KH+V  PI +K
Sbjct  759   LVWTDGKHQVGIPISIK  775



>gb|AES91026.2| subtilisin-like serine protease [Medicago truncatula]
Length=790

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/736 (58%), Positives = 536/736 (73%), Gaps = 19/736 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ LLG+YLGS +KA++AIFYSY R+INGFAA+L+E+EAA+++K+P V+S+F
Sbjct  63    DIESATNSHYDLLGSYLGSTEKAKEAIFYSYNRYINGFAAILDEDEAAQLSKHPNVVSIF  122

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN   +L TTRSW+FLGLE  GG   D S+WK++  GED IIGNLD+GVWPESKSFS+EG
Sbjct  123   LNEKYELYTTRSWDFLGLERGGGFPKD-SLWKRS-LGEDIIIGNLDSGVWPESKSFSDEG  180

Query  1997  FGPIPKRWKGICQNQKDK--SFHCNRKLIGARYFIQGYSSAVGPL---NSSFFTPRDVIG  1833
             +GPIPK+W G CQ  K    +FHCNRKLIGARYF +GY +   P+   N +F + RD  G
Sbjct  181   YGPIPKKWHGTCQTTKGNPDNFHCNRKLIGARYFNKGYLAVPIPIRNPNETFNSARDFEG  240

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFV  A+VFG GNGTA GGSPKARVAAYKVCW      + C DADILAG
Sbjct  241   HGSHTLSTAGGNFVANASVFGNGNGTASGGSPKARVAAYKVCW-----DDGCQDADILAG  295

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLG + P  + N S++IGSFHAV N I+VVA+ GN GP   +V N+
Sbjct  296   FEAAISDGVDVLSVSLGRNIPVEFHNSSISIGSFHAVANNIIVVAAGGNSGPSPNTVANL  355

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
              PW +TV A+T+DR F S V+LGNKK + GES    +LP  K YPL+SAA A+      +
Sbjct  356   EPWTLTVAASTIDRDFTSYVILGNKKIFKGESLSEHELPPHKLYPLISAADAKFD---HV  412

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +AL C  G+LD  K KGK+LVCL G N R++K  EA+  GAVGMILAND+ SG EII
Sbjct  413   SAGEALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEII  472

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
              DAH LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + 
Sbjct  473   PDAHVLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILA  532

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
             P ILKPDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK++
Sbjct  533   PSILKPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKSI  592

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P WSPA I+SAIMTTAT + N G  + D  +  + TP AYGAGH+ PN AADPGLVYDL
Sbjct  593   HPDWSPAAIKSAIMTTATTKDNIGGHVLDS-SQEEATPHAYGAGHVRPNLAADPGLVYDL  651

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTL  399
              +TDY+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT+
Sbjct  652   NITDYLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRTV  711

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVL  222
              NVGSP+ Y   +++P  F V+V P+ L F+K GE++ FKVTL   KG     DY FG L
Sbjct  712   TNVGSPSKYRVHIQAPAEFLVSVEPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKL  771

Query  221   TWSDKKHRVRSPIVVK  174
              W+D KH+V +PI +K
Sbjct  772   VWTDGKHQVGTPIAIK  787



>gb|AES91027.2| subtilisin-like serine protease [Medicago truncatula]
Length=787

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/747 (57%), Positives = 538/747 (72%), Gaps = 31/747 (4%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D +   +SH+ +L +Y+GS +KA++AIFYSY R+INGFAA+L+EEEAA+++K+P V+SVF
Sbjct  50    DFELATNSHYDILASYVGSTEKAKEAIFYSYNRYINGFAAILDEEEAAQLSKHPNVVSVF  109

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+  +L TTRSW FLGLE  GG     S+WKK+  G+D IIGNLDTGVWPESKSFS+EG
Sbjct  110   LNKKYELHTTRSWGFLGLE-RGGEFSKDSLWKKS-LGKDIIIGNLDTGVWPESKSFSDEG  167

Query  1997  FGPIPKRWKGICQNQKDK--SFHCNRKLIGARYFIQGY-SSAVGPLNSSFFTPRDVIGHG  1827
             FG IPK+W+GICQ  K    +FHCNRKLIGARYF +G+ ++     N S  + RD  GHG
Sbjct  168   FGLIPKKWRGICQVTKGNPDNFHCNRKLIGARYFFKGFLANPYRAKNVSLHSARDSEGHG  227

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLSTAGGNFV  A+VFG GNGTA GGSPKARVAAYKVCW      + CYDADILAGF+
Sbjct  228   SHTLSTAGGNFVANASVFGNGNGTASGGSPKARVAAYKVCW------DGCYDADILAGFE  281

Query  1646  RAIEDGVDVLSVSLG-GDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
              AI DGVDVLSVSLG G     Y  +S++IGSFHAV N I+VVAS GN GPV  +V+N+ 
Sbjct  282   AAISDGVDVLSVSLGSGGLAQEYSQNSISIGSFHAVANNIIVVASGGNSGPVPSTVSNLE  341

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW +TV A+T+DR F S V+LGNKK   G S   L+LP  K YPL+SAA  +      +S
Sbjct  342   PWTLTVAASTIDRDFTSYVILGNKKILKGASLSELELPPHKLYPLISAADVKFD---HVS  398

Query  1289  TQDA------------LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMIL  1146
              +DA            L C  G LDP K KGK+LVCL+G+++R++K  EA+  GA+GMIL
Sbjct  399   AEDADCFKMTISFFLVLFCNHGALDPHKAKGKILVCLRGDSNRVDKGVEASRVGAIGMIL  458

Query  1145  ANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIA  966
             AND+ SG EII DAH LPA+HV++ DG  IF Y+N T++PVA+IT   T LGVK +P IA
Sbjct  459   ANDKGSGGEIIDDAHVLPASHVSFKDGDLIFKYVNNTKSPVAYITRVKTQLGVKASPSIA  518

Query  965   AFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPH  786
             AFSSRGPN ++P ILKPDI+APGVN+IAA++EA  P++N YDKR   F   SGTSMSCPH
Sbjct  519   AFSSRGPNRLDPSILKPDITAPGVNIIAAYSEAISPTENSYDKRRTPFITMSGTSMSCPH  578

Query  785   VAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPN  606
             VAG+VGLLK+++P WSPA I+SAIMTTAT + N G  + D     + TP AYGAGH+ PN
Sbjct  579   VAGLVGLLKSIHPDWSPAAIKSAIMTTATTKNNIGGHVLDSSQE-EATPNAYGAGHVRPN  637

Query  605   GAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK  426
              AADPGLVYDL +TDY+NF+C +GYN +++    G  Y CP   +L  FNYP+ITVP +K
Sbjct  638   LAADPGLVYDLNITDYLNFLCGRGYNSSQLKLFYGRSYTCPKSFNLIDFNYPAITVPDIK  697

Query  425   --GTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGE  255
                   VTRT+ NVGSP+ Y   +++P    V+VNP+ L F+K GE++ FKVTL   KG 
Sbjct  698   IGQPLNVTRTVTNVGSPSKYRVLIQAPAELLVSVNPRRLNFKKKGEKREFKVTLTLKKGT  757

Query  254   NATADYAFGVLTWSDKKHRVRSPIVVK  174
                 DY FG L W+D KH+V +PI +K
Sbjct  758   TYKTDYVFGKLVWNDGKHQVGTPIAIK  784



>ref|XP_004951554.1| PREDICTED: subtilisin-like protease-like isoform X2 [Setaria 
italica]
Length=780

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/725 (58%), Positives = 523/725 (72%), Gaps = 13/725 (2%)
 Frame = -2

Query  2336  SHHQLLGTYLG-SWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNRARQ  2160
             +H++LL   LG   +KARDAIFYSYT+HINGFAA L+   AAEIA+ P VISVF NR R+
Sbjct  62    AHYELLAGVLGGDKEKARDAIFYSYTKHINGFAANLDAATAAEIARQPGVISVFPNRGRK  121

Query  2159  LQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGPIPK  1980
             L TTRSW+FLGL G GGV H G+ WKKAKFG DTIIGN DTGVWPES+SF ++G GP+P 
Sbjct  122   LHTTRSWQFLGLAGPGGVPHGGA-WKKAKFGADTIIGNFDTGVWPESESFRDDGLGPVPS  180

Query  1979  RWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLSTAGG  1800
             +WKG C   +D  F CNRKLIGARYF +GY+SA G LN+S  TPRD+ GHG+HTLSTA G
Sbjct  181   QWKGACDKGQDDKFSCNRKLIGARYFNKGYASAAGVLNASMNTPRDMDGHGTHTLSTAAG  240

Query  1799  NFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDGVDV  1620
             + VPGA+VFG GNGTA GGSP ARVAAY+VC+PP + G +C+DADILA FD AI DGV V
Sbjct  241   SPVPGASVFGFGNGTASGGSPHARVAAYRVCFPPIN-GSECFDADILAAFDAAIHDGVHV  299

Query  1619  LSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVGANT  1440
             LS+SLGGD P  YF+D +AIGSFHAV+ GI VV SAGN GP  G+ +N+APWL T GA+T
Sbjct  300   LSLSLGGD-PSNYFDDGIAIGSFHAVRRGIAVVCSAGNSGPGLGTASNLAPWLFTTGAST  358

Query  1439  MDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHCKPG  1260
             MDR F S +V  N     G+S     LP  K YPL+ +A A     A+ +T+DA  C  G
Sbjct  359   MDREFPSYIVF-NHTKAKGQSLSITNLPE-KSYPLIDSAKAGA---ANATTKDAQLCMIG  413

Query  1259  TLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPATHV  1080
              LDP+KVKGK++VCL+G N R+ K      AG VGM+LAND  +GNEIIADAH LPAT +
Sbjct  414   ALDPKKVKGKIVVCLRGINARVAKGEAVKQAGGVGMVLANDASTGNEIIADAHVLPATQI  473

Query  1079  TYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDISAP  900
              YSDGL ++ Y+N T+NP   IT P T+LG KPAP +AAFSS+GPN I P+ILKPDI+AP
Sbjct  474   KYSDGLLLYSYLNSTKNPTGFITKPATVLGTKPAPFMAAFSSQGPNTITPEILKPDITAP  533

Query  899   GVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRS  720
             GV+VIAA+T +  P+D  +D R V+FN ESGTSMSCPHV+G+VGLL+TL+P WSPA I+S
Sbjct  534   GVSVIAAWTRSNSPTDLAFDLRRVAFNSESGTSMSCPHVSGIVGLLRTLHPEWSPAAIKS  593

Query  719   AIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICA  540
             AIMTTA    N G+ I  + + L ++PF YGAGH++P  A +PGLVYDL   DY++F+CA
Sbjct  594   AIMTTAMEMDNKGELIL-NASSLPSSPFGYGAGHVSPARAMNPGLVYDLGDADYLDFLCA  652

Query  539   QGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLKGT-ATVTRTLKNVGSPATYT  369
               YN T +    G PY CP      ++  NYPSITV ++    AT  R +KNVG P TY 
Sbjct  653   LKYNATVMAMFNGAPYTCPGEAPRRVADLNYPSITVVNVTAAGATARRRVKNVGRPGTYW  712

Query  368   ASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRS  189
             A V  P G +V+V P +L+F   GEE+ F+V+ + K      DY+FG L W++ K  VRS
Sbjct  713   AFVVEPAGVAVSVTPNVLEFRAKGEEKGFEVSFQVKNAALAKDYSFGALVWTNGKQFVRS  772

Query  188   PIVVK  174
             P+VVK
Sbjct  773   PLVVK  777



>ref|XP_002530613.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF31756.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=726

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/728 (59%), Positives = 519/728 (71%), Gaps = 47/728 (6%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D  RV+ SH++LL +   S +KA+D IFYSYTR+INGFAA+LEEEEA E+A++P+V+SVF
Sbjct  44    DYKRVEDSHYELLDSLTTSKEKAKDKIFYSYTRNINGFAAVLEEEEAEELARHPDVVSVF  103

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+AR+L TT SW FLGLE +G +  D S+W KA+FGED IIGNLDTGVWPESK FS+EG
Sbjct  104   LNKARKLHTTHSWSFLGLERDGLIPVD-SLWIKARFGEDVIIGNLDTGVWPESKCFSDEG  162

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GPIP  W+GICQ +      CNRKLIGARYF +GY++ VGPLNS++ T RD  GHG+HT
Sbjct  163   MGPIPSNWRGICQ-EGTSGVRCNRKLIGARYFNKGYAAFVGPLNSTYHTARDNSGHGTHT  221

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFV GANVFG GNGTAKGGSP ARVAAYKVCWPP +   +C+DADI+AGF+ AI
Sbjct  222   LSTAGGNFVKGANVFGNGNGTAKGGSPGARVAAYKVCWPPVNGSGECFDADIMAGFEAAI  281

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG+    +F D ++IG+F AVK GIVVVASAGN GP   +V+NVAPWLI
Sbjct  282   SDGVDVLSVSLGGE-AADFFEDPISIGAFDAVKKGIVVVASAGNSGPDPFTVSNVAPWLI  340

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F S V LGNKKH  G S     LP  KFYPL++   A+      +S  DA
Sbjct  341   TVGASTMDRDFTSYVALGNKKHLKGTSLSQKVLPAEKFYPLITGEEAKFN---DVSAVDA  397

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C PG+LDP+KVKGK++VCL+GEN R++K  +A LAGAVGMILANDE SGNEIIAD H 
Sbjct  398   GLCMPGSLDPKKVKGKIVVCLRGENGRVDKGEQAFLAGAVGMILANDEKSGNEIIADPHV  457

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA HV Y+DG A+F Y+N TR PVA +T   T L  KPAP +AAFSSRGPN I   ILK
Sbjct  458   LPAAHVNYTDGEAVFAYVNSTRVPVAFMTRVRTQLESKPAPFMAAFSSRGPNGIERSILK  517

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PD++APGV++IA FT A GP++  +DKR +SFN +SGTSMSCPHV+G+ GLLKTL+P WS
Sbjct  518   PDVTAPGVSIIAGFTLAVGPTEEVFDKRRISFNSQSGTSMSCPHVSGISGLLKTLHPDWS  577

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSA+MT+A  R N+ + + D  +  K TPF YGAGH+ P+ A DPGL         
Sbjct  578   PAAIRSALMTSARTRDNNMEPMLDS-SNRKATPFDYGAGHVRPDQAMDPGL---------  627

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  378
                                            T    S  V  +  T T+TR +KNVGSP 
Sbjct  628   -------------------------------TSTTLSFVVADINTTVTLTRKVKNVGSPG  656

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
              Y A V+ PVG SV+V PK L+F+K+GEE+ FKVT K K  +   DY FG L WSD KH 
Sbjct  657   KYYAHVKEPVGVSVSVKPKSLEFKKIGEEKEFKVTFKTKKASEPVDYVFGRLIWSDGKHY  716

Query  197   VRSPIVVK  174
             VRSP+VVK
Sbjct  717   VRSPLVVK  724



>ref|XP_006469398.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=642

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/626 (64%), Positives = 493/626 (79%), Gaps = 8/626 (1%)
 Frame = -2

Query  2039  TGVWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSS  1860
             +GVWPESKSFS+EG GPIP +WKGIC+N KD  F CNRKLIGARYF +GY++AVGPLNSS
Sbjct  23    SGVWPESKSFSDEGLGPIPSKWKGICENDKDAKFLCNRKLIGARYFNKGYAAAVGPLNSS  82

Query  1859  FFTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED  1680
             F TPRD  GHG+HTLSTAGGNFV  A+VFGLG GTAKGGSPKARVAAYKVCWPP + G +
Sbjct  83    FDTPRDKDGHGTHTLSTAGGNFVAKASVFGLGKGTAKGGSPKARVAAYKVCWPPVT-GNE  141

Query  1679  CYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEG  1500
             CYDADILA FD AI DGVDVLSVSLGG  P  +FNDS AIGSFHAVK+G+VV+ SAGN G
Sbjct  142   CYDADILAAFDMAIHDGVDVLSVSLGGG-PSKFFNDSTAIGSFHAVKHGMVVICSAGNSG  200

Query  1499  PVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAAS  1320
             P   +V+N+APW ITVGA+TMDR F S VV+ N K Y G+S     LP  K +PL+SAA 
Sbjct  201   PTDSTVSNIAPWQITVGASTMDRDFPSYVVVSNNKRYKGQSLSSKGLPRNKLFPLISAAD  260

Query  1319  ARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILAN  1140
             A+    A+ ST+ AL C+ GTLDP+KVKGK+LVCL+G+N RI+K  +A LAGAVGM+LAN
Sbjct  261   AK---AANASTEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLAN  317

Query  1139  DEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAF  960
               ++GNE++AD H LPA+HV Y+DG  +F Y+N T+ PV ++T   T LG+KPAP++AAF
Sbjct  318   ALENGNELLADPHLLPASHVNYTDGADLFRYVNSTKRPVGYLTRATTELGLKPAPIMAAF  377

Query  959   SSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVA  780
             SS+GP++I P+ILKPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCPHV+
Sbjct  378   SSKGPSSIAPEILKPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCPHVS  437

Query  779   GVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGA  600
             G+VGLLKTL+P WSPA I+SAIMTTA+++ N+   I  + +  K TPF+YGAGHI PN A
Sbjct  438   GIVGLLKTLHPEWSPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQPNLA  496

Query  599   ADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT  420
              DPGLVYDL   DY+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L G+
Sbjct  497   MDPGLVYDLTENDYLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKLSGS  556

Query  419   ATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATA  243
               V+RT++NVGSP TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   AT 
Sbjct  557   IIVSRTVRNVGSPGTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRAATK  616

Query  242   DYAFGVLTWS-DKKHRVRSPIVVKTA  168
             DY FG L W+ DK+H+VRSPIVV  A
Sbjct  617   DYVFGDLVWADDKQHQVRSPIVVNPA  642



>ref|XP_008462020.1| PREDICTED: subtilisin-like protease isoform X2 [Cucumis melo]
Length=655

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/667 (62%), Positives = 495/667 (74%), Gaps = 25/667 (4%)
 Frame = -2

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
             R + L+ T   E L L         G  W    FG++  IG     VW ESKSFS++  G
Sbjct  11    RKQDLEKTPLLETLIL---------GKFW----FGKNGKIG-----VWAESKSFSDDEMG  52

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLS  1812
             PIP RWKGICQNQ D SFHCNRKLIGARYF +GY+S VGPLNSSF +PRD  GHGSHTLS
Sbjct  53    PIPHRWKGICQNQNDPSFHCNRKLIGARYFNKGYASVVGPLNSSFHSPRDKEGHGSHTLS  112

Query  1811  TAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIED  1632
             TAGGNFV GA+VFGLG GTAKGGSP+ARVAAYKVCWPP + G +C+DADILA FD AI D
Sbjct  113   TAGGNFVAGASVFGLGKGTAKGGSPRARVAAYKVCWPPKA-GNECFDADILAAFDLAIHD  171

Query  1631  GVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITV  1452
             GVDVLSVSLGGD P P FNDS+AIGSFHA+K+GIVV+ SAGN GP AG+V NVAPW ITV
Sbjct  172   GVDVLSVSLGGD-PNPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQITV  230

Query  1451  GANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALH  1272
             GA+TMDR+F S VVLGNKK   GES     LP+ K YPL++AA  R+   A+ S  +A  
Sbjct  231   GASTMDRKFPSLVVLGNKKQIEGESLSQEALPSKKLYPLMNAADVRL---ANASAHEAQL  287

Query  1271  CKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLP  1092
             CK GTLDP K KGK+LVCL+G+N R++K  +A LAGA GMILAN+E SGNEI+AD H LP
Sbjct  288   CKAGTLDPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVLP  347

Query  1091  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  912
             A H+ Y+DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKPD
Sbjct  348   ALHINYTDGSAVFAYINSTKFPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPD  407

Query  911   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  732
             I+APG++VIAA+TEA GP++ ++D R V FN  SGTSMSCPHV+G+ GLL+TLYP WSPA
Sbjct  408   ITAPGLSVIAAYTEAEGPTNQEFDNRRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSPA  467

Query  731   EIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVN  552
              I+SAIMTTA+   N+ + +  + +    TPF YGAGH++PNGA DPGLVYD+ + +Y++
Sbjct  468   AIKSAIMTTASTLDNNFEPLL-NASYFVATPFNYGAGHVHPNGATDPGLVYDIDVNEYLS  526

Query  551   FICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  372
             F+CA GY+K +I+     P+ C + ISL+  NYPSITVP L  + T+TR LKNVGSP TY
Sbjct  527   FLCALGYDKAQISQFSDGPFNCSEPISLTNLNYPSITVPKLSRSITITRRLKNVGSPGTY  586

Query  371   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHRV  195
              A +R P G SV V PK L F K+GEE SFKV +K KG   A  +Y +G L WSD KH V
Sbjct  587   EAKIRKPAGISVWVKPKKLNFTKLGEELSFKVFMKVKGHKVAKKNYVYGDLIWSDGKHHV  646

Query  194   RSPIVVK  174
             RSPIVVK
Sbjct  647   RSPIVVK  653



>ref|XP_006398487.1| hypothetical protein EUTSA_v10001201mg [Eutrema salsugineum]
 gb|ESQ39940.1| hypothetical protein EUTSA_v10001201mg [Eutrema salsugineum]
Length=763

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/732 (59%), Positives = 531/732 (73%), Gaps = 17/732 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L RV  SHH+LLG++LGS DKARDAIFYSY RHINGFAA+LEEEEAA I+K+P VISVF 
Sbjct  44    LARVAESHHELLGSFLGSLDKARDAIFYSYNRHINGFAAILEEEEAAAISKHPSVISVFP  103

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             ++ ++L TT SWEF+ +E +G V+   S+W KA+FGEDTIIGNLDTGV  +S+SFS EG 
Sbjct  104   DKGKKLHTTHSWEFMQMEKDG-VVPSSSLWSKARFGEDTIIGNLDTGVNSQSQSFSAEGL  162

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             GP+P RWKG C    D    CNRKLIGARYF +GY +  G   NSS+ +  D  GHG+HT
Sbjct  163   GPVPSRWKGSCDTSGD--VRCNRKLIGARYFNKGYLAHTGLKSNSSYESAHDNAGHGTHT  220

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+FVPGA+V+G+ NGTAKGGSP +RVA+YKVCWPP   G +C++AD+LA FD AI
Sbjct  221   LSTAGGHFVPGASVYGIRNGTAKGGSPLSRVASYKVCWPPVE-GSECFEADVLAAFDMAI  279

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLS+SLGG  P  YFND +AIGSFHAVK+GI VV SAGN GPV  +V+NVAPW++
Sbjct  280   HDGVDVLSISLGG-RPSDYFNDGIAIGSFHAVKHGITVVCSAGNSGPVPATVSNVAPWIL  338

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGES-AVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             TV A+T+DR FQS V L N + + G S + PL++   K Y L++ A A++   A+ S  D
Sbjct  339   TVAASTLDREFQSFVKLANGERFRGVSMSKPLQVE--KMYSLITGAQAKL---ANASAVD  393

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A+ CK GTLDP K KGK++VCL+G+  R+ K  +AALAGAV MIL ND+  G++I AD H
Sbjct  394   AMLCKEGTLDPHKAKGKIMVCLRGDTSRVGKGRQAALAGAVAMILCNDKAFGDDITADHH  453

Query  1100  FLPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             FLPAT + + DG A+F Y+N T  +P+  +T P    G+KPAP +A FSS+GPN+I P I
Sbjct  454   FLPATQINFLDGQAVFSYVNTTYLDPMGSLTAPGAAFGIKPAPYMADFSSQGPNSITPGI  513

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPD++APGVN+IAA+T     S  + D R   F   SGTSMSCPHVAG+VGLLKT++PS
Sbjct  514   LKPDVTAPGVNIIAAYTRKQSLSGLESDPRTTPFITLSGTSMSCPHVAGLVGLLKTMHPS  573

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA IRSAIMTTA  R N    + +    +K   F YG+GHI PN A DPGLVYDL + 
Sbjct  574   WSPAAIRSAIMTTARTRDNRMSPMLNGSY-VKANSFNYGSGHIRPNRAGDPGLVYDLTVH  632

Query  563   DYVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             D+++F+CA GYN+T I     +P YKCP   S+   NYPSITVP+L G  TVTR LKNVG
Sbjct  633   DHLDFLCAVGYNQTMIKLFSESPSYKCPKEASVLDLNYPSITVPNLSGAVTVTRKLKNVG  692

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             S  TY A VR P G SV V P  L+FE+VG+ +SFK+TLK K     +   FG LTWSD 
Sbjct  693   SAGTYMARVREPYGVSVRVEPSALEFERVGQVKSFKMTLKPKWSAKGS--VFGGLTWSDG  750

Query  206   KHRVRSPIVVKT  171
             KH VRSPIVV T
Sbjct  751   KHYVRSPIVVST  762



>ref|XP_003608829.1| Subtilisin-like serine protease [Medicago truncatula]
Length=783

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/737 (58%), Positives = 536/737 (73%), Gaps = 20/737 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ LLG+YLGS +KA++AIFYSY R+INGFAA+L+E+EAA+++K+P V+S+F
Sbjct  55    DIESATNSHYDLLGSYLGSTEKAKEAIFYSYNRYINGFAAILDEDEAAQLSKHPNVVSIF  114

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN   +L TTRSW+FLGLE  GG   D S+WK++  GED IIGNLD+GVWPESKSFS+EG
Sbjct  115   LNEKYELYTTRSWDFLGLERGGGFPKD-SLWKRS-LGEDIIIGNLDSGVWPESKSFSDEG  172

Query  1997  FGPIPKRWKGICQNQKDK--SFHCNRKLIGARYFIQGYSSAVGPL---NSSFFTPRDVIG  1833
             +GPIPK+W G CQ  K    +FHCNRKLIGARYF +GY +   P+   N +F + RD  G
Sbjct  173   YGPIPKKWHGTCQTTKGNPDNFHCNRKLIGARYFNKGYLAVPIPIRNPNETFNSARDFEG  232

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFV  A+VFG GNGTA GGSPKARVAAYKVCW      + C DADILAG
Sbjct  233   HGSHTLSTAGGNFVANASVFGNGNGTASGGSPKARVAAYKVCW-----DDGCQDADILAG  287

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLG + P  + N S++IGSFHAV N I+VVA+ GN GP   +V N+
Sbjct  288   FEAAISDGVDVLSVSLGRNIPVEFHNSSISIGSFHAVANNIIVVAAGGNSGPSPNTVANL  347

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
              PW +TV A+T+DR F S V+LGNKK + GES    +LP  K YPL+SAA A+      +
Sbjct  348   EPWTLTVAASTIDRDFTSYVILGNKKIFKGESLSEHELPPHKLYPLISAADAKFD---HV  404

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +AL C  G+LD  K KGK+LVCL G N R++K  EA+  GAVGMILAND+ SG EII
Sbjct  405   SAGEALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEII  464

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
              DAH LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + 
Sbjct  465   PDAHVLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILA  524

Query  932   PDILK-PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
             P ILK PDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK+
Sbjct  525   PSILKVPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKS  584

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             ++P WSPA I+SAIMTTAT + N G  +  D +  + TP AYGAGH+ PN AADPGLVYD
Sbjct  585   IHPDWSPAAIKSAIMTTATTKDNIGGHVL-DSSQEEATPHAYGAGHVRPNLAADPGLVYD  643

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRT  402
             L +TDY+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT
Sbjct  644   LNITDYLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRT  703

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGV  225
             + NVGSP+ Y   +++P  F V+V P+ L F+K GE++ FKVTL   KG     DY FG 
Sbjct  704   VTNVGSPSKYRVHIQAPAEFLVSVEPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGK  763

Query  224   LTWSDKKHRVRSPIVVK  174
             L W+D KH+V +PI +K
Sbjct  764   LVWTDGKHQVGTPIAIK  780



>ref|XP_004957134.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=808

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/742 (57%), Positives = 531/742 (72%), Gaps = 23/742 (3%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             R + SH++LLG+ L S  +ARDAIFYSYTR+INGFAA LEE+EAAE++++P V+SVF NR
Sbjct  59    RARRSHYELLGSVLRSEARARDAIFYSYTRYINGFAATLEEDEAAEVSRHPRVVSVFPNR  118

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSWEFLG+E EGG +  GSIW KA+FGE  +IGNLDTGVWPE+ SFS++G GP
Sbjct  119   GHRLHTTRSWEFLGMEEEGGRVRPGSIWAKARFGEGVVIGNLDTGVWPEAGSFSDDGMGP  178

Query  1988  IPKRWKGICQNQK---DKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              P RW+GICQ+Q+   D    CNRKLIGAR+F +GY + VG    +  + RD  GHG+HT
Sbjct  179   APARWRGICQDQQASDDAQVRCNRKLIGARFFDKGYLATVGQDQVNPASTRDTDGHGTHT  238

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA G FVPGA++FG GNGTAKGG+P+A  AAYKVCW P + G +C+DADI+A FD AI
Sbjct  239   LSTAAGRFVPGASIFGYGNGTAKGGAPRAHAAAYKVCWRPVN-GSECFDADIVAAFDAAI  297

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGV VLSVSLGG  P  YF D +AIGSFHA ++G+ VV SAGN GP AG+V+N APWL+
Sbjct  298   HDGVHVLSVSLGGS-PAEYFRDGVAIGSFHAARHGVTVVCSAGNSGPAAGTVSNTAPWLL  356

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T+DR F + +VL N K   G+S  P +LP  K+Y L+S+  A+  +NA+ +TQ  
Sbjct  357   TVGASTVDREFPAYLVLDNNKRIKGQSLSPTRLPGSKYYQLISSEEAK-GVNAT-ATQAK  414

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L C  G+LD  KVKGK++VC++G+N R+EK      AG VG++LANDE SGNE+IADAH 
Sbjct  415   L-CIEGSLDKAKVKGKIVVCIRGKNARVEKGEAVRRAGGVGLVLANDEASGNEVIADAHV  473

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATH+TY+DG+A+  Y+N TR+   +IT P T L  KPAP +AAFSS+GPN + P ILK
Sbjct  474   LPATHITYTDGVALLAYLNSTRSASGYITVPYTALDTKPAPFMAAFSSQGPNTVTPQILK  533

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV+++AAFT   GP+   +D+R V FN ESGTSMSCPHVAGV GLLK L+P WS
Sbjct  534   PDITAPGVSILAAFTGLAGPTGLPFDERRVLFNAESGTSMSCPHVAGVAGLLKALHPDWS  593

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA V+ N  K ++ + + L+ TPF YGAGH+ PN AADPGLVYD   TDY
Sbjct  594   PAAIKSAIMTTARVQDNMRKPMS-NSSFLRATPFGYGAGHVQPNRAADPGLVYDADATDY  652

Query  557   VNFICAQGYNKTEITAVLG------TPYKCPDHISL-STFNYPSITVPHLKGTA---TVT  408
             + F+CA GYN + I A         T Y CP         NYPS+ VPHL  T    TVT
Sbjct  653   LGFLCALGYNSSAIAAFTAGDGDGHTHYSCPARAPRPEDLNYPSVAVPHLSPTGAAHTVT  712

Query  407   RTLKNVGS-PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYA  234
             R ++NVG+  A Y A V  P G  V V P+ L+F   GEE+ F VT +A+ G     +Y 
Sbjct  713   RRVRNVGAGAAAYDARVHEPRGVEVDVRPRRLEFAAAGEEKQFTVTFRAREGSFWPGEYV  772

Query  233   FGVLTWSDKK--HRVRSPIVVK  174
             FG L WSD    HRVRSP+VV+
Sbjct  773   FGRLVWSDGAGGHRVRSPLVVR  794



>ref|XP_009759335.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana sylvestris]
Length=776

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/736 (57%), Positives = 518/736 (70%), Gaps = 15/736 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L RV   H   L  +LG  DKA+++IFYSY R INGFAA LEE+  A I  +P+VISVF 
Sbjct  48    LQRVSDFHINFLAAFLGGKDKAKESIFYSYRRRINGFAADLEEKFVALIQLHPKVISVFP  107

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N  R+L T  SW+FL LE + GV+  GS+W+KAKFG+D IIGNLDTGVWPE+ SF++EG+
Sbjct  108   NERRELHTFHSWDFLSLE-DNGVVTSGSLWEKAKFGQDIIIGNLDTGVWPENPSFNDEGY  166

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF--TPRDVIGHGSH  1821
             GPIP RWKG CQN     F CNRKLIGARYF +GY    G  N+S    +PRD  GHG+H
Sbjct  167   GPIPSRWKGECQNDDKVPFSCNRKLIGARYFHKGYDDLRGNNNTSNIPNSPRDTEGHGTH  226

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTA GNF P A+V G+ NGTAKGG+PKARVAAYKVCWP    G  C+DADIL  FD A
Sbjct  227   TLSTAAGNFAPKASVIGVYNGTAKGGAPKARVAAYKVCWP-AKQGGGCFDADILKAFDFA  285

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I+DGVDV+S S+GG  P PYF D+ AIG+FHA+K GIVVV SAGN GP+  +V N+APW+
Sbjct  286   IDDGVDVISASVGG-KPRPYFRDAAAIGAFHAMKEGIVVVTSAGNSGPMLSTVGNIAPWM  344

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             ITVGA+T+DR F+SNV L N     G S +   LP  KFYPL++   A+    A+ +  D
Sbjct  345   ITVGASTIDREFESNVKLQNGLTIKGTS-ISYPLPEEKFYPLINGEQAK---TANATVGD  400

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  CK  TLD  KVKG++LVCL+G N R++K H+A + GAVGMIL ND+ SGN+IIAD H
Sbjct  401   AKLCKQATLDASKVKGRILVCLRGNNTRVDKGHQAVMGGAVGMILCNDQTSGNDIIADVH  460

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+H+TY+DGLA+F YIN T N +  IT P   LG+KPAP +A+FSSRGPN I P IL
Sbjct  461   LLPASHITYNDGLAVFAYINSTNNAMGSITAPKATLGIKPAPTMASFSSRGPNLITPAIL  520

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN+IAA+TE   PS+  +D R  ++NV SGTSMSCPHV+G+VGLLK ++P W
Sbjct  521   KPDITAPGVNIIAAYTEGNNPSNEVFDNRRTAYNVMSGTSMSCPHVSGIVGLLKAIHPDW  580

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA IRSA+MTTA+   N+GK +  D T    TPFA GAG I PN A+DPGL+YDL++ D
Sbjct  581   SPAAIRSALMTTASPIDNTGKPLL-DTTKEAATPFACGAGPIRPNLASDPGLIYDLEVDD  639

Query  560   YVNFICAQGYNKTEITAVLGTPYKCP--DHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             Y+NF+CA GY+   I      PY CP   + SL  FNYPSITVP L G   VTRTL NVG
Sbjct  640   YLNFLCASGYDSQVIRTFNKAPYICPPLSNSSLLEFNYPSITVPALSGNLIVTRTLTNVG  699

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATA---DYAFGVLTW  216
              P T+TA V  P G SV V P +L F+  G+++ F + +KA      A    + +G L W
Sbjct  700   PPGTFTARVGQPPGISVVVEPNVLIFKSQGQKERFSLHIKAVNTTYLAGVDQHKYGELVW  759

Query  215   SDKKHRVRSPIVVKTA  168
             SD  H VRSPI V+ A
Sbjct  760   SDGTHTVRSPITVEIA  775



>ref|XP_010251263.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=771

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/731 (57%), Positives = 523/731 (72%), Gaps = 14/731 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DLDR++ SH++ LG++LGS +KA+DAIFYSYTRHINGFAA LE+EEA +I+K+PEV+SV
Sbjct  48    IDLDRIEDSHYEFLGSFLGSKEKAKDAIFYSYTRHINGFAADLEDEEAEQISKHPEVVSV  107

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FL++  +L TTRSW+FL +E   G I   SIW KA+FGED II NLD+GVWPES+SF ++
Sbjct  108   FLDKGNKLHTTRSWDFLRME-RNGSIPSKSIWVKARFGEDVIIANLDSGVWPESESFDDK  166

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GP+P RW+G CQN  +    CNRKLIGARYF +GYS+     N    + RD  GHG+H
Sbjct  167   GMGPVPSRWRGFCQNNTEVGVRCNRKLIGARYFNKGYSTR---FNGLLPSARDYNGHGTH  223

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDAD-ILAGFDR  1644
             TLSTAGG FV GANV G GNGTAKGGSP ARVAAYKVCWP             +LAGFD 
Sbjct  224   TLSTAGGGFVAGANVLGHGNGTAKGGSPNARVAAYKVCWPTGDSSSSDCSDGDVLAGFDA  283

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLS+SLG      Y  DS+AIGSFHAVK G+VVV SAGN GP  GSVNNVAPW
Sbjct  284   AIHDGVDVLSISLG-QTATDYLTDSVAIGSFHAVKKGMVVVCSAGNTGPAWGSVNNVAPW  342

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITVGA+T+DR+F + VVL N   + G+S  P  LP  K YP++ +  A+     + +  
Sbjct  343   IITVGASTIDRQFSTYVVLRNNLRFKGQSLSPDSLPAEKMYPVIRSVDAKA---GNATEH  399

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  C  G+LDP+  KGK+LVCL+G N R+EK      AG +GM+L ND  SG E I DA
Sbjct  400   DAESCVIGSLDPKMAKGKILVCLRGTNPRVEKGKAVMDAGGIGMVLVNDITSGYETIPDA  459

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LP +H++ +DGL++F YIN T++PVA+I+   T L VKPAP +A+FSS+GPN++ P+I
Sbjct  460   HILPTSHISAADGLSLFSYINSTQSPVAYISPATTELDVKPAPTVASFSSQGPNSVTPEI  519

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPD+ APGV++IAAFT+ATGPSD  +D R V FN  SGTSM+CPHV+G+VGLLKTL+P 
Sbjct  520   LKPDVIAPGVSIIAAFTQATGPSDLPFDSRRVLFNSLSGTSMACPHVSGIVGLLKTLHPD  579

Query  743   WSPAEIRSAIMTTATVRANSGKAI--TDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             WSPA I+SA+MTTA  R N  + I  +   +G   TPF+ GAGH+ PN A DPGLVYD+ 
Sbjct  580   WSPAAIKSALMTTARNRDNMREHIHGSSQDSG---TPFSNGAGHVRPNRAMDPGLVYDVT  636

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNV  390
             + DY+ F+CA GY++  I       Y CP   SL  FNYP+I+VP L G+ ++TR +KNV
Sbjct  637   IQDYLYFLCALGYSEDLIAKFANEHYNCPKSTSLLEFNYPAISVPSLYGSVSLTRRVKNV  696

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             GSP  Y   +R P G SV V PK L F ++GEE+ ++VTLK K   +T +Y FG LTWSD
Sbjct  697   GSPGIYNVRIREPAGISVMVEPKRLIFNQMGEEKKYRVTLKIKEGGSTQNYVFGGLTWSD  756

Query  209   KKHRVRSPIVV  177
               H VRSPIVV
Sbjct  757   GVHYVRSPIVV  767



>dbj|BAC42673.1| putative subtilisin-like protease [Arabidopsis thaliana]
Length=756

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/698 (61%), Positives = 519/698 (74%), Gaps = 14/698 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LD V HSH   L +++GS + A++AIFYSY RHINGFAA+L+E EAAEIAK+P+V+SVF 
Sbjct  60    LDGVAHSHRTFLASFVGSHENAKEAIFYSYKRHINGFAAILDENEAAEIAKHPDVVSVFP  119

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW F+ L  + GV+H  S+W KA +GEDTII NLDTGVWPESKSFS+EG+
Sbjct  120   NKGRKLHTTHSWNFM-LLAKNGVVHKSSLWNKAGYGEDTIIANLDTGVWPESKSFSDEGY  178

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C     K   CNRKLIGARYF +GY +  G P N+S+ T RD  GHGSHT
Sbjct  179   GAVPARWKGRCH----KDVPCNRKLIGARYFNKGYLAYTGLPSNASYETCRDHDGHGSHT  234

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGANVFG+GNGTA GGSPKARVAAYKVCWPP   G +C+DADILA  + AI
Sbjct  235   LSTAAGNFVPGANVFGIGNGTASGGSPKARVAAYKVCWPPVD-GAECFDADILAAIEAAI  293

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
             EDGVDVLS S+GGD  G Y +D +AIGSFHAVKNG+ VV SAGN GP +G+V+NVAPW+I
Sbjct  294   EDGVDVLSASVGGD-AGDYMSDGIAIGSFHAVKNGVTVVCSAGNSGPKSGTVSNVAPWVI  352

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N + + G S +   LP  K Y L+SAA A +   A+ +  DA
Sbjct  353   TVGASSMDREFQAFVELKNGQSFKGTS-LSKPLPEEKMYSLISAADANV---ANGNVTDA  408

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK G+LDP+KVKGK+LVCL+G+N R++K  +AA AGA GM+L ND+ SGNEII+DAH 
Sbjct  409   LLCKKGSLDPKKVKGKILVCLRGDNARVDKGMQAAAAGAAGMVLCNDKASGNEIISDAHV  468

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN I P ILK
Sbjct  469   LPASQIDYKDGETLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNTITPGILK  528

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVN+IAAFTEATGP+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P WS
Sbjct  529   PDITAPGVNIIAAFTEATGPTDLDSDNRRTPFNTESGTSMSCPHISGVVGLLKTLHPHWS  588

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTT+  R N  K + D+ +  K  PF+YG+GH+ PN AA PGLVYDL   DY
Sbjct  589   PAAIRSAIMTTSRTRNNRRKPMVDE-SFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGDY  647

Query  557   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GYN T +      P Y C    +L  FNYPSITVP+L G+ TVTR LKNVG P
Sbjct  648   LDFLCAVGYNNTVVQLFAEDPQYTCRQGANLLDFNYPSITVPNLTGSITVTRKLKNVGPP  707

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK  267
             ATY A  R P+G  V+V PK L F K GE + F++TL+
Sbjct  708   ATYNARFREPLGVRVSVEPKQLTFNKTGEVKIFQMTLR  745



>ref|XP_007049441.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOX93598.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=624

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/628 (65%), Positives = 486/628 (77%), Gaps = 6/628 (1%)
 Frame = -2

Query  2057  IIGNLDTGVWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAV  1878
             ++  +  GVWPESKSFS++G+GPIP +WKGICQN KD  FHCNRKLIGARYF +GY+S V
Sbjct  1     MLNGIVLGVWPESKSFSDDGYGPIPSKWKGICQNDKDDGFHCNRKLIGARYFNKGYASIV  60

Query  1877  GPLNSSFFTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPP  1698
             G LNSSF TPRD  GHG+HTLSTAGGN V  A+V G G GTAKGGSP+ARVAAYKVCWPP
Sbjct  61    GKLNSSFDTPRDKEGHGTHTLSTAGGNLVAKASVLGFGKGTAKGGSPRARVAAYKVCWPP  120

Query  1697  TSPGEDCYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVA  1518
              S G++C+DADILA FD AI DGVDVLSVSLGGD P P+FNDS+AIGSFHA+K+GIVVV 
Sbjct  121   VS-GDECFDADILAAFDVAIHDGVDVLSVSLGGD-PTPFFNDSVAIGSFHAIKHGIVVVC  178

Query  1517  SAGNEGPVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYP  1338
             SAGN GP  G+V N+APW ITVGA+TMDR F S VVLGN   Y G+S     LP  KF+P
Sbjct  179   SAGNSGPAYGTVTNIAPWQITVGASTMDREFPSIVVLGNNMRYKGQSLSANDLPDKKFFP  238

Query  1337  LLSAASARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAV  1158
             L+SAA A+    A+ S ++AL C+ GT+DPEK  GK LVCL+G+N R++K  +AALAGAV
Sbjct  239   LISAADAK---AANASIENALLCQAGTIDPEKASGKFLVCLRGQNARVDKGQQAALAGAV  295

Query  1157  GMILANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPA  978
             GM+LAN+  +GNEIIADAH LPA+H+ Y+DGLA+F YIN T+ P A+IT   T +G KPA
Sbjct  296   GMVLANNILAGNEIIADAHVLPASHINYTDGLAVFTYINSTKYPTAYITPVTTQIGTKPA  355

Query  977   PVIAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSM  798
             P +AAFSS+GPN I P+ILKPDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSM
Sbjct  356   PFMAAFSSKGPNTITPEILKPDITAPGVSVIAAYTEAQGPTNEDFDKRRVQFNCVSGTSM  415

Query  797   SCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGH  618
             SCPHV+G+VGLLKTLYP WSPA I+SAIMT+AT   N  + I  + + +K  PF+YGAGH
Sbjct  416   SCPHVSGIVGLLKTLYPDWSPAAIKSAIMTSATTWDNMKEPIL-NASNIKAGPFSYGAGH  474

Query  617   INPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITV  438
             I PN A DPGLVYDL  TDY+NF+C  GYN+T I+     PYKCP  ISL+ FNYPSI V
Sbjct  475   IQPNLAMDPGLVYDLAATDYLNFLCTLGYNETLISMFSQNPYKCPKPISLANFNYPSIAV  534

Query  437   PHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG  258
             P+L G+ TVTRT+KNVGSP TY A V+ P G SV V PK LKF+KVGEE++F VTL    
Sbjct  535   PNLVGSITVTRTVKNVGSPGTYRAQVQRPTGISVQVKPKKLKFKKVGEEKTFSVTLNVMK  594

Query  257   ENATADYAFGVLTWSDKKHRVRSPIVVK  174
              +   +Y FG L WSD  H V SPIVVK
Sbjct  595   AHPVKEYVFGQLIWSDHVHHVSSPIVVK  622



>ref|XP_004951553.1| PREDICTED: subtilisin-like protease-like isoform X1 [Setaria 
italica]
Length=801

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/745 (57%), Positives = 524/745 (70%), Gaps = 32/745 (4%)
 Frame = -2

Query  2336  SHHQLLGTYLG-SWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNRARQ  2160
             +H++LL   LG   +KARDAIFYSYT+HINGFAA L+   AAEIA+ P VISVF NR R+
Sbjct  62    AHYELLAGVLGGDKEKARDAIFYSYTKHINGFAANLDAATAAEIARQPGVISVFPNRGRK  121

Query  2159  LQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGPIPK  1980
             L TTRSW+FLGL G GGV H G+ WKKAKFG DTIIGN DTGVWPES+SF ++G GP+P 
Sbjct  122   LHTTRSWQFLGLAGPGGVPHGGA-WKKAKFGADTIIGNFDTGVWPESESFRDDGLGPVPS  180

Query  1979  RWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLSTAGG  1800
             +WKG C   +D  F CNRKLIGARYF +GY+SA G LN+S  TPRD+ GHG+HTLSTA G
Sbjct  181   QWKGACDKGQDDKFSCNRKLIGARYFNKGYASAAGVLNASMNTPRDMDGHGTHTLSTAAG  240

Query  1799  NFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDGVDV  1620
             + VPGA+VFG GNGTA GGSP ARVAAY+VC+PP + G +C+DADILA FD AI DGV V
Sbjct  241   SPVPGASVFGFGNGTASGGSPHARVAAYRVCFPPIN-GSECFDADILAAFDAAIHDGVHV  299

Query  1619  LSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVGANT  1440
             LS+SLGGD P  YF+D +AIGSFHAV+ GI VV SAGN GP  G+ +N+APWL T GA+T
Sbjct  300   LSLSLGGD-PSNYFDDGIAIGSFHAVRRGIAVVCSAGNSGPGLGTASNLAPWLFTTGAST  358

Query  1439  MDRRFQSNVVLGNKK--------------------HYTGESAVPLKLPTGKFYPLLSAAS  1320
             MDR F S +V  + K                       G+S     LP  K YPL+ +A 
Sbjct  359   MDREFPSYIVFNHTKAKARNSSESPLARPPHKSLTKIKGQSLSITNLPE-KSYPLIDSAK  417

Query  1319  ARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILAN  1140
             A     A+ +T+DA  C  G LDP+KVKGK++VCL+G N R+ K      AG VGM+LAN
Sbjct  418   AGA---ANATTKDAQLCMIGALDPKKVKGKIVVCLRGINARVAKGEAVKQAGGVGMVLAN  474

Query  1139  DEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAF  960
             D  +GNEIIADAH LPAT + YSDGL ++ Y+N T+NP   IT P T+LG KPAP +AAF
Sbjct  475   DASTGNEIIADAHVLPATQIKYSDGLLLYSYLNSTKNPTGFITKPATVLGTKPAPFMAAF  534

Query  959   SSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVA  780
             SS+GPN I P+ILKPDI+APGV+VIAA+T +  P+D  +D R V+FN ESGTSMSCPHV+
Sbjct  535   SSQGPNTITPEILKPDITAPGVSVIAAWTRSNSPTDLAFDLRRVAFNSESGTSMSCPHVS  594

Query  779   GVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGA  600
             G+VGLL+TL+P WSPA I+SAIMTTA    N G+ I  + + L ++PF YGAGH++P  A
Sbjct  595   GIVGLLRTLHPEWSPAAIKSAIMTTAMEMDNKGELIL-NASSLPSSPFGYGAGHVSPARA  653

Query  599   ADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLK  426
              +PGLVYDL   DY++F+CA  YN T +    G PY CP      ++  NYPSITV ++ 
Sbjct  654   MNPGLVYDLGDADYLDFLCALKYNATVMAMFNGAPYTCPGEAPRRVADLNYPSITVVNVT  713

Query  425   GT-ATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA  249
                AT  R +KNVG P TY A V  P G +V+V P +L+F   GEE+ F+V+ + K    
Sbjct  714   AAGATARRRVKNVGRPGTYWAFVVEPAGVAVSVTPNVLEFRAKGEEKGFEVSFQVKNAAL  773

Query  248   TADYAFGVLTWSDKKHRVRSPIVVK  174
               DY+FG L W++ K  VRSP+VVK
Sbjct  774   AKDYSFGALVWTNGKQFVRSPLVVK  798



>ref|XP_002866352.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42611.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/729 (60%), Positives = 537/729 (74%), Gaps = 15/729 (2%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LD V HSH   L +++GS + A++AIFYSY RHINGFAA+L+E EAAEIAK+P+V+SV  
Sbjct  60    LDGVAHSHRTFLASFVGSHENAQEAIFYSYKRHINGFAAVLDENEAAEIAKHPDVVSVIP  119

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW F+ LE + GV+H  S+W KA +GEDTII NLDTGVWPESKSFS+EG+
Sbjct  120   NKGRKLHTTHSWNFMLLE-KNGVVHKSSLWNKAGYGEDTIIANLDTGVWPESKSFSDEGY  178

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C     K   CNRKLIGARYF +GY +  G P N+S  T RD  GHGSHT
Sbjct  179   GAVPARWKGRCH----KDVPCNRKLIGARYFNKGYLAYTGLPSNASLETCRDHDGHGSHT  234

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA GNFVPGANVFG+GNGTA GGSPKARVAAYKVCWPP + G +C+DADILA  D AI
Sbjct  235   LSTAAGNFVPGANVFGIGNGTASGGSPKARVAAYKVCWPPVN-GAECFDADILAAIDAAI  293

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
             +DGVDVLS S+GGD  G Y +D +AIGSFHAVKNG+ VV SAGN GP AG+V+NVAPW+I
Sbjct  294   DDGVDVLSASVGGD-AGDYMSDGIAIGSFHAVKNGVTVVCSAGNSGPKAGTVSNVAPWII  352

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N + + G S +   LP  K Y L+SA  A++   ++ +  DA
Sbjct  353   TVGASSMDREFQAFVELNNGQSFKGTS-LSKPLPEDKMYSLISAEEAKV---SNGNATDA  408

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK G+LDPEKVKGK++VCL+G+N R++K  +A  AGA GMIL ND+ SGNEII+DAH 
Sbjct  409   LLCKKGSLDPEKVKGKIVVCLRGDNARVDKGQQALAAGAAGMILCNDKASGNEIISDAHV  468

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y +G  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN+I P ILK
Sbjct  469   LPASQIDYKEGEVLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNSITPGILK  528

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVN+IAAFTEAT P+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P WS
Sbjct  529   PDITAPGVNIIAAFTEATSPTDLDSDHRRTPFNTESGTSMSCPHISGVVGLLKTLHPQWS  588

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTT+  R N  K + D+ +  K  PF+YG+GH+ PN AA PGLVYDL + DY
Sbjct  589   PAAIRSAIMTTSRTRDNRRKPMVDE-SFKKANPFSYGSGHVQPNKAAHPGLVYDLTIGDY  647

Query  557   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GYN T +      P Y C    +L  FNYPSITVP+L  + TVTR L NVG P
Sbjct  648   LDFLCAVGYNNTVVQLFAEDPQYMCRQGANLLDFNYPSITVPNLTDSITVTRKLTNVGPP  707

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             ATY A  R P+G SV+V PK L F K GE + F++TL+ K    +  Y FG LTW+D  H
Sbjct  708   ATYNAHFREPLGVSVSVEPKQLTFNKTGEVKIFQMTLRPKSAKPSG-YVFGELTWTDSHH  766

Query  200   RVRSPIVVK  174
              VRSPIVV+
Sbjct  767   YVRSPIVVE  775



>ref|XP_010942695.1| PREDICTED: subtilisin-like protease SBT5.3 [Elaeis guineensis]
Length=765

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/729 (58%), Positives = 526/729 (72%), Gaps = 17/729 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D  RV  SHH+ LG++LGS +KAR+ +FYSYT++INGFAA LEEEEA  I+K+PEVISVF
Sbjct  48    DYKRVTDSHHEFLGSFLGSKEKAREEMFYSYTKYINGFAATLEEEEAKRISKHPEVISVF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N A++LQTTRSW+ + +E   G +   SIW +A FG DTII NLDTGVWPES+SF++ G
Sbjct  108   ENTAKKLQTTRSWDLVAME-RNGRVPPQSIWAQANFGNDTIIANLDTGVWPESESFNDRG  166

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P RWKG CQN   +   CNRKLIGARYF +GY S  G +     + RD  GHGSHT
Sbjct  167   MGPVPSRWKGFCQNNTKEGVPCNRKLIGARYFYKGYESGSG-IKVVNGSARDTEGHGSHT  225

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA G FVPGAN+FG  NGTAKGGSP ARVAAYKVCW       DCY+ADI++ F+ AI
Sbjct  226   LSTAAGRFVPGANIFGHANGTAKGGSPHARVAAYKVCW------GDCYNADIISAFEAAI  279

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
             +DGVDV+S+SLGGD P  Y  DS+AIGS HAV NGI VV SAGN GP+ GSV NVAPW++
Sbjct  280   DDGVDVISLSLGGD-PTFYLEDSVAIGSLHAVANGITVVCSAGNSGPIPGSVTNVAPWIL  338

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+T+DR F + + LG+K    GES     LP  K YPL+S A A+    A++S  +A
Sbjct  339   TVGASTIDRDFLAFLTLGDKTQIKGESLASEVLPANKLYPLISGADAK---KANVSASEA  395

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C P +LDP KVKG ++ C++G+  R++K  E  +AG  GMIL ND+ +GN ++AD H 
Sbjct  396   DLCYPDSLDPNKVKGNIVACIRGDVARLDKGAEVLMAGGAGMILINDKTNGNSLLADPHL  455

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA  +TY DG A+  Y+N T++PVA+I+ P T LGVKPAP++AAFSS+GPN ++P ILK
Sbjct  456   LPAIMITYEDGFALRKYMNSTKSPVAYISAPKTELGVKPAPMMAAFSSQGPNLVSPQILK  515

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PD++APGV+++AAFT AT  +    D R V FN+ SGTSMSCPHV+GV GLLKTL+P WS
Sbjct  516   PDVTAPGVSILAAFTGATSATGLTLDNRYVPFNLMSGTSMSCPHVSGVAGLLKTLHPDWS  575

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGL-KTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             PA IRSAIMTTA  R N+G  + D   GL K TP  YG+GHI PN A DPGLV+DL  TD
Sbjct  576   PAAIRSAIMTTARSRDNTGSPMKD--YGLAKATPLEYGSGHIRPNRAMDPGLVFDLNFTD  633

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y++F+CA GYN T++ A     Y+CP   ++L   NYPSI  P++  T TVTRT+KNVGS
Sbjct  634   YLSFLCAFGYNSTQL-AQFKKGYQCPTTPMNLEDLNYPSIAAPNVTRTLTVTRTMKNVGS  692

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY   V  P G +VTV P+ILKF+KVGEE+ F+VTLK++  +    Y FG L WSD K
Sbjct  693   PGTYKVRVEPPYGITVTVKPEILKFDKVGEEKVFEVTLKSQEGSIGRGYQFGRLIWSDGK  752

Query  203   HRVRSPIVV  177
             H VR P+VV
Sbjct  753   HYVRIPLVV  761



>ref|XP_011039898.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=794

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/730 (55%), Positives = 521/730 (71%), Gaps = 10/730 (1%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D+  +  +H  LLGTYL S  K  D + YSYTR INGFAA+L+E + A +  NP V+S+
Sbjct  72    LDVKAMTKAHFDLLGTYLDSKQKVEDHMLYSYTRCINGFAAVLDEAQVAALNDNPGVVSI  131

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N+  ++ TT SW+FLG E + GV    S+ KKA FGED IIGNLD+GVWPESKSF +E
Sbjct  132   FENKENRMYTTHSWDFLGFE-KNGVPSLYSLQKKANFGEDIIIGNLDSGVWPESKSFDDE  190

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRD-VIGHGS  1824
             G GP+P +WKG C +       CN+KLIGARYF +G+++  GP+   + T RD   GHG+
Sbjct  191   GMGPVPSKWKGTCDD--GGGVTCNKKLIGARYFNKGFAANNGPVPEEWNTARDDASGHGT  248

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG++VPG NV+G+GNGTAKGG+PKARVA YKVCWP  + G  C DADILA +D 
Sbjct  249   HTLSTAGGSYVPGVNVYGVGNGTAKGGAPKARVATYKVCWPSANGG--CTDADILAAYDA  306

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDV+SVSLG + P  ++ D ++IGS HA+K GI V+A+ GN GP  GS+ N APW
Sbjct  307   AISDGVDVISVSLGSNEPLQFYEDGISIGSLHAIKKGIPVIAAGGNNGPSDGSITNGAPW  366

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             L T+GA+TMDR   + V LG+KK + G++     LP GK YPL++ A A +   A  + +
Sbjct  367   LFTIGASTMDREIFTTVTLGDKKLFKGKTLASKNLPDGKLYPLINGAEAAL---AEATPR  423

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  C  GTLDP KV GK+++CL+G++ R+ K +EA  AGAVGM+L ND  SG+E+  +A
Sbjct  424   DAQLCLDGTLDPNKVSGKIILCLRGQSPRLPKGYEAERAGAVGMVLVNDIISGDELYLEA  483

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             + LP+ H+TY+DG ++ DYI  TRNP A I+   T  GVKP+P +A FSSRGP+ I P +
Sbjct  484   YELPSAHITYADGESVMDYIKATRNPTASISPAITNFGVKPSPAMAKFSSRGPSKIEPAV  543

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+VIAAFTEA GPS   +DKR   + V SGTSMSCPHV+G+VGLL+ ++P 
Sbjct  544   LKPDITAPGVDVIAAFTEAMGPSRRPFDKRRTPYMVMSGTSMSCPHVSGIVGLLRAIHPD  603

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA ++SAIMTTA  ++N+ K +  D  G   TPF YGAGH+ PN AADPGLVYD  + 
Sbjct  604   WSPAALKSAIMTTAKTKSNNKKRML-DYDGQLATPFMYGAGHVQPNLAADPGLVYDTNVN  662

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             DY++F+CA GYNKT + A    PY CP++ S + FNYPSITVP LKG  TVTR +KNVG+
Sbjct  663   DYLSFLCAHGYNKTLLNAFSDGPYTCPENFSFADFNYPSITVPDLKGPVTVTRRVKNVGA  722

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TYT S+++P   SV V P  L+F++ GEEQ FK+T K   +    DY FG LTWSD  
Sbjct  723   PGTYTVSIKAPAKVSVVVEPSSLEFKQAGEEQLFKLTFKPIMDGMPKDYEFGHLTWSDGL  782

Query  203   HRVRSPIVVK  174
             HRV+SP+VVK
Sbjct  783   HRVKSPLVVK  792



>ref|XP_002299063.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
 gb|EEE83868.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
Length=786

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/736 (55%), Positives = 523/736 (71%), Gaps = 16/736 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D+  +  SH  +LGTYL   +K  D + YSYTR INGFAA+L+E + A +  NP V+S+
Sbjct  58    LDVKAMTKSHFDMLGTYLDRKEKVEDQMLYSYTRCINGFAAVLDESQVAALNDNPGVVSI  117

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N+  ++ TT SW+FLG E + GV    S+ KKA FGED IIGNLD+GVWPESKSF++E
Sbjct  118   FENKENRMYTTHSWDFLGFE-KNGVPSLYSLQKKANFGEDIIIGNLDSGVWPESKSFNDE  176

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRD-VIGHGS  1824
             G GP+P +WKG C +       CN+KLIGARYF +G+++  GP+   + T RD   GHG+
Sbjct  177   GMGPVPSKWKGTCDD--GGGVTCNKKLIGARYFNKGFAANNGPVPEEWNTARDDASGHGT  234

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG++VPG NV+G+GNGTAKGG+PKARVA YKVCWP  + G  C DADILA +D 
Sbjct  235   HTLSTAGGSYVPGVNVYGVGNGTAKGGAPKARVATYKVCWPSANGG--CTDADILAAYDA  292

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDV+SVSLG D P  ++ D ++IGS HA+K GI V+A+ GN GP  GS+ N APW
Sbjct  293   AISDGVDVISVSLGSDEPIQFYEDGISIGSLHAIKKGIPVIAAGGNNGPSDGSITNGAPW  352

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             L T+GA+TMDR   + V LG+KK + G++     LP GK YPL++ A A +   A  + +
Sbjct  353   LFTIGASTMDREIFTTVTLGDKKLFKGKTLASKNLPDGKLYPLINGAEAAL---AEATPR  409

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  C  GTLDP KV GK+++CL+G++ R+ K +EA  AGAVGMILAND  SG+E+  +A
Sbjct  410   DAQLCLDGTLDPNKVSGKIILCLRGQSPRLPKGYEAERAGAVGMILANDIISGDELYLEA  469

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             + LP+ H+TY+DG ++ DYI  TRNP A I+   T  GVKP+P +A FSSRGP+ I P +
Sbjct  470   YELPSAHITYADGESVMDYIKATRNPTASISPAITNFGVKPSPAMAKFSSRGPSKIEPAV  529

Query  923   LK------PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLL  762
             LK      PD++APGV+VIAAFTEA GPS   +DKR   + V SGTSMSCPHV+G+VGLL
Sbjct  530   LKVSSASLPDVTAPGVDVIAAFTEAIGPSRRPFDKRRTPYMVMSGTSMSCPHVSGIVGLL  589

Query  761   KTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLV  582
             + ++P WSPA ++SAIMTTA  + N+ K + D   G   TPF YGAGH+ PN AADPGLV
Sbjct  590   RAIHPDWSPAALKSAIMTTAKTKCNNKKRMLD-YDGQLATPFMYGAGHVQPNLAADPGLV  648

Query  581   YDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRT  402
             YD  + DY++F+CA GYNKT + A    PY CP++ S + FNYPSITVP LKG  TVTR 
Sbjct  649   YDTNVNDYLSFLCAHGYNKTLLNAFSDGPYTCPENFSFADFNYPSITVPDLKGPVTVTRR  708

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVL  222
             +KNVG+P TYT S+++P   SV V P  L+F++ GEEQ FK+TLK   +    DY FG L
Sbjct  709   VKNVGAPGTYTVSIKAPAKVSVVVEPSSLEFKQAGEEQLFKLTLKPIMDGMPKDYEFGHL  768

Query  221   TWSDKKHRVRSPIVVK  174
             TWSD  HRV+SP+VVK
Sbjct  769   TWSDGLHRVKSPLVVK  784



>ref|XP_002530614.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF31757.1| Cucumisin precursor, putative [Ricinus communis]
Length=771

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/733 (56%), Positives = 523/733 (71%), Gaps = 16/733 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTY--LGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVIS  2184
             D  +V  SH+ LL T     S +  +  + YSYT+ +NGFAA+L++ +A ++   P V  
Sbjct  52    DDSKVTQSHYDLLATLSQAQSVNDVQTELLYSYTKCMNGFAAVLDDIQAEQLRNLPGVKQ  111

Query  2183  VFLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSE  2004
             +FLN    L TT SW+F+GLE  G  +   S+W +AK+G+D II NLDTGVWPES SFS+
Sbjct  112   IFLNLKYDLHTTHSWDFVGLESHGTPVPS-SLWDRAKYGQDVIIANLDTGVWPESPSFSD  170

Query  2003  EGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSA-VGPLNSSFFTPRDVIGHG  1827
             EG GP+P RW+G C+   D    CN+KLIGAR F +G  +A  GP N +  T RD  GHG
Sbjct  171   EGMGPVPSRWRGSCE--PDSQIRCNKKLIGARVFYKGAQAAGDGPFNKTSITARDNEGHG  228

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLSTAGG+FVPGA++FG GNGTAKGGSPKARVAAYK+CW        CY ADILAGFD
Sbjct  229   SHTLSTAGGSFVPGASIFGYGNGTAKGGSPKARVAAYKICWT-----GGCYGADILAGFD  283

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              A+ DGVDV+S S+GG  P   F D  A GSF+A+K GI V+AS GN GP   +++NVAP
Sbjct  284   AAMADGVDVISASIGGP-PVDLFTDPTAFGSFNAIKRGIHVIASGGNSGPTPETISNVAP  342

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W+ T+GA+TMDR F S+VVLG+ K   G S     LP GKFYPL+S A A+   +AS + 
Sbjct  343   WIFTIGASTMDRDFVSSVVLGDNKSLRGISLSDKSLPAGKFYPLISGADAK---SASANA  399

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
              DA  C+ G+LD  KV GK++VCL+G++DR+ K    A  GAVGMILAND+ S NE++AD
Sbjct  400   SDAQLCEEGSLDKAKVAGKIIVCLRGDSDRLAKGQVVASLGAVGMILANDQLSANELLAD  459

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              HFLPA+H+TY+DG A+++YI  T+NP A I+   T +GVKPAPV+A+FSSRGPNA+ P 
Sbjct  460   PHFLPASHITYTDGQAVYNYIKTTKNPTASISPVKTEVGVKPAPVMASFSSRGPNAVFPG  519

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             +LKPD++APGVN++AA++ A  PS+ + DKR V F V SGTSMSCPHV+G+VGLLK+++P
Sbjct  520   LLKPDVTAPGVNILAAYSGAISPSEEESDKRRVPFTVMSGTSMSCPHVSGIVGLLKSIHP  579

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA ++SAIMTTA  RAN+G++I D   G   TPFAYGAGH+ PN AADPGLVYDL +
Sbjct  580   DWSPAAVKSAIMTTAKTRANNGRSILDSD-GKTATPFAYGAGHVRPNLAADPGLVYDLTI  638

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             TDY N +C  GYN++ + + +G  Y CP + +++ FNYPSITV +L  +  VTR  KNVG
Sbjct  639   TDYANSLCGFGYNESVVKSFIGESYTCPKNFNMADFNYPSITVANLNASIVVTRKAKNVG  698

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P TYTA V+ P G SVTV P  L F K+GEE+ +KV LKA    +  +Y FG L WSD 
Sbjct  699   TPGTYTAHVKVPGGISVTVEPAQLTFTKLGEEKEYKVNLKASVNGSPKNYVFGQLVWSDG  758

Query  206   KHRVRSPIVVKTA  168
             KH+VRSP+VVK A
Sbjct  759   KHKVRSPLVVKHA  771



>ref|XP_007155547.1| hypothetical protein PHAVU_003G210900g [Phaseolus vulgaris]
 gb|ESW27541.1| hypothetical protein PHAVU_003G210900g [Phaseolus vulgaris]
Length=766

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/732 (59%), Positives = 540/732 (74%), Gaps = 23/732 (3%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             L+ V +SH+ LLG+Y+GS +KA++AIFYSY R+INGFAA+L+E+EAA +AKNP VISVFL
Sbjct  47    LESVTNSHYDLLGSYVGSIEKAKEAIFYSYNRYINGFAAVLDEDEAANVAKNPNVISVFL  106

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW FLGLE +G V    S+W K + GED II N+DTGVWPESKSFS+EGF
Sbjct  107   NKERKLHTTHSWNFLGLERKG-VFPPHSLWSKTE-GEDVIIANIDTGVWPESKSFSDEGF  164

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP-LNSSFFTPRDVIGHGSHT  1818
             GPIPKRW+GICQ  K   F CNRKLIGAR+F +GY ++VG  LN S  + RD  GHGSHT
Sbjct  165   GPIPKRWRGICQ--KGGHFKCNRKLIGARFFYKGYEASVGKKLNVSMLSARDNEGHGSHT  222

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG+ VPGAN+FG GNGTA+GGSPKARVA YK CW      E C+DADI A F+ AI
Sbjct  223   LSTAGGSVVPGANIFGFGNGTARGGSPKARVATYKACW-----AEGCFDADIFAAFEAAI  277

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDV+S+SLG D+P  +   +++IGSFHAV +GI ++ASAGN GPV GSV+N  PW +
Sbjct  278   SDGVDVISMSLGSDNPPEFSESAISIGSFHAVAHGITIMASAGNSGPVPGSVSNNEPWTL  337

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F S VVLGN K   G S     LP+ K YPL+S+A A  K   S S+ D 
Sbjct  338   TVGASTMDRDFFSYVVLGNNKILKGASLSEFSLPSNKKYPLISSAEALTK---SASSSDG  394

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C   TLD  KVKGK+L+CL+G N R+EK   AA  GAVGMI+AND+ +GNEII+D+H 
Sbjct  395   PFCLNNTLDAGKVKGKILLCLRGINGRVEKGMVAASLGAVGMIVANDQLTGNEIISDSHV  454

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATHV Y  G  I+ YIN T++P+A+I+ P T LG+KPAPV+AAFSSRGPN ++  ILK
Sbjct  455   LPATHVNYESGRYIYSYINTTKSPMAYISRPKTELGMKPAPVMAAFSSRGPNLLDQGILK  514

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKR-IVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             PDI+APGVN+IAA++E    SD+   K+ I  +N+ SGTSMSCPHVAGVVGLLK L+P+W
Sbjct  515   PDITAPGVNIIAAYSEL---SDSTASKQPITPYNMLSGTSMSCPHVAGVVGLLKALHPNW  571

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAI+T+AT + NSG+ I       ++TPF  G GHI PN AADPGLVYDL  TD
Sbjct  572   SPAAIKSAIITSATTKDNSGRRIRTSAQN-ESTPFDLGGGHIRPNHAADPGLVYDLNTTD  630

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  387
             Y+N++C +GYN +++      PY CP   SL+ FNYP+IT+P +K   +  V+RT+ NVG
Sbjct  631   YLNYLCGRGYNSSQLKLFYSRPYTCPKSFSLADFNYPTITIPRIKYGHSVNVSRTVTNVG  690

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKV--TLKAKGENATADYAFGVLTWS  213
             SP+ Y   + +P   +V V P  LKFEK GE++ F+V  TLK+K +N T D  +G LTW+
Sbjct  691   SPSLYRVHIEAPPKVAVWVEPTKLKFEKKGEKKEFRVSFTLKSKTDN-TTDSVYGSLTWT  749

Query  212   DKKHRVRSPIVV  177
             D KHRVRSPIVV
Sbjct  750   DHKHRVRSPIVV  761



>ref|XP_003608824.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES91021.1| subtilisin-like serine protease [Medicago truncatula]
Length=780

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/736 (57%), Positives = 534/736 (73%), Gaps = 27/736 (4%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++   +SH+ LLG+YLGS +KA++AIFYSY ++INGFAA+L+E+EAAE+AKNP VIS+F
Sbjct  46    DIESATNSHYDLLGSYLGSTEKAKEAIFYSYNKNINGFAAILDEDEAAEVAKNPNVISIF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+  +LQTT SW+FL L+  GG+  D SIWK++ FGED IIGN+DTGVWPESKSFS+EG
Sbjct  106   LNKKHKLQTTHSWDFLRLKSNGGIRKD-SIWKRS-FGEDIIIGNIDTGVWPESKSFSDEG  163

Query  1997  FGPIPKRWKGICQ--NQKDKSFHCNRKLIGARYFIQGY----SSAVGPLNSSFFTPRDVI  1836
              GPIPK+W GICQ   Q    F CNRKLIGARYF +G+    S   G  + SF + RD+ 
Sbjct  164   MGPIPKKWHGICQVDKQNQDKFFCNRKLIGARYFYKGFLASPSGGKGLHSVSFNSARDID  223

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTLSTAGGNFV  A+VFG GNGTA GGSPKARV AYKVCW      + CYDADILA
Sbjct  224   GHGTHTLSTAGGNFVANASVFGYGNGTASGGSPKARVVAYKVCW------DSCYDADILA  277

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
             GF+ AI DGVDVLSVSLGGD P  +++ S++IGSFHAV N I+VVA+ GN GP   +V+N
Sbjct  278   GFEAAISDGVDVLSVSLGGDFPVEFYDSSISIGSFHAVANNIIVVAAGGNSGPAPSTVSN  337

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             + PW+ TV A+T+DR F S V LG+ K   G S   L+L   K YPL++ A  +     +
Sbjct  338   LEPWVFTVAASTIDREFTSFVTLGDNKTLKGASLSELELLPNKLYPLITGADVKYD---N  394

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGEND-----RIEKSHEAALAGAVGMILAN-DE  1134
              S++DAL+C+ GTLDP+K KGK+LVC Q  +D     R  K  EAA  GAVG+ILAN D+
Sbjct  395   ASSKDALNCEGGTLDPQKAKGKILVCFQVPDDCHFLCRTHKGVEAARVGAVGIILANSDK  454

Query  1133  DSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSS  954
             DSG+ I AD H LP+++V + DG  IF+YIN T++PVA+I+   T L  KPAP IA+FS+
Sbjct  455   DSGSGIQADPHVLPSSYVNFIDGSYIFNYINHTKSPVAYISKVTTQLATKPAPFIASFSA  514

Query  953   RGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGV  774
             RGPN + P ILKPDI+APGV++IAA++E   PS+ +YDKR   FN+ SGTSMSCPHVAG+
Sbjct  515   RGPNLVEPTILKPDITAPGVDIIAAYSENISPSEQEYDKRRTLFNIMSGTSMSCPHVAGL  574

Query  773   VGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAAD  594
             VGL+K+L+P+WSPA ++SAIMTTAT   N+G  I D     K TPF YGAGHI PN   D
Sbjct  575   VGLVKSLHPNWSPAAVKSAIMTTATTEDNTGGPILDSFKE-KATPFDYGAGHIQPNRVVD  633

Query  593   PGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GT  420
             PGLVYDL +TDY+NF+CA+GYN + +    G PY CP   +L  FNYP+IT+   K   +
Sbjct  634   PGLVYDLNITDYMNFLCARGYNSSMLRFFYGKPYTCPKSFNLKDFNYPAITILDFKVGQS  693

Query  419   ATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TA  243
               VTRTL NVGSP+TYTA +++P  + + V PK L F + GE++ F+VTL  K ++   +
Sbjct  694   INVTRTLTNVGSPSTYTAQIQAPPEYVIYVEPKTLSFNQKGEKKEFRVTLTFKLQSKDKS  753

Query  242   DYAFGVLTWSDKKHRV  195
             DY FG L W++ K+ V
Sbjct  754   DYVFGKLIWTNGKNYV  769



>ref|XP_010092360.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51036.1| Subtilisin-like protease [Morus notabilis]
Length=732

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/740 (55%), Positives = 515/740 (70%), Gaps = 73/740 (10%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DL+ V  SH+ LLG++LGS +KARDAIFYSYTRHINGF                     
Sbjct  53    IDLESVTTSHYSLLGSFLGSEEKARDAIFYSYTRHINGF---------------------  91

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
                                          +I  +AK  E          VWPESKSFS+E
Sbjct  92    ----------------------------AAILDEAKVAEIA-------SVWPESKSFSDE  116

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLN--------SSFFTPR  1845
             G GP+P +W GIC++  +   HCNRKLIGARYF +GY++ +  +N        S+ F+ R
Sbjct  117   GIGPVPSKWHGICESDTNDRIHCNRKLIGARYFNRGYAAYLLTMNTTITPTENSTLFSIR  176

Query  1844  DVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDAD  1665
             D  GHG+HTLSTAGG+FV  A VFG GNGTAKGGSP+ARVAAYKVCWPP + G +C+DAD
Sbjct  177   DHEGHGTHTLSTAGGSFVTDATVFGNGNGTAKGGSPRARVAAYKVCWPPVN-GNECFDAD  235

Query  1664  ILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGS  1485
             I+A F+ AI DG+DVLSVSLGG+ P  +F D ++IG+FHAVKNGIVVV+SAGN GP  G+
Sbjct  236   IIAAFETAITDGIDVLSVSLGGE-PSEFFEDGISIGAFHAVKNGIVVVSSAGNSGPTPGT  294

Query  1484  VNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKI  1305
             V+NV+PW++TVGA+T+DR F S V LG+KKH  G S     LP+ KFYPL+S A+AR   
Sbjct  295   VSNVSPWMVTVGASTIDREFSSYVALGSKKHLKGASLSSKVLPSEKFYPLISGANARA--  352

Query  1304  NASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSG  1125
              A++   +AL CK GTLDP+KVKGK++VCL+G+  R EK   A+LAGAVGMILAND  SG
Sbjct  353   -ANVPPSEALLCKNGTLDPKKVKGKIVVCLRGDIARTEKGQYASLAGAVGMILANDLQSG  411

Query  1124  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  945
             NEIIADAH LPA+H+ ++DG ++F Y+N T+ P+A++T   T +G+KPAP +A+FSSRGP
Sbjct  412   NEIIADAHLLPASHINFTDGNSVFAYLNSTKTPMAYMTRVKTEVGIKPAPFMASFSSRGP  471

Query  944   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  765
             N I   +LKPDI+APGVN+IAA+T+A GP+D D+DKR V FN ESGTSMSCPHV+G+VGL
Sbjct  472   NTIEEALLKPDITAPGVNIIAAYTQAAGPTDQDFDKRRVPFNTESGTSMSCPHVSGIVGL  531

Query  764   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGL  585
             LKTL+P WSPA I+SAIMT+A  R ++ + + D     K TPFAYGAGHI PN A DPGL
Sbjct  532   LKTLHPDWSPAAIKSAIMTSARTRDDNKEPLLDSSMK-KATPFAYGAGHIQPNHAMDPGL  590

Query  584   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA-TVT  408
             VYDL   DY+NF+CA+GYN+T +      P+ CP   +L+ FNYPSI VP+L   +  V+
Sbjct  591   VYDLTTDDYLNFLCARGYNETLLKLFSDKPHNCPKSFTLANFNYPSIVVPNLGSESIVVS  650

Query  407   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGE-NATAD-YA  234
             R +KNVG+P  YT  V+ P G SV+V PK LKF K+GEE+ F V +K KG   +T D Y 
Sbjct  651   RRVKNVGTPGIYTVYVKQPAGVSVSVWPKSLKFSKIGEEKKFNVFVKTKGVGKSTKDGYV  710

Query  233   FGVLTWSDKKHRVRSPIVVK  174
             FG L WSD KH VRSPIVVK
Sbjct  711   FGHLKWSDGKHNVRSPIVVK  730



>gb|KEH35215.1| subtilisin-like serine protease [Medicago truncatula]
Length=634

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/622 (62%), Positives = 481/622 (77%), Gaps = 8/622 (1%)
 Frame = -2

Query  2036  GVWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSS  1860
             GVWPESKSFS+EGFGPIP +W+GIC   +D SFHCNRKLIGARYF +GY+S +  PLNSS
Sbjct  18    GVWPESKSFSDEGFGPIPSKWRGICDKGRDPSFHCNRKLIGARYFNKGYASRLTVPLNSS  77

Query  1859  FFTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED  1680
             F TPRD  GHGSHTLSTAGGN VPG +VFG G GTAKGGSPKARVA+YKVCWPP + G++
Sbjct  78    FETPRDNEGHGSHTLSTAGGNMVPGVSVFGQGYGTAKGGSPKARVASYKVCWPPIN-GDE  136

Query  1679  CYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEG  1500
             C+DADILA FD AI DGVDVLSVSLGG      FNDS+AIGSFHA K GIVVV SAGN G
Sbjct  137   CFDADILAAFDAAIHDGVDVLSVSLGGSASN-LFNDSVAIGSFHAAKKGIVVVCSAGNSG  195

Query  1499  PVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAAS  1320
             P   + +N+APW ITVGA+TMDR F S VVLGN   + GES    +L   KFYP++ A  
Sbjct  196   PNDATASNLAPWYITVGASTMDREFPSYVVLGNNLTFKGESLSAARL-ADKFYPIIKATD  254

Query  1319  ARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILAN  1140
             A++   AS + +DA+ C+ GTLDP+KVKGK+++CL+G N R++K  +A LAGAVGM+LAN
Sbjct  255   AKL---ASATNEDAVLCQNGTLDPKKVKGKIVLCLRGINARVDKGEQALLAGAVGMVLAN  311

Query  1139  DEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAF  960
             D+ +GNEIIAD H LPA+H+ +SDG+ +F Y+N +++PVA+ITHP T L  KPAP +AAF
Sbjct  312   DKTTGNEIIADPHVLPASHINFSDGVEVFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAF  371

Query  959   SSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVA  780
             SS+GPN I P+ILKPDI+APGV+VIAA+TEA GP++ ++D R + FN  SGTSMSCPH++
Sbjct  372   SSKGPNTIIPEILKPDITAPGVSVIAAYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHIS  431

Query  779   GVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGA  600
             G+VGLL++LYPSW+PA I+SAIMTTAT   N  + I  + T  + TPF+YGAGH+ PN A
Sbjct  432   GIVGLLRSLYPSWTPAAIKSAIMTTATTLDNKAEPIM-NATKSQATPFSYGAGHVQPNSA  490

Query  599   ADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT  420
              DPGLVYD+   DY NF+CA GYN+T+++     PYKC  + S+   NYPSITVP+L G+
Sbjct  491   MDPGLVYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKNFSILNLNYPSITVPNLSGS  550

Query  419   ATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD  240
              TVTRTLKNVG+P TY   V+SP G +++V P IL+F+KVGEE+ F+V LK K   AT  
Sbjct  551   VTVTRTLKNVGAPGTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKS  610

Query  239   YAFGVLTWSDKKHRVRSPIVVK  174
             Y FG + WSD KH V+SP+VVK
Sbjct  611   YVFGKMIWSDGKHYVKSPLVVK  632



>ref|XP_006857645.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
 gb|ERN19112.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
Length=774

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/735 (57%), Positives = 530/735 (72%), Gaps = 13/735 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D  RV  SHH+LLGT++GS +KA+DAIFYSYT ++NGFAA LEEEEA EI+K+P V+SV
Sbjct  43    IDHARVTESHHELLGTFIGSKEKAKDAIFYSYTLNVNGFAANLEEEEALEISKHPGVVSV  102

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F ++ R+L TTRSW F+GLE +G V    S+W +  FG D I+ NLDTGVWPES+SF +E
Sbjct  103   FPDKLRELHTTRSWHFMGLERDGRVPKK-SLWHQTNFGRDVIVANLDTGVWPESESFRDE  161

Query  2000  GFGPIPKRWKGICQNQ--KDKSFHCNRKLIGARYFIQGYSSAVGPLN---SSFFTPRDVI  1836
             G GP+P +WKGICQN   + +   CNRKLIG RYF +GY++    LN    +  +PRD+ 
Sbjct  162   GIGPVPSKWKGICQNDDPEMRPVKCNRKLIGVRYFNKGYNAYAATLNITPPALNSPRDIE  221

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED-CYDADIL  1659
             GHG+HTLST  G+FVP A++FG  +GTAKGG+P ARVAAYKVCWP T   +  C+D+DIL
Sbjct  222   GHGTHTLSTVAGSFVPNASIFGFASGTAKGGAPGARVAAYKVCWPATKQIQGGCFDSDIL  281

Query  1658  AGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVN  1479
             A FD AI DGVDV+SVSLGGD P P+F D+ AIG+FHA + GI V+ SAGN GP  GSV 
Sbjct  282   ASFDAAIHDGVDVVSVSLGGD-PYPFFEDATAIGAFHAARKGISVICSAGNSGPTPGSVT  340

Query  1478  NVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINA  1299
             N+APW++TVGA+T+DR F + V +G K H  G+S     LP  KFYPL+SAA   +   +
Sbjct  341   NLAPWILTVGASTLDRDFPTYVSIGGK-HLKGQSLSIDTLPHEKFYPLISAADI-LNPQS  398

Query  1298  SISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNE  1119
             + S  +  +C  G+LDP K KGK++ CL+G+N R+EK     LAG VGMIL ND +SGNE
Sbjct  399   NFSLLNVTNCLLGSLDPTKAKGKIVACLRGDNARVEKGEAVKLAGGVGMILCNDPNSGNE  458

Query  1118  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  939
             +IADAH LPA H+T SDG  +F YI  T+NP+A+IT PNT LG  PAPV+AAFSS+GPN 
Sbjct  459   VIADAHVLPAAHLTLSDGAQVFSYIKSTKNPMAYITRPNTNLGSTPAPVMAAFSSQGPNT  518

Query  938   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  759
             I P ILKPDI+ PGV+++AA+TEAT P+D +YDKR VSFNV SGTSMSCPH++GVV L+K
Sbjct  519   ITPQILKPDITGPGVSILAAYTEATSPTDMEYDKRRVSFNVVSGTSMSCPHLSGVVALIK  578

Query  758   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVY  579
               +P+WS A I+SAIMTTA  R N   A+ D     K TPF YGAGH+ PN AADPGLVY
Sbjct  579   ARHPNWSEAAIKSAIMTTAHRRDNVESAVKDASLE-KATPFNYGAGHVRPNAAADPGLVY  637

Query  578   DLKLTDYVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRT  402
             DL  TDY+NF+C+  YN++ I+A+    Y CP     L  FNYPS ++ +L  T TVTR 
Sbjct  638   DLTPTDYLNFLCSLDYNQSSISAITDQNYTCPTPKPKLLDFNYPSFSITNLTSTVTVTRV  697

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVL  222
             +K VG PATYT  V+SP G S+ V+ K L FEK GEE+S+ V    K +N   +Y+FG L
Sbjct  698   VKLVGPPATYTVRVQSPTGVSIEVSTKSLSFEKEGEEKSYTVKFTLKSKN-FGNYSFGRL  756

Query  221   TWSDKKHRVRSPIVV  177
              WSD  H VRS IV+
Sbjct  757   IWSDGTHYVRSAIVI  771



>ref|XP_008794758.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=758

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/730 (57%), Positives = 522/730 (72%), Gaps = 18/730 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D +RV  SHH+ LG++LGS +KA+  +FYSYT+HINGFAA LEEEEA  I+K+PEVISVF
Sbjct  40    DYERVTDSHHEFLGSFLGSKEKAQVEMFYSYTKHINGFAATLEEEEAKRISKHPEVISVF  99

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N A++L TTRSW+ + +E +G V H  SIW +AKFG DTII  LDTGVWPES+SF++ G
Sbjct  100   ENTAKKLHTTRSWDLVAMERDGRVPHS-SIWAQAKFGNDTIIATLDTGVWPESESFNDRG  158

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP--LNSSFFTPRDVIGHGS  1824
              GP+P RW+G CQN   +   CNRKLIGARYF +GY +  G   +N S    RD  GHGS
Sbjct  159   MGPVPSRWRGSCQNNTKEGVPCNRKLIGARYFTKGYEAGSGKKVVNGS---ARDTEGHGS  215

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTA G FVPGAN+FG  NGTAKGGSP ARVAAYKVCW      + CYDAD++A FD 
Sbjct  216   HTLSTAAGRFVPGANIFGQANGTAKGGSPDARVAAYKVCW------DGCYDADLIAAFDA  269

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVS+GGD P  YF+D +AIGSFHAV NGI VV SAGN GP  GSV+N+APW
Sbjct  270   AIHDGVDVLSVSVGGD-PADYFDDPIAIGSFHAVVNGITVVCSAGNSGPARGSVSNIAPW  328

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             ++T  A+T+DR F + + LG+KK   G S   + LP  KFYPL+S A A+    A++S  
Sbjct  329   IVTAAASTIDRDFPAFLTLGDKKQMKGGSLASVALPANKFYPLISGADAK---KANVSAA  385

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  C   +LDP KVKGK++ CL+G   R+EK      AG  GM+L ND+  GN +++D 
Sbjct  386   DAQLCFMDSLDPNKVKGKIVACLRGIIARMEKGAAVLRAGGAGMVLINDKQDGNSLLSDP  445

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             + LPA  VT+ DG+A+  Y++ T++PVA I+ P T LGVKPAP +AAFSS+GPN I+P I
Sbjct  446   YILPALMVTHRDGVALRKYMDSTKSPVASISAPATKLGVKPAPTMAAFSSQGPNLISPHI  505

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV ++AAFT A   +    D R V FN+ SGTSMSCPHV+GV GLLKTL+P 
Sbjct  506   LKPDITAPGVGILAAFTGARSATGLPMDNRHVPFNLLSGTSMSCPHVSGVAGLLKTLHPH  565

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             W+PA IRSAIMTTA  R N+G  +       K TPFA+G+GHI PN A DPGLV+DL LT
Sbjct  566   WTPAAIRSAIMTTARSRDNTGSPMKGYNLLEKATPFAHGSGHIRPNRAMDPGLVFDLTLT  625

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+N++CA GYN T++ A     Y+CP   I +  FNYPSI VP +  T T+TRT+KNVG
Sbjct  626   DYLNYLCAFGYNSTQL-AQFSKRYRCPATPIKMEDFNYPSIAVPTVTRTLTLTRTVKNVG  684

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP TY A V  P G ++TV P+ILKF+KVGEE++F+VTLK   ++    Y FG L WSD 
Sbjct  685   SPGTYKARVEPPYGITMTVKPEILKFDKVGEEKAFEVTLKPHEKSIGRGYLFGRLIWSDG  744

Query  206   KHRVRSPIVV  177
             +H VR P+ V
Sbjct  745   RHYVRIPVAV  754



>gb|EEE69917.1| hypothetical protein OsJ_29768 [Oryza sativa Japonica Group]
Length=805

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/743 (58%), Positives = 528/743 (71%), Gaps = 25/743 (3%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             +R K+SHH+ LG++LGS +KARDAIFYSYT++INGFAA LEEEEA EI+K+P VISVF N
Sbjct  58    ERAKNSHHEFLGSFLGSKEKARDAIFYSYTKYINGFAATLEEEEAMEISKHPSVISVFPN  117

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
             R  +L TTRSWEFLG+E +G  I   SIW KA+FGE  IIGNLDTGVWPE+ SFS++G G
Sbjct  118   RGHRLHTTRSWEFLGMEKDG-RIRANSIWAKARFGEGVIIGNLDTGVWPEAGSFSDDGMG  176

Query  1991  PIPKRWKGICQNQK--DKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             P P RW+GICQ+Q   D    CNRKLIGARYF +GY S VG   +   T RD  GHG+HT
Sbjct  177   PAPVRWRGICQDQASDDAQVPCNRKLIGARYFNKGYLSTVGQAANPAST-RDTDGHGTHT  235

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTA G FVPGAN+FG GNGTAKGG+P A VAAYKVCW P + G +C+DADI+A FD AI
Sbjct  236   LSTAAGRFVPGANLFGYGNGTAKGGAPGAHVAAYKVCWRPVN-GSECFDADIIAAFDAAI  294

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLGG  P  Y  D +AIGSFHAV+ G+ VV SAGN GP AG+V+N APWL+
Sbjct  295   HDGVDVLSVSLGGA-PAGYLRDGVAIGSFHAVRRGVTVVCSAGNSGPGAGTVSNTAPWLV  353

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA+TMDR F + +VLGN K   G+S  P++L  GK YPL+S+  AR    A+ +   A
Sbjct  354   TVGASTMDREFPAYLVLGNNKKIKGQSLSPVRLAGGKNYPLISSEQARA---ANATASQA  410

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C  G+L+  KV+G+++VC++G+N R+EK      AG  G++LANDE +GNE+IADAH 
Sbjct  411   RLCMEGSLERGKVEGRIVVCMRGKNARVEKGEAVRRAGGAGLVLANDEATGNEMIADAHV  470

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATHVTYSDG+A+  Y+N TR+P   IT P+T L  KPAP +AAFSS+GPN +   ILK
Sbjct  471   LPATHVTYSDGVALLAYLNSTRSPSGFITVPDTALDTKPAPFMAAFSSQGPNTVTTQILK  530

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGV+++AAFT   GP+   +D R V FN ESGTSMSCPHVAGV GLLK L+P WS
Sbjct  531   PDITAPGVSILAAFTGQAGPTGLAFDSRRVLFNAESGTSMSCPHVAGVAGLLKALHPDWS  590

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA V+ N  + +++    L+ TPF+YGAGH+ P  AADPGLVYD+  TDY
Sbjct  591   PAAIKSAIMTTARVKDNMRRPMSNSSF-LRATPFSYGAGHVQPGRAADPGLVYDMNDTDY  649

Query  557   VNFICAQGYNKTEITAVLGT------PYKCPDHISLSTFNYPSITVPHLK---GTATVTR  405
             + F+CA GYN + I   + +      PY CP        NYPS  +PHL       TVTR
Sbjct  650   LGFLCALGYNSSVIATFMASGSGAQPPYACPPARRPEDLNYPSFALPHLSPSGAARTVTR  709

Query  404   TLKNVG-SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKA-KGENATADYAF  231
              ++NVG +PA Y ASV  P G SV V P  L+F   GEE  F VT +A KG     +Y F
Sbjct  710   RVRNVGAAPAAYVASVAEPRGVSVAVRPSRLEFTAAGEELEFAVTFRAKKGSFLAGEYEF  769

Query  230   GVLTWSDK----KHRVRSPIVVK  174
             G L WSD     +HRVRSP+VV+
Sbjct  770   GRLVWSDAAAGGRHRVRSPLVVR  792



>ref|XP_004148290.1| PREDICTED: uncharacterized protein LOC101212014 [Cucumis sativus]
Length=1696

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/732 (58%), Positives = 525/732 (72%), Gaps = 11/732 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++    S + LLG+ +GS   A+DAI YSY ++INGFAA L+E++A ++AKNP+V+SVF
Sbjct  111   DIEVATESQYDLLGSVVGSKLAAKDAIKYSYNKYINGFAATLDEKQAKDLAKNPKVVSVF  170

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ R+L TTRSW FLG+E + G I   SIW   +FGEDTIIGNLDTGVWPESKSF++ G
Sbjct  171   ENKERKLHTTRSWHFLGVESDEG-IPSNSIWNAGRFGEDTIIGNLDTGVWPESKSFNDAG  229

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GP+P RW+G C+   +  F CNRKLIGARYF +G++ A GPLN SF T RD  GHGSHT
Sbjct  230   YGPVPSRWRGACEGGAN--FRCNRKLIGARYFNKGFAMASGPLNISFNTARDKQGHGSHT  287

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPGANVFG GNGTAKGGSPKARVAAYKVCWP TS G  CYDADILAGF+ AI
Sbjct  288   LSTAGGNFVPGANVFGYGNGTAKGGSPKARVAAYKVCWPATS-GGGCYDADILAGFEAAI  346

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLSVSLG   P  +  DS++IG+FHAV+ GIVVV SAGN+GP  G+V+N++PW+ 
Sbjct  347   SDGVDVLSVSLG-SKPEEFAYDSMSIGAFHAVQQGIVVVCSAGNDGPGPGTVSNISPWMF  405

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV A+++DR F S   LGNKKHY G S     L  GKFYPL++A  A+    + I  Q  
Sbjct  406   TVAASSIDRDFTSYASLGNKKHYKGSSISSSALAGGKFYPLINAVDAKAANASEILAQ--  463

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
               C  G+LDP K KGK++VCL+GEN R+EK      AG VGMIL N ++ G+   ADAH 
Sbjct  464   -LCHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMILVNGKNGGSGTTADAHI  522

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPATH++Y+DGLA+  YIN T+ PVAHIT   T LG+KP+PV+A FSSRGPN I   +LK
Sbjct  523   LPATHLSYTDGLAVAQYINSTKTPVAHITPVQTQLGIKPSPVMADFSSRGPNPITEAMLK  582

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+ PG++++A+ T     +   +D R V FNVESGTSMSCPH++GVVGLLKTLYP+WS
Sbjct  583   PDITGPGMSILASVTTDVTATTFPFDTRRVPFNVESGTSMSCPHISGVVGLLKTLYPTWS  642

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA I+SAIMTTA  R N+ + I+D+    K TPF YGAGH++PN A DPGLVYD  + DY
Sbjct  643   PAAIKSAIMTTAKTRDNTMRTISDN-VKPKATPFDYGAGHVHPNSAMDPGLVYDTTIDDY  701

Query  557   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGS  384
             +NF+CA+GYN          P+ C    +L+  NYPSI++P L+  A  TV R +KNVG+
Sbjct  702   LNFLCARGYNSLTFKNFYNKPFVCAKSFTLTDLNYPSISIPKLQFGAPVTVNRRVKNVGT  761

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A V +     VTV P  L+F  VGEE++FKV  + KG      Y FG L WSD K
Sbjct  762   PGTYVARVNASSKILVTVEPSTLQFNSVGEEKAFKVVFEYKGNEQDKGYVFGTLIWSDGK  821

Query  203   HRVRSPIVVKTA  168
             H VRSPI+  TA
Sbjct  822   HNVRSPILDITA  833


 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/726 (55%), Positives = 512/726 (71%), Gaps = 11/726 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             +V   H+ LLG+  GS   A +AIFYSYTR  NGFAA L+++EA  +A+NP+VISVF N+
Sbjct  972   QVTALHYDLLGSLFGSKTMAEEAIFYSYTRSFNGFAAKLDDKEAENLARNPKVISVFENK  1031

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
             AR+L TTRSW FLG+E + G I   SIW  AKFGED I+ N+DTGVWPESKSFS+EG+GP
Sbjct  1032  ARKLHTTRSWNFLGVENDIG-IPSNSIWNTAKFGEDVIVANIDTGVWPESKSFSDEGYGP  1090

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +W+GICQ   D +FHCNRKLIG RYF +GY +A G LN++  T RD  GHG+HTLST
Sbjct  1091  VPSKWRGICQT--DSTFHCNRKLIGGRYFHKGYEAAGGKLNATLLTVRDHDGHGTHTLST  1148

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             A GNFV GANVFG GNGTAKGG+PKAR  AYK CWPP    + C+DADILA F+ AI DG
Sbjct  1149  AAGNFVTGANVFGHGNGTAKGGAPKARAVAYKACWPPLFDSQ-CFDADILAAFEAAIADG  1207

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLS SLGG     YFND LAI +F AV+ GI+VV S GN GP   ++ N++PW+ TV 
Sbjct  1208  VDVLSTSLGG-AADEYFNDPLAIAAFLAVQRGILVVFSGGNSGPFPMTIANISPWVFTVA  1266

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+T+DR F S V LGNKKH  G S   +     KF+PL+++  A+ +   +++   A  C
Sbjct  1267  ASTIDREFASYVGLGNKKHIKGLSLSSVPSLPKKFFPLINSVDAKFR---NVTEFHAQFC  1323

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               GTLDP KVKGK+++C  GE D ++K  +A+ AGAVG+I+AND + G+EI  + HF+PA
Sbjct  1324  GKGTLDPMKVKGKIVICQVGETDGVDKGFQASRAGAVGVIIANDLEKGDEIFPELHFIPA  1383

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             + +T +D   + +Y+  TR P+AH+T   TLL VKPAP IA FS+RGPN I+  ILKPD+
Sbjct  1384  SDITNTDAQIVQNYLKSTRTPMAHLTSVKTLLSVKPAPTIATFSARGPNPIDSTILKPDV  1443

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSPA 
Sbjct  1444  TAPGVNILASYPTGIAPTFSPVDRRRIPFNVISGTSMSCPHVAGIAGLIKSIHPNWSPAA  1503

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  R N+ + I D  T LK TP+AYGAG +NPN AADPGLVYD+ + DY+NF
Sbjct  1504  IKSAIMTTAKTRGNNNQTILDS-TKLKATPYAYGAGQVNPNDAADPGLVYDITVNDYLNF  1562

Query  548   ICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSPAT  375
             +CA+GYN  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP T
Sbjct  1563  LCARGYNAMQIKKFYAKPFSCVRSFKVTDLNYPSISVGELKIGAPLTMNRRVKNVGSPGT  1622

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  195
             Y A V++  G +V++ P  L F +VGEE+ FKV L+  G+       FG L WSD KH V
Sbjct  1623  YVARVKASPGVAVSIEPSTLVFSRVGEEKGFKVVLQNTGKVKNGSDVFGTLIWSDGKHFV  1682

Query  194   RSPIVV  177
             RS I V
Sbjct  1683  RSSIAV  1688



>ref|XP_008449184.1| PREDICTED: uncharacterized protein LOC103491134 [Cucumis melo]
Length=1511

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/731 (56%), Positives = 530/731 (73%), Gaps = 14/731 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D+     S ++LL + +GS   A+++IFYSY R+INGFAA+L+E +A  +A+NP V+S+F
Sbjct  790   DVQLATESQYELLESVVGSKLAAKESIFYSYNRYINGFAAILDENQAIALARNPNVVSIF  849

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ R+L TTRSW FLG+E + G I   SIWK A+FGEDTIIGNLDTG WPESKSF++ G
Sbjct  850   ENQKRKLHTTRSWSFLGMESDEG-IPPNSIWKAARFGEDTIIGNLDTGAWPESKSFNDAG  908

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
             +GP+P RW G+C+   +  F CN+KLIGARYF +G+ +  GP++++  T RD  GHGSHT
Sbjct  909   YGPVPSRWMGVCEGGAN--FTCNKKLIGARYFNKGFEAENGPMSANLTTARDQEGHGSHT  966

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPGANVFG GNGTAKGGSP+AR+AAYKVCWP  + G  CYDADILA  + AI
Sbjct  967   LSTAGGNFVPGANVFGNGNGTAKGGSPRARLAAYKVCWPSFTGG--CYDADILAAVESAI  1024

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDVLS+SLG      + +D+L+IG+FHAV+ GIVVV S GN+GP  G+V NV+PW+I
Sbjct  1025  HDGVDVLSISLGSSARD-FASDTLSIGAFHAVQQGIVVVCSGGNDGPTPGTVTNVSPWMI  1083

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD-  1281
             TV A+T+DR F + V LGNK+H+ G S     LP GKFYPL+      +++ A  +T   
Sbjct  1084  TVAASTVDRDFVNYVALGNKRHFKGVSLSSGGLPRGKFYPLVDG----VQVKAGNATDKL  1139

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             AL C+ G+LDP K KGK+++CL+G++ R++KS E   AG +G+IL ND++ GN+I AD H
Sbjct  1140  ALLCEDGSLDPAKAKGKIVLCLRGDSARMDKSFEVRRAGGIGLILVNDKEDGNDITADPH  1199

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
             FLPA+H+ Y+DG+AIF YIN T++P+A ITH  T +G+KP+P++A FSSRGPN I   ++
Sbjct  1200  FLPASHLNYADGIAIFQYINSTKSPMAFITHVKTEMGIKPSPMVADFSSRGPNPIIDSMI  1259

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+++AAF+E    +D   D R VSFN ESGTSM+CPH++GVVGLLKTLYP W
Sbjct  1260  KPDIAAPGVSILAAFSEYATATDFPLDTRRVSFNFESGTSMACPHISGVVGLLKTLYPKW  1319

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA  R NS K+I D     K TPF YGAGH++PN A DPGLVYD  + D
Sbjct  1320  SPAAIKSAIMTTAKTRDNSMKSILDYNKA-KATPFQYGAGHVHPNNAIDPGLVYDTTIED  1378

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  387
             Y+NFICAQGYN T +      PY CP    L+  NYPSI+VP L      T+ R LKNVG
Sbjct  1379  YMNFICAQGYNSTTLKRFYNKPYLCPKSFPLTDLNYPSISVPKLTIGVPVTINRRLKNVG  1438

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P TY A V+     SVTV P  L+F  VGEE++FKV  + KG+     + FG L WSD 
Sbjct  1439  TPGTYVARVKVSSKVSVTVKPSTLQFNSVGEEKAFKVVFEYKGKGQGKGHVFGTLIWSDG  1498

Query  206   KHRVRSPIVVK  174
              H VRSP+ VK
Sbjct  1499  NHFVRSPMAVK  1509


 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/745 (57%), Positives = 532/745 (71%), Gaps = 17/745 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++    SH+ LLG+ +G+  +A+D+I YSY ++INGFAA+L+E++A ++AKNP+V+SVF
Sbjct  46    DIEAATESHYDLLGSVVGNNLEAKDSIKYSYNKYINGFAAVLDEQQATDLAKNPKVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ RQL TTRSW FLG+E + G I   SIWK A+FGEDTIIGNLD+GVWPESKSF++ G
Sbjct  106   ENKKRQLHTTRSWSFLGMENDEG-IPSNSIWKAARFGEDTIIGNLDSGVWPESKSFNDAG  164

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSF-FTPRDVIGHGSH  1821
             +GP+P RW+G C+   +  F CNRKLIGARYF  G+    G +N SF  T RD  GHGSH
Sbjct  165   YGPVPSRWRGACEGGNN--FQCNRKLIGARYFHAGFVMGSGLINVSFNKTARDEDGHGSH  222

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGGNFVPGA++FG GNGTAKGGSPKARVAAY+VCWPP   G  CYDADILAGF+ A
Sbjct  223   TLSTAGGNFVPGASIFGYGNGTAKGGSPKARVAAYRVCWPPALFGGGCYDADILAGFEAA  282

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVDVLSVSLG +    + +DS++IG+FHAV+ GIVVV SAGN GP   +V+NV+PW+
Sbjct  283   ISDGVDVLSVSLGSEAQ-EFSHDSMSIGAFHAVEQGIVVVCSAGNSGPGPKTVSNVSPWM  341

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
              TVGA+T+DR F S   LGNKK Y G S     L  GKFYPL++A  AR   N + +   
Sbjct  342   FTVGASTIDRDFTSYATLGNKKQYKGSSLSSSSLAGGKFYPLINAVDAR---NPNSTDSF  398

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  C+ G+LDP KVKGK++VCL+G   R+EK +    AG VGMIL ND+  G+ +I+D+H
Sbjct  399   AQKCETGSLDPAKVKGKIVVCLRGVTARVEKGYVVLQAGGVGMILVNDKTDGSGLISDSH  458

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPAT +TY+DGLA+  YIN T  PVA IT   T LGVKP+PV+A FSSRGPN I   +L
Sbjct  459   ILPATSLTYTDGLAVAQYINSTTTPVALITPVETQLGVKPSPVMAGFSSRGPNPITDAML  518

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+ PGVN++A+ T     +   +D R V FNVESGTSMSCPH+AGV GLLKTLYP+W
Sbjct  519   KPDITGPGVNILASVTTDVTATKFPFDTRRVPFNVESGTSMSCPHIAGVSGLLKTLYPTW  578

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA  R NS   ++ D    K TPF YGAGH+NPN A DPGLVYD  + D
Sbjct  579   SPAAIKSAIMTTAKTRDNSMHTLS-DTVKAKATPFDYGAGHVNPNNAMDPGLVYDTTIDD  637

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVG  387
             Y+NF+CA+GYN   + +    P+ C    +L+  NYPSI++P LK  A  TV R +KNVG
Sbjct  638   YLNFLCARGYNAQTLMSFHSKPFVCATPFTLTDLNYPSISIPELKSGAPVTVNRRVKNVG  697

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P TY A V++    SVTV P  L+F  VGEE++FKV  + KG      Y FG L WSD 
Sbjct  698   TPGTYVARVKASSKISVTVEPSTLQFNSVGEEKAFKVLFEYKGTGQGKSYVFGTLIWSDN  757

Query  206   -KHRVRSPIVVKTA*MNICSYILGL  135
              KH VRSPIVVK     + SYI+ L
Sbjct  758   GKHNVRSPIVVK-----LGSYIVYL  777



>gb|KGN64982.1| hypothetical protein Csa_1G171040 [Cucumis sativus]
Length=757

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/736 (57%), Positives = 528/736 (72%), Gaps = 16/736 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+LLG+  GS +KAR+AIFYSY ++INGFAA+++EEEAA++AK+PEV +V 
Sbjct  30    DLKRVADSHHKLLGSIFGSDEKARNAIFYSYKKNINGFAAIMDEEEAAQLAKHPEVAAVL  89

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NRA++L TT SWEF+ LE + GVI   S W++AK G+D II NLDTGVWPESKSF E G
Sbjct  90    PNRAKKLHTTHSWEFMHLE-KNGVIPPSSAWRRAKSGKDVIIANLDTGVWPESKSFGEHG  148

Query  1997  F-GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF---TPRDVIGH  1830
               GP+P +WKG C ++      CNRKLIGA+YF +G+ + +   N +     + RD  GH
Sbjct  149   IVGPVPSKWKGGCTDKTLDRVPCNRKLIGAKYFNKGFLAYLKSENLTALVINSTRDYDGH  208

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLSTAGG++V GA+VFGLG GTAKGGSPKARVAAYKVCWP    G  C+DADI   F
Sbjct  209   GSHTLSTAGGSYVSGASVFGLGVGTAKGGSPKARVAAYKVCWPLEDGG--CFDADIAQAF  266

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             D AI D VDVLS+SLGG+ P  Y++D +AI +FHAVK GI VV SAGN GP A +V+N A
Sbjct  267   DHAIHDRVDVLSLSLGGE-PADYYDDGIAISAFHAVKKGIPVVCSAGNSGPGAQTVSNTA  325

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW++TVGA+TMDR FQ+ V L N   Y G S++   L   K YPL++ A A+ K   + +
Sbjct  326   PWILTVGASTMDREFQAPVELQNGHRYMG-SSLSKGLKGDKLYPLITGAEAKAK---NAT  381

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
              ++A  CKP TLD  KVKGK+LVCL+G+  R++K  +AALAGAVGMIL NDE SG E IA
Sbjct  382   AEEARLCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDELSGFETIA  441

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D H LPA+H+ Y+DG A+F YI  T+NP+ ++  P   +  KPAP +AAFSSRGPN I+P
Sbjct  442   DPHVLPASHINYNDGQAVFSYIKTTKNPMGYLIPPTAKVNTKPAPTMAAFSSRGPNLISP  501

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +I+KPD++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+
Sbjct  502   EIIKPDVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLH  561

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTG--LKTTPFAYGAGHINPNGAADPGLVYD  576
             P WSP+ I+SAIMT+A +R N+ K + D  +     +TPFAYG+GHI P GA DPGLVYD
Sbjct  562   PQWSPSAIKSAIMTSARIRDNTKKPMLDGGSPDLAPSTPFAYGSGHIRPTGAIDPGLVYD  621

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLK  396
             L   DY+ F+CA GYN+  I A    P+KCP   S+   NYPSI V +L G+ TVTR LK
Sbjct  622   LSPNDYLEFLCASGYNEKTIQAFSDGPFKCPASASILNLNYPSIGVQNLTGSVTVTRKLK  681

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NV +P  Y   VR P G  V V PK+LKFE+VGEE+SF++T+   G+        GVL W
Sbjct  682   NVSTPGVYKGRVRHPNGVKVLVKPKVLKFERVGEEKSFELTI--TGDVPEDQVVDGVLIW  739

Query  215   SDKKHRVRSPIVVKTA  168
             +D KH VRSPIVV ++
Sbjct  740   TDGKHFVRSPIVVSSS  755



>ref|XP_004159123.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=751

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/736 (57%), Positives = 527/736 (72%), Gaps = 16/736 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+LLG+  GS +KAR+AIFYSY ++INGFAA+++EEEAA++AK+PEV +V 
Sbjct  24    DLKRVADSHHKLLGSIFGSDEKARNAIFYSYKKNINGFAAIMDEEEAAQLAKHPEVAAVL  83

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NRA++L TT SWEF+ LE + GVI   S W++AK G+D II NLDTGVWPESKSF E G
Sbjct  84    PNRAKKLHTTHSWEFMHLE-KNGVIPPSSAWRRAKSGKDVIIANLDTGVWPESKSFGEHG  142

Query  1997  F-GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF---TPRDVIGH  1830
               GP+P +WKG C ++      CNRKLIGA+YF +G+ + +   N +     + RD  GH
Sbjct  143   IVGPVPSKWKGGCTDKTLDRVPCNRKLIGAKYFNKGFLAYLKSENLTALVINSTRDYDGH  202

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLSTAGG++V GA+VFGLG GTAKGGSPKARVAAYKVCWP    G  C+DADI   F
Sbjct  203   GSHTLSTAGGSYVSGASVFGLGVGTAKGGSPKARVAAYKVCWPLEDGG--CFDADIAQAF  260

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             D AI D VDVLS+SLGG+ P  Y++D +AI +FHAVK GI VV SAGN GP A +V+N A
Sbjct  261   DHAIHDRVDVLSLSLGGE-PADYYDDGIAISAFHAVKKGIPVVCSAGNSGPGAQTVSNTA  319

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW++TVGA+TMDR FQ+ V L N   Y G S++   L   K YPL++ A A+ K   + +
Sbjct  320   PWILTVGASTMDREFQAPVELQNGHRYMG-SSLSKGLKGDKLYPLITGAEAKAK---NAT  375

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
              + A+ CKP TLD  KVKGK+LVCL+G+  R++K  +AALAGAVGMIL NDE SG E IA
Sbjct  376   AEVAMLCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDELSGFETIA  435

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D H LPA+H+ Y+DG A+F YI  T+NP+ ++  P   +  KPAP +AAFSSRGPN I+P
Sbjct  436   DPHVLPASHINYNDGQAVFSYIKSTKNPMGYLIPPTAKVNTKPAPTMAAFSSRGPNLISP  495

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +I+KPD++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+
Sbjct  496   EIIKPDVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLH  555

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTG--LKTTPFAYGAGHINPNGAADPGLVYD  576
             P WSP+ I+SAIMT+A +R N  K + D  +     +TPFAYG+GHI P GA DPGLVYD
Sbjct  556   PQWSPSAIKSAIMTSARIRDNQKKPMLDGGSPDLAPSTPFAYGSGHIRPTGAIDPGLVYD  615

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLK  396
             L   DY+ F+CA GYN+  I A    P+KCP   S+   NYPSI V +L G+ TVTR LK
Sbjct  616   LSPNDYLEFLCASGYNEKTIQAFSDGPFKCPASASILNLNYPSIGVQNLTGSVTVTRKLK  675

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NV +P  Y   VR P G  V V PK+LKFE+VGEE+SF++T+   G+        GVL W
Sbjct  676   NVSTPGVYKGRVRHPNGVKVLVKPKVLKFERVGEEKSFELTI--TGDVPEDQVVDGVLIW  733

Query  215   SDKKHRVRSPIVVKTA  168
             +D KH VRSPIVV ++
Sbjct  734   TDGKHFVRSPIVVSSS  749



>ref|XP_004139597.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=751

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/736 (57%), Positives = 528/736 (72%), Gaps = 16/736 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL RV  SHH+LLG+  GS +KAR+AIFYSY ++INGFAA+++EEEAA++AK+PEV +V 
Sbjct  24    DLKRVADSHHKLLGSIFGSDEKARNAIFYSYKKNINGFAAIMDEEEAAQLAKHPEVAAVL  83

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NRA++L TT SWEF+ LE + GVI   S W++AK G+D II NLDTGVWPESKSF E G
Sbjct  84    PNRAKKLHTTHSWEFMHLE-KNGVIPPSSAWRRAKSGKDVIIANLDTGVWPESKSFGEHG  142

Query  1997  F-GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF---TPRDVIGH  1830
               GP+P +WKG C ++      CNRKLIGA+YF +G+ + +   N +     + RD  GH
Sbjct  143   IVGPVPSKWKGGCTDKTLDRVPCNRKLIGAKYFNKGFLAYLKSENLTALVINSTRDYDGH  202

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLSTAGG++V GA+VFGLG GTAKGGSPKARVAAYKVCWP    G  C+DADI   F
Sbjct  203   GSHTLSTAGGSYVSGASVFGLGVGTAKGGSPKARVAAYKVCWPLEDGG--CFDADIAQAF  260

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             D AI D VDVLS+SLGG+ P  Y++D +AI +FHAVK GI VV SAGN GP A +V+N A
Sbjct  261   DHAIHDRVDVLSLSLGGE-PADYYDDGIAISAFHAVKKGIPVVCSAGNSGPGAQTVSNTA  319

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW++TVGA+TMDR FQ+ V L N   Y G S++   L   K YPL++ A A+ K   + +
Sbjct  320   PWILTVGASTMDREFQAPVELQNGHRYMG-SSLSKGLKGDKLYPLITGAEAKAK---NAT  375

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
              ++A  CKP TLD  KVKGK+LVCL+G+  R++K  +AALAGAVGMIL NDE SG E IA
Sbjct  376   AEEARLCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDELSGFETIA  435

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D H LPA+H+ Y+DG A+F YI  T+NP+ ++  P   +  KPAP +AAFSSRGPN I+P
Sbjct  436   DPHVLPASHINYNDGQAVFSYIKTTKNPMGYLIPPTAKVNTKPAPTMAAFSSRGPNLISP  495

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +I+KPD++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+
Sbjct  496   EIIKPDVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLH  555

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTG--LKTTPFAYGAGHINPNGAADPGLVYD  576
             P WSP+ I+SAIMT+A +R N+ K + D  +     +TPFAYG+GHI P GA DPGLVYD
Sbjct  556   PQWSPSAIKSAIMTSARIRDNTKKPMLDGGSPDLAPSTPFAYGSGHIRPTGAIDPGLVYD  615

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLK  396
             L   DY+ F+CA GYN+  I A    P+KCP   S+   NYPSI V +L G+ TVTR LK
Sbjct  616   LSPNDYLEFLCASGYNEKTIQAFSDGPFKCPASASILNLNYPSIGVQNLTGSVTVTRKLK  675

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NV +P  Y   VR P G  V V PK+LKFE+VGEE+SF++T+   G+        GVL W
Sbjct  676   NVSTPGVYKGRVRHPNGVKVLVKPKVLKFERVGEEKSFELTI--TGDVPEDQVVDGVLIW  733

Query  215   SDKKHRVRSPIVVKTA  168
             +D KH VRSPIVV ++
Sbjct  734   TDGKHFVRSPIVVSSS  749



>ref|XP_004162792.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=768

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/729 (54%), Positives = 518/729 (71%), Gaps = 12/729 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D  R   SH+ LLG+ LGS   A + I YSY ++INGF AML+E++A ++ K P V+SV
Sbjct  47    LDHQRATASHYDLLGSALGSKKTAEEVILYSYNKNINGFVAMLDEKQATDLTKFPHVVSV  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F +++R+L TT+SW+FLG+E    ++   SIW  A+FGED II N DTGVWPESKSFS+E
Sbjct  107   FESQSRKLHTTQSWKFLGVEKYEQILASNSIWNVARFGEDIIIANFDTGVWPESKSFSDE  166

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP RW G CQ+  D  F CNRKLIGAR+F  GY    G L  +F + RD +GHG+H
Sbjct  167   GYGPIPPRWMGTCQSDADPKFRCNRKLIGARFFNIGY----GELTDTFNSSRDNVGHGTH  222

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLS AGGNFVPGANV G+GNGT KGGSP+ARVA+YKVCWP  +   +C D + LA F+ A
Sbjct  223   TLSIAGGNFVPGANVLGMGNGTVKGGSPRARVASYKVCWPDET--NECVDPNTLAAFEAA  280

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             IEDGVDV+S+S+GG+ P  +F+D+L++G+FHAV+ GIVVV+SAGN GP  G+V+NV+PW+
Sbjct  281   IEDGVDVISISVGGE-PREFFSDALSVGAFHAVERGIVVVSSAGNVGPTPGTVSNVSPWI  339

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TVGA+T+DR F + VVLGNKK + G S     LP  KFYPL++A  A+     ++S  D
Sbjct  340   LTVGASTIDRGFTNFVVLGNKKKFKGTSFSSKVLPVNKFYPLINAVDAKAN---NVSVSD  396

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  C  G+LDPEK+ GK++VCL+G   R+ K + AA AGAVGM++ NDE+SGN I+ D+H
Sbjct  397   AEVCDEGSLDPEKLAGKIVVCLRGGLPRVSKGYVAAKAGAVGMLVVNDEESGNAILTDSH  456

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HVTY D ++IF YIN T+ P+A+I+   T L + P+PV+A FSSRGPN I   IL
Sbjct  457   VLPASHVTYDDSISIFQYINSTKTPMAYISSVMTELEITPSPVVADFSSRGPNTIEESIL  516

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI APGVN++AA+ +    ++   D R   F V+SGTSM+CPH+AG+VGLLKTL P W
Sbjct  517   KPDIIAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHIAGIVGLLKTLNPKW  576

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA    N+   I  D  GL+  P AYGAGH+NPN A DPGLVYD+ + D
Sbjct  577   SPAAIKSAIMTTAKTTDNNFNPIV-DYGGLEANPLAYGAGHVNPNSAMDPGLVYDITIDD  635

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGS  384
             Y+NF+CA+GYN T+I  +    + C     ++  NYPSI+V +LK G   + R LKNVGS
Sbjct  636   YLNFLCARGYNTTQIKRISKKNFVCDKSFKVTDLNYPSISVTNLKMGPVAINRKLKNVGS  695

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A V++P+  S+ V P+IL F  + EE+SFKV L   G+     Y FG L W+D  
Sbjct  696   PGTYVARVKTPLEVSIIVEPRILDFTAMDEEKSFKVLLNRSGKGKQEGYVFGELVWTDVN  755

Query  203   HRVRSPIVV  177
               VR+PIVV
Sbjct  756   RHVRTPIVV  764



>ref|XP_004148289.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=768

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/729 (54%), Positives = 518/729 (71%), Gaps = 12/729 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D  R   SH+ LLG+ LGS   A + I YSY ++INGF AML+E++A ++ K P V+S+
Sbjct  47    LDHQRATASHYDLLGSALGSKKTAEEVILYSYNKNINGFVAMLDEKQATDLTKFPHVVSI  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F +++R+L TT+SW+FLG+E    ++   SIW  A+FGED II N DTGVWPESKSFS+E
Sbjct  107   FESQSRKLHTTQSWKFLGVEKYEQILASNSIWNVARFGEDIIIANFDTGVWPESKSFSDE  166

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G+GPIP RW G CQ+  D  F CNRKLIGAR+F  GY    G L  +F + RD +GHG+H
Sbjct  167   GYGPIPPRWMGTCQSDADPKFRCNRKLIGARFFNIGY----GELTDTFNSSRDNVGHGTH  222

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLS AGGNFVPGANV G+GNGT KGGSP+ARVA+YKVCWP  +   +C D + LA F+ A
Sbjct  223   TLSIAGGNFVPGANVLGMGNGTVKGGSPRARVASYKVCWPDET--NECVDPNTLAAFEAA  280

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             IEDGVDV+S+S+GG+ P  +F+D+L++G+FHAV+ GIVVV+SAGN GP  G+V+NV+PW+
Sbjct  281   IEDGVDVISISVGGE-PKEFFSDALSVGAFHAVERGIVVVSSAGNVGPTPGTVSNVSPWI  339

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TVGA+T+DR F + VVLGNKK + G S     LP  KFYPL++A  A+     ++S  D
Sbjct  340   LTVGASTIDRGFTNFVVLGNKKKFKGTSFSSKVLPVNKFYPLINAVDAKAN---NVSVSD  396

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  C  G+LDPEK+ GK++VCL+G   R+ K + AA AGAVGM++ NDE+SGN I+ D+H
Sbjct  397   AEVCDEGSLDPEKLAGKIVVCLRGGLPRVSKGYVAAKAGAVGMLVVNDEESGNAILTDSH  456

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPA+HVTY D ++IF YIN T+ P+A+I+   T L + P+PV+A FSSRGPN I   IL
Sbjct  457   VLPASHVTYDDSISIFQYINSTKTPMAYISSVMTELEITPSPVVADFSSRGPNTIEESIL  516

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI APGVN++AA+ +    ++   D R   F V+SGTSM+CPH+AG+VGLLKTL P W
Sbjct  517   KPDIIAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHIAGIVGLLKTLNPKW  576

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA    N+   I  D  GL+  P AYGAGH+NPN A DPGLVYD+ + D
Sbjct  577   SPAAIKSAIMTTAKTTDNNFNPIV-DYGGLEANPLAYGAGHVNPNSAMDPGLVYDITIDD  635

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGS  384
             Y+NF+CA+GYN T+I  +    + C     ++  NYPSI+V +LK G   + R LKNVGS
Sbjct  636   YLNFLCARGYNTTQIKRISKKNFVCDKSFKVTDLNYPSISVTNLKMGPVAINRKLKNVGS  695

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P TY A V++P+  S+ V P+IL F  + EE+SFKV L   G+     Y FG L W+D  
Sbjct  696   PGTYVARVKTPLEVSIIVEPRILDFTAMDEEKSFKVLLNRSGKGKQEGYVFGELVWTDVN  755

Query  203   HRVRSPIVV  177
               VR+PIVV
Sbjct  756   RHVRTPIVV  764



>ref|XP_003608830.1| Subtilisin-like serine protease [Medicago truncatula]
Length=1572

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/739 (57%), Positives = 536/739 (73%), Gaps = 13/739 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D++ V +SH+ LLG+Y+GS DKA++AIFYSY+++ NGFAA+L+E+EAA +AK+P V S+
Sbjct  46    LDIESVTNSHYNLLGSYVGSTDKAKEAIFYSYSKYFNGFAAVLDEDEAAMVAKHPNVASI  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SW+FLGLE   GVI  GS+W K+K GED IIGNLDTGVWPESKSFS+E
Sbjct  106   FLNKPRKLHTTHSWDFLGLE-RNGVIPKGSLWSKSK-GEDIIIGNLDTGVWPESKSFSDE  163

Query  2000  GFGPIPKRWKGICQNQKDKS--FHCNRKLIGARYFIQGYSSAVGP-LNSSFFTPRDVIGH  1830
             G GP+P RW+GIC    D +  F CNRKLIGARYF +GY +  G   N +F + RD  GH
Sbjct  164   GVGPVPTRWRGICDVDIDNTDKFKCNRKLIGARYFYKGYLADAGKSTNVTFHSARDFDGH  223

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLSTAGGNFV  A+VFG G GTA GGSP ARVAAYKVCWPP + G  CY+ADILAGF
Sbjct  224   GSHTLSTAGGNFVANASVFGNGLGTASGGSPNARVAAYKVCWPPLAVGGGCYEADILAGF  283

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             + AI DGVDV+S S+GGD P  ++  S+AIGSFHAV NGIVVV+SAGN GP   + +N+ 
Sbjct  284   EAAILDGVDVISASVGGD-PVEFYESSIAIGSFHAVANGIVVVSSAGNTGPKPKTASNLE  342

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW ITV A+T DR F S V LGNKK   G S     LP  KFYPL+SA  A+       S
Sbjct  343   PWSITVAASTTDREFTSYVTLGNKKILKGASLSESHLPPHKFYPLISAVDAKAD---RAS  399

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
             + DAL CK GTLD +K KGK++VCL+G+NDR +K  +AA AGAVGMILAN+ +SGN++++
Sbjct  400   SDDALLCKKGTLDSKKAKGKIVVCLRGDNDRTDKGVQAARAGAVGMILANNIESGNDVLS  459

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D H LPA+H+ Y DG  IF Y+N T++P A I+   T LG  P+P++A+FSSRGPN I+P
Sbjct  460   DPHVLPASHLGYDDGSYIFSYLNNTKSPKASISKVETKLGQSPSPIMASFSSRGPNIIDP  519

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
              ILKPDI+ PGV+++AA++EA  PS    DKR   F   SGTSMS PHV+G+VG++K+L+
Sbjct  520   SILKPDITGPGVDIVAAYSEAASPSQQKSDKRRSPFITLSGTSMSTPHVSGIVGIIKSLH  579

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P WSPA I+SAIMTTA ++ N+GK I  D T +   PFAYGAG + PN A DPGLVYDL 
Sbjct  580   PDWSPAAIKSAIMTTARIKDNTGKPIL-DSTRINANPFAYGAGQVQPNHAVDPGLVYDLN  638

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLK  396
             +TDY N++C +GY  + +T   G  Y CP   +L  FNYPSI++P+LK      VTRTL 
Sbjct  639   ITDYTNYLCNRGYKGSRLTIFYGKRYICPKSFNLLDFNYPSISIPNLKIRDFLNVTRTLT  698

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATADYAFGVLT  219
             NVGSP+TY   +++P    V+V PK+L F++ GE++ F+VT   K   N + DY FG L 
Sbjct  699   NVGSPSTYKVHIQAPHEVLVSVEPKVLNFKEKGEKKEFRVTFSLKTLTNNSTDYLFGSLD  758

Query  218   WSDKKHRVRSPIVVKTA*M  162
             WSD KH VRS IV+  A M
Sbjct  759   WSDCKHHVRSSIVINGAQM  777


 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/748 (57%), Positives = 539/748 (72%), Gaps = 32/748 (4%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D +   +SH+ +L +Y+GS +KA++AIFYSY R+INGFAA+L+EEEAA+++K+P V+SVF
Sbjct  834   DFELATNSHYDILASYVGSTEKAKEAIFYSYNRYINGFAAILDEEEAAQLSKHPNVVSVF  893

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+  +L TTRSW FLGLE  GG     S+WKK+  G+D IIGNLDTGVWPESKSFS+EG
Sbjct  894   LNKKYELHTTRSWGFLGLE-RGGEFSKDSLWKKS-LGKDIIIGNLDTGVWPESKSFSDEG  951

Query  1997  FGPIPKRWKGICQNQKDK--SFHCNRKLIGARYFIQGY-SSAVGPLNSSFFTPRDVIGHG  1827
             FG IPK+W+GICQ  K    +FHCNRKLIGARYF +G+ ++     N S  + RD  GHG
Sbjct  952   FGLIPKKWRGICQVTKGNPDNFHCNRKLIGARYFFKGFLANPYRAKNVSLHSARDSEGHG  1011

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLSTAGGNFV  A+VFG GNGTA GGSPKARVAAYKVCW      + CYDADILAGF+
Sbjct  1012  SHTLSTAGGNFVANASVFGNGNGTASGGSPKARVAAYKVCW------DGCYDADILAGFE  1065

Query  1646  RAIEDGVDVLSVSLG-GDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
              AI DGVDVLSVSLG G     Y  +S++IGSFHAV N I+VVAS GN GPV  +V+N+ 
Sbjct  1066  AAISDGVDVLSVSLGSGGLAQEYSQNSISIGSFHAVANNIIVVASGGNSGPVPSTVSNLE  1125

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW +TV A+T+DR F S V+LGNKK   G S   L+LP  K YPL+SAA  +      +S
Sbjct  1126  PWTLTVAASTIDRDFTSYVILGNKKILKGASLSELELPPHKLYPLISAADVKFD---HVS  1182

Query  1289  TQDA------------LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMIL  1146
              +DA            L C  G LDP K KGK+LVCL+G+++R++K  EA+  GA+GMIL
Sbjct  1183  AEDADCFKMTISFFLVLFCNHGALDPHKAKGKILVCLRGDSNRVDKGVEASRVGAIGMIL  1242

Query  1145  ANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIA  966
             AND+ SG EII DAH LPA+HV++ DG  IF Y+N T++PVA+IT   T LGVK +P IA
Sbjct  1243  ANDKGSGGEIIDDAHVLPASHVSFKDGDLIFKYVNNTKSPVAYITRVKTQLGVKASPSIA  1302

Query  965   AFSSRGPNAINPDILK-PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  789
             AFSSRGPN ++P ILK PDI+APGVN+IAA++EA  P++N YDKR   F   SGTSMSCP
Sbjct  1303  AFSSRGPNRLDPSILKVPDITAPGVNIIAAYSEAISPTENSYDKRRTPFITMSGTSMSCP  1362

Query  788   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINP  609
             HVAG+VGLLK+++P WSPA I+SAIMTTAT + N G  +  D +  + TP AYGAGH+ P
Sbjct  1363  HVAGLVGLLKSIHPDWSPAAIKSAIMTTATTKNNIGGHVL-DSSQEEATPNAYGAGHVRP  1421

Query  608   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  429
             N AADPGLVYDL +TDY+NF+C +GYN +++    G  Y CP   +L  FNYP+ITVP +
Sbjct  1422  NLAADPGLVYDLNITDYLNFLCGRGYNSSQLKLFYGRSYTCPKSFNLIDFNYPAITVPDI  1481

Query  428   K--GTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKG  258
             K      VTRT+ NVGSP+ Y   +++P    V+VNP+ L F+K GE++ FKVTL   KG
Sbjct  1482  KIGQPLNVTRTVTNVGSPSKYRVLIQAPAELLVSVNPRRLNFKKKGEKREFKVTLTLKKG  1541

Query  257   ENATADYAFGVLTWSDKKHRVRSPIVVK  174
                  DY FG L W+D KH+V +PI +K
Sbjct  1542  TTYKTDYVFGKLVWNDGKHQVGTPIAIK  1569



>ref|XP_008645399.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 gb|AFW70717.1| putative subtilase family protein [Zea mays]
Length=805

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/734 (57%), Positives = 514/734 (70%), Gaps = 13/734 (2%)
 Frame = -2

Query  2354  LDR-VKHSHHQLLGTYLG-SWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             L+R    +H  LL   LG    KAR+AIFYSYT+HINGFAA L+   AAEIA  P VISV
Sbjct  76    LERDAAEAHCDLLAGVLGGDKQKAREAIFYSYTKHINGFAANLDAATAAEIAGKPGVISV  135

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N+ R+L TTRSW+F+GL G GGV H G+ W+KAKFG DTIIGN DTGVWPES+SF ++
Sbjct  136   FPNQGRKLHTTRSWQFVGLAGPGGVPHGGA-WRKAKFGADTIIGNFDTGVWPESESFRDD  194

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GP+P  WKG C   +D  FHCNRKLIGARYF +GY++A G LN+S  TPRD+ GHG+H
Sbjct  195   GLGPVPSHWKGACDKGQDDKFHCNRKLIGARYFNKGYAAAAGALNASMNTPRDMDGHGTH  254

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGG+ VPGA+VFG GNGTA GGSP+ARVAAY+VC+PP + G +C+DADILA FD A
Sbjct  255   TLSTAGGSPVPGASVFGFGNGTASGGSPRARVAAYRVCFPPVN-GSECFDADILAAFDAA  313

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGV VLS+SLGGD P  Y +D +AIGSFHAV+ GI VV SAGN GP  G+ +N+APWL
Sbjct  314   IHDGVHVLSLSLGGD-PSDYLDDGIAIGSFHAVRRGISVVCSAGNSGPALGTASNLAPWL  372

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +T GA+TMDR F S +V  + K   G+S     LP    YPL+ +  A      +   Q 
Sbjct  373   LTTGASTMDREFPSYIVFDHTKA-KGQSLSMTTLPEKTSYPLIDSVKAAAANATTKDAQ-  430

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
                C  G+LDP K KGK++VCL+G N R+ K      AG VGM+LAND  +GNEIIADAH
Sbjct  431   --LCMIGSLDPAKAKGKIVVCLRGINPRVAKGEAVKQAGGVGMVLANDASTGNEIIADAH  488

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LPAT + Y DGL ++ Y+N T+ P   IT P T+LG KPAP +AAFSS+GPN I P IL
Sbjct  489   VLPATQIKYRDGLLLYSYVNSTKKPTGFITRPATVLGTKPAPFMAAFSSQGPNIITPGIL  548

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+VIAA+T A  P+D  +D+R V+FN ESGTSMSCPHV+GVVGLL+TL+P W
Sbjct  549   KPDITAPGVSVIAAWTRANSPTDLAFDRRRVAFNSESGTSMSCPHVSGVVGLLRTLHPEW  608

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA    N G+ I  + + L ++PF YGAGHI+P  A +PGLVYDL   D
Sbjct  609   SPAAIKSAIMTTAAEMDNKGELIL-NASSLPSSPFGYGAGHISPARAMNPGLVYDLGDAD  667

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLKGT-ATVTRTLKNV  390
             Y++F+CA  YN T +    G PY CP      ++  NYPSITV ++    AT  R +KNV
Sbjct  668   YLDFLCALKYNATVMAMFKGAPYTCPSEAPRRIADLNYPSITVVNVTAAGATALRKVKNV  727

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             G P TYTA V  P G +V V P +LKF   GEE+ F+V  K        DY+FG L W++
Sbjct  728   GKPGTYTAFVAEPAGVAVLVTPSVLKFSAKGEEKGFEVHFKVVNATLARDYSFGALVWTN  787

Query  209   KKHRVRSPIVVKTA  168
              +  VRSP+VVK A
Sbjct  788   GRQFVRSPLVVKAA  801



>ref|XP_008464322.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=776

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/736 (56%), Positives = 527/736 (72%), Gaps = 18/736 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL+RV  SHH+LLG+ +GS +KARDAIFYSY R+INGFAA+++EEEA ++AK+PEV +V 
Sbjct  49    DLERVADSHHKLLGSIIGSDEKARDAIFYSYKRNINGFAAIMDEEEATQLAKHPEVAAVL  108

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             LN+A++L TT SWEF+ LE + GVI   S W++AK G+D IIGNLDTGVW ESKSF E G
Sbjct  109   LNKAKKLHTTHSWEFMHLE-KNGVIPPSSAWRRAKSGKDVIIGNLDTGVWGESKSFGEHG  167

Query  1997  F-GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLN---SSFFTPRDVIGH  1830
               G +P +WKG C ++      CNRKLIGA+YF +G+ + +   N   S   + RD  GH
Sbjct  168   IVGAVPSKWKGGCTDKTPDGVSCNRKLIGAKYFNKGFLAYLNSQNLTASVINSTRDYDGH  227

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLSTAGG++V GA+VFGLG GTAKGGSPKARVA+YKVCWP    G  C++ADI   F
Sbjct  228   GSHTLSTAGGSYVSGASVFGLGVGTAKGGSPKARVASYKVCWPLEDGG--CFEADIAEAF  285

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             D AI D VDVLS+SLGG+ P  Y++D +AI +FHAVK GI VV SAGN GP A +V+N A
Sbjct  286   DHAIHDRVDVLSLSLGGE-PADYYDDGIAIAAFHAVKKGIPVVCSAGNSGPAAQTVSNTA  344

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW++TVGA+T+DR FQ+ V L N   Y G S++   L   K YPL++ A A+ K   + +
Sbjct  345   PWILTVGASTLDREFQAPVELQNGHSYMG-SSLSKGLKGDKLYPLITGAEAKAK---NAT  400

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
              + A+ CKP TLD  KVKGK+LVCL+G+  R++K  +AALAGAVGMIL ND+ SG E IA
Sbjct  401   AEVAMLCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDKLSGFETIA  460

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D H LPA+H+ Y+DG A+F YI  T+NP+  +  P+  +  KPAP +AAFSSRGPN I+P
Sbjct  461   DPHVLPASHINYNDGQAVFSYIKSTKNPMGSLIPPSAKVNTKPAPSMAAFSSRGPNLISP  520

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +I+KPD++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+
Sbjct  521   EIIKPDVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLH  580

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTG--LKTTPFAYGAGHINPNGAADPGLVYD  576
             P WSP+ I+SAIMT+A +R N+ K + D  +      TPFAYG+GHI P GA DPGLVYD
Sbjct  581   PHWSPSAIKSAIMTSARIRDNTKKPMLDGGSPDLAPATPFAYGSGHIRPTGAIDPGLVYD  640

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLK  396
             L   DY+ F+CA GYN+  I A    P+KCP   S+  FNYPSI V +L G+ T+TR LK
Sbjct  641   LSPNDYLEFLCASGYNEKTIQAFSDGPFKCPASASILNFNYPSIGVQNLTGSVTLTRKLK  700

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAFGVLT  219
             NV +P  Y A V  P G  V V PK+LKFE+VGEE+ F++ +     EN   D   GVL 
Sbjct  701   NVSTPGVYKARVMHPNGVKVLVKPKVLKFERVGEEKRFELIITGDVPENQVVD---GVLI  757

Query  218   WSDKKHRVRSPIVVKT  171
             W+D KH VRSPIVV +
Sbjct  758   WTDGKHFVRSPIVVSS  773



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/732 (55%), Positives = 520/732 (71%), Gaps = 19/732 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D +    SH+QLLG+  GS + AR AIFYSYT+HINGFAAMLEEEEA  I+++P+VISVF
Sbjct  46    DFESATQSHYQLLGSTFGSEELARSAIFYSYTKHINGFAAMLEEEEATLISEHPDVISVF  105

Query  2177  LNRARQLQTTRSWEFLG-LEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
              N  + L TTRSW+ +G      G  H  SIW KA +G+D II N DTGVWPES SF ++
Sbjct  106   ENTMKTLHTTRSWDVMGGFLNRQGKAHPESIWAKANYGDDVIIANFDTGVWPESDSFDDK  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGY--SSAVGPLNSSFFTPRDVIGHG  1827
             G+GP+PKRW+GICQN    SFHCNRKLIGAR++   +  +SA  P+    ++PRD  GHG
Sbjct  166   GYGPVPKRWRGICQNSTKHSFHCNRKLIGARFYDLSHQANSASPPVE---YSPRDSEGHG  222

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             +HTLSTA G  V GAN++G  NGTA+GGSP ARVAAYKVCW        C DA+ILA FD
Sbjct  223   THTLSTAAGGIVRGANIYGEANGTARGGSPHARVAAYKVCW------GLCADANILAAFD  276

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDV+S+S+GG  P  Y  DS+A+GSFHAV+ GI VV SAGN+GP  G+V+N+AP
Sbjct  277   DAIHDGVDVISLSVGG-LPYEYIFDSIALGSFHAVQRGITVVCSAGNDGPTPGTVSNIAP  335

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W+ TVGA+T+DR F S V LG+ K   G S     LP  K YPL+  ++A+     + S 
Sbjct  336   WIFTVGASTIDREFYSLVTLGSNKKIKGVSLSSKSLPAHKPYPLIDGSNAK---RPNSSA  392

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGEN-DRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
             ++A  C PGTLDPEKV+GK++VC +  +  R+EK  +   AG  GMILAN ++ GN ++A
Sbjct  393   EEAGWCYPGTLDPEKVRGKIVVCTRDTSFARVEKGVDVLKAGGAGMILANSDEEGNSLLA  452

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D HFLPA+ +TY D L +  Y+  T++P A I+   T+LGVKPAP +A+FSSRGPN INP
Sbjct  453   DPHFLPASMITYKDALRLSSYLKSTKSPTATISPVTTVLGVKPAPAMASFSSRGPNLINP  512

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +ILKPDI+APGV+++AAFTE  GP+  D DKR V FNV SGTSMSCPH++GV GLLK L+
Sbjct  513   EILKPDITAPGVDILAAFTEEVGPTMLDLDKRRVRFNVMSGTSMSCPHISGVAGLLKKLH  572

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P WSPA IRSA+MTTA  R N+   + DD    K  PF YGAGH+ PN A DPGLVYD+ 
Sbjct  573   PRWSPAVIRSAVMTTARTRDNTRTPMKDDNRE-KAIPFDYGAGHVRPNRAMDPGLVYDIT  631

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKN  393
              TDYV+F+C++GYN + +   +G  + CP   +     NYPSITVP+L+ + TV+RT++N
Sbjct  632   FTDYVHFLCSRGYNASNMAQFIGKRFACPSKTMRAEDLNYPSITVPNLQKSFTVSRTVRN  691

Query  392   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  213
             VG+P TY   +++P G  V+V P+ L+F KVGEE++F+V L+++ E+    Y FG LTW+
Sbjct  692   VGTPGTYNVRIKAPFGIHVSVKPQTLEFAKVGEEKTFQVRLRSRSESVGVGYVFGGLTWT  751

Query  212   DKKHRVRSPIVV  177
             D KH VRSP+VV
Sbjct  752   DGKHYVRSPLVV  763



>ref|XP_008448997.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=776

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/727 (55%), Positives = 517/727 (71%), Gaps = 12/727 (2%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
              +V   H+ LLG+ LGS   A +AIFYSYTR  NGFAA+L+++EA  +A+NP+VISVF N
Sbjct  52    QQVTALHYDLLGSSLGSKTMAEEAIFYSYTRSFNGFAAILDDKEAENLARNPKVISVFEN  111

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
             +AR+L TTRSW FLG+E + G I   SIW  AKFGED II N+DTGVWPESKSFS+EG+G
Sbjct  112   KARKLHTTRSWNFLGVENDIG-IPSNSIWNAAKFGEDVIIANIDTGVWPESKSFSDEGYG  170

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLS  1812
             P+P +W+GICQ   D +FHCNRKLIG RYF +GY +A G LN++  T RD  GHG+HTLS
Sbjct  171   PVPSKWRGICQT--DSNFHCNRKLIGGRYFHKGYEAAGGKLNATLLTVRDHDGHGTHTLS  228

Query  1811  TAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIED  1632
             TA GNFV GANVFG GNGTAKGG+PKAR  AYKVCWPP    + C+DADILA F+ AI D
Sbjct  229   TAAGNFVTGANVFGHGNGTAKGGAPKARAVAYKVCWPPLFDSQ-CFDADILAAFEAAIAD  287

Query  1631  GVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITV  1452
             GVDVLS SLGG     YFND LAI +F AV+ GI+VV S GN GP   +V NV+PW+ TV
Sbjct  288   GVDVLSTSLGG-AADEYFNDPLAIAAFLAVQRGILVVFSGGNSGPFPMTVTNVSPWVFTV  346

Query  1451  GANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALH  1272
              ANT+DR F S V LGNKKH  G S   +     KFYPL+++  A+    ++++   A  
Sbjct  347   AANTIDRDFVSYVGLGNKKHVKGVSLSSVASLPKKFYPLINSVDAKF---SNVTEFHAQF  403

Query  1271  CKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLP  1092
             C  GTLDP KVKGK+++C  GE + ++K ++A+LAGA G+I+AND + G+EI  + HF+P
Sbjct  404   CGKGTLDPMKVKGKIVICQVGETEGVDKGYQASLAGAAGVIVANDIEKGDEIYPELHFIP  463

Query  1091  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  912
             A+ +T +D   +  Y+  T+ P+AH+T   TLL VKPAP+IA FSSRGPN I+  ILKPD
Sbjct  464   ASDITNTDAQIVQKYLKSTKTPIAHLTSVKTLLSVKPAPIIATFSSRGPNPIDSTILKPD  523

Query  911   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  732
             ++APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSPA
Sbjct  524   VTAPGVNILASYPTGIAPTFSAADRRRIPFNVISGTSMSCPHVAGIAGLVKSIHPNWSPA  583

Query  731   EIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVN  552
              I+SAIMTTA  R N+ + I D  T LK TP+AYGAG + PN AADPGLVYD+ + DY+N
Sbjct  584   AIKSAIMTTAKTRGNNNQTILDS-TKLKATPYAYGAGQVYPNDAADPGLVYDITINDYLN  642

Query  551   FICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSPA  378
             F+CA+GY+  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP 
Sbjct  643   FLCARGYDAMKIKKFYAKPFNCVRSFKVTDLNYPSISVGELKIGAPLTINRRVKNVGSPG  702

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             TY A V++  G +VT+ P  L F  VGEE+ FKV L+  G+  + D  FG L WSD KH 
Sbjct  703   TYVARVKASPGVAVTIEPSTLVFRSVGEEKGFKVVLQNTGKVKSGD-VFGTLIWSDGKHF  761

Query  197   VRSPIVV  177
             VRSPI V
Sbjct  762   VRSPIAV  768



>ref|XP_010647021.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=725

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/734 (57%), Positives = 528/734 (72%), Gaps = 22/734 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DL+R+  SHH LLG+ LGS +KA+++IFYSYT HINGFAA LE+EEAAE++K P V+S+
Sbjct  1     MDLNRITDSHHDLLGSCLGSKEKAQESIFYSYTHHINGFAANLEDEEAAELSKRPGVVSI  60

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +LQTTRSWEFLGLE  G +  D SIW KA+FGED IIGN+DTGVWPES+SF+++
Sbjct  61    FLNQKHKLQTTRSWEFLGLERNGEIPAD-SIWVKARFGEDIIIGNIDTGVWPESESFNDQ  119

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GPIP +WKG C+   D    CNRKLIGARYF +G  + +G PLNSS+ T RD  GHG+
Sbjct  120   GMGPIPSKWKGYCEPNDD--VKCNRKLIGARYFNRGVEAKLGSPLNSSYQTVRDTNGHGT  177

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G G GTAKGGSP ARVA+YK CWP      DC DAD+LA  D 
Sbjct  178   HTLSTAGGRFVGGANLLGSGYGTAKGGSPSARVASYKSCWP------DCNDADVLAAIDA  231

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LS+S+       YF DS+AIGS HAV+NGIVVV + GN GP  GSV N APW
Sbjct  232   AIHDGVDILSLSIAFVSRD-YFLDSIAIGSLHAVQNGIVVVCAGGNSGPTPGSVTNSAPW  290

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F SNV+LGN K + G S     L   KFYPL+ +  AR    A+ S +
Sbjct  291   IITVAASTIDREFPSNVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARA---ANASAR  347

Query  1283  DALHCKPGTLDPEKVKGKVLVCL---QGEND-RIEKSHEAALAGAVGMILANDEDSGNEI  1116
             DA  C  G+LDP+KVKGK++ CL    G N   +EKS   A AG +GMILAN   +   +
Sbjct  348   DAQLCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTAT-L  406

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             I  AHF+P + V+ +DGLAI  YI+ T+ PVA+I+   T +G   AP++A+FSS+GPN I
Sbjct  407   IPQAHFVPTSRVSAADGLAILLYIHTTKYPVAYISGA-TEVGTVTAPIMASFSSQGPNTI  465

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
              P+ILKPDI+APGV +IAA+TEA GP+    D R V FN+ SGTSMSCPHV+G VGLLK 
Sbjct  466   TPEILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKK  525

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             ++P+WSP+ IRSAIMT+A  R+N  + I +  T     PF YGAGH++PN A DPGLVYD
Sbjct  526   IHPNWSPSAIRSAIMTSARTRSNLRQPIANG-TLAGGNPFNYGAGHLSPNRAMDPGLVYD  584

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLS-TFNYPSITVPHLKGTATVTRTL  399
             L +TDY+NF+C+ GYN T+++  +   Y+CP   +     NYPSITVP L G  TVTRTL
Sbjct  585   LTITDYLNFLCSIGYNATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTL  644

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLT  219
             KNVG+PATYT  +++P G SV V PK L+FEK+ EE+ FKVT++AK ++   +Y FG L 
Sbjct  645   KNVGTPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLI  704

Query  218   WSDKKHRVRSPIVV  177
             WSD KH V SPIVV
Sbjct  705   WSDGKHFVGSPIVV  718



>emb|CBI38460.3| unnamed protein product [Vitis vinifera]
Length=783

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/734 (57%), Positives = 528/734 (72%), Gaps = 22/734 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DL+R+  SHH LLG+ LGS +KA+++IFYSYT HINGFAA LE+EEAAE++K P V+S+
Sbjct  59    MDLNRITDSHHDLLGSCLGSKEKAQESIFYSYTHHINGFAANLEDEEAAELSKRPGVVSI  118

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +LQTTRSWEFLGLE  G +  D SIW KA+FGED IIGN+DTGVWPES+SF+++
Sbjct  119   FLNQKHKLQTTRSWEFLGLERNGEIPAD-SIWVKARFGEDIIIGNIDTGVWPESESFNDQ  177

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GPIP +WKG C+   D    CNRKLIGARYF +G  + +G PLNSS+ T RD  GHG+
Sbjct  178   GMGPIPSKWKGYCEPNDD--VKCNRKLIGARYFNRGVEAKLGSPLNSSYQTVRDTNGHGT  235

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G G GTAKGGSP ARVA+YK CWP      DC DAD+LA  D 
Sbjct  236   HTLSTAGGRFVGGANLLGSGYGTAKGGSPSARVASYKSCWP------DCNDADVLAAIDA  289

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LS+S+       YF DS+AIGS HAV+NGIVVV + GN GP  GSV N APW
Sbjct  290   AIHDGVDILSLSIAFVSRD-YFLDSIAIGSLHAVQNGIVVVCAGGNSGPTPGSVTNSAPW  348

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F SNV+LGN K + G S     L   KFYPL+ +  AR    A+ S +
Sbjct  349   IITVAASTIDREFPSNVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARA---ANASAR  405

Query  1283  DALHCKPGTLDPEKVKGKVLVCL---QGEND-RIEKSHEAALAGAVGMILANDEDSGNEI  1116
             DA  C  G+LDP+KVKGK++ CL    G N   +EKS   A AG +GMILAN   +   +
Sbjct  406   DAQLCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTAT-L  464

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             I  AHF+P + V+ +DGLAI  YI+ T+ PVA+I+   T +G   AP++A+FSS+GPN I
Sbjct  465   IPQAHFVPTSRVSAADGLAILLYIHTTKYPVAYISGA-TEVGTVTAPIMASFSSQGPNTI  523

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
              P+ILKPDI+APGV +IAA+TEA GP+    D R V FN+ SGTSMSCPHV+G VGLLK 
Sbjct  524   TPEILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKK  583

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             ++P+WSP+ IRSAIMT+A  R+N  + I +  T     PF YGAGH++PN A DPGLVYD
Sbjct  584   IHPNWSPSAIRSAIMTSARTRSNLRQPIANG-TLAGGNPFNYGAGHLSPNRAMDPGLVYD  642

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLS-TFNYPSITVPHLKGTATVTRTL  399
             L +TDY+NF+C+ GYN T+++  +   Y+CP   +     NYPSITVP L G  TVTRTL
Sbjct  643   LTITDYLNFLCSIGYNATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTL  702

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLT  219
             KNVG+PATYT  +++P G SV V PK L+FEK+ EE+ FKVT++AK ++   +Y FG L 
Sbjct  703   KNVGTPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLI  762

Query  218   WSDKKHRVRSPIVV  177
             WSD KH V SPIVV
Sbjct  763   WSDGKHFVGSPIVV  776



>ref|XP_010647020.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
Length=771

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/734 (57%), Positives = 528/734 (72%), Gaps = 22/734 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DL+R+  SHH LLG+ LGS +KA+++IFYSYT HINGFAA LE+EEAAE++K P V+S+
Sbjct  47    MDLNRITDSHHDLLGSCLGSKEKAQESIFYSYTHHINGFAANLEDEEAAELSKRPGVVSI  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +LQTTRSWEFLGLE  G +  D SIW KA+FGED IIGN+DTGVWPES+SF+++
Sbjct  107   FLNQKHKLQTTRSWEFLGLERNGEIPAD-SIWVKARFGEDIIIGNIDTGVWPESESFNDQ  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GPIP +WKG C+   D    CNRKLIGARYF +G  + +G PLNSS+ T RD  GHG+
Sbjct  166   GMGPIPSKWKGYCEPNDD--VKCNRKLIGARYFNRGVEAKLGSPLNSSYQTVRDTNGHGT  223

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G G GTAKGGSP ARVA+YK CWP      DC DAD+LA  D 
Sbjct  224   HTLSTAGGRFVGGANLLGSGYGTAKGGSPSARVASYKSCWP------DCNDADVLAAIDA  277

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LS+S+       YF DS+AIGS HAV+NGIVVV + GN GP  GSV N APW
Sbjct  278   AIHDGVDILSLSIAFVSRD-YFLDSIAIGSLHAVQNGIVVVCAGGNSGPTPGSVTNSAPW  336

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F SNV+LGN K + G S     L   KFYPL+ +  AR    A+ S +
Sbjct  337   IITVAASTIDREFPSNVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARA---ANASAR  393

Query  1283  DALHCKPGTLDPEKVKGKVLVCL---QGEND-RIEKSHEAALAGAVGMILANDEDSGNEI  1116
             DA  C  G+LDP+KVKGK++ CL    G N   +EKS   A AG +GMILAN   +   +
Sbjct  394   DAQLCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTAT-L  452

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             I  AHF+P + V+ +DGLAI  YI+ T+ PVA+I+   T +G   AP++A+FSS+GPN I
Sbjct  453   IPQAHFVPTSRVSAADGLAILLYIHTTKYPVAYISGA-TEVGTVTAPIMASFSSQGPNTI  511

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
              P+ILKPDI+APGV +IAA+TEA GP+    D R V FN+ SGTSMSCPHV+G VGLLK 
Sbjct  512   TPEILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKK  571

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             ++P+WSP+ IRSAIMT+A  R+N  + I +  T     PF YGAGH++PN A DPGLVYD
Sbjct  572   IHPNWSPSAIRSAIMTSARTRSNLRQPIANG-TLAGGNPFNYGAGHLSPNRAMDPGLVYD  630

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLS-TFNYPSITVPHLKGTATVTRTL  399
             L +TDY+NF+C+ GYN T+++  +   Y+CP   +     NYPSITVP L G  TVTRTL
Sbjct  631   LTITDYLNFLCSIGYNATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTL  690

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLT  219
             KNVG+PATYT  +++P G SV V PK L+FEK+ EE+ FKVT++AK ++   +Y FG L 
Sbjct  691   KNVGTPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLI  750

Query  218   WSDKKHRVRSPIVV  177
             WSD KH V SPIVV
Sbjct  751   WSDGKHFVGSPIVV  764



>ref|NP_001046210.1| Os02g0198700 [Oryza sativa Japonica Group]
 dbj|BAD25466.1| putative subtilisin-like proteinase AIR3 [Oryza sativa Japonica 
Group]
 dbj|BAF08124.1| Os02g0198700 [Oryza sativa Japonica Group]
Length=799

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/732 (56%), Positives = 512/732 (70%), Gaps = 13/732 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             + + SH +LL   LG  +KAR+AIFYSYTRHINGFAA L+   AA+IA+ P V+SVF NR
Sbjct  69    QAEDSHCELLAGVLGDKEKAREAIFYSYTRHINGFAANLDAAAAAKIAEKPGVVSVFPNR  128

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSW+FLGL G GG    G+ WKKA+FGEDTIIGNLDTGVWPES+SF ++G GP
Sbjct  129   GHKLHTTRSWQFLGLAGVGGA-PTGAAWKKARFGEDTIIGNLDTGVWPESESFRDDGLGP  187

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-TPRDVIGHGSHTLS  1812
             IP  W+G CQ  +D +F CNRKLIGAR+F +GY+SAVG LN+S F TPRD  GHG+HTLS
Sbjct  188   IPSWWRGECQKGQDDAFSCNRKLIGARFFNKGYASAVGNLNTSLFDTPRDTDGHGTHTLS  247

Query  1811  TAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIED  1632
             TAGG  V GA+VFG GNGTA GGSP ARVAAY+VC+ P + G +C+DADILA FD AI D
Sbjct  248   TAGGAPVAGASVFGYGNGTASGGSPMARVAAYRVCYTPVN-GSECFDADILAAFDAAIHD  306

Query  1631  GVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITV  1452
             GV VLSVSLGGD  G YF D LAIGSFHAV++GI VV SAGN GP  G+V+NVAPWL T 
Sbjct  307   GVHVLSVSLGGDA-GDYFADGLAIGSFHAVRHGIAVVCSAGNSGPAPGTVSNVAPWLFTA  365

Query  1451  GANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALH  1272
              A+TMDR F + VV  + K      +     P    +P++ ++   +  + + +  ++  
Sbjct  366   AASTMDREFPAYVVFNDTKLKGQSLSASALSPASSSFPMIDSS---LAASPNRTQNESQL  422

Query  1271  CKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLP  1092
             C  G+LDPEKVKGK++VCL+G N R+EK      AG  GM+LAND  +GNEIIADAH LP
Sbjct  423   CFLGSLDPEKVKGKIVVCLRGVNPRVEKGEAVLEAGGAGMVLANDVTTGNEIIADAHVLP  482

Query  1091  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  912
             ATH+ +SDG  +F Y+  T++P   IT P T LG KPAP +AAFSS+GPN + P ILKPD
Sbjct  483   ATHIKFSDGQILFSYLKNTKSPAGTITRPETRLGTKPAPFMAAFSSQGPNTVTPGILKPD  542

Query  911   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  732
             I+APGV+V+AA+T A+ P+D  +DKR V+FN ESGTSMSCPHVAGVVGLL+TL P WSPA
Sbjct  543   ITAPGVSVVAAWTRASAPTDLAFDKRRVAFNSESGTSMSCPHVAGVVGLLRTLRPDWSPA  602

Query  731   EIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVN  552
              IRSA+MTTA    N   AI +        PF +GAGH++P  A +PGLVYDL   DY+N
Sbjct  603   AIRSALMTTAVEVDNERHAILNSSFA-AANPFGFGAGHVSPARAMNPGLVYDLAAVDYLN  661

Query  551   FICAQGYNKT----EITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             F+C+  YN T            P++CP     +   NYPSITV +L  +ATV RT+KNVG
Sbjct  662   FLCSLSYNATVMAMFAGGGGAAPFRCPASPPKVQDLNYPSITVVNLTSSATVRRTVKNVG  721

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
              P  Y A V SP G  VTV+P  L F   GE+++F+V  +    +   DY+FG L W++ 
Sbjct  722   KPGVYKAYVTSPAGVRVTVSPDTLPFLLKGEKKTFQVRFEVTNASLAMDYSFGALVWTNG  781

Query  206   KHRVRSPIVVKT  171
             K  VRSP+VVKT
Sbjct  782   KQFVRSPLVVKT  793



>gb|EAY84890.1| hypothetical protein OsI_06255 [Oryza sativa Indica Group]
Length=791

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/732 (56%), Positives = 512/732 (70%), Gaps = 13/732 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             + + SH +LL   LG  +KAR+AIFYSYTRHINGFAA L+   AA+IA+ P V+SVF NR
Sbjct  61    QAEDSHCELLAGVLGDKEKAREAIFYSYTRHINGFAANLDAAAAAKIAEKPGVVSVFPNR  120

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
               +L TTRSW+FLGL G GG    G+ WKKA+FGEDTIIGNLDTGVWPES+SF ++G GP
Sbjct  121   GHKLHTTRSWQFLGLAGVGGA-PTGAAWKKARFGEDTIIGNLDTGVWPESESFRDDGLGP  179

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-TPRDVIGHGSHTLS  1812
             IP  W+G CQ  +D +F CNRKLIGAR+F +GY+SAVG LN+S F TPRD  GHG+HTLS
Sbjct  180   IPSWWRGECQKGQDDAFSCNRKLIGARFFNKGYASAVGNLNTSLFDTPRDTDGHGTHTLS  239

Query  1811  TAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIED  1632
             TAGG  V GA+VFG GNGTA GGSP ARVAAY+VC+ P + G +C+DADILA FD AI D
Sbjct  240   TAGGAPVAGASVFGYGNGTASGGSPMARVAAYRVCYTPVN-GSECFDADILAAFDAAIHD  298

Query  1631  GVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITV  1452
             GV VLSVSLGGD  G YF D LAIGSFHAV++GI VV SAGN GP  G+V+NVAPWL T 
Sbjct  299   GVHVLSVSLGGD-AGDYFADGLAIGSFHAVRHGIAVVCSAGNSGPAPGTVSNVAPWLFTA  357

Query  1451  GANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALH  1272
              A+TMDR F + VV  + K      +     P    +P++ ++   +  + + +  ++  
Sbjct  358   AASTMDREFPAYVVFNDTKLKGQSLSASALSPASSSFPMIDSS---LAASPNRTQNESQL  414

Query  1271  CKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLP  1092
             C  G+LDPEKVKGK++VCL+G N R+EK      AG  GM+LAND  +GNEIIADAH LP
Sbjct  415   CFLGSLDPEKVKGKIVVCLRGVNPRVEKGEAVLEAGGAGMVLANDVTTGNEIIADAHVLP  474

Query  1091  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  912
             ATH+ +SDG  +F Y+  T++P   IT P T LG KPAP +AAFSS+GPN + P ILKPD
Sbjct  475   ATHIKFSDGQILFSYLKNTKSPAGTITRPETRLGTKPAPFMAAFSSQGPNTVTPGILKPD  534

Query  911   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  732
             I+APGV+V+AA+T A+ P+D  +DKR V+FN ESGTSMSCPHVAGVVGLL+TL P WSPA
Sbjct  535   ITAPGVSVVAAWTRASAPTDLAFDKRRVAFNSESGTSMSCPHVAGVVGLLRTLRPDWSPA  594

Query  731   EIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVN  552
              IRSA+MTTA    N   AI +        PF +GAGH++P  A +PGLVYDL   DY+N
Sbjct  595   AIRSALMTTAVEVDNERHAILNSSFA-AANPFGFGAGHVSPARAMNPGLVYDLAAVDYLN  653

Query  551   FICAQGYNKT----EITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             F+C+  YN T            P++CP     +   NYPSITV +L  +ATV RT+KNVG
Sbjct  654   FLCSLRYNATVMAMFAGGGGAAPFRCPASPPKVQDLNYPSITVVNLTSSATVRRTVKNVG  713

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
              P  Y A V SP G  VTV+P  L F   GE+++F+V  +    +   DY+FG L W++ 
Sbjct  714   KPGVYKAYVTSPAGVRVTVSPDTLPFLLKGEKKTFQVRFEVTNASLAMDYSFGALVWTNG  773

Query  206   KHRVRSPIVVKT  171
             K  VRSP+VVKT
Sbjct  774   KQFVRSPLVVKT  785



>ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/733 (57%), Positives = 520/733 (71%), Gaps = 22/733 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D++ +  SH++LLG+ + S +KAR+AIFYSYT +INGFAA+LE++E  EI+K PEV+SV
Sbjct  48    LDINGITDSHYELLGSCIKSKEKAREAIFYSYTNYINGFAAILEDDEVHEISKRPEVVSV  107

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N A +L TTRSWEFLGLE   G I   S+W KA+FGED IIGNLDTGVWPES+SFS+E
Sbjct  108   FPNEASELHTTRSWEFLGLE-RNGRIPANSLWLKARFGEDVIIGNLDTGVWPESESFSDE  166

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GP+P +WKG C    +    CNRKLIGARYF +GY +A G  LNSSF T RD  GHG+
Sbjct  167   GMGPVPSKWKGYCDT--NDGVRCNRKLIGARYFNKGYQAATGIRLNSSFDTARDTNGHGT  224

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTL+TAGG FV GAN  G  NGTAKGGSP ARV +YKVCWP       C DADILA FD 
Sbjct  225   HTLATAGGRFVSGANFLGSANGTAKGGSPNARVVSYKVCWP------SCSDADILAAFDA  278

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LS+SLG   P  Y+N  ++IGSFHAV+NGI+VV SAGN GP A S +N APW
Sbjct  279   AIHDGVDILSISLG-SRPRHYYNHGISIGSFHAVRNGILVVCSAGNSGPTASSASNGAPW  337

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             ++TV A+T+DR F SN +LGNKK   G S     LP  K+YPL+ +  A+    A+ +  
Sbjct  338   ILTVAASTIDRNFTSNAILGNKKILKGLSFNTNTLPAKKYYPLVYSLDAKA---ANDTFD  394

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             +A  C PG+L+P K+KGK++ C+ G N  +EKS   A AG VGMIL++   S  E    A
Sbjct  395   EAQFCTPGSLEPSKIKGKIVYCVSGFNQDVEKSWVVAQAGGVGMILSSFHTSTPE----A  450

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             HFLP + V+  DG ++  YIN T+ PVA+I+   T  G   APV+A FSS GPNAI P+I
Sbjct  451   HFLPTSVVSEHDGSSVLAYINSTKLPVAYISGA-TEFGKTVAPVMALFSSPGPNAITPEI  509

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+++AA TEA GP+    D R + F + SGTSMSCPHV+G+  LLK+L P 
Sbjct  510   LKPDITAPGVDILAANTEAKGPTSVRMDHRHLPFTILSGTSMSCPHVSGIAALLKSLRPD  569

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA IRSAIMTTA  ++N+G +I ++    + TPF YG+GHI P+   DPGLVYDL   
Sbjct  570   WSPAAIRSAIMTTARTKSNTGGSILNENLE-EATPFDYGSGHIRPSHIVDPGLVYDLSSK  628

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++  +   Y CP   ISL  FNYPSITVP+LKG  T+TRTLKNVG
Sbjct  629   DYLNFLCSIGYNNTQMSNFVDKSYNCPSAKISLLDFNYPSITVPNLKGNVTLTRTLKNVG  688

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P  YT  +R+P G S+ ++P  LKF KV EE+SFKVTLKAK +N +  Y FG L WSD 
Sbjct  689   TPGIYTVRIRAPKGISIKIDPMSLKFNKVNEERSFKVTLKAK-KNQSQGYVFGKLVWSDG  747

Query  206   KHRVRSPIVVKTA  168
              H VRSPIVVK A
Sbjct  748   MHNVRSPIVVKKA  760



>ref|XP_004164572.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=771

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/726 (55%), Positives = 513/726 (71%), Gaps = 11/726 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             +V   H+ LLG+  GS   A +AIFYSYTR  NGFAA L+++EA  +A+NP+VISVF N+
Sbjct  47    QVTALHYDLLGSLFGSKTMAEEAIFYSYTRSFNGFAAKLDDKEAENLARNPKVISVFENK  106

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
             AR+L TTRSW FLG+E + G I   SIW  AKFGED II N+DTGVWPESKSFS+EG+GP
Sbjct  107   ARKLHTTRSWNFLGVENDIG-IPSNSIWNTAKFGEDVIIANIDTGVWPESKSFSDEGYGP  165

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +W+GICQ   D +FHCNRKLIG RYF +GY +A G LN++  T RD  GHG+HTLST
Sbjct  166   VPSKWRGICQT--DSTFHCNRKLIGGRYFHKGYEAAGGKLNATLLTVRDHDGHGTHTLST  223

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             A GNFV GANVFG GNGTAKGG+PKAR  AYK CWPP    + C+DADILA F+ AI DG
Sbjct  224   AAGNFVTGANVFGHGNGTAKGGAPKARAVAYKACWPPLFDSQ-CFDADILAAFEAAIADG  282

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLS SLGG     YFND LAI +F AV+ GI+VV S GN GP   ++ N++PW+ TV 
Sbjct  283   VDVLSTSLGG-AADEYFNDPLAIAAFLAVQRGILVVFSGGNSGPFPMTIANISPWVFTVA  341

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+T+DR F S V LGNKKH  G S   +     KF+PL+++  A+ +   +++   A  C
Sbjct  342   ASTIDREFASYVGLGNKKHIKGLSLSSVPSLPKKFFPLINSVDAKFR---NVTEFHAQFC  398

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               GTLDP KVKGK+++C  GE D ++K  +A+ AGAVG+I+AND + G+EI  + HF+PA
Sbjct  399   GKGTLDPMKVKGKIVICQVGETDGVDKGFQASRAGAVGVIIANDLEKGDEIFPELHFIPA  458

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             + +T +D   + +Y+  TR P+AH+T   TLL VKPAP IA FS+RGPN I+  ILKPD+
Sbjct  459   SDITNTDAQIVQNYLKSTRTPMAHLTSVKTLLSVKPAPTIATFSARGPNPIDSTILKPDV  518

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSPA 
Sbjct  519   TAPGVNILASYPTGIAPTFSPVDRRRIPFNVISGTSMSCPHVAGIAGLIKSIHPNWSPAA  578

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  R N+ + I D  T LK TP+AYGAG +NPN AADPGLVYD+ + DY+NF
Sbjct  579   IKSAIMTTAKTRGNNNQTILDS-TKLKATPYAYGAGQVNPNDAADPGLVYDITVNDYLNF  637

Query  548   ICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSPAT  375
             +CA+GYN  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP T
Sbjct  638   LCARGYNAMQIKKFYAKPFSCVRSFKVTDLNYPSISVGELKIGAPLTMNRRVKNVGSPGT  697

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  195
             Y A V++  G +V++ P  L F +VGEE+ FKV L+  G+  +    FG L WSD KH V
Sbjct  698   YVARVKASPGVAVSIEPSTLVFSRVGEEKGFKVVLQNTGKVKSGSDVFGTLIWSDGKHFV  757

Query  194   RSPIVV  177
             RS I V
Sbjct  758   RSSIAV  763



>gb|KGN55995.1| hypothetical protein Csa_3G045090 [Cucumis sativus]
Length=751

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/726 (55%), Positives = 512/726 (71%), Gaps = 11/726 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             +V   H+ LLG+  GS   A +AIFYSYTR  NGFAA L+++EA  +A+NP+VISVF N+
Sbjct  27    QVTALHYDLLGSLFGSKTMAEEAIFYSYTRSFNGFAAKLDDKEAENLARNPKVISVFENK  86

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
             AR+L TTRSW FLG+E + G I   SIW  AKFGED I+ N+DTGVWPESKSFS+EG+GP
Sbjct  87    ARKLHTTRSWNFLGVENDIG-IPSNSIWNTAKFGEDVIVANIDTGVWPESKSFSDEGYGP  145

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLST  1809
             +P +W+GICQ   D +FHCNRKLIG RYF +GY +A G LN++  T RD  GHG+HTLST
Sbjct  146   VPSKWRGICQT--DSTFHCNRKLIGGRYFHKGYEAAGGKLNATLLTVRDHDGHGTHTLST  203

Query  1808  AGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDG  1629
             A GNFV GANVFG GNGTAKGG+PKAR  AYK CWPP    + C+DADILA F+ AI DG
Sbjct  204   AAGNFVTGANVFGHGNGTAKGGAPKARAVAYKACWPPLFDSQ-CFDADILAAFEAAIADG  262

Query  1628  VDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVG  1449
             VDVLS SLGG     YFND LAI +F AV+ GI+VV S GN GP   ++ N++PW+ TV 
Sbjct  263   VDVLSTSLGG-AADEYFNDPLAIAAFLAVQRGILVVFSGGNSGPFPMTIANISPWVFTVA  321

Query  1448  ANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHC  1269
             A+T+DR F S V LGNKKH  G S   +     KF+PL+++  A+ +   +++   A  C
Sbjct  322   ASTIDREFASYVGLGNKKHIKGLSLSSVPSLPKKFFPLINSVDAKFR---NVTEFHAQFC  378

Query  1268  KPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPA  1089
               GTLDP KVKGK+++C  GE D ++K  +A+ AGAVG+I+AND + G+EI  + HF+PA
Sbjct  379   GKGTLDPMKVKGKIVICQVGETDGVDKGFQASRAGAVGVIIANDLEKGDEIFPELHFIPA  438

Query  1088  THVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDI  909
             + +T +D   + +Y+  TR P+AH+T   TLL VKPAP IA FS+RGPN I+  ILKPD+
Sbjct  439   SDITNTDAQIVQNYLKSTRTPMAHLTSVKTLLSVKPAPTIATFSARGPNPIDSTILKPDV  498

Query  908   SAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAE  729
             +APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSPA 
Sbjct  499   TAPGVNILASYPTGIAPTFSPVDRRRIPFNVISGTSMSCPHVAGIAGLIKSIHPNWSPAA  558

Query  728   IRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNF  549
             I+SAIMTTA  R N+ + I D  T LK TP+AYGAG +NPN AADPGLVYD+ + DY+NF
Sbjct  559   IKSAIMTTAKTRGNNNQTILDS-TKLKATPYAYGAGQVNPNDAADPGLVYDITVNDYLNF  617

Query  548   ICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSPAT  375
             +CA+GYN  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP T
Sbjct  618   LCARGYNAMQIKKFYAKPFSCVRSFKVTDLNYPSISVGELKIGAPLTMNRRVKNVGSPGT  677

Query  374   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  195
             Y A V++  G +V++ P  L F +VGEE+ FKV L+  G+       FG L WSD KH V
Sbjct  678   YVARVKASPGVAVSIEPSTLVFSRVGEEKGFKVVLQNTGKVKNGSDVFGTLIWSDGKHFV  737

Query  194   RSPIVV  177
             RS I V
Sbjct  738   RSSIAV  743



>ref|XP_007154079.1| hypothetical protein PHAVU_003G089100g [Phaseolus vulgaris]
 gb|ESW26073.1| hypothetical protein PHAVU_003G089100g [Phaseolus vulgaris]
Length=788

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/729 (56%), Positives = 515/729 (71%), Gaps = 40/729 (5%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D D V  +HH+ L +Y+GS++KA++A+ YSYTRHINGFAAMLEEEEAA+IA++PEV+SVF
Sbjct  52    DFDLVTQAHHEFLHSYVGSFEKAKEAMIYSYTRHINGFAAMLEEEEAADIAEHPEVVSVF  111

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGN-------------LDT  2037
             LN+ R+L TT SWEF+ +E   GV+   S WK    G  + + N             +  
Sbjct  112   LNKGRKLHTTHSWEFMDMERVDGVVPSDSPWKSLWRGSFSCVTNHGRPMMFSQVALCVFY  171

Query  2036  GVWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG---PLN  1866
              VWPES SF +EG GPIP RWKG CQ+     F CNRKLIGARYF +GY + +G     N
Sbjct  172   CVWPESPSFGDEGMGPIPSRWKGTCQHDI-TGFRCNRKLIGARYFNKGYLAYLGGIAKFN  230

Query  1865  SSFFTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPG  1686
              +  T RD  GHGSHTLST GG FVPGANVFG GNGTA+GGSPKARVA+YKVCWPP   G
Sbjct  231   RTLNTARDYEGHGSHTLSTIGGTFVPGANVFGFGNGTAEGGSPKARVASYKVCWPPFE-G  289

Query  1685  EDCYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGN  1506
              +C+DADI+AG D AI DGVDVLS+SLGG     YF D +AIG+FHA    I VV SAGN
Sbjct  290   NECFDADIMAGLDMAIHDGVDVLSLSLGG-LASDYFEDGIAIGAFHANMKSIPVVCSAGN  348

Query  1505  EGPVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSA  1326
              GP  G+V NVAPW++TV A+T+DR F + + L N + + G S +   +P  KFYPL+ A
Sbjct  349   SGPSPGTVANVAPWIVTVSASTLDREFDTVIQLHNGQRFKGAS-LAKAMPESKFYPLIKA  407

Query  1325  ASARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMIL  1146
             A A++   A  S ++A  C  GT+DPEK +GK+LVCL+G N R+EKS  A  AGA GMIL
Sbjct  408   AEAKL---AKESVENATLCIRGTIDPEKARGKILVCLRGINPRVEKSLVALEAGAAGMIL  464

Query  1145  ANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIA  966
              NDE SGNE+IAD H LPA+ VTY DGLA++ Y+N T+NP+ +I  P T L  KPAPV+ 
Sbjct  465   CNDELSGNELIADPHLLPASQVTYKDGLAVYAYVNSTKNPLGYIEPPETKLRTKPAPVMT  524

Query  965   AFSSRGPNAINPDILK--PDIS--------------APGVNVIAAFTEATGPSDNDYDKR  834
             AFSSRGPN + P+ILK  P +                PGVN+IAA++ A  P++ ++DKR
Sbjct  525   AFSSRGPNLVTPEILKVCPFVHYVVPFKFAQNLMSPLPGVNIIAAYSGAVSPTELNFDKR  584

Query  833   IVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTG  654
              V F   SGTSMSCPHVAGVVGLL+TLYP+WSPA I+SAIMTTA  R N+GK + D   G
Sbjct  585   RVPFITMSGTSMSCPHVAGVVGLLRTLYPTWSPAAIKSAIMTTARTRDNTGKPMLDGNNG  644

Query  653   LKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHI  474
              K TPFAYG+GHI PN A DPGLVY+L + DY+NF+C  GYN+T+I    G  Y+CPD I
Sbjct  645   -KATPFAYGSGHIRPNRAMDPGLVYELTMNDYLNFLCISGYNQTQIKTFSGAHYRCPDII  703

Query  473   SLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGE  294
              +  FNYP++T+P L G+A+ TR +KNVGSP TYTAS+R P G S++V P +LKF+K+GE
Sbjct  704   DILDFNYPTMTIPKLYGSASFTRRVKNVGSPGTYTASLRVPAGLSISVEPNVLKFDKIGE  763

Query  293   EQSFKVTLK  267
             E+S+K+TLK
Sbjct  764   EKSYKLTLK  772



>ref|XP_009126659.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X2 [Brassica 
rapa]
Length=725

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/729 (57%), Positives = 508/729 (70%), Gaps = 53/729 (7%)
 Frame = -2

Query  2354  LDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFL  2175
             LDRV HSH   L ++LGS   A DAIFYSY RHINGFAA+L++++A+EIAK+P V S+FL
Sbjct  45    LDRVAHSHRTFLASFLGSHQSAEDAIFYSYKRHINGFAAVLDDKKASEIAKHPNVASIFL  104

Query  2174  NRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGF  1995
             N+ R+L TT SW+F+ LE + GV+H  S+WKKA+FGEDTII NLDTGVWPESKSFS+EG+
Sbjct  105   NKGRKLHTTHSWDFMLLE-KHGVVHKSSLWKKARFGEDTIIANLDTGVWPESKSFSDEGY  163

Query  1994  GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGY-SSAVGPLNSSFFTPRDVIGHGSHT  1818
             G +P RWKG C         CNRKLIGA+YF +GY + A  P NS+F TPRD+ GHG+HT
Sbjct  164   GDVPARWKGSCHGD----VPCNRKLIGAKYFNKGYLAYAKFPSNSTFETPRDLDGHGTHT  219

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGGNFVPGANVFGLGN                                       AI
Sbjct  220   LSTAGGNFVPGANVFGLGN---------------------------------------AI  240

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVDV+S S+GGD  G Y ND L+IGSF AVKNG+ VV SAGN GP  G+V+NVAPW+I
Sbjct  241   GDGVDVISASVGGD-AGDYMNDGLSIGSFVAVKNGVTVVCSAGNSGPKPGTVSNVAPWII  299

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVGA++MDR FQ+ V L N   + G S +   LP  K Y L+SAA  +    A+ S   A
Sbjct  300   TVGASSMDREFQAFVELSNGSRFEGTS-LSTPLPENKMYDLISAADGKA---ANASALQA  355

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
             L CK  +LDPEKVKGK++VCL+G+N R++K  +AA AGAVGMIL ND+ SGNEII+DAH 
Sbjct  356   LLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEIISDAHV  415

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             LPA+ + Y DG A+F Y+N T++P  +IT PNT L  KPAP +A+FSSRGPN I P ILK
Sbjct  416   LPASQINYKDGEAVFSYLNSTKDPKGYITAPNTQLHTKPAPFMASFSSRGPNTITPGILK  475

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVNV+AA+TEATGP+D + D R   FNVESGTSMSCPH++G+VGLLKTL P WS
Sbjct  476   PDITAPGVNVVAAYTEATGPTDIESDNRRTPFNVESGTSMSCPHISGIVGLLKTLRPQWS  535

Query  737   PAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDY  558
             PA IRSAIMTT+  R N+ K +  D T  K TPF YG+GH+ PN A+ PGLVYDL   DY
Sbjct  536   PAAIRSAIMTTSRTRDNTRKPMV-DATFHKATPFGYGSGHVQPNKASHPGLVYDLNTGDY  594

Query  557   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  381
             ++F+CA GY    +      P Y C    +L  FNYPSITVP L  + T+TR L NVG P
Sbjct  595   LDFLCAIGYENKVVQLFADDPLYTCRQGANLLDFNYPSITVPKLTDSVTITRKLTNVGPP  654

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
             +TY +   +P+G  V+V PK L F KVGEE+ F++T+ A  E A   Y FG LTW+D K+
Sbjct  655   STYRSYFHAPLGVEVSVEPKQLTFSKVGEEKMFQMTIGATSEKALG-YVFGELTWTDSKY  713

Query  200   RVRSPIVVK  174
              VR+PIVV+
Sbjct  714   YVRTPIVVQ  722



>ref|XP_008645398.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=826

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/754 (55%), Positives = 514/754 (68%), Gaps = 32/754 (4%)
 Frame = -2

Query  2354  LDR-VKHSHHQLLGTYLG-SWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             L+R    +H  LL   LG    KAR+AIFYSYT+HINGFAA L+   AAEIA  P VISV
Sbjct  76    LERDAAEAHCDLLAGVLGGDKQKAREAIFYSYTKHINGFAANLDAATAAEIAGKPGVISV  135

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N+ R+L TTRSW+F+GL G GGV H G+ W+KAKFG DTIIGN DTGVWPES+SF ++
Sbjct  136   FPNQGRKLHTTRSWQFVGLAGPGGVPHGGA-WRKAKFGADTIIGNFDTGVWPESESFRDD  194

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
             G GP+P  WKG C   +D  FHCNRKLIGARYF +GY++A G LN+S  TPRD+ GHG+H
Sbjct  195   GLGPVPSHWKGACDKGQDDKFHCNRKLIGARYFNKGYAAAAGALNASMNTPRDMDGHGTH  254

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGG+ VPGA+VFG GNGTA GGSP+ARVAAY+VC+PP + G +C+DADILA FD A
Sbjct  255   TLSTAGGSPVPGASVFGFGNGTASGGSPRARVAAYRVCFPPVN-GSECFDADILAAFDAA  313

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGV VLS+SLGGD P  Y +D +AIGSFHAV+ GI VV SAGN GP  G+ +N+APWL
Sbjct  314   IHDGVHVLSLSLGGD-PSDYLDDGIAIGSFHAVRRGISVVCSAGNSGPALGTASNLAPWL  372

Query  1460  ITVGANTMDRRFQSNVVLGNKK--------------------HYTGESAVPLKLPTGKFY  1341
             +T GA+TMDR F S +V  + K                       G+S     LP    Y
Sbjct  373   LTTGASTMDREFPSYIVFDHTKAKACNSSECPLARPPNSGLTKIKGQSLSMTTLPEKTSY  432

Query  1340  PLLSAASARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGA  1161
             PL+ +  A      +   Q    C  G+LDP K KGK++VCL+G N R+ K      AG 
Sbjct  433   PLIDSVKAAAANATTKDAQ---LCMIGSLDPAKAKGKIVVCLRGINPRVAKGEAVKQAGG  489

Query  1160  VGMILANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKP  981
             VGM+LAND  +GNEIIADAH LPAT + Y DGL ++ Y+N T+ P   IT P T+LG KP
Sbjct  490   VGMVLANDASTGNEIIADAHVLPATQIKYRDGLLLYSYVNSTKKPTGFITRPATVLGTKP  549

Query  980   APVIAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTS  801
             AP +AAFSS+GPN I P ILKPDI+APGV+VIAA+T A  P+D  +D+R V+FN ESGTS
Sbjct  550   APFMAAFSSQGPNIITPGILKPDITAPGVSVIAAWTRANSPTDLAFDRRRVAFNSESGTS  609

Query  800   MSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAG  621
             MSCPHV+GVVGLL+TL+P WSPA I+SAIMTTA    N G+ I  + + L ++PF YGAG
Sbjct  610   MSCPHVSGVVGLLRTLHPEWSPAAIKSAIMTTAAEMDNKGELIL-NASSLPSSPFGYGAG  668

Query  620   HINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPS  447
             HI+P  A +PGLVYDL   DY++F+CA  YN T +    G PY CP      ++  NYPS
Sbjct  669   HISPARAMNPGLVYDLGDADYLDFLCALKYNATVMAMFKGAPYTCPSEAPRRIADLNYPS  728

Query  446   ITVPHLKGT-ATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTL  270
             ITV ++    AT  R +KNVG P TYTA V  P G +V V P +LKF   GEE+ F+V  
Sbjct  729   ITVVNVTAAGATALRKVKNVGKPGTYTAFVAEPAGVAVLVTPSVLKFSAKGEEKGFEVHF  788

Query  269   KAKGENATADYAFGVLTWSDKKHRVRSPIVVKTA  168
             K        DY+FG L W++ +  VRSP+VVK A
Sbjct  789   KVVNATLARDYSFGALVWTNGRQFVRSPLVVKAA  822



>gb|KHN14107.1| Subtilisin-like protease [Glycine soja]
Length=1029

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/723 (58%), Positives = 523/723 (72%), Gaps = 12/723 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D++ V  SH+ +L +Y+GS +KA +AIFYSY R+INGFAA+L+E+EAA ++ +P VISV
Sbjct  29    IDVESVTMSHYDILESYVGSTEKALEAIFYSYKRYINGFAAILDEDEAANVSMHPNVISV  88

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SW FLGLE  G   HD S+WKK K GED IIGN+DTGVWPESKSFS+E
Sbjct  89    FLNKERKLHTTNSWNFLGLERNGVFPHD-SVWKKTK-GEDIIIGNIDTGVWPESKSFSDE  146

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             GFGPIPKRW+GICQ + DK FHCNRKLIGARYF +GY +  G  LN+S  + RD  GHGS
Sbjct  147   GFGPIPKRWRGICQTE-DK-FHCNRKLIGARYFYKGYEAGSGIKLNASEVSVRDYEGHGS  204

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGGNFV GA+VFG GNGTA GGSPKARVAAYK CWP T  G  C+DADILA F+ 
Sbjct  205   HTLSTAGGNFVAGASVFGFGNGTASGGSPKARVAAYKACWPDTFFG-GCFDADILAAFEA  263

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDV+S+SLG + P  YF  S++I SFHAV NGI VV S GN GP  G+V+N  PW
Sbjct  264   AISDGVDVISMSLGSEDPPEYFQSSISIASFHAVANGITVVGSGGNSGPSPGTVSNNEPW  323

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             ++TV A+T +R F S+V LG+KK   G S     LP+ K YPL+SA  A  K  A     
Sbjct  324   MLTVAASTTNRDFASHVTLGDKKILKGASLSEHHLPSNKMYPLISAVDAGTKYAA---VN  380

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             D   C   TLDPEKVKGK+LVCL+G N RIEK   AA  GAVGMILAND+DSGNE+++D 
Sbjct  381   DTPFCLNKTLDPEKVKGKILVCLRGVNGRIEKGVIAASLGAVGMILANDKDSGNEVLSDP  440

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LP +HV ++ G  I++YIN T++PVA+I+   T LGVKPAP +A+FSSRGPN + P I
Sbjct  441   HVLPTSHVNFASGSYIYNYINHTKSPVAYISKAKTELGVKPAPFVASFSSRGPNLLEPAI  500

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPD++APGV++IAA+TEA  P+D   D +   +   SGTSMSCPHVAG+VGLLK  +P 
Sbjct  501   LKPDVTAPGVDIIAAYTEAVSPTDEASDTQRTPYYALSGTSMSCPHVAGLVGLLKAFHPD  560

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAI+T+AT + N+ + I +     + TPF YG GHI PN A DPGLVYDL   
Sbjct  561   WSPAAIKSAIITSATTKGNNRRPILNSSFVNEATPFDYGGGHIRPNHAVDPGLVYDLNTA  620

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVP--HLKGTATVTRTLKNV  390
             DY+NF+C++GYN +++    G PY CP   SL+ FNYP+ITVP  H   +  VTRT+ NV
Sbjct  621   DYLNFLCSRGYNSSQLKLFYGKPYTCPKSFSLADFNYPTITVPRIHPGHSVNVTRTVTNV  680

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVLTWS  213
             GSP+ Y   +++P    V+V PK L+F+K GE++ F+VTL  K +   T DY FG LT  
Sbjct  681   GSPSMYRVLIKAPPQVVVSVEPKKLRFKKKGEKKEFRVTLTLKPQTKYTTDYVFGWLTSI  740

Query  212   DKK  204
             D K
Sbjct  741   DAK  743


 Score =   160 bits (405),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  1304  NASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSG  1125
             NASI   DA +C  GTLDPEK KGK+LVC        +K  EA   G VG+ILA D +SG
Sbjct  746   NASI--VDAAYCDNGTLDPEKAKGKILVCFG-----TDKGVEAIRVGDVGLILAFD-NSG  797

Query  1124  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  945
              EI+AD H LPA++V + DG  I++YI  T++PVA I+   T LGVK AP +A FSSRGP
Sbjct  798   LEILADLHLLPASNVGFVDGNYIYNYIRITKSPVACISRVKTELGVKSAPFVAPFSSRGP  857

Query  944   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMS  795
             N + P ILKPD++APG ++IAA++EA  P++ D DKR   +   S TS+S
Sbjct  858   NPLEPTILKPDVTAPGTDIIAAYSEAISPTEQDSDKRRTPYITLSSTSIS  907


 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = -2

Query  551   FICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVGSPA  378
             +I     + + +    G PY CP   SL+ FNYP++TV  L    +  VTRT+ NVGSP+
Sbjct  898   YITLSSTSISRLKLFYGKPYTCPKSFSLADFNYPAVTVAQLDPGHSLRVTRTVTNVGSPS  957

Query  377   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFK--VTLKAKGENATADYAFGVLTWSDKK  204
             TY    ++P   +V V P+  +F+K GE + F+  +TLK + +NAT DY FG LTW+D K
Sbjct  958   TYRVHSKAPPQVAVPVKPRKRRFKKKGERKEFRLTLTLKPQTKNAT-DYVFGWLTWTDHK  1016

Query  203   HRVRSPIVV  177
             H V SP  V
Sbjct  1017  HHVMSPNAV  1025



>ref|XP_008359025.1| PREDICTED: subtilisin-like protease, partial [Malus domestica]
Length=635

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/617 (64%), Positives = 473/617 (77%), Gaps = 12/617 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLD V +SH+ LLGT LGS ++A+++IFYSYTR+INGFAA+L++EEAA+IAK+P V+SVF
Sbjct  25    DLDSVTNSHYNLLGTVLGSNERAQESIFYSYTRNINGFAAILDDEEAAQIAKDPNVVSVF  84

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NR R+L TTRSW+FL LE E G I  GSIWKKA+ G +TIIGNLDTGVWPESKSFS+EG
Sbjct  85    PNRGRKLXTTRSWDFLRLE-ENGEIRAGSIWKKARLGANTIIGNLDTGVWPESKSFSDEG  143

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF-----TPRDVIG  1833
              GPIP +W+GICQ        CNRKLIGARYF +GY+     +NSS         RD  G
Sbjct  144   MGPIPSKWRGICQLDTKDGSRCNRKLIGARYFSKGYAVYASTVNSSAAKSIQPNARDHAG  203

Query  1832  HGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAG  1653
             HGSHTLSTAGGNFVP A+VFG GNGTAKGGSPKARVAAYKVCWPP   G +C+DADILA 
Sbjct  204   HGSHTLSTAGGNFVPRASVFGNGNGTAKGGSPKARVAAYKVCWPPID-GNECFDADILAA  262

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
             F+ AI DGVDVLSVSLGG+    + +D +AIGSFHAVK GI VV+SAGN GP  GSV+NV
Sbjct  263   FEAAINDGVDVLSVSLGGE-AAEFLSDGIAIGSFHAVKKGITVVSSAGNSGPTPGSVSNV  321

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASI  1293
             +PW++TVGA+T+DR F S V LGNKKH  G S     LP  KFYPL+SA  A+    A+ 
Sbjct  322   SPWMLTVGASTIDREFSSYVTLGNKKHLKGASLSSTALPAKKFYPLISACDAKA---ANA  378

Query  1292  STQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEII  1113
             S  +A  CKPGTLD +K KGK+LVC++G+N R  K  +A LAGAVGMIL ND+ SGNEII
Sbjct  379   SGSEAHLCKPGTLDKKKAKGKILVCVRGQNPRANKGQQAILAGAVGMILVNDKLSGNEII  438

Query  1112  ADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
             AD H LPA+HV YSDG ++  YI  T+NP+A+I    T  G KPAP +A+FSSRGPN I 
Sbjct  439   ADPHLLPASHVNYSDGKSVXAYIKSTKNPMAYINRVKTEQGTKPAPFMASFSSRGPNXIE  498

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
               ILKPDI+APGV++IAA+T+ATGP+   +D R VSFN +SGTSMSCPHV+G+VGLLKTL
Sbjct  499   QSILKPDITAPGVSIIAAYTQATGPTGQKFDNRRVSFNTQSGTSMSCPHVSGIVGLLKTL  558

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P+WSPA I+SAIMTTA+ R NS K    D +  + TPFAYGAGH+ PN A DPGLVYDL
Sbjct  559   HPTWSPAAIKSAIMTTASKRDNS-KGTMLDSSKARATPFAYGAGHVQPNRAMDPGLVYDL  617

Query  572   KLTDYVNFICAQGYNKT  522
                DY+NF+CA+GYN T
Sbjct  618   TTDDYLNFLCARGYNAT  634



>gb|KDP35557.1| hypothetical protein JCGZ_08995 [Jatropha curcas]
Length=786

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/738 (56%), Positives = 526/738 (71%), Gaps = 26/738 (4%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D +++  S+++LLG+ + S +KAR AIFYSYT +INGFAA LE+EE  EI+K PEV+SV
Sbjct  56    LDANKITDSYYELLGSCMKSKEKARTAIFYSYTSYINGFAATLEDEEVDEISKRPEVLSV  115

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N A +L TTRSWEFLGLE  G +  D S+W KA+FGED II NLDTGVWPES+SF++E
Sbjct  116   FPNEANELHTTRSWEFLGLERNGQIPAD-SLWLKARFGEDIIIANLDTGVWPESESFNDE  174

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GPIP +WKG C+   +    CN+KLIGARYF +G+ +A+G PLNSSF T RD+ GHG+
Sbjct  175   GMGPIPSKWKGHCKT--NDGVKCNKKLIGARYFNKGFEAAIGSPLNSSFNTARDLDGHGT  232

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+FG  NGT KGG P ARVA+YKVCWP       C+DADILA FD 
Sbjct  233   HTLSTAGGRFVSGANIFGSANGTIKGGLPNARVASYKVCWP------SCFDADILAAFDA  286

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI+DGVD+L+VSLG   P  YF   ++IGSFHAV+NGI+VV SAGN GP   S +NVAPW
Sbjct  287   AIQDGVDILTVSLG-SRPRNYFGHGISIGSFHAVRNGILVVCSAGNSGPQPASASNVAPW  345

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             ++TV A+++DR F SNV+LGN + + G S     LP   ++PL+ +  A+   NA++ST 
Sbjct  346   ILTVAASSIDRNFPSNVILGNNRLFKGLSFNTNSLPARNYHPLVYSVDAK---NANVSTS  402

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHE----AALAGAVGMILANDEDSGNEI  1116
             DA  C PG+LDP K+KGK++ CL+  +  +E   E     A AG VGMILA+  D    I
Sbjct  403   DAQFCSPGSLDPTKIKGKIVYCLRNLDPEVEPDVEKGWVVAQAGGVGMILASQFDF-QTI  461

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             I   HFLP + V+ +DGL+I  YI  +  PVA+I+   T +G   AP++A+FSS GPNAI
Sbjct  462   IPRPHFLPTSIVSATDGLSILAYIYNSGFPVAYISG-ETEVGEVAAPIMASFSSPGPNAI  520

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
              P+ILKPDI+APGV++IAA+++A+GPS  + D+R V FN+ SGTSM+CPHVAG+ GLLKT
Sbjct  521   TPEILKPDITAPGVHIIAAYSKASGPSSLEVDQRHVPFNIISGTSMACPHVAGIAGLLKT  580

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+P WSPA I+SAIMTTA  R+N  + I  +    K  PF YG+GHI PN A DPGLVYD
Sbjct  581   LHPDWSPAAIKSAIMTTARTRSNIKQPILTNLFD-KANPFNYGSGHIWPNRATDPGLVYD  639

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHIS----LSTFNYPSITVPHLKGTATVT  408
             L   DY+NF+C+ GYN T+I+A  G PY CP   +    L  FNYPSITVP+L     +T
Sbjct  640   LTPKDYLNFLCSIGYNATQISAFAGAPYSCPSKNTTTNFLLDFNYPSITVPNLSKKVILT  699

Query  407   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFG  228
             RTLKNVG+P  Y   + +P G SV V PK L F K+ EE+ FK+TL+AK +N + DY FG
Sbjct  700   RTLKNVGTPGVYRVRIDAPEGISVKVEPKKLGFSKMNEEKRFKLTLEAK-KNGSQDYVFG  758

Query  227   VLTWSDKKHRVRSPIVVK  174
              L WSD  H VRSPIVV+
Sbjct  759   GLVWSDGIHNVRSPIVVR  776



>ref|XP_006377331.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
 gb|ERP55128.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
Length=746

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/732 (56%), Positives = 517/732 (71%), Gaps = 19/732 (3%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             DR+  S++ LLG+ L S +KA++AIFYSYT HINGFAA LE++E  +++  PEV+SVF N
Sbjct  24    DRMTESYYDLLGSCLKSKEKAKEAIFYSYTSHINGFAATLEDDEVDQLSNRPEVVSVFPN  83

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
                QL TTRSWEFLGLE  G +  D SIW KA+FGED IIGNLDTGVWPES+SF++EG G
Sbjct  84    EVNQLHTTRSWEFLGLERNGQIPAD-SIWLKARFGEDVIIGNLDTGVWPESESFNDEGMG  142

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTL  1815
             PIP RWKG C+   +    CNRKLIGARYF +GY +A+G PL+SS  T RD  GHG+HTL
Sbjct  143   PIPTRWKGYCET--NDGVKCNRKLIGARYFNKGYEAALGRPLDSSNNTARDTDGHGTHTL  200

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FV GAN  G   GTAKGGSP ARVA+YKVCWP       CYDADILA FD AI+
Sbjct  201   STAGGRFVSGANFLGSAYGTAKGGSPNARVASYKVCWP------SCYDADILAAFDAAIQ  254

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVA--GSVNNVAPWL  1461
             DGVD+LS+SLG     PYF   +AIGSF AVKNGI+VV SAGN G     G+ +NVAPW+
Sbjct  255   DGVDILSISLGRALAIPYFRYGIAIGSFQAVKNGILVVCSAGNSGQFLSFGTTSNVAPWV  314

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+T+DR F SNVVLGN K + G S     L   K+YP++ +  A++   A+ S Q 
Sbjct  315   LTVAASTIDREFPSNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKV---ANASAQL  371

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  C P +LDP KV+GK++ CL+G    +EKS   A AG VGMILA D+ + +  +    
Sbjct  372   AQLCYPESLDPTKVRGKIVYCLRGMIPDVEKSLVVAQAGGVGMILA-DQSAESSSMPQGF  430

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
             F+P + V+  DGL++  YI  T++PVA+I+  +T +G   APV+A FSS GPN I P+IL
Sbjct  431   FVPTSIVSAIDGLSVLSYIYSTKSPVAYISG-STEIGKVVAPVMAFFSSTGPNEITPEIL  489

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+++AA+T+A        D+R +SFNV SGTSM+CPHV+G+ GLLKT++P W
Sbjct  490   KPDITAPGVSILAAYTKAPRRLSRLIDQRPLSFNVISGTSMACPHVSGIAGLLKTMHPDW  549

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTA   +N+ + I    +  + TPF YG+GH+ PN A DPGLVYDL  TD
Sbjct  550   SPAAIKSAIMTTARTCSNARQPIV-KASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTTD  608

Query  560   YVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+NF+C+ GYN T+++  +  PY C P +ISL  FNYPSITVP+L G  T+TRTLKNVG+
Sbjct  609   YLNFLCSIGYNATQMSIFIEEPYACPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVGT  668

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P  YT  V+ P G  V V P+ LKF K+ EE++FKV LKA      + Y FG LTWSD  
Sbjct  669   PGLYTVRVKKPDGILVKVEPESLKFSKLNEEKTFKVMLKAMDNWFDSSYVFGGLTWSDGV  728

Query  203   HRVRSPIVVKTA  168
             H VRSPIVV+ A
Sbjct  729   HHVRSPIVVRKA  740



>dbj|BAK01624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=792

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/739 (55%), Positives = 515/739 (70%), Gaps = 15/739 (2%)
 Frame = -2

Query  2360  VDLDRVK----HSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPE  2193
             VDL  V+     SH+ LL T LG   KA+DAIFYSYT+HINGFAA L+ ++AA++A+ PE
Sbjct  60    VDLAAVEGKAADSHYDLLATVLGDKAKAQDAIFYSYTKHINGFAANLDADQAAQLARLPE  119

Query  2192  VISVFLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKS  2013
             V+SVF NR  QL TTRSW+FLG+ G GGV   G+ W+KAKFGE  IIGN+DTGVWPES+S
Sbjct  120   VVSVFPNRGYQLHTTRSWQFLGIAGPGGVPR-GASWRKAKFGEGVIIGNIDTGVWPESES  178

Query  2012  FSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGY-SSAVGPLNSSFFTPRDVI  1836
             F + G GP PK WKG C+  +D  FHCN KLIGARYF +GY +  +      F TPRD  
Sbjct  179   FRDHGLGPAPKHWKGTCEKGQDDDFHCNAKLIGARYFNKGYGAEGLDTKAPEFNTPRDNE  238

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTLSTAGG  VPGA+VFG GNGTA GGSP+A VAAY+VC+ P + G  C++ADILA
Sbjct  239   GHGTHTLSTAGGAPVPGASVFGFGNGTASGGSPRAHVAAYRVCYKPVN-GSSCFEADILA  297

Query  1655  GFDRAIEDGVDVLSVSLGGD-HPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVN  1479
              FD AI DGV VLSVSLG D  P  YF+D+++IGSFHAV+ GI VV SAGN GP   S++
Sbjct  298   AFDAAIHDGVHVLSVSLGNDGEPYDYFDDAISIGSFHAVRRGISVVCSAGNSGPKPSSIS  357

Query  1478  NVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINA  1299
             N+APW+ TVGA+TMDR F S +V    K   G+S     L T   YP++ +A A     A
Sbjct  358   NLAPWVFTVGASTMDREFPSYLVFNGTK-IKGQSMSETSLKTKDPYPMIDSAEAAAPGRA  416

Query  1298  SISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNE  1119
                  DA  C  G+LDPEKVKGK++VCL+G + R+ K      AG   M+LAND  SGNE
Sbjct  417   ---VDDAKICLQGSLDPEKVKGKIVVCLRGTSARVAKGLTVLQAGGAAMVLANDAASGNE  473

Query  1118  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  939
             +IADAH LPATH+ + DGL ++ Y+  T++PV ++  P T L  KPAP +AAFSS+GPN 
Sbjct  474   VIADAHLLPATHIRHHDGLTLYSYLKSTKSPVGYVEKPETSLETKPAPYMAAFSSQGPNP  533

Query  938   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  759
             +NP+ILKPDI+APGV VIAAFT A  P++  +D+R V+F   SGTSMSCPHV+G+VGLLK
Sbjct  534   VNPEILKPDITAPGVGVIAAFTRAMAPTELAFDERRVAFTTMSGTSMSCPHVSGLVGLLK  593

Query  758   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVY  579
              L+P WSP+ I+SA+MTTAT   N G++I +        PFAYGAGH+ P+ A +PGLVY
Sbjct  594   ALHPDWSPSAIKSAMMTTATDVDNKGESILNASL-TPAGPFAYGAGHVWPSRAMNPGLVY  652

Query  578   DLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHI-SLSTFNYPSITVPHLKGT-ATVTR  405
             DL    Y++F+CA  YN T ++   G PYKCP+    +   NYPSITV +L  + ATV R
Sbjct  653   DLGPDHYLDFLCALKYNATVLSMFNGEPYKCPEKAPKIQDLNYPSITVVNLTASGATVKR  712

Query  404   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  225
             T+KNVG P  Y A VR P G  V V+P++++F K GEE++F+V  + K      +YAFG 
Sbjct  713   TVKNVGFPGKYKAVVRQPAGVHVAVSPEVMEFGKKGEEKTFEVKFEIKDAKLAKNYAFGT  772

Query  224   LTWSDKKHRVRSPIVVKTA  168
             L WS+    V+SPIVVKTA
Sbjct  773   LMWSNGVQFVKSPIVVKTA  791



>ref|XP_006857622.1| hypothetical protein AMTR_s00061p00122710 [Amborella trichopoda]
 gb|ERN19089.1| hypothetical protein AMTR_s00061p00122710 [Amborella trichopoda]
Length=775

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/736 (56%), Positives = 517/736 (70%), Gaps = 14/736 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D  RV  SHH+LL T++GS +KA+DAIFYSYT ++NGFAA LEEEEA EI+K+P V+SV
Sbjct  43    IDHARVTESHHELLATFMGSKEKAKDAIFYSYTLNVNGFAANLEEEEALEISKHPGVVSV  102

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F ++ R+L TT SW F+ LE +G +    S+W ++ FG D I+ NLD+GVWPES+SF +E
Sbjct  103   FPDKLRELHTTHSWNFMRLERDGRIPMK-SLWHQSNFGRDVIVANLDSGVWPESESFRDE  161

Query  2000  GFGPIPKRWKGICQNQKDKSF--HCNRKLIGARYFIQGYSSAVGPLNSSF----FTPRDV  1839
             G GP+P +WKGIC N   +     CNRKLIGARYF +GY +  G +N S      +PRD 
Sbjct  162   GMGPVPSKWKGICINDDPQILPVKCNRKLIGARYFNKGYKAFFGIVNDSAPLAPNSPRDF  221

Query  1838  IGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPG-EDCYDADI  1662
              GHG+HTLSTA G+FVP A++FG  +GTAKGG+P ARVAAYKVCWP T      C+D+DI
Sbjct  222   EGHGTHTLSTAAGSFVPNASIFGYASGTAKGGAPGARVAAYKVCWPTTERSIGGCFDSDI  281

Query  1661  LAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSV  1482
             LA  + AI DGVDVLSVSLG D P P+  D +AI +FHAV  GI V+ SAGN GP  GSV
Sbjct  282   LAAVEAAIHDGVDVLSVSLGDDRPYPFLEDGIAIAAFHAVWKGISVICSAGNSGPKPGSV  341

Query  1481  NNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKIN  1302
              N+APW++TVGA+T+DR F + V +G K H  GES +   LP  KFYPL+S A   +   
Sbjct  342   TNIAPWILTVGASTLDREFPTYVSIGGK-HLKGES-LSSALPQEKFYPLVSGADI-LNPQ  398

Query  1301  ASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGN  1122
             ++ S  +A +C  G+LDP K KGK++ CL+G NDR+EK      AG VGMIL ND +SGN
Sbjct  399   SNFSLLNARNCLIGSLDPTKTKGKIVACLRGVNDRVEKGEAVKQAGGVGMILCNDPNSGN  458

Query  1121  EIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPN  942
             E+IAD H LPA H+T SDG  +F YI  T+NP+A+IT P T LG  PAPV+AAFSS+GPN
Sbjct  459   EVIADPHVLPAAHLTLSDGAEVFSYIKSTKNPMAYITRPKTFLGSTPAPVMAAFSSQGPN  518

Query  941   AINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLL  762
              I P+ILKPDI+ PGV+++AA+TE   PS  ++DKR VSFN +SGTSMSCPH+AGVV L+
Sbjct  519   VITPEILKPDITGPGVDILAAYTEVRPPSHMEFDKRRVSFNTDSGTSMSCPHLAGVVALI  578

Query  761   KTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLV  582
             K  Y  WS A I+SAIMTTA    N   AI D     + TPF+YGAGH+ PN AADPGLV
Sbjct  579   KARYTHWSEAAIKSAIMTTARRHDNMELAIKDASLE-RATPFSYGAGHVRPNAAADPGLV  637

Query  581   YDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTR  405
             YDL  TDY+NF+CA  YN++ I+A+    Y CP     L  FNYPS ++ +L  T TVTR
Sbjct  638   YDLTPTDYLNFLCALDYNQSSISAITEQNYTCPTPKPKLLDFNYPSFSITNLTSTVTVTR  697

Query  404   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  225
              +K VG PATYT  V+SP G SV V+PK L FEK GEE+S+ +    K +N   +Y+FG 
Sbjct  698   VVKLVGPPATYTVRVQSPPGVSVEVSPKSLSFEKEGEEKSYALKFTLKSQN-FGNYSFGR  756

Query  224   LTWSDKKHRVRSPIVV  177
             L WSD  H VRS IV+
Sbjct  757   LIWSDGTHHVRSSIVI  772



>gb|AIC80772.1| subtilase [Cicer arietinum]
Length=743

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/734 (54%), Positives = 517/734 (70%), Gaps = 16/734 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL+   +SH+ LLG++LGS +KA++AIFYSY +HINGF+A+LE EEAA IAK+P V+SVF
Sbjct  18    DLESATNSHYNLLGSHLGSHEKAKEAIFYSYNKHINGFSAVLEVEEAANIAKHPNVVSVF  77

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             +N+  +LQTTRSWEFLGLE   GV+   SIW+KA++GE TII N+DTGVWPESKSFS+ G
Sbjct  78    VNKGHELQTTRSWEFLGLENNNGVVLKDSIWEKARYGEGTIIANIDTGVWPESKSFSDHG  137

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P RW+GICQ     +FHCNRKLIGAR++ +GY S  G LN S +T RDV+GHG+ T
Sbjct  138   MGPVPSRWRGICQLH---NFHCNRKLIGARFYSKGYESKFGRLNQSEYTARDVLGHGTPT  194

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LS AGGNFVPGANVFG GNGTAKGGSP++ VAAYKVCW  T   E C DADI+  F+ AI
Sbjct  195   LSIAGGNFVPGANVFGFGNGTAKGGSPRSHVAAYKVCWLGTIQIE-CTDADIMKAFEDAI  253

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGV+V+S SLG   P  +F D ++IGSFHA++NG++VVAS GN GP  G+V NVAPWL 
Sbjct  254   SDGVNVISCSLGKTTPPEFFEDGISIGSFHAIQNGVIVVASGGNSGPKLGTVTNVAPWLF  313

Query  1457  TVGANTMDRRFQSNVVLG-NKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +VGA+T+DR+F + + LG + KH  G S +   LP+ KFY L+S+  A++  NA+I   D
Sbjct  314   SVGASTIDRKFVNYIQLGGDNKHIMGVS-LSTGLPSDKFYSLISSVDAKLG-NATI--DD  369

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAG-AVGMILANDEDSGNEIIADA  1104
             A  C  GT+DP KVKGK+L CL  + + +  + E A++G A+G+IL ND+  GN+IIA  
Sbjct  370   AQICMVGTIDPNKVKGKILFCLLRDINGLYYAEEEAVSGGAIGLILGNDKQRGNDIIAYP  429

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LP +H+ Y D   +  YI  T+ PVA+++   T +G KP+PVIA+ SSRGPN I   I
Sbjct  430   HLLPTSHINYIDANYVHSYIKATKTPVAYMSKAKTEVGAKPSPVIASLSSRGPNPIQSII  489

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDISAPGV+++ AF  A  P+    D R + + + SGTS+SCPHV+ +V LLKTLYP 
Sbjct  490   LKPDISAPGVDILYAFIGAISPTGLASDNRRIPYYIGSGTSVSCPHVSAIVALLKTLYPH  549

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA  +SA+MTTA +   + + I D       TPF YGAGHI P  A DPGL+YDL   
Sbjct  550   WSPAAFKSAVMTTAKILDTNERPIRDQSNKEDATPFGYGAGHIQPELAMDPGLIYDLNTI  609

Query  563   DYVNFI-CAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH---LKGTATVTRTLK  396
             DY+NF+ C++GYN+T +      P+ CP   ++  FNYPSITVP+   L     VTRT+ 
Sbjct  610   DYLNFLSCSRGYNQTNMKIFSKRPHTCPKSYNMLDFNYPSITVPNLGKLHSVQIVTRTVT  669

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NVGSP+TY   V++P G SV V P  L F +VGE+++FKV LK      T  Y FG L W
Sbjct  670   NVGSPSTYHVHVKTPYGISVLVKPSSLTFNQVGEKKTFKVVLKV--TKPTLGYVFGHLWW  727

Query  215   SDKKHRVRSPIVVK  174
              D +H+V SP+VVK
Sbjct  728   FDGRHKVMSPLVVK  741



>ref|XP_004500162.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=771

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/734 (54%), Positives = 517/734 (70%), Gaps = 16/734 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL+   +SH+ LLG++LGS +KA++AIFYSY +HINGF+A+LE EEAA IAK+P V+SVF
Sbjct  46    DLESATNSHYNLLGSHLGSHEKAKEAIFYSYNKHINGFSAVLEVEEAANIAKHPNVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             +N+  +LQTTRSWEFLGLE   GV+   SIW+KA++GE TII N+DTGVWPESKSFS+ G
Sbjct  106   VNKGHELQTTRSWEFLGLENNNGVVLKDSIWEKARYGEGTIIANIDTGVWPESKSFSDHG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P RW+GICQ     +FHCNRKLIGAR++ +GY S  G LN S +T RDV+GHG+ T
Sbjct  166   MGPVPSRWRGICQLH---NFHCNRKLIGARFYSKGYESKFGRLNQSEYTARDVLGHGTPT  222

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LS AGGNFVPGANVFG GNGTAKGGSP++ VAAYKVCW  T   E C DADI+  F+ AI
Sbjct  223   LSIAGGNFVPGANVFGFGNGTAKGGSPRSHVAAYKVCWLGTIQIE-CTDADIMKAFEDAI  281

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGV+V+S SLG   P  +F D ++IGSFHA++NG++VVAS GN GP  G+V NVAPWL 
Sbjct  282   SDGVNVISCSLGKTTPPEFFEDGISIGSFHAIQNGVIVVASGGNSGPKLGTVTNVAPWLF  341

Query  1457  TVGANTMDRRFQSNVVLG-NKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +VGA+T+DR+F + + LG + KH  G S +   LP+ KFY L+S+  A++  NA+I   D
Sbjct  342   SVGASTIDRKFVNYIQLGGDNKHIMGVS-LSTGLPSDKFYSLISSVDAKLG-NATI--DD  397

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAG-AVGMILANDEDSGNEIIADA  1104
             A  C  GT+DP KVKGK+L CL  + + +  + E A++G A+G+IL ND+  GN+IIA  
Sbjct  398   AQICMVGTIDPNKVKGKILFCLLRDINGLYYAEEEAVSGGAIGLILGNDKQRGNDIIAYP  457

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             H LP +H+ Y D   +  YI  T+ PVA+++   T +G KP+PVIA+ SSRGPN I   I
Sbjct  458   HLLPTSHINYIDANYVHSYIKATKTPVAYMSKAKTEVGAKPSPVIASLSSRGPNPIQSII  517

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDISAPGV+++ AF  A  P+    D R + + + SGTS+SCPHV+ +V LLKTLYP 
Sbjct  518   LKPDISAPGVDILYAFIGAISPTGLASDNRRIPYYIGSGTSVSCPHVSAIVALLKTLYPH  577

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA  +SA+MTTA +   + + I D       TPF YGAGHI P  A DPGL+YDL   
Sbjct  578   WSPAAFKSAVMTTAKILDTNERPIRDQSNKEDATPFGYGAGHIQPELAMDPGLIYDLNTI  637

Query  563   DYVNFI-CAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH---LKGTATVTRTLK  396
             DY+NF+ C++GYN+T +      P+ CP   ++  FNYPSITVP+   L     VTRT+ 
Sbjct  638   DYLNFLSCSRGYNQTNMKIFSKRPHTCPKSYNMLDFNYPSITVPNLGKLHSVQIVTRTVT  697

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NVGSP+TY   V++P G SV V P  L F +VGE+++FKV LK      T  Y FG L W
Sbjct  698   NVGSPSTYHVHVKTPYGISVLVKPSSLTFNQVGEKKTFKVVLKV--TKPTLGYVFGHLWW  755

Query  215   SDKKHRVRSPIVVK  174
              D +H+V SP+VVK
Sbjct  756   FDGRHKVMSPLVVK  769



>gb|KEH31720.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/690 (58%), Positives = 504/690 (73%), Gaps = 12/690 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D++ V +SH+ LLG+Y+GS DKA++AIFYSY+++ NGFAA+L+E+EAA +AK+P V S+
Sbjct  46    LDIESVTNSHYNLLGSYVGSTDKAKEAIFYSYSKYFNGFAAVLDEDEAAMVAKHPNVASI  105

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+ R+L TT SW+FLGLE   GVI  GS+W K+K GED IIGNLDTGVWPESKSFS+E
Sbjct  106   FLNKPRKLHTTHSWDFLGLE-RNGVIPKGSLWSKSK-GEDIIIGNLDTGVWPESKSFSDE  163

Query  2000  GFGPIPKRWKGICQNQKDKS--FHCNRKLIGARYFIQGYSSAVGP-LNSSFFTPRDVIGH  1830
             G GP+P RW+GIC    D +  F CNRKLIGARYF +GY +  G   N +F + RD  GH
Sbjct  164   GVGPVPTRWRGICDVDIDNTDKFKCNRKLIGARYFYKGYLADAGKSTNVTFHSARDFDGH  223

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             GSHTLSTAGGNFV  A+VFG G GTA GGSP ARVAAYKVCWPP + G  CY+ADILAGF
Sbjct  224   GSHTLSTAGGNFVANASVFGNGLGTASGGSPNARVAAYKVCWPPLAVGGGCYEADILAGF  283

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             + AI DGVDV+S S+GGD P  ++  S+AIGSFHAV NGIVVV+SAGN GP   + +N+ 
Sbjct  284   EAAILDGVDVISASVGGD-PVEFYESSIAIGSFHAVANGIVVVSSAGNTGPKPKTASNLE  342

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PW ITV A+T DR F S V LGNKK   G S     LP  KFYPL+SA  A+       S
Sbjct  343   PWSITVAASTTDREFTSYVTLGNKKILKGASLSESHLPPHKFYPLISAVDAKAD---RAS  399

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
             + DAL CK GTLD +K KGK++VCL+G+NDR +K  +AA AGAVGMILAN+ +SGN++++
Sbjct  400   SDDALLCKKGTLDSKKAKGKIVVCLRGDNDRTDKGVQAARAGAVGMILANNIESGNDVLS  459

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             D H LPA+H+ Y DG  IF Y+N T++P A I+   T LG  P+P++A+FSSRGPN I+P
Sbjct  460   DPHVLPASHLGYDDGSYIFSYLNNTKSPKASISKVETKLGQSPSPIMASFSSRGPNIIDP  519

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
              ILKPDI+ PGV+++AA++EA  PS    DKR   F   SGTSMS PHV+G+VG++K+L+
Sbjct  520   SILKPDITGPGVDIVAAYSEAASPSQQKSDKRRSPFITLSGTSMSTPHVSGIVGIIKSLH  579

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P WSPA I+SAIMTTA ++ N+GK I  D T +   PFAYGAG + PN A DPGLVYDL 
Sbjct  580   PDWSPAAIKSAIMTTARIKDNTGKPIL-DSTRINANPFAYGAGQVQPNHAVDPGLVYDLN  638

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLK  396
             +TDY N++C +GY  + +T   G  Y CP   +L  FNYPSI++P+LK      VTRTL 
Sbjct  639   ITDYTNYLCNRGYKGSRLTIFYGKRYICPKSFNLLDFNYPSISIPNLKIRDFLNVTRTLT  698

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFE  306
             NVGSP+TY   +++P    V+V PK+   E
Sbjct  699   NVGSPSTYKVHIQAPHEVLVSVEPKVGGME  728



>emb|CAN62337.1| hypothetical protein VITISV_004299 [Vitis vinifera]
Length=590

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/587 (66%), Positives = 459/587 (78%), Gaps = 6/587 (1%)
 Frame = -2

Query  1928  RKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAK  1749
             RKLIGARYF QGY++AVG LNSSF TPRD  GHGSHTLSTAGGNFV GA+VFG GNGTAK
Sbjct  10    RKLIGARYFHQGYAAAVGSLNSSFHTPRDTEGHGSHTLSTAGGNFVEGASVFGFGNGTAK  69

Query  1748  GGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDS  1569
             GGSPKARVAAYKVCWPP   G +C+DADILA FD AI DGVDVLS SLGG  P P+FNDS
Sbjct  70    GGSPKARVAAYKVCWPPVG-GNECFDADILAAFDIAIHDGVDVLSASLGG-LPTPFFNDS  127

Query  1568  LAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHY  1389
             L+IGSFHAVK+GIVVV SAGN GP  G+V+N++PW  TVGA+TMDR+F S  VLGNKK  
Sbjct  128   LSIGSFHAVKHGIVVVCSAGNSGPADGTVSNISPWQFTVGASTMDRQFPSYXVLGNKKRL  187

Query  1388  TGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQG  1209
              G S  P  LP  KF+PL+SAA A+    A+ S  DAL CK GTLD  KVKGK+LVCL+G
Sbjct  188   EGGSLSPKALPPNKFFPLISAADAK---AANASADDALLCKAGTLDHSKVKGKILVCLRG  244

Query  1208  ENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRN  1029
             EN R++K  +AALAGAVGM+LAN+E +GNE+IAD H LPA+H+ ++DG+A+F Y+N T++
Sbjct  245   ENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHVLPASHINFTDGVAVFTYLNSTKS  304

Query  1028  PVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDN  849
             P+A+IT   T LG KPAP +AAFSS+GPN I P+ILKPDI+APGV+VIAA+TEA GP++ 
Sbjct  305   PIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIAAYTEAQGPTNQ  364

Query  848   DYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAIT  669
             D+DKR V FN  SGTSMSCPHV+G+VGLLKTL+P WSPA IRSA+MTTA    NS +AI 
Sbjct  365   DFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWSPAAIRSAMMTTARTMDNSMEAIL  424

Query  668   DDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYK  489
              + +  K TPF+YGAGH+ PN A +PGLVYDL + DY+NF+CA GYN+T I      PY 
Sbjct  425   -NASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDYLNFLCALGYNQTLIKMFSERPYT  483

Query  488   CPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKF  309
             CP  ISL+ FNYPSITVP L G+ TVTRTLKNVG P TY A +R P G SV+V P  LKF
Sbjct  484   CPKPISLTNFNYPSITVPKLHGSITVTRTLKNVGPPGTYKARIRKPTGISVSVKPDSLKF  543

Query  308   EKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVKTA  168
              K+GEE++F +TL+A+   A  DY FG L WSD KH VRSPIVVK A
Sbjct  544   NKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHFVRSPIVVKAA  590



>ref|XP_002306266.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
 gb|EEE93262.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
Length=759

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/734 (56%), Positives = 531/734 (72%), Gaps = 19/734 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DLDRV  SHH+LLG+ + S +KA++AIFYSYTR+ NGFAA+LE+EEAAEI+K+P+V+SV
Sbjct  40    LDLDRVTDSHHELLGSCMQSKEKAKEAIFYSYTRYFNGFAAILEDEEAAEISKHPKVLSV  99

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N+  +L TT SW+FLGLE +G +  D S+W KAKFGE  IIG LD GVWPES+SF++E
Sbjct  100   FRNQISKLHTTNSWDFLGLERDGEISAD-SMWLKAKFGEGVIIGTLDFGVWPESESFNDE  158

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GP+P +WKG C    +    CNRKLIGARYF +GY + VG PLNSS+ T RD  GHG+
Sbjct  159   GMGPVPSKWKGYCDT--NDGVKCNRKLIGARYFSKGYEAEVGHPLNSSYHTARDYNGHGT  216

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G   GTAKGGSP +RVA+YKVCWP      DC DAD+LAG++ 
Sbjct  217   HTLSTAGGRFVSGANLLGSAYGTAKGGSPNSRVASYKVCWP------DCLDADVLAGYEA  270

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LSVSLG   P  YF D  AIG+FHAV+NGI+VVA+AGNEGP  G+V NVAPW
Sbjct  271   AIHDGVDILSVSLGFV-PNEYFKDRTAIGAFHAVENGILVVAAAGNEGPAPGAVVNVAPW  329

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             ++TVGA+T+ R F SN +LGN K Y G S      P GKFYPL+++   +    A++S+ 
Sbjct  330   ILTVGASTISREFPSNAILGNHKRYKGLSINTNTQPAGKFYPLINSVDVKA---ANVSSH  386

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
              A HC  G+LDP KVKGK++ C + E    EKS   A +G VGMILA D+   + +   A
Sbjct  387   LAKHCLVGSLDPVKVKGKIVYCTRDEVFDGEKSLVVAQSGGVGMILA-DQFMFSVVDPIA  445

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             HF+P + V+  DGL+I  YI  T+ PVA+I+   T +G   AP +A FSS GPN I P+I
Sbjct  446   HFVPTSVVSAVDGLSILSYIYSTKTPVAYISGA-TEVGTVAAPTMANFSSPGPNPITPEI  504

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGVN++AA+TEA+GP     D+R V FN+ SGTS+SCPHV+G+ GLLK ++P 
Sbjct  505   LKPDITAPGVNILAAYTEASGPFHIAGDQRQVLFNIMSGTSISCPHVSGIAGLLKAIHPD  564

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMTTAT  +N+ + I  + + ++  P  YGAGHI P+ A +PGLVYDL   
Sbjct  565   WSPAAIKSAIMTTATTISNAREPIA-NASLIEANPLNYGAGHIWPSRAMEPGLVYDLTTR  623

Query  563   DYVNFICAQGYNKTEITAVLGTPYKC--PDHISLSTFNYPSITVPHLKGTATVTRTLKNV  390
             DYV+F+C+ GYN T+++  LG PY C   ++ S+  FNYPSITVP+L G  T++RTLKNV
Sbjct  624   DYVDFLCSIGYNSTQLSLFLGEPYICQSQNNSSVVDFNYPSITVPNLSGKITLSRTLKNV  683

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  210
             G+P++Y   +++P G SV V P+ L+F+K  EE+ F++T++AK      DY FG +TWSD
Sbjct  684   GTPSSYRVHIKAPRGISVKVEPRSLRFDKKHEEKMFEMTVEAKKGFKNDDYVFGGITWSD  743

Query  209   KKHRVRSPIVVKTA  168
              KH VRSPIV+K A
Sbjct  744   GKHHVRSPIVIKKA  757



>ref|XP_010647022.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=758

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/730 (56%), Positives = 515/730 (71%), Gaps = 25/730 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DL+R+  SHH LLG+ LGS +KA+++IFYSYT HINGFAA LE+EEAAE++K P V+S+
Sbjct  47    MDLNRITDSHHDLLGSCLGSKEKAQESIFYSYTHHINGFAANLEDEEAAELSKRPGVVSI  106

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +LQTTRSWEFLGLE  G +  D SIW KA+FGED IIGN+DTGVWPES+SF+++
Sbjct  107   FLNQKHKLQTTRSWEFLGLERNGEIPAD-SIWVKARFGEDIIIGNIDTGVWPESESFNDQ  165

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GPIP +WKG C+   D    CNRKLIGARYF +G  + +G PLNSS+ T RD  GHG+
Sbjct  166   GMGPIPSKWKGYCEPNDD--VKCNRKLIGARYFNKGVEAELGSPLNSSYQTVRDTSGHGT  223

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G G GTAKGGSP ARVA+YK CWP      DC D D+LA  D 
Sbjct  224   HTLSTAGGRFVGGANLLGSGYGTAKGGSPSARVASYKSCWP------DCNDVDVLAAIDA  277

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LS+S+       YF DS+AIGS HAV+NGIVVV + GNEGP  GSV N+APW
Sbjct  278   AIHDGVDILSLSIAFVSRD-YFLDSIAIGSLHAVQNGIVVVCAGGNEGPTPGSVKNMAPW  336

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F SNV LGN + + G S     LP  KFYPL+ +  AR    A+ S  
Sbjct  337   IITVAASTIDRDFPSNVTLGNNQQFKGRSFYTNTLPAEKFYPLVYSVDARA---ANASAS  393

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  C  G+LDP+KVKGK++ CL G N+ +EKS   A AG +GMIL++       +  D 
Sbjct  394   DAQVCSVGSLDPKKVKGKIVYCLVGVNENVEKSWVVAQAGGIGMILSD------RLSTDT  447

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
              F+    +        F +++  R PVA+I+   T +G   AP+I +FSS+GPN I P+I
Sbjct  448   SFM--IXLVLRKVFFFFFHVSTFRYPVAYISGA-TEVGTVAAPIIPSFSSQGPNPITPEI  504

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPD++APGV ++AA+++ATGP+D   D R V F++ SGTSMSCPHVAG +GLLK ++P 
Sbjct  505   LKPDLTAPGVQIVAAYSQATGPTDLQSDDRRVPFSIISGTSMSCPHVAGTIGLLKKIHPD  564

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSP+ +RSAIMTTA  R N  + + ++  G +  PF+YGAGH+ P+ A DPGLVYDL  T
Sbjct  565   WSPSALRSAIMTTARTRTNVRQPLVNETLG-EANPFSYGAGHLWPSRAMDPGLVYDLTTT  623

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++  +   Y+CP   +SL   NYPSITVP L G  TVTRTLKNVG
Sbjct  624   DYLNFLCSIGYNATQLSTFVDKGYECPSKPMSLLNLNYPSITVPSLSGKVTVTRTLKNVG  683

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +PATYT     P G SV V P  LKFEK+ EE++FKV L+AK +    +Y FG L WSD 
Sbjct  684   TPATYTVRTEVPSGISVKVEPNTLKFEKINEEKTFKVILEAKRDGKGGEYVFGRLIWSDG  743

Query  206   KHRVRSPIVV  177
             +H VRSPIVV
Sbjct  744   EHYVRSPIVV  753



>ref|XP_002269259.3| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=749

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/730 (57%), Positives = 516/730 (71%), Gaps = 18/730 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +   ++  S++ LLG+ +GS  KA++AIFYSYT +INGFAA+LE+EEAAE++K P V+SV
Sbjct  29    LHFSKITDSYYDLLGSCMGSKKKAQEAIFYSYTSYINGFAAVLEDEEAAELSKQPGVLSV  88

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +L TTRSWEFLGLE   G I   SIW KA+FGE+ IIGNLDTGVW ES SF+++
Sbjct  89    FLNQKNELHTTRSWEFLGLE-RNGEIPANSIWVKARFGEEIIIGNLDTGVWSESDSFNDK  147

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G  PIP +WKG C+        CNRKL+GARYF +GY +A+G PL+SS+ T RD  GHG+
Sbjct  148   GMEPIPSKWKGYCE--PSDGVKCNRKLVGARYFNKGYEAALGKPLDSSYQTARDTNGHGT  205

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G G GTAKGGSP ARVA+YKVCWP       CYDADILA FD 
Sbjct  206   HTLSTAGGGFVGGANLLGSGYGTAKGGSPSARVASYKVCWP------SCYDADILAAFDA  259

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVSLGG  P  YF DS+AIGSF AVK GIVVV SAGN GP  GSV N APW
Sbjct  260   AIHDGVDVLSVSLGGP-PRDYFLDSIAIGSFQAVKKGIVVVCSAGNSGPTPGSVENSAPW  318

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F S V+LGN   + G S     LP  KFYPL+ +  AR     + S +
Sbjct  319   IITVAASTIDRDFPSYVMLGNNLQFKGLSFYTNSLPAAKFYPLVYSVDARAP---NASAR  375

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             +A  C  G+LDPEKVKGK++ CL G N+ ++KS   A AG +GMILAN   S + +I  A
Sbjct  376   EAQLCFVGSLDPEKVKGKIVYCLIGLNEIVQKSWVVAQAGGIGMILAN-RLSTSTLIPQA  434

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             HF+P ++V+ +DGLAI  YI+ T+ PVA+I    T +G   AP++A+FSS+GPN I P I
Sbjct  435   HFVPTSYVSAADGLAILLYIHITKYPVAYI-RGATEVGTVAAPIMASFSSQGPNTITPGI  493

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             L PDI+APGVN++AA+ EA GP+    D R V FN+ SGTSMSCP V+G VGLLK ++P 
Sbjct  494   LNPDITAPGVNILAAYIEAKGPTFLQSDDRRVLFNIVSGTSMSCPQVSGTVGLLKKIHPH  553

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSP+ IRSAIMTTA  R N  + + +  T  +  PF YGAGH+ PN A DPGLVYDL   
Sbjct  554   WSPSAIRSAIMTTARTRNNVRQPMANG-TLEEANPFNYGAGHLWPNRAMDPGLVYDLTTI  612

Query  563   DYVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++  +  PY+  P+ +S+   NYPSITVP   G  TVTRTLKNVG
Sbjct  613   DYLNFLCSIGYNATQLSRFVDEPYESPPNPMSVLDLNYPSITVPSFSGKVTVTRTLKNVG  672

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +PATY      P    V V P+ LKFEK+ EE++FKVTL+AK +   + Y FG L WSD 
Sbjct  673   TPATYAVRTEVPSELLVKVEPERLKFEKINEEKTFKVTLEAKRDGEGSGYIFGRLIWSDG  732

Query  206   KHRVRSPIVV  177
             +H VRSPIVV
Sbjct  733   EHYVRSPIVV  742



>gb|AET00862.2| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/737 (56%), Positives = 515/737 (70%), Gaps = 28/737 (4%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLD    SH+ LL + LGS +KA+DAIFYSY RHINGFAA+L++EEA E+A+NP V+SV
Sbjct  49    VDLDYATKSHYSLLSSILGSNEKAKDAIFYSYNRHINGFAAILKDEEADELARNPNVVSV  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
              LN+  QL TTRSWEFLG+E    +I   SIW+KA++GEDTIIGNLDTGVWPES+SF ++
Sbjct  109   SLNKMHQLHTTRSWEFLGVE-RNEIIPKESIWEKARYGEDTIIGNLDTGVWPESQSFGDQ  167

Query  2000  GFGPIPKRWKG--ICQNQK---DKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVI  1836
             G GPIP +W+G  ICQ       +  HCNRKLIGAR F +GY + VG L++SF+T RD I
Sbjct  168   GMGPIPSKWRGNGICQFDTFIGSRKTHCNRKLIGARAFYKGYEAYVGKLDASFYTARDTI  227

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHGSHTLSTAGGNFV G +V+G GNGTAKGGSPKA VAAYKVCW        C DAD+LA
Sbjct  228   GHGSHTLSTAGGNFVQGVSVYGNGNGTAKGGSPKAHVAAYKVCWK-----GGCSDADVLA  282

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
             GF+ AI DGVDVLSVSLG       F DS++IGSFHAV NGIVVVASAGN GP  G+V+N
Sbjct  283   GFEAAISDGVDVLSVSLGMKTHN-LFTDSISIGSFHAVANGIVVVASAGNSGPYFGTVSN  341

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             VAPWL TV A+T+DR F S V LG+ KH+ G S     LPT KFYPL+S    +   +  
Sbjct  342   VAPWLFTVAASTIDRDFASYVTLGDNKHFKGTSLSSKDLPTHKFYPLISGEQGK---HFY  398

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
               ++DA  C+ GTLD EKV+GK++VCL+          EA+ AGAVGMILA+D++S  + 
Sbjct  399   ALSRDAKFCRYGTLDVEKVRGKIVVCLEDVYFGTIPGPEASSAGAVGMILASDDESYYDF  458

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             IA  H LP + V Y D   I+ YI   +NPVA+IT   T + + PAPVIA+FSSRGP+ I
Sbjct  459   IAYPHALPTSQVNYIDSQYIYSYIKNEKNPVAYITKAITEIPIIPAPVIASFSSRGPSTI  518

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
              P ILKPDI+APGVN+IAA+TE           R +S+   SGTSM+CPHV+G+ GLLKT
Sbjct  519   IPSILKPDITAPGVNIIAAYTEIN---------RRISYKSLSGTSMACPHVSGIAGLLKT  569

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+P WSPA I+SAIMTTA+   NS + I  D+ G   TPFAYG+GH+ PN A DPGL+YD
Sbjct  570   LHPKWSPAAIKSAIMTTASKMDNSKRPI-KDRFGENATPFAYGSGHVQPNLAIDPGLIYD  628

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL-KGTATVTRTL  399
             L + DY++ +C    N  +I A+   P+ CP+  ++   NYP+IT+ +L      V+RT+
Sbjct  629   LNIVDYLSLLCVYNKNYKQIEAIYKKPFICPESYNVVDLNYPTITILNLGDKIIKVSRTV  688

Query  398   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN--ATADYAFGV  225
              NVG P+TY    ++P G SV++ P  L F++VGE++SFKV +    EN  AT DY FG 
Sbjct  689   TNVGPPSTYYVQAKAPDGVSVSIEPSYLSFKEVGEKKSFKVIVMKAMENGDATMDYVFGE  748

Query  224   LTWSDKKHRVRSPIVVK  174
             L WS+ KHRV S I VK
Sbjct  749   LLWSNGKHRVMSTIAVK  765



>emb|CBI38462.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/730 (57%), Positives = 517/730 (71%), Gaps = 18/730 (2%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +   ++  S++ LLG+ +GS  KA++AIFYSYT +INGFAA+LE+EEAAE++K P V+SV
Sbjct  52    LHFSKITDSYYDLLGSCMGSKKKAQEAIFYSYTSYINGFAAVLEDEEAAELSKQPGVLSV  111

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +L TTRSWEFLGLE   G I   SIW KA+FGE+ IIGNLDTGVW ES SF+++
Sbjct  112   FLNQKNELHTTRSWEFLGLE-RNGEIPANSIWVKARFGEEIIIGNLDTGVWSESDSFNDK  170

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G  PIP +WKG C+        CNRKL+GARYF +GY +A+G PL+SS+ T RD  GHG+
Sbjct  171   GMEPIPSKWKGYCE--PSDGVKCNRKLVGARYFNKGYEAALGKPLDSSYQTARDTNGHGT  228

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G G GTAKGGSP ARVA+YKVCWP       CYDADILA FD 
Sbjct  229   HTLSTAGGGFVGGANLLGSGYGTAKGGSPSARVASYKVCWP------SCYDADILAAFDA  282

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVDVLSVSLGG  P  YF DS+AIGSF AVK GIVVV SAGN GP  GSV N APW
Sbjct  283   AIHDGVDVLSVSLGGP-PRDYFLDSIAIGSFQAVKKGIVVVCSAGNSGPTPGSVENSAPW  341

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F S V+LGN   + G S     LP  KFYPL+ +  AR   NAS   +
Sbjct  342   IITVAASTIDRDFPSYVMLGNNLQFKGLSFYTNSLPAAKFYPLVYSVDARAP-NAS--AR  398

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             +A  C  G+LDPEKVKGK++ CL G N+ ++KS   A AG +GMILAN   S + +I  A
Sbjct  399   EAQLCFVGSLDPEKVKGKIVYCLIGLNEIVQKSWVVAQAGGIGMILAN-RLSTSTLIPQA  457

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             HF+P ++V+ +DGLAI  YI+ T+ PVA+I    T +G   AP++A+FSS+GPN I P I
Sbjct  458   HFVPTSYVSAADGLAILLYIHITKYPVAYI-RGATEVGTVAAPIMASFSSQGPNTITPGI  516

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             L PDI+APGVN++AA+ EA GP+    D R V FN+ SGTSMSCP V+G VGLLK ++P 
Sbjct  517   LNPDITAPGVNILAAYIEAKGPTFLQSDDRRVLFNIVSGTSMSCPQVSGTVGLLKKIHPH  576

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSP+ IRSAIMTTA  R N  + + +  T  +  PF YGAGH+ PN A DPGLVYDL   
Sbjct  577   WSPSAIRSAIMTTARTRNNVRQPMANG-TLEEANPFNYGAGHLWPNRAMDPGLVYDLTTI  635

Query  563   DYVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++  +  PY+  P+ +S+   NYPSITVP   G  TVTRTLKNVG
Sbjct  636   DYLNFLCSIGYNATQLSRFVDEPYESPPNPMSVLDLNYPSITVPSFSGKVTVTRTLKNVG  695

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +PATY      P    V V P+ LKFEK+ EE++FKVTL+AK +   + Y FG L WSD 
Sbjct  696   TPATYAVRTEVPSELLVKVEPERLKFEKINEEKTFKVTLEAKRDGEGSGYIFGRLIWSDG  755

Query  206   KHRVRSPIVV  177
             +H VRSPIVV
Sbjct  756   EHYVRSPIVV  765



>emb|CBI38458.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/730 (55%), Positives = 511/730 (70%), Gaps = 33/730 (5%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +DL+R+  SHH LLG+ LGS +KA+++IFYSYT HINGFAA LE+EEAAE++K P V+S+
Sbjct  44    MDLNRITDSHHDLLGSCLGSKEKAQESIFYSYTHHINGFAANLEDEEAAELSKRPGVVSI  103

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             FLN+  +LQTTRSWEFLGLE  G +  D SIW KA+FGED IIGN+DTGVWPES+SF+++
Sbjct  104   FLNQKHKLQTTRSWEFLGLERNGEIPAD-SIWVKARFGEDIIIGNIDTGVWPESESFNDQ  162

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GPIP +WKG C+   D    CNRKLIGARYF +G  + +G PLNSS+ T RD  GHG+
Sbjct  163   GMGPIPSKWKGYCEPNDD--VKCNRKLIGARYFNKGVEAELGSPLNSSYQTVRDTSGHGT  220

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTLSTAGG FV GAN+ G G GTAKGGSP ARVA+YK CWP      DC D D+LA  D 
Sbjct  221   HTLSTAGGRFVGGANLLGSGYGTAKGGSPSARVASYKSCWP------DCNDVDVLAAIDA  274

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LS+S+       YF DS+AIGS HAV+NGIVVV + GNEGP  GSV N+APW
Sbjct  275   AIHDGVDILSLSIAFVSRD-YFLDSIAIGSLHAVQNGIVVVCAGGNEGPTPGSVKNMAPW  333

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             +ITV A+T+DR F SNV LGN + + G S     LP  KFYPL+ +  AR    A+ S  
Sbjct  334   IITVAASTIDRDFPSNVTLGNNQQFKGRSFYTNTLPAEKFYPLVYSVDARA---ANASAS  390

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
             DA  C  G+LDP+KVKGK++ CL G N+ +EKS   A AG +GMIL++   +    +   
Sbjct  391   DAQVCSVGSLDPKKVKGKIVYCLVGVNENVEKSWVVAQAGGIGMILSDRLSTDTSKVFFF  450

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
                               +++  R PVA+I+   T +G   AP+I +FSS+GPN I P+I
Sbjct  451   F----------------FHVSTFRYPVAYISGA-TEVGTVAAPIIPSFSSQGPNPITPEI  493

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPD++APGV ++AA+++ATGP+D   D R V F++ SGTSMSCPHVAG +GLLK ++P 
Sbjct  494   LKPDLTAPGVQIVAAYSQATGPTDLQSDDRRVPFSIISGTSMSCPHVAGTIGLLKKIHPD  553

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSP+ +RSAIMTTA  R N  + + ++  G +  PF+YGAGH+ P+ A DPGLVYDL  T
Sbjct  554   WSPSALRSAIMTTARTRTNVRQPLVNETLG-EANPFSYGAGHLWPSRAMDPGLVYDLTTT  612

Query  563   DYVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++  +   Y+CP   +SL   NYPSITVP L G  TVTRTLKNVG
Sbjct  613   DYLNFLCSIGYNATQLSTFVDKGYECPSKPMSLLNLNYPSITVPSLSGKVTVTRTLKNVG  672

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +PATYT     P G SV V P  LKFEK+ EE++FKV L+AK +    +Y FG L WSD 
Sbjct  673   TPATYTVRTEVPSGISVKVEPNTLKFEKINEEKTFKVILEAKRDGKGGEYVFGRLIWSDG  732

Query  206   KHRVRSPIVV  177
             +H VRSPIVV
Sbjct  733   EHYVRSPIVV  742



>ref|XP_008344750.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=627

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/625 (62%), Positives = 465/625 (74%), Gaps = 14/625 (2%)
 Frame = -2

Query  2033  VWPESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF  1854
             VWPESKSFS+EG GPIP +W+GICQ  K+ S  CNRKLIGARYF +GY +    +NS+  
Sbjct  8     VWPESKSFSDEGMGPIPSKWRGICQLTKNGS-RCNRKLIGARYFSKGYLAYASMVNSTAA  66

Query  1853  -----TPRDVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSP  1689
                    RD  GHGSHTLSTAGGNFVP A+VFG GNGTAKGGSPKARVAAYKVCWPP + 
Sbjct  67    KSIQPNARDYAGHGSHTLSTAGGNFVPRASVFGNGNGTAKGGSPKARVAAYKVCWPPIND  126

Query  1688  GEDCYDADILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAG  1509
              E C+DADILA F+ AI DGVDVLSVSLGG+    +FND +AIGSFHAVK GI VV+SAG
Sbjct  127   NE-CFDADILAAFEAAISDGVDVLSVSLGGEAV-EFFNDGIAIGSFHAVKKGITVVSSAG  184

Query  1508  NEGPVAGSVNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLS  1329
             N GP  GSV+NVAPW++TVGA+T+DR F + V LGNKKH  G S     LP  KFYPL+S
Sbjct  185   NSGPTPGSVSNVAPWMLTVGASTIDREFSNYVALGNKKHLKGASLSSTGLPAEKFYPLIS  244

Query  1328  AASARIKINASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMI  1149
             A+ A+   NAS S  +A  CKP TLD +K +GK+LVC++GEN R  K  +A LAGAVGMI
Sbjct  245   ASDAK-ATNASAS--EAQLCKPSTLDKKKAEGKILVCVRGENARANKGQQAILAGAVGMI  301

Query  1148  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  969
             L ND+ SGNEIIAD H LPA+HV +SD  ++F YI  T+ P+A+IT   T LG KPAP +
Sbjct  302   LVNDKLSGNEIIADPHLLPASHVNFSDXESVFAYIKSTKIPMAYITRVKTELGTKPAPFM  361

Query  968   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  789
             A+FSSRGPN +   ILKPDI+APGV++IAA+T+ATGP+D ++D R V FN ESGTSMSCP
Sbjct  362   ASFSSRGPNPVEQSILKPDITAPGVSIIAAYTQATGPTDGEFDTRRVPFNTESGTSMSCP  421

Query  788   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINP  609
             HV+G+VGLLKTL+P+W+PA I+SAIMTTA  R N+ K    D +  + TPFAYGAGH+ P
Sbjct  422   HVSGIVGLLKTLHPTWTPAAIKSAIMTTARKRDNN-KGTMLDSSKARATPFAYGAGHVQP  480

Query  608   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  429
             N A DPGLVYDL   DY+NF+CA+GYN T +      P+KCP   SLS FNYPSITVP+L
Sbjct  481   NXAMDPGLVYDLTTDDYLNFLCARGYNATLLKVFSKEPHKCPKAYSLSDFNYPSITVPNL  540

Query  428   KGT-ATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  252
             + T  TVTR +KNVGSP TY   V+ PVG SVTV P  L+F+  GEE+ F V LKA+ + 
Sbjct  541   RDTPVTVTRRVKNVGSPGTYVVRVKEPVGVSVTVKPGTLQFKSNGEEKKFTVVLKAQVQ-  599

Query  251   ATADYAFGVLTWSDKKHRVRSPIVV  177
                DY FG L W+D KH VRSPIVV
Sbjct  600   GPQDYVFGELNWTDGKHNVRSPIVV  624



>ref|XP_011013808.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=749

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/733 (56%), Positives = 513/733 (70%), Gaps = 21/733 (3%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             D +  S++ LLG+ L S +KA++AIFYSYT HINGFAA LE++E  +++  PEV+SVF N
Sbjct  27    DGMTESYYDLLGSCLKSKEKAKEAIFYSYTSHINGFAATLEDDEVDQLSNRPEVVSVFPN  86

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
                QL TTRSWEFLGLE  G +  D SIW KA+FGED IIGNLDTGVWPES+SF +EG G
Sbjct  87    EVNQLHTTRSWEFLGLERNGQIPAD-SIWLKARFGEDVIIGNLDTGVWPESQSFDDEGMG  145

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGP-LNSSFFTPRDVIGHGSHTL  1815
             PIP RWKG C+   +    CNRKLIGARYF +GY +A+G  L+SS    RD  GHG+HTL
Sbjct  146   PIPTRWKGYCET--NDGVKCNRKLIGARYFNKGYEAALGRRLDSSNNPARDTNGHGTHTL  203

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FV GAN  G   GTAKGGSP ARVA+YKVCWP       CYDADILA FD AI+
Sbjct  204   STAGGRFVSGANFLGSAYGTAKGGSPNARVASYKVCWP------RCYDADILAAFDAAIQ  257

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAG--SVNNVAPWL  1461
             DGVD+LS+SLG     PYF   +AIGSF AV NGI+VV SAGN G V G  + +NVAPW+
Sbjct  258   DGVDILSLSLGRALEIPYFRSGIAIGSFQAVMNGILVVCSAGNSGQVLGFGTTSNVAPWV  317

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+T+DR F SNVVLGN K + G S     L   K+YP++ +  A+    A+ S Q 
Sbjct  318   LTVAASTIDREFPSNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKA---ANASAQL  374

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILAND-EDSGNEIIADA  1104
             A  C P +LDP+KV+GK++ CL+G    +EKS   A AG VGMILA+   DS +      
Sbjct  375   AQICYPESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVGMILAHQFADSSSS--PRG  432

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
              F+P + V+  DGL++  YI+ T++PVA+I+  +T +G   APV+A FSS GPN I P+I
Sbjct  433   FFVPTSLVSAIDGLSVLSYIHSTKSPVAYISG-STEIGKVVAPVMAPFSSTGPNEITPEI  491

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+++AA+T+A        D+R +SFN+ SGTSMSCPHV+G+ GLLKT++P 
Sbjct  492   LKPDITAPGVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPD  551

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMTTA   +N+ + I    +  + TPF YG+GH+ PN A DPGLVYDL  T
Sbjct  552   WSPAAIKSAIMTTARTSSNARQPIA-KASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTT  610

Query  563   DYVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++     PY C P +ISL  FNYPSITVP+L G  T+TRTLKNVG
Sbjct  611   DYLNFLCSIGYNATQMSIFNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVG  670

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P  YT  V+ P G  V V PK LKF K+ EE++FKV LKAK +     Y FG LTWSD 
Sbjct  671   TPGLYTVRVKKPDGILVKVEPKSLKFSKLNEEKTFKVMLKAKDDWFRRSYVFGGLTWSDG  730

Query  206   KHRVRSPIVVKTA  168
              H V+SPIVV+ A
Sbjct  731   VHHVKSPIVVRKA  743



>ref|XP_002309930.2| hypothetical protein POPTR_0007s04500g [Populus trichocarpa]
 gb|EEE90380.2| hypothetical protein POPTR_0007s04500g [Populus trichocarpa]
Length=743

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/731 (56%), Positives = 525/731 (72%), Gaps = 20/731 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  +HH+LLG+ + S +KA+ AIFYSYTR+INGFAA+LE+EEAAEI+K+PEV+SV 
Sbjct  24    DLDRVTDAHHELLGSCMKSKEKAKQAIFYSYTRYINGFAAVLEDEEAAEISKHPEVVSVS  83

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+  QL TT SW FLGLE   G I   S+W KA+FGED IIG LD+GVWPES+SF++EG
Sbjct  84    RNQISQLHTTNSWGFLGLE-RNGEIPANSMWLKARFGEDVIIGTLDSGVWPESESFNDEG  142

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +WKG C    +    CNRKLIGARYF +GY +A   L+SS+ T RD  GHG+HT
Sbjct  143   MGPVPSKWKGYCD--PNDGIKCNRKLIGARYFSKGYEAA-ETLDSSYHTARDYDGHGTHT  199

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG FV GAN+ G   GTAKGGSP +RVA+YKVCWP       C DAD+LAG++ AI
Sbjct  200   LSTAGGRFVSGANLLGSAYGTAKGGSPNSRVASYKVCWP------RCSDADVLAGYEAAI  253

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVD+LSVSLG   P  YF    AIG+F AV+ GI+VVASAGNEGP  G V NVAPW++
Sbjct  254   HDGVDILSVSLGSG-PREYFTHGNAIGAFLAVERGILVVASAGNEGPDPGIVGNVAPWIL  312

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV  +T+ R F SNV+LGN K Y G S      P GK YPL+++  A+    A++S+  A
Sbjct  313   TVACSTISRDFTSNVILGNNKQYKGVSFNTNTQPAGKSYPLINSVDAKA---ANVSSNQA  369

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGEN-DRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
              +C  G+LDP KVKGK++ C + E+ D +EKS   A AG VG+ILAN   +  +I+  AH
Sbjct  370   KYCSIGSLDPLKVKGKIVYCTRNEDPDIVEKSLVVAQAGGVGVILANQFIT-EQILPLAH  428

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
             F+P + V+  DGL+I  Y+  T++PVA+I+   T +G   APV+A FSS GPN I P+IL
Sbjct  429   FVPTSFVSADDGLSILTYVYGTKSPVAYISGA-TEVGTVAAPVMADFSSPGPNFITPEIL  487

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN++AAFT A+GP+D   D+R V FN  SGTSM+CPHV+G+ GLLKT++P W
Sbjct  488   KPDITAPGVNILAAFTGASGPADVRGDRRRVHFNFLSGTSMACPHVSGIAGLLKTIHPDW  547

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA I+SAIMTTAT  +N  + I +    L+  P  YGAGH+ P+ A DPGLVYDL   +
Sbjct  548   SPAAIKSAIMTTATTISNVKQPIANASL-LEANPLNYGAGHVWPSRAMDPGLVYDLTTKN  606

Query  560   YVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGT-ATVTRTLKNVG  387
             YVNF+C+ GYN T+++  +G PY C P +  L  FNYPSITVP+L G   T++RTLKNVG
Sbjct  607   YVNFLCSIGYNSTQLSLFIGKPYICQPHNNGLLDFNYPSITVPNLSGNKTTLSRTLKNVG  666

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P+ Y  ++R+P G SV V P+ LKF+K+ EE+ FKVTL+AK    + DY FG +TWSD+
Sbjct  667   TPSLYRVNIRAPGGISVKVEPRSLKFDKINEEKMFKVTLEAKKGFKSNDYVFGEITWSDE  726

Query  206   KHRVRSPIVVK  174
              H VRSP+VVK
Sbjct  727   NHHVRSPVVVK  737



>ref|XP_002525023.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37350.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/733 (56%), Positives = 524/733 (71%), Gaps = 20/733 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D   + +S+++LLG+ + S +KA++AIFYSYT +INGFAA LE+EE  EIAK PEV+SV
Sbjct  26    LDDSGITNSYYELLGSCMKSKEKAKEAIFYSYTSYINGFAATLEDEEVDEIAKRPEVVSV  85

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F N   +L TTRSWEFLGLE  G +  D SIW KA+FGED IIGNLDTG+WPES+SF+++
Sbjct  86    FPNEENELHTTRSWEFLGLERNGHIPPD-SIWPKARFGEDIIIGNLDTGIWPESESFNDD  144

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGS  1824
             G GPIP +WKG C    +    CNRKLIGARYF +G+ +A G  LNS+F T RD  GHG+
Sbjct  145   GMGPIPSKWKGHCDT--NDGVKCNRKLIGARYFNKGFEAATGISLNSTFNTARDKDGHGT  202

Query  1823  HTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDR  1644
             HTL+TAGG FV GAN  G  NGT KGGSP ARVAAYKVCWP       C+DADILA FD 
Sbjct  203   HTLATAGGRFVSGANFLGSANGTVKGGSPNARVAAYKVCWP------SCFDADILAAFDA  256

Query  1643  AIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPW  1464
             AI DGVD+LS+SLG   P  Y+N  ++IGSFHAV+NGI+VV SAGN GP+  + +NVAPW
Sbjct  257   AIHDGVDILSISLG-SRPRHYYNHGISIGSFHAVRNGILVVCSAGNSGPII-TASNVAPW  314

Query  1463  LITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQ  1284
             ++TV A+T+DR F S+V LG++K Y G S     LP  K+YPL+ + +A+   NAS+S  
Sbjct  315   ILTVAASTIDRSFPSDVTLGSRKIYKGLSYNTNSLPAKKYYPLIYSGNAKAA-NASVS--  371

Query  1283  DALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADA  1104
              A  C PG+L+P K+KGK++ C +G    ++KS   A AG VGMILAN   + N I   A
Sbjct  372   HARFCVPGSLEPTKMKGKIVYCERGLIPDLQKSWVVAQAGGVGMILANQFPTEN-ISPQA  430

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
             HFLP + V+  DGL+I  YI  T++PV +I+   T +G   AP++A+FS+ GPNAIN +I
Sbjct  431   HFLPTSVVSADDGLSILAYIYSTKSPVGYISG-GTEVGEVAAPIMASFSAPGPNAINSEI  489

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGVN++AA+TEA+GPS    D R + FN+ SGTSMSCPHV+G+ GLLK+++P 
Sbjct  490   LKPDITAPGVNILAAYTEASGPSSLPVDNRHLPFNIISGTSMSCPHVSGIAGLLKSVHPD  549

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMTTA  R+N    I  D   L  +PF YG+GHI P+ A DPGLVYDL   
Sbjct  550   WSPAAIKSAIMTTARTRSNIRLPIFTDSLDL-ASPFNYGSGHIWPSRAMDPGLVYDLSYK  608

Query  563   DYVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYNKT+++A +   + C  +  S+  FNYPSITVPHL G  TVTRTLKNVG
Sbjct  609   DYLNFLCSIGYNKTQMSAFVDRSFNCRSNKTSVLNFNYPSITVPHLLGNVTVTRTLKNVG  668

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P  YT  V +P G SV V P  LKF KV E++SF+VTL+AK    +  YAFG L WSD 
Sbjct  669   TPGVYTVRVDAPEGISVKVEPMSLKFNKVNEKKSFRVTLEAKIIE-SGFYAFGGLVWSDG  727

Query  206   KHRVRSPIVVKTA  168
              H VRSP+VVK A
Sbjct  728   VHNVRSPLVVKQA  740



>ref|XP_003600434.1| Subtilisin-like protease [Medicago truncatula]
Length=754

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/731 (53%), Positives = 513/731 (70%), Gaps = 27/731 (4%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL     SH+ LLG++LGS +KA++AIFYSY +HINGFAA+LE EEAA+IAK+P V+SVF
Sbjct  46    DLQSATDSHYNLLGSHLGSHEKAKEAIFYSYNKHINGFAAVLEVEEAAKIAKHPNVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+  +LQTTRSWEFLGLE   GV+   SIW+K ++GE TII N+D+GV PESKSFS++G
Sbjct  106   ENKGHELQTTRSWEFLGLENNYGVVPKDSIWEKGRYGEGTIIANIDSGVSPESKSFSDDG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P RW+GICQ     +FHCNRKLIGAR++ QGY S  G LN S +  RDV+GHG+ T
Sbjct  166   MGPVPSRWRGICQLD---NFHCNRKLIGARFYSQGYESKFGRLNQSLYNARDVLGHGTPT  222

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LS AGGNFV GANVFGL NGTAKGGSP++ VAAYKVCW                 F+ AI
Sbjct  223   LSVAGGNFVSGANVFGLANGTAKGGSPRSHVAAYKVCW---------------LAFEDAI  267

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVD++S SLG   P  +F D ++IG+FHA++NG++VVA  GN GP  G+V NVAPWL 
Sbjct  268   SDGVDIISCSLGQTSPKEFFEDGISIGAFHAIENGVIVVAGGGNSGPKFGTVTNVAPWLF  327

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             +V A+T+DR F S + LG+K H    +++   LP  KFY L+S+  A++  NA+I  +DA
Sbjct  328   SVAASTIDRNFVSYLQLGDK-HIIMGTSLSTGLPNEKFYSLVSSVDAKVG-NATI--EDA  383

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAG-AVGMILANDEDSGNEIIADAH  1101
               CK G+LDP KVKGK+L CL  E D +  + E A++G ++G++L ND+  GN+I+A AH
Sbjct  384   KICKVGSLDPNKVKGKILFCLLRELDGLVYAEEEAISGGSIGLVLGNDKQRGNDIMAYAH  443

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LP +H+ Y+DG  +  YI  T+ P+A++T   T +GVKPAPVIA+ SSRGPN I P IL
Sbjct  444   LLPTSHINYTDGEYVHSYIKATKTPMAYMTKAKTEVGVKPAPVIASLSSRGPNPIQPIIL  503

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+++ A+  A  P+    D + + +N+ SGTS+SCPHV+ +V LLKT+YP+W
Sbjct  504   KPDITAPGVDILYAYIGAISPTGLASDNQWIPYNIGSGTSISCPHVSAIVALLKTIYPNW  563

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA  +SAIMTT T++ N+ + I  D++    TPF YGAGHI P  A DPGLVYDL + D
Sbjct  564   SPAAFKSAIMTTTTIQGNNHRPI-KDQSKEDATPFGYGAGHIQPELAMDPGLVYDLNIVD  622

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL--KGTATVTRTLKNVG  387
             Y+NF+CA GYN+T++      PY CP   ++  FNYPSITVP+L       VTRT+ NVG
Sbjct  623   YLNFLCAHGYNQTQMKMFSRKPYICPKSYNMLDFNYPSITVPNLGKHFVQEVTRTVTNVG  682

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP TY   V  P G  V + P+ L F +VGE+++FK+  K   +  ++ Y FG L WSD 
Sbjct  683   SPGTYRVQVNEPHGIFVLIKPRSLTFNEVGEKKTFKIIFKVT-KPTSSGYVFGHLLWSDG  741

Query  206   KHRVRSPIVVK  174
             +H+V SP+VVK
Sbjct  742   RHKVMSPLVVK  752



>ref|XP_008449005.1| PREDICTED: subtilisin-like protease isoform X2 [Cucumis melo]
Length=681

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/677 (55%), Positives = 480/677 (71%), Gaps = 12/677 (2%)
 Frame = -2

Query  2204  KNPEVISVFLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWP  2025
             K P V+SVF +R+R+L TT+SW+FLG+E    +    SIW   +FGED II N DTGVWP
Sbjct  12    KFPHVVSVFESRSRKLHTTQSWKFLGVEKHEEIPTSNSIWNVTRFGEDIIIANFDTGVWP  71

Query  2024  ESKSFSEEGFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPR  1845
             ESKSFS+EG+GPIP RW G CQ+  D  F CNRKLIGAR+F  GY    G L  +F + R
Sbjct  72    ESKSFSDEGYGPIPSRWMGTCQSDADPKFRCNRKLIGARFFNIGY----GELADTFNSSR  127

Query  1844  DVIGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDAD  1665
             D +GHG+HTLS AGGNFVPGANV GLGNGT KGGSP+ARVA+YKVCWP      +C D +
Sbjct  128   DNVGHGTHTLSIAGGNFVPGANVLGLGNGTVKGGSPRARVASYKVCWP--DEANECMDPN  185

Query  1664  ILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGS  1485
              LA F+ AI+DGVDV+S+S+GG+ P  +F+D+L++G+FHAV+ GIVVV+SAGN GP  G+
Sbjct  186   TLAAFEAAIDDGVDVISISVGGE-PKEFFSDALSVGAFHAVERGIVVVSSAGNVGPTPGT  244

Query  1484  VNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKI  1305
             V+NV+PW++TVGA+T DR F + V+LGNKK + G S     LP  KFYPL++A  A+ K 
Sbjct  245   VSNVSPWILTVGASTTDRGFTNFVILGNKKKFKGTSFSSKVLPVNKFYPLINAVDAKAK-  303

Query  1304  NASISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSG  1125
               ++S  DA  C  G+LDP+K+ GK++VCL+G   R+ K + AA AGAVGMI+ NDEDSG
Sbjct  304   --NVSVSDAEVCDEGSLDPKKLAGKIVVCLRGGLSRVSKGYVAAKAGAVGMIVENDEDSG  361

Query  1124  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  945
             N II D+H LPA+HVTY D ++IF YIN T+ P A+I+   T L + P+ V+A FSSRGP
Sbjct  362   NAIITDSHVLPASHVTYDDSISIFQYINSTKRPKAYISSVMTELEITPSAVVADFSSRGP  421

Query  944   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  765
             N I   ILKPDI+APGVN++AA+ +    ++   D R   F V+SGTSM+CPHVAG+VGL
Sbjct  422   NTIEESILKPDITAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHVAGIVGL  481

Query  764   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGL  585
             LKTL P WSPA I+SAIMTTA    N+   I D + GL+  P AYGAGH+NPN A DPGL
Sbjct  482   LKTLNPKWSPAAIKSAIMTTAKTTDNNFNPIVDHR-GLEANPLAYGAGHVNPNSAMDPGL  540

Query  584   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVT  408
             VYD+ + DY+NF+CA+GYN  +I  +    + C     ++  NYPSI+V +LK G   + 
Sbjct  541   VYDITIDDYLNFLCARGYNTKQIKRISKKNFICDKSFKVTDLNYPSISVTNLKMGPVAIN  600

Query  407   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFG  228
             R LKNVGSP  Y A V++P+  S+ V P+IL+F  + EE+SFKV LK  G+     Y FG
Sbjct  601   RKLKNVGSPGRYVARVKTPLEVSIIVEPRILEFTAMDEEKSFKVLLKRSGKGKQEGYVFG  660

Query  227   VLTWSDKKHRVRSPIVV  177
              L W+D  H VRS IVV
Sbjct  661   ELVWTDFNHHVRSSIVV  677



>ref|XP_011013366.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=770

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/733 (56%), Positives = 514/733 (70%), Gaps = 21/733 (3%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             D +  S++ LLG+ L S +KA++AIFYSYT HINGFAA LE++E  +++  PEV+SVF N
Sbjct  48    DGMTESYYDLLGSCLKSKEKAKEAIFYSYTSHINGFAATLEDDEVDQLSNRPEVVSVFPN  107

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
                QL TTRSWEFLGLE  G +  D SIW KA+FGED IIGNLDTGVWPES+SF +EG G
Sbjct  108   EVNQLHTTRSWEFLGLERNGQIPAD-SIWLKARFGEDVIIGNLDTGVWPESQSFDDEGMG  166

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTL  1815
             PIP RWKG C+   +    CNRKLIGARYF +GY +A+G  L+SS  T RD  GHG+HTL
Sbjct  167   PIPTRWKGYCET--NDGVKCNRKLIGARYFNKGYEAALGRALDSSNNTARDTDGHGTHTL  224

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FV GAN  G   GTAKGGSP ARVA+YKVCWP       CYDADILA FD AI+
Sbjct  225   STAGGRFVSGANFLGSAYGTAKGGSPNARVASYKVCWP------RCYDADILAAFDAAIQ  278

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGN--EGPVAGSVNNVAPWL  1461
             DGVD+LS+SLG     PYF   +AIG+F AV NGI+VV SAGN  +G   G+ +NVAPW+
Sbjct  279   DGVDILSISLGRAVAIPYFRSGIAIGAFQAVMNGILVVCSAGNSGQGFGFGTASNVAPWV  338

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+T+DR F SNVVLGN K + G S     L   K+YP++ +  A+    A+ S Q 
Sbjct  339   LTVAASTIDREFPSNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKA---ANASAQL  395

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILAND-EDSGNEIIADA  1104
             A  C P +LDP+KV+GK++ CL+G    +EKS   A AG VGMILA+   DS +      
Sbjct  396   AQICYPESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVGMILAHQFADSSSS--PRG  453

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
              F+P + V+  DGL++  YI+ T++PVA+I+  +T +G   APV+A FSS GPN I P+I
Sbjct  454   FFVPTSLVSAIDGLSVLSYIHSTKSPVAYISG-STEIGKVVAPVMAPFSSTGPNEITPEI  512

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+++AA+T+A        D+R +SFN+ SGTSMSCPHV+G+ GLLKT++P 
Sbjct  513   LKPDITAPGVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPD  572

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMTTA   +N+ + I    +  + TPF YG+GH+ PN A DPGLVYDL  T
Sbjct  573   WSPAAIKSAIMTTARTSSNARQPIA-KASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTT  631

Query  563   DYVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++     PY C P +ISL  FNYPSITVP+L G  T+TRTLKNVG
Sbjct  632   DYLNFLCSIGYNATQMSIFNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVG  691

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P  YT  V+ P G  V V PK LKF K+ EE++FKV LKAK +     Y FG LTWSD 
Sbjct  692   TPGLYTVRVKKPDGILVKVEPKSLKFSKLNEEKTFKVMLKAKDDWFRRSYVFGGLTWSDG  751

Query  206   KHRVRSPIVVKTA  168
              H V+SPIVV+ A
Sbjct  752   VHHVKSPIVVRKA  764



>ref|XP_011022895.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Populus 
euphratica]
Length=762

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/733 (55%), Positives = 520/733 (71%), Gaps = 26/733 (4%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  +HH+LLG+ + S +KA+ AIFYSYTR+INGFAA+L++EEAAEI+K+PEV+SV 
Sbjct  45    DLDRVTDAHHELLGSCMKSKEKAKQAIFYSYTRYINGFAAVLDDEEAAEISKHPEVVSVS  104

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+  QL TT SW FLGLE  G +  D S+W KA+FGED IIG LDTGVWPES+SF++EG
Sbjct  105   RNQISQLHTTNSWGFLGLERNGEIPPD-SMWLKARFGEDVIIGTLDTGVWPESESFNDEG  163

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +WKG C         CNRKLIGARYF +GY +A    +SS+ T RD  GHG+HT
Sbjct  164   MGPVPSKWKGYCD--PIDGIKCNRKLIGARYFSKGYEAA-ETHDSSYHTARDYDGHGTHT  220

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG FV GAN+ G G GTAKGGSP +RVA+YKVCW        C DAD+LAG++ AI
Sbjct  221   LSTAGGRFVSGANLLGSGYGTAKGGSPNSRVASYKVCW------SGCNDADVLAGYEAAI  274

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVD+LSVSLG   PG Y  D   IG+F A++NGI+VVA+AGNEGP  G V NVAPW++
Sbjct  275   HDGVDILSVSLGSG-PGEYITDGNLIGAFLAMENGILVVAAAGNEGPDPGMVGNVAPWIL  333

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TV  +T+ R F SNV+LGN K Y G S      P GKFYPL+++  A+    A++S+  A
Sbjct  334   TVACSTISREFTSNVILGNNKQYKGVSFNTNTQPAGKFYPLINSVDAKA---ANVSSNQA  390

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD---  1107
              +C  G+LDP KV+GK++ C + E+  +EKS   A AG VG ILAN       II     
Sbjct  391   KYCSIGSLDPLKVEGKIVYCTRNEDPDLEKSLVVAQAGGVGGILAN-----QLIIQQPRP  445

Query  1106  -AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
              AHF+P + V+  DGL+I  Y+  T++PVA+I+   T +G   APV+A FSS GPN INP
Sbjct  446   RAHFVPTSVVSAGDGLSILTYVYSTKSPVAYISGA-TEVGTVAAPVMADFSSPGPNFINP  504

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +ILKPDI+APGVN++AAFT A+GP+    D+R V FN+ SGTSM+CPHV+G+ GLLKT++
Sbjct  505   EILKPDITAPGVNILAAFTGASGPAAVGGDRRRVHFNIRSGTSMACPHVSGIAGLLKTIH  564

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P WSPA I+SAIMTTAT  +N  + I +    L+  P  YGAGHI P+ A DPGLVYDL 
Sbjct  565   PDWSPAAIKSAIMTTATTISNVKRPIANASL-LEANPLNYGAGHIWPSLAMDPGLVYDLT  623

Query  569   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHIS-LSTFNYPSITVPHLKGTATVTRTLKN  393
               DYVNF+C+ GYN T+++  +G PY C  H + L  FNYPSITVP+L    T++RTLKN
Sbjct  624   TKDYVNFLCSIGYNSTQLSLFIGKPYICQSHNNGLLDFNYPSITVPNLSSKTTLSRTLKN  683

Query  392   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  213
             VG+P+ Y  ++R+P G SV V P+ LKF+K+ +E+ FKV L+ K    + DY FG +TWS
Sbjct  684   VGTPSLYRVNIRAPGGISVNVEPRSLKFDKINKEKMFKVALEVKKGFKSNDYVFGEITWS  743

Query  212   DKKHRVRSPIVVK  174
             D+ H VRSP+VVK
Sbjct  744   DENHHVRSPVVVK  756



>ref|XP_008464289.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=774

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/738 (54%), Positives = 506/738 (69%), Gaps = 19/738 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D + V  SHH+LLG++L S +KA+D+IFYSY +HINGFAA L++E+A  +A +PEV +V 
Sbjct  44    DFESVVDSHHKLLGSFLRSDEKAKDSIFYSYKKHINGFAATLDDEDATRLANHPEVAAVL  103

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+ + L TT SWEF+ LE + GV+   S W+ AKFG+D II NLDTGVWPESKSF E G
Sbjct  104   PNKPKDLYTTHSWEFMHLE-KNGVVPPSSPWRMAKFGKDVIIANLDTGVWPESKSFGEHG  162

Query  1997  F-GPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGY------SSAVGPLNSSFFTPRDV  1839
               GP P +WKG C ++      CN KLIGA+YF +GY       ++   L+S   + RD 
Sbjct  163   IDGPAPSKWKGGCTDKSPDGVPCNXKLIGAKYFNKGYLEYLKSENSTVDLSSIINSTRDY  222

Query  1838  IGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADIL  1659
              GHGSHTLSTA GN+V GA+VFG G GTAKGGSPKARVAAYKVCWP    G  C+DADI 
Sbjct  223   DGHGSHTLSTAAGNYVFGASVFGSGIGTAKGGSPKARVAAYKVCWPFEQGG--CFDADIT  280

Query  1658  AGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVN  1479
               FD AI DGVDVLS+SLGGD P  Y  DS+AI SFHAVK GI VV + GN GP   + +
Sbjct  281   EAFDHAIHDGVDVLSLSLGGD-PIKYSEDSIAIASFHAVKKGIPVVCAVGNSGPTPKTAS  339

Query  1478  NVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINA  1299
             N APW++TVGA+T+DR F + VVL N   + G S     L   K YPL++ A A+     
Sbjct  340   NTAPWILTVGASTLDREFYAPVVLQNGHRFMGSSHSK-GLTGRKLYPLITGAQAKA---G  395

Query  1298  SISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNE  1119
             + +  DA+ CKP TLD  KVKGK+LVCL+GE  R++K  +AALAGAVGMIL ND+ SG+ 
Sbjct  396   NANEDDAMLCKPETLDHSKVKGKILVCLRGETARLDKGKQAALAGAVGMILCNDKLSGSS  455

Query  1118  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  939
             I+ D H LPA+H+ Y DG  +  YIN  RNP+ ++  P   +  KPAP +A FSSRGPN 
Sbjct  456   IVPDFHLLPASHINYQDGQVLLSYINSARNPMGYLIPPLAKVNTKPAPTMAVFSSRGPNT  515

Query  938   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  759
             I+P+I+KPD++APGVN+IAAF+EA  P+ +  D R   F   SGTSMSCPHVAG+VGLL+
Sbjct  516   ISPEIIKPDVTAPGVNIIAAFSEAISPTRDASDNRTTPFITMSGTSMSCPHVAGLVGLLR  575

Query  758   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDKT--GLKTTPFAYGAGHINPNGAADPGL  585
              L+P WSP+ I+SAIMT++ VR N+   + D  +      TPFAYG+GHINP GA DPGL
Sbjct  576   NLHPDWSPSAIKSAIMTSSQVRDNTLNPMIDGGSLDLAPATPFAYGSGHINPTGAIDPGL  635

Query  584   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTR  405
             VYDL   DY+ F+CA GY++  I A    P+KCP   S+   NYPSI V +LKG+ +VTR
Sbjct  636   VYDLSPNDYLEFLCASGYDEKTIRAFSDEPFKCPPASSVLNLNYPSIGVQNLKGSVSVTR  695

Query  404   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  225
              LKNVGSP  Y A +  P G  V+V P+ LKFE+VGEE+SF++TL   G        +G 
Sbjct  696   KLKNVGSPGVYRAQILHPNGVVVSVKPRFLKFERVGEEKSFELTL--AGVVPKDRVGYGA  753

Query  224   LTWSDKKHRVRSPIVVKT  171
             L WSD +H VRSPIVV +
Sbjct  754   LIWSDGRHVVRSPIVVSS  771



>gb|AES70685.2| subtilisin-like serine protease [Medicago truncatula]
Length=755

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/731 (53%), Positives = 513/731 (70%), Gaps = 26/731 (4%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DL     SH+ LLG++LGS +KA++AIFYSY +HINGFAA+LE EEAA+IAK+P V+SVF
Sbjct  46    DLQSATDSHYNLLGSHLGSHEKAKEAIFYSYNKHINGFAAVLEVEEAAKIAKHPNVVSVF  105

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+  +LQTTRSWEFLGLE   GV+   SIW+K ++GE TII N+D+GV PESKSFS++G
Sbjct  106   ENKGHELQTTRSWEFLGLENNYGVVPKDSIWEKGRYGEGTIIANIDSGVSPESKSFSDDG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P RW+GICQ     +FHCNRKLIGAR++ QGY S  G LN S +  RDV+GHG+ T
Sbjct  166   MGPVPSRWRGICQLD---NFHCNRKLIGARFYSQGYESKFGRLNQSLYNARDVLGHGTPT  222

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LS AGGNFV GANVFGL NGTAKGGSP++ +              +C DADI+  F+ AI
Sbjct  223   LSVAGGNFVSGANVFGLANGTAKGGSPRSHI--------------ECTDADIMQAFEDAI  268

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVD++S SLG   P  +F D ++IG+FHA++NG++VVA  GN GP  G+V NVAPWL 
Sbjct  269   SDGVDIISCSLGQTSPKEFFEDGISIGAFHAIENGVIVVAGGGNSGPKFGTVTNVAPWLF  328

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             +V A+T+DR F S + LG+K H    +++   LP  KFY L+S+  A++  NA+I  +DA
Sbjct  329   SVAASTIDRNFVSYLQLGDK-HIIMGTSLSTGLPNEKFYSLVSSVDAKVG-NATI--EDA  384

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAG-AVGMILANDEDSGNEIIADAH  1101
               CK G+LDP KVKGK+L CL  E D +  + E A++G ++G++L ND+  GN+I+A AH
Sbjct  385   KICKVGSLDPNKVKGKILFCLLRELDGLVYAEEEAISGGSIGLVLGNDKQRGNDIMAYAH  444

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
              LP +H+ Y+DG  +  YI  T+ P+A++T   T +GVKPAPVIA+ SSRGPN I P IL
Sbjct  445   LLPTSHINYTDGEYVHSYIKATKTPMAYMTKAKTEVGVKPAPVIASLSSRGPNPIQPIIL  504

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGV+++ A+  A  P+    D + + +N+ SGTS+SCPHV+ +V LLKT+YP+W
Sbjct  505   KPDITAPGVDILYAYIGAISPTGLASDNQWIPYNIGSGTSISCPHVSAIVALLKTIYPNW  564

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             SPA  +SAIMTT T++ N+ + I  D++    TPF YGAGHI P  A DPGLVYDL + D
Sbjct  565   SPAAFKSAIMTTTTIQGNNHRPI-KDQSKEDATPFGYGAGHIQPELAMDPGLVYDLNIVD  623

Query  560   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL--KGTATVTRTLKNVG  387
             Y+NF+CA GYN+T++      PY CP   ++  FNYPSITVP+L       VTRT+ NVG
Sbjct  624   YLNFLCAHGYNQTQMKMFSRKPYICPKSYNMLDFNYPSITVPNLGKHFVQEVTRTVTNVG  683

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             SP TY   V  P G  V + P+ L F +VGE+++FK+  K   +  ++ Y FG L WSD 
Sbjct  684   SPGTYRVQVNEPHGIFVLIKPRSLTFNEVGEKKTFKIIFKVT-KPTSSGYVFGHLLWSDG  742

Query  206   KHRVRSPIVVK  174
             +H+V SP+VVK
Sbjct  743   RHKVMSPLVVK  753



>ref|XP_008661010.1| PREDICTED: subtilisin-like protease SBT5.3 [Zea mays]
 gb|AFW87513.1| putative subtilase family protein [Zea mays]
Length=785

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/730 (54%), Positives = 502/730 (69%), Gaps = 12/730 (2%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             R   SH+ LLG  LG  +KAR AIFYSYT+HINGFAA L+   AAEIA+ P V+SVF NR
Sbjct  61    RATDSHYDLLGAVLGDREKARQAIFYSYTKHINGFAANLDPGAAAEIARYPGVVSVFPNR  120

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
              R+L TTRSW+F+GLE +G V    S W+KA++GEDTIIGNLD+GVWPES+SF +   GP
Sbjct  121   GRKLHTTRSWQFMGLERDGDVPQ-WSAWEKARYGEDTIIGNLDSGVWPESESFDDGEMGP  179

Query  1988  IPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTLS  1812
             IP  WKGICQN  D++F CNRKLIGARYF +G+   V  PL+++F TPRD  GHG+HTLS
Sbjct  180   IPDYWKGICQNDHDRAFQCNRKLIGARYFNKGFGDEVRVPLDAAFKTPRDENGHGTHTLS  239

Query  1811  TAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIED  1632
             TAGG  V GA+ FG   GTA+GGSP+ARVAAY+VC+ P + G +C+D+DILA FD AI+D
Sbjct  240   TAGGAAVRGASAFGYAAGTARGGSPRARVAAYRVCFRPVN-GSECFDSDILAAFDTAIDD  298

Query  1631  GVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITV  1452
             GV V+S S+GGD    Y ND++A+GS HAVK G+ VV SA NEGP  G+V NVAPW++TV
Sbjct  299   GVHVISASVGGDATD-YLNDAVAVGSLHAVKAGVTVVCSASNEGPDLGTVTNVAPWILTV  357

Query  1451  GANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALH  1272
              A+++DR F +  V  N     G S     L    FYPL++   A   I+     +DA  
Sbjct  358   AASSVDREFSAFAVF-NHTRVEGVSLSARWLHGKGFYPLITGDQA---IHPGSKQEDAQL  413

Query  1271  CKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLP  1092
             C  G+LDPEK +GK++VCL+G   R++K      AG   MIL NDE +GN + AD H +P
Sbjct  414   CLVGSLDPEKTRGKIVVCLRGNIPRVDKGAAVRHAGGAAMILVNDEANGNVLQADPHVIP  473

Query  1091  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  912
             A H++Y+DGL +  YI  T+ P   +    T+LG +PAPV+AAFSS+GPN INP+ILKPD
Sbjct  474   AVHISYADGLRLSAYIKNTKVPSGFVVKGRTILGTRPAPVMAAFSSQGPNTINPEILKPD  533

Query  911   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  732
             I+APGVNVIAA++ AT P+D  +DKR V+FN+ SGTSMSCPHV+GV GL+KTL+P WSPA
Sbjct  534   ITAPGVNVIAAWSGATSPTDKSFDKRRVAFNILSGTSMSCPHVSGVAGLIKTLHPDWSPA  593

Query  731   EIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVN  552
              I+SAIMT+ATV     K I +       TPF+YGAGH+ P+ A DPGLVYD+ + DY++
Sbjct  594   AIKSAIMTSATVLDAEMKPILNSSYA-PATPFSYGAGHVFPSRALDPGLVYDMTVVDYLD  652

Query  551   FICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKG--TATVTRTLKNVGSP  381
             F+CA GYN T +  +    + CP   +SL   NYPSIT   L    T  V R LKNVG P
Sbjct  653   FLCALGYNATAMRTMNRGSFVCPTTPMSLHDLNYPSITAHGLPAGTTTMVRRRLKNVGLP  712

Query  380   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  201
              TYTA+V  P G  V+V P +L F + GEE+ F V          A Y FG + WSD  H
Sbjct  713   GTYTAAVVEPEGMHVSVIPAMLVFRETGEEKEFDVIFTVSDRAPAASYVFGTIVWSDGSH  772

Query  200   RVRSPIVVKT  171
             +VRSP+VVKT
Sbjct  773   QVRSPLVVKT  782



>ref|XP_010675634.1| PREDICTED: subtilisin-like protease SBT5.4 [Beta vulgaris subsp. 
vulgaris]
Length=774

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/734 (54%), Positives = 507/734 (69%), Gaps = 18/734 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D   V  SH  LL +   S  KA DAI YSY +  NGF A+L EEEA E+ K+P+VISVF
Sbjct  48    DHGAVTTSHLDLLSSLQRSSAKAEDAILYSYNKVFNGFTALLHEEEARELQKHPDVISVF  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              ++  ++ TTRSWEFLGLE + G I + SIW+K  FGED+II  LDTGVWPES+SFS+E 
Sbjct  108   KSQLNKIHTTRSWEFLGLE-DNGYIPNYSIWRK-NFGEDSIIATLDTGVWPESRSFSDEN  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFF----TPRDVIGH  1830
              G IPK++KG C+N+ D +F CNRKLIGARYF +GY+ A+    +  F    +PRD  GH
Sbjct  166   LGLIPKKFKGTCENENDPTFRCNRKLIGARYFFKGYAEALRQEYNMTFNHSKSPRDSDGH  225

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWP-PTSPGEDCYDADILAG  1653
             GSHTLS AGGN V   NV G G GTA GGSP+ARVAAYK CWP P++    C D+DILAG
Sbjct  226   GSHTLSIAGGNIVSDVNVKGFGKGTAAGGSPRARVAAYKTCWPSPSNQESYCSDSDILAG  285

Query  1652  FDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNV  1473
              + AI DGVD++S+S+G D P  Y +DS+AIGSFHAVKNGI VVA+AGN GP +GSV+NV
Sbjct  286   LEAAIADGVDIISMSIGKD-PKDYLSDSIAIGSFHAVKNGIPVVAAAGNNGPKSGSVSNV  344

Query  1472  APWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARI-KINAS  1296
             APW+ TVGA+T DR+F S+V LGN   + G S     L   KFY L+++  A+  K NA+
Sbjct  345   APWIFTVGASTTDRQFLSHVTLGNNNKFKGASITHKGLDANKFYGLVTSVIAQSPKANAT  404

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
                 +A  C  GT+DPEK KGK+LVCL+G   R  K +EAA  GAVG+I+AN ++ G +I
Sbjct  405   ----EAKFCFNGTMDPEKAKGKILVCLRGLGARKHKGYEAARVGAVGLIIANAKEHGMQI  460

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             +A+ + LPA+H+ +SD  A+F YIN T +PVA IT   T  GVKPAP +A FSS GPN +
Sbjct  461   MAENYPLPASHLAFSDAQALFAYINSTNSPVATITAARTEFGVKPAPFVAGFSSTGPNIV  520

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
              P ILKPD+ APGVN+IAA +EA   S  +       + +  GTSMSCPH+ G++GLLKT
Sbjct  521   TPGILKPDVIAPGVNIIAAISEAKAKSTQEN----TPYGLMDGTSMSCPHITGIIGLLKT  576

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             +YP WSP+ I+SAIMTT++ R N  K + D  T +  TPF YGAGH+ PN A  PGLVYD
Sbjct  577   MYPHWSPSAIKSAIMTTSSTRDNRRKPLVD-FTNMTATPFHYGAGHVRPNKAMYPGLVYD  635

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLK  396
             +   DY+NF+CA GYNK  I  +    Y CPD ++++  NYP+I VP   G AT+ R LK
Sbjct  636   MNHHDYLNFLCAIGYNKKMIKKLSDNSYCCPDLVAVADLNYPTIVVPSFSGNATIVRRLK  695

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NVG P+TY AS+R+P G S+TV PK L F + G+E  +K+   A+  +   D++FG L W
Sbjct  696   NVGHPSTYLASIRAPSGISITVEPKTLTFTEKGQELHYKLIFTAEQSHLLKDHSFGYLLW  755

Query  215   SDKKHRVRSPIVVK  174
             SD+K+RVRS IVVK
Sbjct  756   SDRKYRVRSSIVVK  769



>ref|XP_006475104.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/737 (54%), Positives = 501/737 (68%), Gaps = 16/737 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D+DR +  HH+ LG++LGS ++A  +IF+SY R INGF A+LEEE A ++  +P V+SVF
Sbjct  47    DIDRARIRHHEFLGSFLGSVEEAESSIFHSYGRFINGFGAVLEEEHAKQLENHPGVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              +   +L TTRSW+FLGLE +  +  D S WKKA+FGED II N+D+GVWPESKSF+++G
Sbjct  107   PDEGAKLHTTRSWDFLGLEKDNFIPPD-SAWKKARFGEDVIIANVDSGVWPESKSFADDG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTP------RDVI  1836
              GPIP +WKGICQN   K   CN+KLIG RY  QG    +   N     P      RD  
Sbjct  166   MGPIPSKWKGICQNDNYKGVSCNKKLIGIRYINQGTIEELRAKNPDAVIPQNLTTGRDEE  225

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTL+TAGGNFVP  +V+G G GTAKGGSPKARVAAYKVCW P    + C  ADIL+
Sbjct  226   GHGTHTLATAGGNFVPNVSVYGSGYGTAKGGSPKARVAAYKVCWKPNE-NDSCSSADILS  284

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
              +D AI DGVDV+S SLG      +  +++AIGSFHA+ NGIV  A+AGN GP  GSV N
Sbjct  285   AYDLAIHDGVDVISASLGS-VAREHLKNTIAIGSFHAMMNGIVSAAAAGNSGPDDGSVEN  343

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTG-KFYPLLSAASARIKINA  1299
             VAPW++TVGA+T DR F S V LGNK    G S     L      YPL+  A ARI   A
Sbjct  344   VAPWILTVGASTTDREFTSYVTLGNKMVIKGASVSQKGLLNDLDSYPLIGGADARI---A  400

Query  1298  SISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNE  1119
             ++S  DA  CK G++DP KV+GK+L+C  G     EK   AA AGAVGMIL + ++SGN+
Sbjct  401   NVSEIDASECKKGSIDPAKVQGKILICY-GARYGDEKGRWAAQAGAVGMILVSSKESGNK  459

Query  1118  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  939
             ++   H LP  H+ Y+DG +++ YIN T+NP A +T+  T    +P+ ++A F+SRGPN 
Sbjct  460   VLNMVHHLPTAHLNYTDGESVYAYINSTQNPTASMTNSKTEFNTRPSRMMAFFTSRGPNM  519

Query  938   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  759
             I+P I KPD++APGV++IAAFTEA+GPS ++ DKR + + + SGTSMSCPHVAG+VGL+K
Sbjct  520   IDPAIFKPDVTAPGVDIIAAFTEASGPSPDETDKRRIPYIMMSGTSMSCPHVAGIVGLVK  579

Query  758   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVY  579
             TL+P WSPA I+SAIMTTA    +S + I D  TG K TPFAYGAGH+NPN A DPGLVY
Sbjct  580   TLHPDWSPAAIKSAIMTTARAEDSSNRPILDQNTGEKATPFAYGAGHVNPNSALDPGLVY  639

Query  578   DLKLTDYVNFICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKGTATVTRT  402
             DL   DY+ +IC +GYN++ I        + CP   +L+ FNYPSI VP L GT T TR 
Sbjct  640   DLTFEDYLGYICDRGYNQSTIDLFTAPKKFTCPKSFNLADFNYPSIAVPKLNGTITFTRK  699

Query  401   LKNVGSP-ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  225
             +KNVG+  +TY A      G S  V P IL F K GEE++FKVT   KG++   DY FG 
Sbjct  700   VKNVGAANSTYKARTSEITGVSTIVEPSILNFTKYGEEKTFKVTFSVKGDDKPKDYVFGE  759

Query  224   LTWSDKKHRVRSPIVVK  174
             L WSD  H VRSPI VK
Sbjct  760   LVWSDGFHDVRSPIAVK  776



>ref|XP_004491541.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=779

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/742 (57%), Positives = 520/742 (70%), Gaps = 25/742 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             VDLD    SH+ LL + LGS +KA+DAIFYSY +HINGFAA+LEE+EA ++A+NP V+SV
Sbjct  49    VDLDYATKSHYSLLSSILGSHEKAKDAIFYSYNKHINGFAAILEEKEAEKLARNPNVVSV  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
              LN+  QL TTRSWEFLGLE E G++   SIW+KA++GEDTIIGNLDTGVWPESKSFS+ 
Sbjct  109   SLNKMNQLHTTRSWEFLGLE-ENGIVPKDSIWEKARYGEDTIIGNLDTGVWPESKSFSDH  167

Query  2000  GFGPIPKRWKG--ICQ----NQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDV  1839
             G GPIP +W+G  ICQ    N  +K++ CNRKLIGARYF +GY +  G  N+SF+T RD 
Sbjct  168   GMGPIPSKWRGNGICQIDNFNDSNKNY-CNRKLIGARYFYKGYEAHEGKQNASFYTARDT  226

Query  1838  IGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADIL  1659
              GHGSHTLS AGGNFV G  VFG GNGTAKGGSPK+RVAAYKVCWP       C DADIL
Sbjct  227   QGHGSHTLSIAGGNFVQGVTVFGNGNGTAKGGSPKSRVAAYKVCWP-----GGCSDADIL  281

Query  1658  AGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVN  1479
             AGF+ AI DGVDVLSVSLGG       +DS+AIGSFHAV +G+VVV+SAGN GP   +V 
Sbjct  282   AGFEAAISDGVDVLSVSLGGRSEN-LLSDSIAIGSFHAVDSGVVVVSSAGNSGPSFETVF  340

Query  1478  NVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINA  1299
             NVAPWL TV A+T+DR F S V LG+ K + G S     LP+ KFYPL++   A+     
Sbjct  341   NVAPWLFTVAASTIDRDFTSYVTLGDNKQFKGTSLSYKDLPSQKFYPLITGEDAKHSYAL  400

Query  1298  SISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSH-EAALAGAVGMILANDEDSGN  1122
              I   DA +C+ GTLD EKVKGK++VCL+ E   I  +  EA+ AGAVGMILA+D +S  
Sbjct  401   YI---DAKYCRYGTLDVEKVKGKIVVCLEDEFFGIVVAGPEASSAGAVGMILASDSESFY  457

Query  1121  EIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPN  942
             + IA  H LP +H+ YSD   I  YI   +NPVA+IT P T + + P PVIA+FSSRGPN
Sbjct  458   DFIAYPHVLPTSHLNYSDSQYISSYIQTQKNPVAYITKPITEIPIIPTPVIASFSSRGPN  517

Query  941   AINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLL  762
              I P ILKPDI+APGVN+IAA++EAT  S    D R   +   SGTSMSCPHV+G+VGLL
Sbjct  518   NIQPSILKPDITAPGVNIIAAYSEATSISGLTSDNRRFPYTSMSGTSMSCPHVSGIVGLL  577

Query  761   KTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLV  582
             KTL+P WSPA I+SAIMTTA+   N  K I  D+     +PFAYG+GHI P+ A DPGL+
Sbjct  578   KTLHPEWSPAAIKSAIMTTASKLDNIKKPI-KDRFYENASPFAYGSGHIQPDLAKDPGLI  636

Query  581   YDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHL-KGTATVT  408
             YDL +TDY+N +CA   N  +I A+   P+ CP +  ++  FNYP+IT+  L       +
Sbjct  637   YDLNVTDYLNLLCAINQNHKKIEAIYNKPFICPKYSYNMLDFNYPTITILDLGDKIVNAS  696

Query  407   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG----ENATAD  240
             R + NVG P+TY    ++P G S+ V P  LKF +VGE++SFKV +KA      E A  D
Sbjct  697   RIVTNVGPPSTYNVKTKAPNGISILVEPSSLKFNEVGEKKSFKVVVKAMDNYVKEGAIMD  756

Query  239   YAFGVLTWSDKKHRVRSPIVVK  174
             Y FG L WS+  +RVRS IVVK
Sbjct  757   YVFGELVWSNGNNRVRSTIVVK  778



>ref|XP_011022894.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Populus 
euphratica]
Length=763

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/734 (55%), Positives = 520/734 (71%), Gaps = 27/734 (4%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  +HH+LLG+ + S +KA+ AIFYSYTR+INGFAA+L++EEAAEI+K+PEV+SV 
Sbjct  45    DLDRVTDAHHELLGSCMKSKEKAKQAIFYSYTRYINGFAAVLDDEEAAEISKHPEVVSVS  104

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              N+  QL TT SW FLGLE  G +  D S+W KA+FGED IIG LDTGVWPES+SF++EG
Sbjct  105   RNQISQLHTTNSWGFLGLERNGEIPPD-SMWLKARFGEDVIIGTLDTGVWPESESFNDEG  163

Query  1997  FGPIPKRWKGICQNQKDKSFHCN-RKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSH  1821
              GP+P +WKG C         CN RKLIGARYF +GY +A    +SS+ T RD  GHG+H
Sbjct  164   MGPVPSKWKGYCD--PIDGIKCNSRKLIGARYFSKGYEAA-ETHDSSYHTARDYDGHGTH  220

Query  1820  TLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRA  1641
             TLSTAGG FV GAN+ G G GTAKGGSP +RVA+YKVCW        C DAD+LAG++ A
Sbjct  221   TLSTAGGRFVSGANLLGSGYGTAKGGSPNSRVASYKVCW------SGCNDADVLAGYEAA  274

Query  1640  IEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWL  1461
             I DGVD+LSVSLG   PG Y  D   IG+F A++NGI+VVA+AGNEGP  G V NVAPW+
Sbjct  275   IHDGVDILSVSLGSG-PGEYITDGNLIGAFLAMENGILVVAAAGNEGPDPGMVGNVAPWI  333

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV  +T+ R F SNV+LGN K Y G S      P GKFYPL+++  A+    A++S+  
Sbjct  334   LTVACSTISREFTSNVILGNNKQYKGVSFNTNTQPAGKFYPLINSVDAKA---ANVSSNQ  390

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD--  1107
             A +C  G+LDP KV+GK++ C + E+  +EKS   A AG VG ILAN       II    
Sbjct  391   AKYCSIGSLDPLKVEGKIVYCTRNEDPDLEKSLVVAQAGGVGGILAN-----QLIIQQPR  445

Query  1106  --AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  933
               AHF+P + V+  DGL+I  Y+  T++PVA+I+   T +G   APV+A FSS GPN IN
Sbjct  446   PRAHFVPTSVVSAGDGLSILTYVYSTKSPVAYISGA-TEVGTVAAPVMADFSSPGPNFIN  504

Query  932   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  753
             P+ILKPDI+APGVN++AAFT A+GP+    D+R V FN+ SGTSM+CPHV+G+ GLLKT+
Sbjct  505   PEILKPDITAPGVNILAAFTGASGPAAVGGDRRRVHFNIRSGTSMACPHVSGIAGLLKTI  564

Query  752   YPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDL  573
             +P WSPA I+SAIMTTAT  +N  + I +    L+  P  YGAGHI P+ A DPGLVYDL
Sbjct  565   HPDWSPAAIKSAIMTTATTISNVKRPIANASL-LEANPLNYGAGHIWPSLAMDPGLVYDL  623

Query  572   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHIS-LSTFNYPSITVPHLKGTATVTRTLK  396
                DYVNF+C+ GYN T+++  +G PY C  H + L  FNYPSITVP+L    T++RTLK
Sbjct  624   TTKDYVNFLCSIGYNSTQLSLFIGKPYICQSHNNGLLDFNYPSITVPNLSSKTTLSRTLK  683

Query  395   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  216
             NVG+P+ Y  ++R+P G SV V P+ LKF+K+ +E+ FKV L+ K    + DY FG +TW
Sbjct  684   NVGTPSLYRVNIRAPGGISVNVEPRSLKFDKINKEKMFKVALEVKKGFKSNDYVFGEITW  743

Query  215   SDKKHRVRSPIVVK  174
             SD+ H VRSP+VVK
Sbjct  744   SDENHHVRSPVVVK  757



>gb|ACN85315.1| subtilisin-like protease precursor [Oryza brachyantha]
Length=790

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/727 (55%), Positives = 506/727 (70%), Gaps = 10/727 (1%)
 Frame = -2

Query  2339  HSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNRARQ  2160
              SH+ LLG+ LG  +KAR+AIFYSYTR+INGFAA LE EEAA +A  P V+SVF NR R+
Sbjct  66    ESHYDLLGSVLGDREKAREAIFYSYTRNINGFAAGLEPEEAAAVAGLPGVVSVFPNRGRR  125

Query  2159  LQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGPIPK  1980
             L TTRSW+F+GLE   G +   S WK A++GE  IIGNLD+GVWPES SF++   GPIP 
Sbjct  126   LHTTRSWQFMGLERGDGEVPRWSAWKVARYGEGAIIGNLDSGVWPESLSFNDRELGPIPN  185

Query  1979  RWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTLSTAG  1803
              WKGICQN  DK+F CN KLIGARYF +G+++  G PL+ +  TPRD  GHG+HTL+TAG
Sbjct  186   SWKGICQNDHDKTFKCNSKLIGARYFNKGHAAGTGVPLSDAEMTPRDDNGHGTHTLATAG  245

Query  1802  GNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDGVD  1623
             G+ V  A  FG G GTAKGG+P+ARVAAY+VC+PP +   +CYDADILA F+ AI DGV 
Sbjct  246   GSPVRNAAAFGYGYGTAKGGAPRARVAAYRVCYPPVNGSNECYDADILAAFEAAIADGVH  305

Query  1622  VLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVGAN  1443
             V+S S+G D P  YF D++AIG+ HAVK G+ VV SA N GP  G+V NVAPW++TV A+
Sbjct  306   VISASVGAD-PNYYFQDAVAIGALHAVKAGVTVVCSASNFGPDPGTVTNVAPWILTVAAS  364

Query  1442  TMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHCKP  1263
             T+DR F ++VV  N+    G+S   + L  GK +PL+ +A+A   +    S  DA  C  
Sbjct  365   TVDRAFPAHVVF-NRTRADGQSLSGMWL-RGKGFPLMVSAAA--AVAPGRSPADAKECNL  420

Query  1262  GTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPATH  1083
             G LD  KV GK++VCL+G N R+EK    + AG VGMIL NDE SG+++IADAH LPA H
Sbjct  421   GALDAGKVTGKIVVCLRGGNPRVEKGEAVSRAGGVGMILVNDEASGDDVIADAHILPAVH  480

Query  1082  VTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDISA  903
             + Y+DGLA+  YIN T+     IT   TLLG  PAPV+A+FSS+GPN +NP+ILKPD++A
Sbjct  481   IGYNDGLALLAYINSTKVARGFITKAKTLLGTTPAPVMASFSSQGPNTVNPEILKPDVTA  540

Query  902   PGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIR  723
             PGV+VIAA+T A GP+   YD+R V+FN ++GTSMSCPHV+GV GL+KTL+P WSP  I+
Sbjct  541   PGVSVIAAWTGAAGPTGLPYDQRRVAFNTQTGTSMSCPHVSGVAGLVKTLHPEWSPGAIK  600

Query  722   SAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFIC  543
             SAIMT+AT   +  K I +    L  TPF+YGAGH+ P+ A DPGLVYD   TDY++F+C
Sbjct  601   SAIMTSATELDSELKPILNSSR-LPATPFSYGAGHVFPHRALDPGLVYDATATDYLDFLC  659

Query  542   AQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG-SPATYT  369
               GYN + +      PY+CPD  +     NYPSITV  L     V R ++NVG +P TYT
Sbjct  660   GIGYNASSLELFNEAPYRCPDDPLDPVDLNYPSITVYDLAEPTAVRRRVRNVGPAPVTYT  719

Query  368   AS-VRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVR  192
             A+ V+ P G  VTV P  L F   GE + F V L  +     ADYAFG + WSD  H VR
Sbjct  720   ATVVKEPEGVQVTVTPPTLTFASTGEVRQFWVKLAVRDPAPAADYAFGAIVWSDGSHLVR  779

Query  191   SPIVVKT  171
             SP+VVKT
Sbjct  780   SPLVVKT  786



>ref|XP_006452710.1| hypothetical protein CICLE_v10010380mg, partial [Citrus clementina]
 gb|ESR65950.1| hypothetical protein CICLE_v10010380mg, partial [Citrus clementina]
Length=750

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/737 (54%), Positives = 500/737 (68%), Gaps = 16/737 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D+DR +  HH+ LG++LGS ++A  +IF+SY R INGF A+LEEE A ++  +P V+SVF
Sbjct  19    DIDRARIRHHEFLGSFLGSVEEAESSIFHSYGRFINGFGAVLEEEHAKQLENHPGVVSVF  78

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              +   +L TTRSW+FLGLE +  +  D S WKKA+FGED II N+D+GVWPESKSF+++G
Sbjct  79    PDEGAKLHTTRSWDFLGLEKDNFIPPD-SAWKKARFGEDVIIANVDSGVWPESKSFADDG  137

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTP------RDVI  1836
              GPIP +WKGICQN   K   CN+KLIG RY  QG    +   N     P      RD  
Sbjct  138   MGPIPSKWKGICQNDNYKGVSCNKKLIGIRYINQGTIEELRAKNPDAVIPQNLTTGRDEE  197

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTL+TAGGNFVP  +V+G G GTAKGGSPKARVAAYKVCW P    + C  ADIL+
Sbjct  198   GHGTHTLATAGGNFVPNVSVYGSGYGTAKGGSPKARVAAYKVCWKPNE-NDSCASADILS  256

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
              +D AI DGVDV+S SLG      +  +++AIGSFHA+ NGIV VA+AGN GP  GSV N
Sbjct  257   AYDLAIHDGVDVISASLGS-IAREHLKNTIAIGSFHAMMNGIVSVAAAGNSGPDDGSVEN  315

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTG-KFYPLLSAASARIKINA  1299
             VAPW++TVGA+T DR F S V LGNK    G S     L      YPL+  A ARI   A
Sbjct  316   VAPWILTVGASTTDREFTSYVTLGNKMVIKGASVSQKGLLNDLDSYPLIGGADARI---A  372

Query  1298  SISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNE  1119
             ++S  DA  CK G++DP KV+GK+L+C  G     EK   AA AGAVGMIL + ++SGN+
Sbjct  373   NVSEIDASECKKGSIDPAKVQGKILICY-GARYGDEKGQWAAQAGAVGMILVSSKESGNK  431

Query  1118  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  939
             ++   H LP  H+ Y+DG +++ YIN T+NP A +T+  T    +P+ ++A F+SRGPN 
Sbjct  432   VLNMVHHLPTAHLNYTDGESVYAYINSTQNPTASMTNSKTEFNTRPSRMMAFFTSRGPNM  491

Query  938   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  759
             I+P I KPD++APGV++IAAFTEA+GPS ++  KR + + + SGTSMSCPHVAG+VGL+K
Sbjct  492   IDPAIFKPDVTAPGVDIIAAFTEASGPSPDETHKRRIPYIMMSGTSMSCPHVAGIVGLVK  551

Query  758   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVY  579
             TL+P WSPA I+SAIMTTA    +S + I D  TG K TPFAYGAGH+NPN A DPGLVY
Sbjct  552   TLHPDWSPAAIKSAIMTTARAEDSSNRPILDQNTGEKATPFAYGAGHVNPNSALDPGLVY  611

Query  578   DLKLTDYVNFICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKGTATVTRT  402
             DL   DY+ +IC +GYN++ I        + CP   +L+ FNYPSI VP L GT T TR 
Sbjct  612   DLTFEDYLGYICDRGYNQSTIDLFTAPKKFTCPKSFNLADFNYPSIAVPKLNGTITFTRK  671

Query  401   LKNVGSP-ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  225
             +KNVG+  +TY A      G S  V P IL F K GEE++FKV    KG++   DY FG 
Sbjct  672   VKNVGAANSTYKARTSEITGVSTIVEPSILNFTKYGEEKTFKVAFSVKGDDKPTDYGFGE  731

Query  224   LTWSDKKHRVRSPIVVK  174
             L WSD  H VRSPI VK
Sbjct  732   LVWSDGFHDVRSPIAVK  748



>ref|XP_011013813.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=768

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/731 (55%), Positives = 512/731 (70%), Gaps = 21/731 (3%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             D +  S++ LLG+ L S +KA++AIFYSYT HINGFAA LE++E  +++  PEV+SVF N
Sbjct  48    DGMTESYYDLLGSCLKSKEKAKEAIFYSYTSHINGFAATLEDDEVDQLSNRPEVVSVFPN  107

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
                QL TTRSWEFLGLE  G +  D SIW KA+FGED IIGNLDTGVWPES+SF +EG G
Sbjct  108   EVNQLHTTRSWEFLGLERNGQIPAD-SIWLKARFGEDVIIGNLDTGVWPESESFDDEGMG  166

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTL  1815
             PIP RWKG C+   +    CNRKLIGARYF +GY +A+G  L+SS  T RD  GHG+HTL
Sbjct  167   PIPTRWKGYCET--NDGVKCNRKLIGARYFNKGYEAALGRALDSSNNTARDTDGHGTHTL  224

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FV GAN  G   GTAKGGSP ARVA+YKVCWP       CYDADILA FD AI+
Sbjct  225   STAGGRFVSGANFLGSAYGTAKGGSPNARVASYKVCWP------RCYDADILAAFDAAIQ  278

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGN--EGPVAGSVNNVAPWL  1461
             DGVD+LS+SLG     PYF   +AIGSF AV NGI+VV SAGN  +G   G+ +NVAPW+
Sbjct  279   DGVDILSLSLGRALEIPYFRSGIAIGSFQAVMNGILVVCSAGNSGQGFGFGTASNVAPWV  338

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+T+DR F SNVVLGN K + G S     L   K+YP++++  A+    A+ S Q 
Sbjct  339   LTVAASTIDREFPSNVVLGNNKEFKGTSFNTNNLSARKYYPIVNSVDAKA---ANASAQL  395

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILAND-EDSGNEIIADA  1104
             A  C P +LDP KV+GK++ CL      +E+S   A AG VGMILA+   DS +      
Sbjct  396   AQLCYPESLDPTKVRGKIVYCLGDMIPDVEQSLVVAQAGGVGMILAHQFADSSSS--PRG  453

Query  1103  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  924
              F+P + V+  DGL++  YI+ T++PVA+I+  +T +G   APV+A FSS GPN I P+I
Sbjct  454   FFVPTSLVSAIDGLSVLSYIHSTKSPVAYISG-STEIGKVVAPVMAPFSSTGPNEITPEI  512

Query  923   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  744
             LKPDI+APGV+++AA+T+A        D+R +SFN+ SGTSMSCPHV+G+ GLLKT++P 
Sbjct  513   LKPDITAPGVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPD  572

Query  743   WSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLT  564
             WSPA I+SAIMTTA   +N+ + I    +  + TPF YG+GH+ PN A DPGLVYDL  T
Sbjct  573   WSPAAIKSAIMTTARTSSNARQPIP-KASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTT  631

Query  563   DYVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  387
             DY+NF+C+ GYN T+++     PY C P +ISL  FNYPSITVP+L G  T+TR LKNVG
Sbjct  632   DYLNFLCSIGYNATQMSIFNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRILKNVG  691

Query  386   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  207
             +P  YT  V+ P G  V V P+ LKF K+ EE++FKV LKA  +  ++ Y FG LTWSD 
Sbjct  692   TPGLYTVRVKMPDGILVKVEPESLKFSKLNEERTFKVMLKATDDWYSSSYVFGGLTWSDG  751

Query  206   KHRVRSPIVVK  174
              HRV+SPIVV+
Sbjct  752   VHRVKSPIVVR  762



>ref|XP_006452708.1| hypothetical protein CICLE_v10010806mg, partial [Citrus clementina]
 gb|ESR65948.1| hypothetical protein CICLE_v10010806mg, partial [Citrus clementina]
Length=753

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/740 (54%), Positives = 502/740 (68%), Gaps = 19/740 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++R +  HH+ LG++LGS D+A   IF+SY R+INGF A+LEEE A +IA++PEV+SVF
Sbjct  19    DINRARIKHHEFLGSFLGSVDEAAGLIFHSYGRYINGFGAVLEEEHAKQIARHPEVVSVF  78

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L     L TTRSWEFLGLE +  +  D S W KA+FGED IIGNLD+GVWPES+SF++EG
Sbjct  79    LEEGIDLHTTRSWEFLGLEKDNQIPPD-SAWNKARFGEDVIIGNLDSGVWPESQSFTDEG  137

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVI------  1836
              GPIP RW+G CQN  +K+  CNRKLIG RY  +G   +   +NSSF  P ++       
Sbjct  138   MGPIPDRWQGTCQNDTNKAITCNRKLIGIRYMSEGLIESCRAINSSFLVPENLTTSIDHN  197

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTLSTAGG+FV   +++G+G GTAKGGSPKAR+AAYKVCW P      C  ADI+A
Sbjct  198   GHGTHTLSTAGGSFVSNVSLYGMGYGTAKGGSPKARLAAYKVCWKPNG-ANLCNAADIIA  256

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
             GFD AI DGVD++S SLG   P  +F  S+A+GSFHA+ +GI+VVASAGN GP   +V+N
Sbjct  257   GFDVAIHDGVDIISASLG-SKPKEHFESSVAVGSFHAMMHGILVVASAGNSGPAEKTVDN  315

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             V PW++TVGA+T DR F S V LGNK    G S       T  FYPL++  +A++   A+
Sbjct  316   VPPWVLTVGASTTDREFSSYVTLGNKMVIKGASIAEKGSLTQDFYPLIAGEAAKV---AN  372

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
             +S +DA  CK GT+DPEKVKGK+L+C   +     K   AA AGAVGMILAN  +  N  
Sbjct  373   VSNEDATQCKNGTIDPEKVKGKILICYDAKIGD-AKGQRAAQAGAVGMILANSREDQNIS  431

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             +   HFLP  +V Y DG +++ YI  T NPVA +T+  T      + + + FS+RGPN I
Sbjct  432   LNMVHFLPTAYVNYKDGQSVYAYIYNTENPVASMTNSITEFNKIWSRMTSFFSARGPNLI  491

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
             +P ILKPD+ APGV++IAAFT   GPS  ++D R V +NV SGTSM+CPHVAG+ GL+KT
Sbjct  492   DPAILKPDVIAPGVDIIAAFTNEYGPSHEEFDPRRVPYNVMSGTSMACPHVAGIAGLVKT  551

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+P WSPA I+SAIMTTAT   +S   I D  TG K TPFAYGAGH+NPN A DPGLVYD
Sbjct  552   LHPDWSPAAIKSAIMTTATTEDSSKHPILDQVTGQKATPFAYGAGHVNPNSALDPGLVYD  611

Query  575   LKLTDYVNFICAQGYNKTEITAVLG--TPYKCPDHISLSTFNYPSITVPHL-KGTATVTR  405
             L   DY+ ++C  GYN++ I        P+KCP   S++ FNYPSI VP+L  G+ TV+R
Sbjct  612   LGPGDYLAYLCGLGYNQSIIDLFTQPKEPFKCPGPFSIADFNYPSIAVPNLVNGSMTVSR  671

Query  404   TLKNVGSP-ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN--ATADYA  234
              LKNVG+P  TY A +   VG S  V P  L F K GEE +FK+T   KG +     DY 
Sbjct  672   RLKNVGTPTCTYKAQITEIVGVSAVVEPITLNFTKYGEELTFKITFSVKGNDKPVATDYV  731

Query  233   FGVLTWSDKKHRVRSPIVVK  174
             FG L WSD  H V+S I VK
Sbjct  732   FGELVWSDGFHNVKSTIAVK  751



>ref|XP_004296128.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=718

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/737 (57%), Positives = 514/737 (70%), Gaps = 50/737 (7%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             ++L    +SH+ LLG+ LGS ++A++A+FYSYT  INGFAA+L+EEEA++IAKNP V+SV
Sbjct  20    LELQAATNSHYDLLGSVLGSNERAQEAMFYSYTGQINGFAAVLDEEEASQIAKNPNVVSV  79

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
               NR  +L TT SWEF+ LE + GV   GS+WKKAKFGE+ IIGNLDTGVWPES+SF++E
Sbjct  80    LPNRKVELHTTHSWEFMELEDKAGVPRPGSLWKKAKFGENIIIGNLDTGVWPESESFNDE  139

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLN------SSFFTPRDV  1839
             GFGPIP +W+G C         CNRKLIGARYF +GY + V  LN      S   +PRD 
Sbjct  140   GFGPIPSKWRGACLFDTKDKVRCNRKLIGARYFNKGYLANV-KLNKDTIPPSLLVSPRDQ  198

Query  1838  IGHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGED--CYDAD  1665
              GHGSHTLSTAGG+FVPGAN FG GNGTAKGGSPKARVAAYKVCWP      +  C+ AD
Sbjct  199   EGHGSHTLSTAGGSFVPGANAFGNGNGTAKGGSPKARVAAYKVCWPSVDGYTEGGCFAAD  258

Query  1664  ILAGFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGS  1485
             I A FD AI DGVDVLS+SLGG+    +  D ++IG+FHA K+GIVVV SAGN GP  G+
Sbjct  259   IFAAFDAAISDGVDVLSLSLGGNAV-EFSQDEISIGAFHADKHGIVVVCSAGNSGPTPGT  317

Query  1484  VNNVAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKI  1305
             V NVAPW++TVGA+T+DR F S +  G  KH  G S     LP+ K++PL+S A+A    
Sbjct  318   VTNVAPWMLTVGASTLDREFTSFLTFGRGKHLKGTSLSSTGLPSKKYFPLISGANANA--  375

Query  1304  NASISTQDALHCKPGTLDPEKVKGKVLVCLQGEN-DRIEKSHEAALAGAVGMILANDEDS  1128
              A+   +D+L C  GTL+P+KVKGK+LVCL+G +  R EK   AALAGAVGM+L NDE+S
Sbjct  376   -ATARPEDSLLCLNGTLNPKKVKGKILVCLRGGDISRTEKGVMAALAGAVGMVLVNDEES  434

Query  1127  GNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRG  948
             GN+I AD H LPATH+TY+DG  +F+Y+N T+ P+A IT   T+ G KPAPV+AAFSSRG
Sbjct  435   GNDITADPHVLPATHLTYTDGKRVFEYLNSTKTPLARITRVKTVHGTKPAPVMAAFSSRG  494

Query  947   PNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVG  768
             P+ I P ILKPDI+APGV++IAAFT AT P+D     R   +  ESGTSMSCPHV+G+VG
Sbjct  495   PSPIEPSILKPDITAPGVDIIAAFTGATSPTDPSNKPR-PRYITESGTSMSCPHVSGIVG  553

Query  767   LLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPG  588
             LLKTLYP+WSPA IRSAI+TTA    N G++I D  T    TPFAYGAGH+NPN AADPG
Sbjct  554   LLKTLYPTWSPAAIRSAIITTARRWDNVGESILDS-TKEPATPFAYGAGHVNPNRAADPG  612

Query  587   LVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVT  408
             LVYDL   DY+NF+                              +P +    +    T+ 
Sbjct  613   LVYDLTTNDYLNFL------------------------------FPDLQDKPI----TIY  638

Query  407   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFG  228
             R +KNVG+P TY A V++P G SV+V P  L+F+ VGEE+ FKVTLKA  +    DY FG
Sbjct  639   RRVKNVGTPGTYVAQVQAPAGVSVSVQPSKLEFKSVGEEKEFKVTLKANSKVRNQDYVFG  698

Query  227   VLTWSDKKHRVRSPIVV  177
              L WSD KH V SPI V
Sbjct  699   ELKWSDGKHYVTSPIAV  715



>gb|KDO74053.1| hypothetical protein CISIN_1g047013mg [Citrus sinensis]
Length=781

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/740 (54%), Positives = 502/740 (68%), Gaps = 19/740 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++R +  HH+ LG++LGS ++A   IF+SY R+INGF A+LEEE A +IA++PEV+SVF
Sbjct  47    DINRARIKHHEFLGSFLGSVEEAAGLIFHSYGRYINGFGAVLEEEHAKQIARHPEVVSVF  106

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L     L TTRSWEFLGLE +  +  D S W KA+FGED IIGNLD+GVWPES+SF++EG
Sbjct  107   LEEGIDLHTTRSWEFLGLEKDNQIPPD-SAWNKARFGEDVIIGNLDSGVWPESQSFTDEG  165

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVI------  1836
              GPIP RW+G CQN  +K+  CNRKLIG RY  +G   +   +NSSF  P ++       
Sbjct  166   MGPIPDRWQGTCQNDTNKAITCNRKLIGIRYISEGLIESCRAMNSSFLVPENLTTSIDHN  225

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTLSTAGG+FV   +++G+G GTAKGGSPKAR+AAYKVCW P      C  ADI+A
Sbjct  226   GHGTHTLSTAGGSFVSNVSLYGMGYGTAKGGSPKARLAAYKVCWKPNG-ANLCNAADIIA  284

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
             GFD AI DGVD++S SLG   P  +F  S+A+GSFHA+ +GI+VVASAGN GP   +V+N
Sbjct  285   GFDVAIHDGVDIISASLG-SKPKEHFESSVAVGSFHAMMHGILVVASAGNSGPAEKTVDN  343

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             V PW++TVGA+T DR F S V LGNK    G S       T  FYPL++  +A++   A+
Sbjct  344   VPPWVLTVGASTTDREFSSYVTLGNKMVIKGASIAEKGSLTQDFYPLIAGEAAKV---AN  400

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
             +S +DA  CK GT+DPEKVKGK+L+C   +     K   AA AGAVGMILAN  +  N  
Sbjct  401   VSNEDATQCKNGTIDPEKVKGKILICYDAKIGD-AKGQRAAQAGAVGMILANSREDQNIS  459

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             +   HFLP  +V Y DG +++ YI  T NPVA +T+  T      + + + FS+RGPN I
Sbjct  460   LNMVHFLPTAYVNYKDGQSVYAYIYNTENPVASMTNSITEFNKIWSRMTSFFSARGPNLI  519

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
             +P ILKPD+ APGV++IAAFT   GPS  ++D R V +NV SGTSM+CPHVAG+ GL+KT
Sbjct  520   DPAILKPDVIAPGVDIIAAFTNEYGPSHEEFDPRRVPYNVMSGTSMACPHVAGIAGLVKT  579

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+P WSPA I+SAIMTTAT   +S   I D  TG K TPFAYGAGH+NPN A DPGLVYD
Sbjct  580   LHPDWSPAAIKSAIMTTATTEDSSKHPILDQVTGQKATPFAYGAGHVNPNSALDPGLVYD  639

Query  575   LKLTDYVNFICAQGYNKTEITAVLG--TPYKCPDHISLSTFNYPSITVPHL-KGTATVTR  405
             L   DY+ ++C  GYN++ I        P+KCP   S++ FNYPSI VP+L  G+ TV+R
Sbjct  640   LGPGDYLAYLCGLGYNQSIIDLFTQPKEPFKCPGPFSIADFNYPSIAVPNLVNGSMTVSR  699

Query  404   TLKNVGSP-ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN--ATADYA  234
              LKNVG+P  TY A +   VG S  V P  L F K GEE +FK+T   KG +     DY 
Sbjct  700   RLKNVGTPTCTYKAQITEIVGVSAVVEPITLNFTKYGEELTFKITFSVKGNDKPVATDYV  759

Query  233   FGVLTWSDKKHRVRSPIVVK  174
             FG L WSD  H V+S I VK
Sbjct  760   FGELVWSDGFHNVKSTIAVK  779



>gb|ACN85269.1| subtilisin-like protease precursor [Oryza alta]
Length=783

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/729 (55%), Positives = 516/729 (71%), Gaps = 12/729 (2%)
 Frame = -2

Query  2339  HSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNRARQ  2160
              SH+ LLG+ LG  ++ARDAIFYSYTR+INGFAA LE EEAA +A+ P V+SVF +R R+
Sbjct  58    ESHYDLLGSVLGDRERARDAIFYSYTRNINGFAAGLEPEEAAAVAEQPGVVSVFPDRGRR  117

Query  2159  LQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGPIPK  1980
             + TTRSW+FLGLE   G I   S W+ A +GE+TIIGNLD+GVWPES SF++   GPIP 
Sbjct  118   MHTTRSWQFLGLERADGNIPAWSPWELAHYGENTIIGNLDSGVWPESLSFNDGELGPIPD  177

Query  1979  RWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTLSTAG  1803
              WKGICQN++DK F CN KLIGARYF +GY++A+G PLN++  TPRD  GHG+HTL+TAG
Sbjct  178   YWKGICQNERDKMFKCNSKLIGARYFNKGYAAAIGVPLNNTHKTPRDDNGHGTHTLATAG  237

Query  1802  GNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIEDGVD  1623
             G+ V GA  FGLG GTA+GGSP+ARVAAY+VC+PP +  + CYD+DILA F+ AI DGV 
Sbjct  238   GSAVRGAEAFGLGGGTARGGSPRARVAAYRVCYPPFNGSDACYDSDILAAFEAAIADGVH  297

Query  1622  VLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLITVGAN  1443
             V+S S+G D P  Y  D++AIGS HAVK GI VV SA N GP  G+V NVAPW++TV A+
Sbjct  298   VISASVGAD-PNDYLEDAVAIGSLHAVKAGITVVCSASNFGPDPGTVTNVAPWILTVAAS  356

Query  1442  TMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDALHCKP  1263
             TMDR F +++V  N+    G+S  P +L    FY ++SAA A           DA  C+ 
Sbjct  357   TMDRAFPAHLVF-NRTRVEGQSLSPTRLRGKGFYTMISAADAAAP---GRPPADAQLCEL  412

Query  1262  GTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHFLPATH  1083
             G LD  KV GK++VC++G + R+EK    + AG  GMIL NDE SG+++IAD H +PA H
Sbjct  413   GALDAAKVTGKIVVCMRGGSPRVEKGEAVSRAGGAGMILVNDEASGHDVIADPHIIPAVH  472

Query  1082  VTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDISA  903
             + ++DGLA+  YIN T+   A IT   T++G+KPAPV+A+FSS+GPN +NP+ILKPD++A
Sbjct  473   INHADGLALLAYINSTKGAKAFITKAKTVVGIKPAPVMASFSSQGPNTVNPEILKPDVAA  532

Query  902   PGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIR  723
             PGV+VIAA+T A GP+   YD+R V+FN ++GTSMSCPHV+G+ GL+KTL+P WSPA I+
Sbjct  533   PGVSVIAAWTGAAGPTGLPYDQRRVAFNTQTGTSMSCPHVSGIAGLIKTLHPDWSPAAIK  592

Query  722   SAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTDYVNFIC  543
             SAIMT+AT  +N  K I +       TPF+YGAGH+ P+ A DPGLVYDL   DY++F+C
Sbjct  593   SAIMTSATELSNEVKPILNSSLS-PATPFSYGAGHVFPHRAMDPGLVYDLTADDYLSFLC  651

Query  542   AQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHL---KGTATVTRTLKNVGSPAT  375
             + GYN T +    G PY+CPD  +    FNYPSIT   L      A   R +KNVG PAT
Sbjct  652   SIGYNATSLALFNGAPYRCPDDPLDPLDFNYPSITAYDLAPAGPPAAARRRVKNVGPPAT  711

Query  374   YTAS-VRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  198
             YTA+ VR P G  VTV P  L FE  GE ++F V    +      DYAFG + WSD  H+
Sbjct  712   YTAAVVREPEGVQVTVTPPTLTFESTGEVRTFWVKFAVRDPLPAVDYAFGAIVWSDGTHQ  771

Query  197   VRSPIVVKT  171
             VRSPIVVKT
Sbjct  772   VRSPIVVKT  780



>gb|EPS60041.1| subtilase family protein, partial [Genlisea aurea]
Length=709

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/699 (56%), Positives = 493/699 (71%), Gaps = 11/699 (2%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLG-SWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             DL RV  SH   L ++LG S ++AR+++ YSY +  NGFAA+L E E  +I  +P+V+S+
Sbjct  18    DLHRVAESHTLFLASHLGRSEEEARESLIYSYDKSFNGFAALLHENEVEKIRDHPDVVSI  77

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F ++ R+L TT SW+FL LE     +   S+W++AK+GED I+ NLDTGVWPESK FS E
Sbjct  78    FSDKPRKLHTTHSWDFLRLE-TNDFVSSSSLWERAKYGEDIILANLDTGVWPESKCFSGE  136

Query  2000  GFGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSS--FFTPRDVIGHG  1827
             G+GP+P +W+G     +D+S  CNRKL+GA Y+ +GY +      +S  F T RD  GHG
Sbjct  137   GYGPVPTQWRGTTCQLEDRSL-CNRKLLGAAYYNKGYLAYTRQSGNSPVFNTSRDNEGHG  195

Query  1826  SHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFD  1647
             SHTLSTA GNFV GA+VFG+GNGTAKGG+PKARVA+YKVCWPP   G +C+D+DI  GFD
Sbjct  196   SHTLSTAAGNFVSGASVFGVGNGTAKGGAPKARVASYKVCWPPLEDGSECFDSDITKGFD  255

Query  1646  RAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAP  1467
              AI DGVDV+S+SLGGD P  YFND +AI + HAV+ GIVVV SAGN GP  G+V+NVAP
Sbjct  256   AAIYDGVDVVSISLGGD-PSDYFNDGIAIAALHAVRRGIVVVCSAGNGGPTPGTVSNVAP  314

Query  1466  WLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIST  1287
             W+ITV A+T+DR F+++  L + + + GES +   +P GK Y L+ A  A       I++
Sbjct  315   WIITVAASTLDREFRTDARLRSGEIFHGES-LTKAMPQGKLYRLIDAGEAAAP---GINS  370

Query  1286  QDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIAD  1107
              D+L CK  TLDP KVKGK++VCL+G+N R+EK    A AG  GMIL ND+  G+EIIAD
Sbjct  371   TDSLLCKNNTLDPRKVKGKIVVCLRGDNARLEKGAVVARAGGAGMILCNDKADGSEIIAD  430

Query  1106  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  927
              H LPATH+ Y+DGL +F Y+N+ R P   I+ P  ++GVKPAP +AAFSSRGPN I P 
Sbjct  431   PHLLPATHINYTDGLKLFSYLNENRKPRGVISSPTAVVGVKPAPFMAAFSSRGPNTITPS  490

Query  926   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  747
             ILKPDI+APGVN+IAA+TE   PS  ++D R   F  ESGTSMSCPHVAGV  LL+ L+P
Sbjct  491   ILKPDITAPGVNIIAAYTENASPSGMEFDHRKTPFITESGTSMSCPHVAGVTALLRRLHP  550

Query  746   SWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKL  567
              WSPA I+SAIMTTA  R N+G+A+ D  T    TP AYGAGHI PN A DPGLVYDL  
Sbjct  551   DWSPAAIKSAIMTTARTRDNNGRAMIDGATETGATPLAYGAGHIRPNRAMDPGLVYDLDS  610

Query  566   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKG-TATVTRTLKNV  390
              DY++F+C  GYN+T I     T Y CP   ++  FNYPSIT+P + G + TV R LKNV
Sbjct  611   DDYLDFLCGSGYNETMIKRFSRTHYACPKEYNMLNFNYPSITIPAISGESVTVVRKLKNV  670

Query  389   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVT  273
             G P  Y A +R P G++  V P  L F K+GEE+SFKVT
Sbjct  671   GKPGKYGAVIRPPPGYTAKVEPDNLSFGKIGEEKSFKVT  709



>ref|XP_006475105.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=916

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/740 (53%), Positives = 505/740 (68%), Gaps = 19/740 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             D++R +  HH+ LG++LGS ++A   IF+SY R+INGF A+LEEE A +IA++PEV+SVF
Sbjct  182   DINRARIKHHEFLGSFLGSVEEAAGLIFHSYGRYINGFGAVLEEEHAKQIARHPEVVSVF  241

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
             L     L TTRSWEFLGLE +  +  D S W KA+FGED IIGNLD+GVWPES+SF++EG
Sbjct  242   LEEGIDLHTTRSWEFLGLEKDNQIPPD-SAWNKARFGEDVIIGNLDSGVWPESQSFTDEG  300

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVI------  1836
              GPIP RW+G CQN  +K+  CNRKLIG RY  +G   +   +NSSF  P ++       
Sbjct  301   MGPIPDRWQGTCQNDTNKAITCNRKLIGIRYISEGLIESCRAMNSSFLVPENLTTSIDHN  360

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHG+HTLSTAGG+FV   +++G+G GTAKGGSPKAR+AAYKVCW P      C  ADI+A
Sbjct  361   GHGTHTLSTAGGSFVSNVSLYGMGYGTAKGGSPKARLAAYKVCWKPNG-ANLCNAADIIA  419

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
             GFD AI DGVD++S SLG   P  +F  S+A+GSFHA+ +GI+VVASAGN GP   +V+N
Sbjct  420   GFDVAIHDGVDIISASLGSK-PKEHFESSVAVGSFHAMMHGILVVASAGNSGPAEKTVDN  478

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             V PW++TVGA+T DR F S V LGNK    G S       T  FYPL++  +A++   A+
Sbjct  479   VPPWVLTVGASTTDREFSSYVTLGNKMVIKGASIAEKGSLTQDFYPLIAGEAAKV---AN  535

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
             +S +DA  CK GT+DPEKVKGK+L+C   +     K  +AA AGAVGMILAN  +  N  
Sbjct  536   VSNEDATQCKNGTIDPEKVKGKILICYDAKLGD-AKGQQAAQAGAVGMILANSREDQNIS  594

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             +   HFLP  +V Y DG +++ YI  T+NPVA +T+  T      + + + FS+RGPN+I
Sbjct  595   LNMVHFLPTAYVNYKDGQSVYAYIYNTKNPVASMTNSITEFNKNSSRMTSFFSARGPNSI  654

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
             +P ILKPD+ APGV++IAA+T   GPS  ++D R V +NV SGTSM+CPHVAG+ GL+KT
Sbjct  655   DPAILKPDVIAPGVDIIAAYTNEYGPSHEEFDPRRVPYNVMSGTSMACPHVAGIAGLVKT  714

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+P WSPA I+SAIMTTAT   +S   I D  TG K TPFAYGAGH+NPN A DPGLVYD
Sbjct  715   LHPDWSPAAIKSAIMTTATTEDSSKHPILDQVTGQKATPFAYGAGHVNPNSALDPGLVYD  774

Query  575   LKLTDYVNFICAQGYNKTEITAVLG--TPYKCPDHISLSTFNYPSITVPHL-KGTATVTR  405
             L   DY+ ++C  GYN++ I        P+KCP   S++ FNYPSI VP+L  G+ TV+R
Sbjct  775   LGPGDYLAYLCGLGYNQSIIDLFTQPKEPFKCPGPFSIADFNYPSIAVPNLVNGSMTVSR  834

Query  404   TLKNVGSP-ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN--ATADYA  234
              LKNVG+P  TY A +   VG S  V P  + F K GEE +FK+T   KG +     DY 
Sbjct  835   RLKNVGTPTCTYKAQITEIVGVSAVVEPITMNFTKYGEELTFKITFSVKGNDKPVATDYV  894

Query  233   FGVLTWSDKKHRVRSPIVVK  174
             FG L WSD  H V+S I VK
Sbjct  895   FGELVWSDGFHNVKSTIAVK  914



>ref|XP_006380388.1| hypothetical protein POPTR_0007s04520g, partial [Populus trichocarpa]
 gb|ERP58185.1| hypothetical protein POPTR_0007s04520g, partial [Populus trichocarpa]
Length=836

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/736 (55%), Positives = 520/736 (71%), Gaps = 24/736 (3%)
 Frame = -2

Query  2357  DLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVF  2178
             DLDRV  +HH+LLG+ + S +KA+ AIFYSYTR+INGFAA+LE+EEAAEI+K+PEV+SV 
Sbjct  48    DLDRVTDAHHELLGSCMKSKEKAKQAIFYSYTRYINGFAAILEDEEAAEISKHPEVVSVS  107

Query  2177  LNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEG  1998
              NR  QL TT SW FLGLE  G +  D S+W KA+FGED IIG LD+GVWPES+SF++EG
Sbjct  108   RNRISQLHTTNSWGFLGLERNGEIPAD-SMWLKARFGEDVIIGTLDSGVWPESESFNDEG  166

Query  1997  FGPIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVGPLNSSFFTPRDVIGHGSHT  1818
              GP+P +WKG C    +    CNRKLIGARYF +GY +A    +SS+ T RD  GHG+HT
Sbjct  167   MGPVPSKWKGYCD--PNDGIKCNRKLIGARYFSKGYEAA-ETHDSSYHTARDYDGHGTHT  223

Query  1817  LSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAI  1638
             LSTAGG FV GAN+ G   GTAKGGSP +RVA+YKVCWP       C DAD+LAG++ AI
Sbjct  224   LSTAGGRFVSGANLLGSAYGTAKGGSPNSRVASYKVCWP------RCSDADVLAGYEAAI  277

Query  1637  EDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVAPWLI  1458
              DGVD+LSVSLG      Y  D +AIG+F A++ GI+VVA+AGN+GP  G V NVAPW++
Sbjct  278   HDGVDILSVSLGSGQE-EYITDGIAIGAFLAMERGILVVAAAGNDGPDPGVVGNVAPWIL  336

Query  1457  TVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQDA  1278
             TVG +T+ R F SNV+LGN K Y G S      P GK YPL+++  A+    A++S+  A
Sbjct  337   TVGYSTISRDFTSNVILGNNKQYKGVSFNTNTQPAGKSYPLINSVDAKA---ANVSSNQA  393

Query  1277  LHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAHF  1098
              +C  G+LDP KVKGK++ C + E+  +EKS   A AG VG+ILAN +    +I   AHF
Sbjct  394   KYCSIGSLDPLKVKGKIVYCTRNEDPDVEKSLVVAQAGGVGVILAN-QLIIQQIRPRAHF  452

Query  1097  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  918
             +P + ++  DGL+I  Y+  T++PVA+I+   T +G   APV+A FSS GPN I P+ILK
Sbjct  453   VPTSVISADDGLSILTYVYSTKSPVAYISGA-TEVGTVAAPVMADFSSPGPNFITPEILK  511

Query  917   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  738
             PDI+APGVN++AAFT A+GP+D   D+R V FN  SGTSM+CPHV+G+ GLL T++P WS
Sbjct  512   PDITAPGVNILAAFTGASGPTDVPGDRRRVHFNFISGTSMACPHVSGIAGLLNTMHPDWS  571

Query  737   PAEIRSAIMTTATVRANSGKAITDDK------TGLKTTPFAYGAGHINPNGAADPGLVYD  576
             PA I+SAIMTT      S   I++ K      + L+  P  YGAGHI P  A DPGLVYD
Sbjct  572   PAAIKSAIMTTVVAYDISATTISNVKQPIANASLLEANPLNYGAGHIWPCRAMDPGLVYD  631

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGT-ATVTRT  402
             L   DYVNF+C+ GYN T+++  +G PY C P +  L  FNYPSITVP+L     T++RT
Sbjct  632   LTTKDYVNFLCSIGYNSTQLSLFIGKPYICQPHNNGLLDFNYPSITVPNLSSNKTTLSRT  691

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVL  222
             LKNVG+P+ Y  ++R+P G SV V P+ LKF+K+ EE+ FKVTL+AK    + DY FG +
Sbjct  692   LKNVGTPSLYRVNIRAPGGISVKVEPRSLKFDKINEEKMFKVTLEAKKGFKSNDYVFGEI  751

Query  221   TWSDKKHRVRSPIVVK  174
             TWSD KH VRSP+VV+
Sbjct  752   TWSDGKHHVRSPVVVE  767



>ref|XP_008650860.1| PREDICTED: uncharacterized protein LOC100192953 isoform X1 [Zea 
mays]
 tpg|DAA61960.1| TPA: putative subtilase family protein [Zea mays]
Length=808

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/745 (56%), Positives = 519/745 (70%), Gaps = 26/745 (3%)
 Frame = -2

Query  2348  RVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLNR  2169
             R + SH  LLG+ L S  +ARDAIFYSYTR+INGFAA LEE+EAAE++++P V+SVF NR
Sbjct  58    RARSSHRALLGSVLRSEARARDAIFYSYTRYINGFAATLEEDEAAEVSRHPRVVSVFPNR  117

Query  2168  ARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFGP  1989
                L TTRSWEFLG+E EGG +  GSIW KA+FGE  +IGNLDTGVWPE+ SF ++G GP
Sbjct  118   GHPLHTTRSWEFLGMEEEGGRVRPGSIWAKARFGEGVVIGNLDTGVWPEAGSFRDDGMGP  177

Query  1988  IPKRWKGICQNQK---DKSFHCNRKLIGARYFIQGYSSAVGPLNSSF----FTPRDVIGH  1830
              P  W+GICQ+Q+   D    CNRKLIGAR+F +GY + VG           + RD  GH
Sbjct  178   APPGWRGICQDQQASDDAQVRCNRKLIGARFFNKGYLATVGRRQQQQEVNPASTRDTDGH  237

Query  1829  GSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGF  1650
             G+HTLSTA G  VPGAN+FG GNGTAKGG+P A  AAYKVCW P + G +C+DADI+A F
Sbjct  238   GTHTLSTAAGRLVPGANLFGYGNGTAKGGAPAAHAAAYKVCWRPVN-GSECFDADIIAAF  296

Query  1649  DRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNNVA  1470
             D AI DGV VLSVSLGG  P  YF D LAIGSFHA ++G+ VV SAGN GP AG+V+N A
Sbjct  297   DAAIHDGVHVLSVSLGGS-PADYFRDGLAIGSFHAARHGVTVVCSAGNSGPGAGTVSNTA  355

Query  1469  PWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASIS  1290
             PWL+TVGA+TMDR F + +VL N K   G+S    +LP  K+Y L+S+  A+   NA++ 
Sbjct  356   PWLLTVGASTMDREFPAYLVLDNNKRIKGQSLSRTRLPANKYYQLISSEEAK-GANATV-  413

Query  1289  TQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIA  1110
             TQ  L C  G+LD  KVKGK++VC++G+N R+EK      AG  GM+LANDE SGNE+IA
Sbjct  414   TQAKL-CIGGSLDKAKVKGKIVVCVRGKNARVEKGEAVHRAGGAGMVLANDEASGNEVIA  472

Query  1109  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  930
             DAH LPATH+TY+DG+ +  Y+  TR    +IT P T L  KPAP +AAFSS+GPN + P
Sbjct  473   DAHVLPATHITYADGVTLLAYLKATRLASGYITVPYTALDAKPAPFMAAFSSQGPNTVTP  532

Query  929   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  750
             +ILKPDI+APGV+++AAFT   GP+   +D R V FN ESGTSMSCPHVAG+ GLLK ++
Sbjct  533   EILKPDITAPGVSILAAFTGEAGPTGLAFDDRRVLFNAESGTSMSCPHVAGIAGLLKAVH  592

Query  749   PSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLK  570
             P WSPA I+SAIMTTA V+ N  K +++  + L+ TPF YGAGH+ PN AADPGLVYD  
Sbjct  593   PDWSPAAIKSAIMTTARVQDNMRKPMSNS-SFLRATPFGYGAGHVQPNRAADPGLVYDAN  651

Query  569   LTDYVNFICAQGYNKTEITAVLGTP------YKCPDHISLSTFNYPSITVPHLK---GTA  417
              TDY++F+CA GYN + I   +         + CP  +     NYPS+ VPHL    G  
Sbjct  652   TTDYLSFLCALGYNSSVIATFMAGAGDGHEVHACPARLRPEDLNYPSVAVPHLSPTGGAH  711

Query  416   TVTRTLKNVG-SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATA  243
             TVTR ++NVG   ATY A V  P G +V V P+ L+F   GEE+ F VT +A+ G     
Sbjct  712   TVTRRVRNVGPGGATYDAKVHEPRGVAVDVRPRRLEFAAAGEEKQFTVTFRAREGFFLPG  771

Query  242   DYAFGVLTWSD--KKHRVRSPIVVK  174
             +Y FG L WSD   +HRVRSP+V +
Sbjct  772   EYVFGRLVWSDGRGRHRVRSPLVAR  796



>ref|XP_004515813.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/737 (54%), Positives = 512/737 (69%), Gaps = 21/737 (3%)
 Frame = -2

Query  2360  VDLDRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISV  2181
             +D + V +SH  LL +Y+GS  KA++AIFYSY+++ NGFAAML+E++AA +AKNP V+SV
Sbjct  49    LDAEFVTNSHSNLLRSYVGSTVKAKEAIFYSYSKYFNGFAAMLDEDQAAMVAKNPNVVSV  108

Query  2180  FLNRARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEE  2001
             F NRA +L TT SW+FL L G+ G I   + W K + GED IIGN+DTGVWPESKSFS+E
Sbjct  109   FSNRALKLHTTHSWDFLEL-GKNGFIRKNAAWSKTQ-GEDVIIGNIDTGVWPESKSFSDE  166

Query  2000  GFGPIPKRWKGIC---QNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFF-TPRDVI  1836
               GPIP RW+G C   QN  DK F+CNRKLIGARYF +GY + VG   N+S F + RD  
Sbjct  167   TMGPIPTRWRGSCDVDQNNTDK-FYCNRKLIGARYFYKGYLAGVGDKTNASIFNSARDFH  225

Query  1835  GHGSHTLSTAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILA  1656
             GHGSHTLSTAGGNFV   +V G G GTA GGSPKARVA+YKVCWPP   G+ CY+ADILA
Sbjct  226   GHGSHTLSTAGGNFVGETSVNGNGKGTASGGSPKARVASYKVCWPPIVDGKGCYEADILA  285

Query  1655  GFDRAIEDGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAGSVNN  1476
              F+ AI DGVD++S+S+G   P  +F +S +IGSFHAV NGIVVV+SAGN+GP   +V N
Sbjct  286   AFEAAISDGVDIISLSMG-ISPVEFFENSFSIGSFHAVANGIVVVSSAGNQGPSPSTVGN  344

Query  1475  VAPWLITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINAS  1296
             V PWL+TV A+T DR F + V+LGN     G S     L   KFYPL+ A  A+++ NAS
Sbjct  345   VEPWLLTVAASTTDRTFTNKVILGNGIKIKGTSLSKDLLTPRKFYPLVKAVDAKVE-NAS  403

Query  1295  ISTQDALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEI  1116
              +  DAL C  G+LDP+K  GK++VCL+G   R +K  E   AGA+GM+LAN ++  N +
Sbjct  404   YT--DALLCNTGSLDPQKTTGKIVVCLRGNASRGDKGVEVDRAGAIGMVLANSKEVPNIL  461

Query  1115  IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAI  936
             +A +H LP++ V + DG  IF+YIN T +PVA I+  +T LGVKPAP+++ FSSRGPN +
Sbjct  462   LAYSHVLPSSMVNFQDGETIFNYINHTNSPVAFISKVSTRLGVKPAPLVSLFSSRGPNIL  521

Query  935   NPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKT  756
             +P ILKPDI+APG N+IAA++EA   S        + F   SGTSMSCPHVAGVVGL+K 
Sbjct  522   DPTILKPDITAPGQNIIAAYSEANTTSTG------LPFVAMSGTSMSCPHVAGVVGLIKA  575

Query  755   LYPSWSPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYD  576
             L+P WSPA I+S+IMTTA +  N         +    TPFAYGAGHI PN A +PGLVYD
Sbjct  576   LHPDWSPAAIKSSIMTTAKIEHNHHGRRVLSPSLENATPFAYGAGHIQPNSAVNPGLVYD  635

Query  575   LKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRT  402
             L +TDY+N++C +GY    ++   G PY CP   S+  FNYP+IT+P+LK   +  VTRT
Sbjct  636   LNVTDYMNYLCNRGYKDIHLSMFYGKPYTCPKSFSIVDFNYPTITIPNLKIGNSLNVTRT  695

Query  401   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATADYAFGV  225
             L NVG P+ Y   + +P    V+V PK+LKF++ GE++ F VTL  +   N   DY FG 
Sbjct  696   LTNVGDPSKYKVRIEAPDNVLVSVEPKVLKFKEKGEKREFTVTLSFRPLTNPKTDYVFGR  755

Query  224   LTWSDKKHRVRSPIVVK  174
             L W+  KHRV S I +K
Sbjct  756   LVWTGHKHRVGSSIAIK  772



>ref|XP_006377332.1| hypothetical protein POPTR_0011s04980g [Populus trichocarpa]
 gb|ERP55129.1| hypothetical protein POPTR_0011s04980g [Populus trichocarpa]
Length=744

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/730 (56%), Positives = 511/730 (70%), Gaps = 19/730 (3%)
 Frame = -2

Query  2351  DRVKHSHHQLLGTYLGSWDKARDAIFYSYTRHINGFaamleeeeaaeiAKNPEVISVFLN  2172
             D +  S++ LLG+ L S +KA++AIFYSYT HINGFAA LE++E  +++  PEV+SVF N
Sbjct  24    DGMTESYYDLLGSCLKSKEKAKEAIFYSYTSHINGFAATLEDDEVDQLSNRPEVVSVFPN  83

Query  2171  RARQLQTTRSWEFLGLEGEGGVIHDGSIWKKAKFGEDTIIGNLDTGVWPESKSFSEEGFG  1992
                QL TTRSWEFLGLE  G +  D SIW KA+FGED IIGNLDTGVWPES+SF +EG G
Sbjct  84    EVNQLHTTRSWEFLGLERNGQIPAD-SIWLKARFGEDVIIGNLDTGVWPESESFDDEGMG  142

Query  1991  PIPKRWKGICQNQKDKSFHCNRKLIGARYFIQGYSSAVG-PLNSSFFTPRDVIGHGSHTL  1815
             PIP RWKG C+   +    CNRKLIGARYF +GY +A+G PL+SS  T RD  GHG+HTL
Sbjct  143   PIPTRWKGYCET--NDGVKCNRKLIGARYFNKGYEAALGRPLDSSNNTARDTNGHGTHTL  200

Query  1814  STAGGNFVPGANVFGLGNGTAKGGSPKARVAAYKVCWPPTSPGEDCYDADILAGFDRAIE  1635
             STAGG FV GAN  G   GTAKGGSP ARVA+YKVCWP       CYDADILA  D AIE
Sbjct  201   STAGGRFVSGANFLGSAYGTAKGGSPNARVASYKVCWP------SCYDADILAALDAAIE  254

Query  1634  DGVDVLSVSLGGDHPGPYFNDSLAIGSFHAVKNGIVVVASAGNEGPVAG--SVNNVAPWL  1461
             DGVD+LS+SLG     PYF   +AIGSF AV NGI+VV SAGN G V G  + +NVAPW+
Sbjct  255   DGVDILSISLGRAVAIPYFRSGIAIGSFQAVMNGILVVCSAGNSGQVLGFGTTSNVAPWV  314

Query  1460  ITVGANTMDRRFQSNVVLGNKKHYTGESAVPLKLPTGKFYPLLSAASARIKINASISTQD  1281
             +TV A+T+DR F SNVVLGN K + G S     L   K+YP++ +  A+    A+ + Q 
Sbjct  315   LTVAASTIDREFPSNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKA---ANATAQL  371

Query  1280  ALHCKPGTLDPEKVKGKVLVCLQGENDRIEKSHEAALAGAVGMILANDEDSGNEIIADAH  1101
             A  C P +LDP KV+GK++ CL G    +EKS   A AG VGMIL+ D+   +  +    
Sbjct  372   AQICYPESLDPTKVRGKIVYCLGGMIPDVEKSLVVAQAGGVGMILS-DQSEDSSSMPQGF  430

Query  1100  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  921
             F+P + V+  DGL++  YI  T++PVA+I+  +T +G   APV+A+FSS GPN I P+IL
Sbjct  431   FVPTSLVSAIDGLSVLSYIYSTKSPVAYISG-STEIGKVVAPVMASFSSTGPNEITPEIL  489

Query  920   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  741
             KPDI+APGVN++AA+T+A        D+R +SFN+ SGTSMSCPHV+G+ GLLKT++P W
Sbjct  490   KPDITAPGVNILAAYTKAPRRLSRLIDQRPLSFNIISGTSMSCPHVSGIAGLLKTMHPDW  549

Query  740   SPAEIRSAIMTTATVRANSGKAITDDKTGLKTTPFAYGAGHINPNGAADPGLVYDLKLTD  561
             S A I+SAIMTTA   + + + I  D +  + TPF YG+GH+ PN   DPGLVYDL  TD
Sbjct  550   SAAAIKSAIMTTARTGSTARQPIA-DASAAEATPFNYGSGHLRPNREMDPGLVYDLTTTD  608

Query  560   YVNFICAQGYNKTEITAVLGTPYKC-PDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  384
             Y+NF+C+ GYN T+++  +  PY C P +ISL  FNYPSITVP+L G  T+TRTLKNVG+
Sbjct  609   YLNFLCSIGYNATQMSIFIEEPYACPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVGT  668

Query  383   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  204
             P  YT  V+ P G  V V P+ LKF K+ EE++FKV LKAK    ++ Y FG LTWSD  
Sbjct  669   PGLYTVRVKKPDGILVKVEPESLKFSKLNEERTFKVILKAKDNWFSSSYVFGGLTWSDGV  728

Query  203   HRVRSPIVVK  174
             H VRSPIVV+
Sbjct  729   HHVRSPIVVR  738



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7296111656336