BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25945_g1_i1 len=1363 path=[15061:0-47 13226:48-103 134:104-128
15483:129-143 174:144-174 15516:175-175 206:176-209 240:210-227
15539:228-242 273:243-259 290:260-280 15597:281-281 15598:282-283
314:284-288 15601:289-310 15623:311-319 15632:320-341 372:342-372
15662:373-374 15664:375-392 423:393-458 15692:459-471 502:472-476
507:477-514 15728:515-557 588:558-582 613:583-614 15814:615-628
15828:629-650 15848:651-659 690:660-683 714:684-736 15924:737-743
15931:744-747 13957:748-748 15947:749-761 15960:762-764
15963:765-772 13982:773-781 7626:782-790 821:791-870 901:871-949
16072:950-988 16042:989-1011 1042:1012-1049 1080:1050-1076
1107:1077-1110 1141:1111-1145 1176:1146-1146 11293:1147-1170
1201:1171-1177 1208:1178-1202 16216:1203-1207 16221:1208-1208
12645:1209-1316 1239:1317-1362]

Length=1363
                                                                      Score     E

ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    503   4e-167   
emb|CAN62337.1|  hypothetical protein VITISV_004299                     494   2e-166   Vitis vinifera
ref|XP_010657502.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    493   9e-166   
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         498   1e-165   
ref|XP_002320540.2|  subtilisin-like protease family protein            496   6e-165   Populus trichocarpa [western balsam poplar]
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         494   3e-164   
gb|KCW88587.1|  hypothetical protein EUGRSUZ_A00964                     482   3e-164   
gb|ACP18876.1|  subtilisin-like serine protease                         493   6e-164   Carica papaya [mamon]
emb|CBI39824.3|  unnamed protein product                                494   7e-164   
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    493   1e-163   Vitis vinifera
ref|XP_010107369.1|  Subtilisin-like protease                           491   4e-163   
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      491   5e-163   Ricinus communis
ref|XP_009611073.1|  PREDICTED: subtilisin-like protease SBT5.3         491   6e-163   
ref|XP_009759676.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    486   6e-163   
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         488   6e-162   
gb|KEH35215.1|  subtilisin-like serine protease                         483   1e-161   
emb|CDP06146.1|  unnamed protein product                                488   1e-161   
gb|KEH35216.1|  subtilisin-like serine protease                         483   2e-161   
ref|XP_002269456.2|  PREDICTED: subtilisin-like protease SBT5.4         480   3e-161   Vitis vinifera
ref|XP_009759675.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    486   5e-161   
ref|NP_001267495.1|  SUB1 homolog precursor                             486   7e-161   
ref|XP_003601486.1|  Subtilisin-like protease                           484   4e-160   
gb|AFV08661.1|  subtilisin-like protease                                483   6e-160   
ref|XP_006469398.1|  PREDICTED: subtilisin-like protease-like iso...    478   1e-159   
ref|XP_002299062.1|  hypothetical protein POPTR_0001s47280g             483   1e-159   Populus trichocarpa [western balsam poplar]
ref|XP_007213363.1|  hypothetical protein PRUPE_ppa026835mg             481   2e-159   
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease-like           482   2e-159   
gb|KCW75459.1|  hypothetical protein EUGRSUZ_E04225                     481   2e-159   
ref|XP_010059708.1|  PREDICTED: subtilisin-like protease SBT5.4         481   7e-159   
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           480   8e-159   
ref|XP_008384293.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    480   9e-159   
gb|EYU34388.1|  hypothetical protein MIMGU_mgv1a001745mg                479   2e-158   
ref|XP_007217687.1|  hypothetical protein PRUPE_ppa001727mg             479   4e-158   
ref|XP_009374900.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    478   5e-158   
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         478   5e-158   
ref|XP_004243217.1|  PREDICTED: subtilisin-like protease SBT5.3         478   8e-158   
ref|XP_006447869.1|  hypothetical protein CICLE_v10014351mg             478   1e-157   
ref|XP_006469397.1|  PREDICTED: subtilisin-like protease-like iso...    478   1e-157   
ref|XP_008224681.1|  PREDICTED: subtilisin-like protease                477   2e-157   
ref|XP_007214967.1|  hypothetical protein PRUPE_ppa001732mg             477   2e-157   
ref|XP_008229767.1|  PREDICTED: subtilisin-like protease                476   3e-157   
ref|XP_007049441.1|  Subtilisin-like serine endopeptidase family ...    471   4e-157   
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         480   4e-157   
gb|KCW88582.1|  hypothetical protein EUGRSUZ_A00959                     476   5e-157   
gb|KDP45154.1|  hypothetical protein JCGZ_15019                         476   6e-157   
ref|XP_011005797.1|  PREDICTED: subtilisin-like protease SBT5.4         475   8e-157   
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             474   3e-156   
ref|XP_011039832.1|  PREDICTED: subtilisin-like protease SBT5.4         474   4e-156   
gb|KDO78650.1|  hypothetical protein CISIN_1g048642mg                   474   4e-156   
ref|XP_006468177.1|  PREDICTED: subtilisin-like protease-like           474   4e-156   
ref|XP_002308740.2|  hypothetical protein POPTR_0006s00370g             470   5e-156   Populus trichocarpa [western balsam poplar]
gb|KDO42093.1|  hypothetical protein CISIN_1g038881mg                   474   6e-156   
ref|XP_010252985.1|  PREDICTED: subtilisin-like protease SBT5.4         472   1e-155   
ref|XP_007049440.1|  Subtilisin-like serine endopeptidase family ...    472   2e-155   
ref|XP_006377976.1|  hypothetical protein POPTR_0011s16870g             471   3e-155   
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                471   4e-155   
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           470   9e-155   
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         469   2e-154   
ref|XP_010048342.1|  PREDICTED: subtilisin-like protease SBT5.3         468   8e-154   
ref|XP_006601388.1|  PREDICTED: subtilisin-like protease-like           461   8e-154   
ref|XP_011000330.1|  PREDICTED: subtilisin-like protease SBT5.4         467   1e-153   
gb|KEH32715.1|  subtilisin-like serine protease                         467   1e-153   
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4         468   2e-153   
ref|XP_008344750.1|  PREDICTED: subtilisin-like protease                461   4e-153   
gb|KDP32632.1|  hypothetical protein JCGZ_13182                         466   4e-153   
ref|XP_010092360.1|  Subtilisin-like protease                           464   5e-153   
ref|XP_008357992.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    459   6e-153   
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                463   3e-152   
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                463   6e-152   
ref|XP_008462020.1|  PREDICTED: subtilisin-like protease isoform X2     458   1e-151   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                462   1e-151   
ref|XP_007207992.1|  hypothetical protein PRUPE_ppa015005mg             461   2e-151   
ref|XP_002525223.1|  Xylem serine proteinase 1 precursor, putative      460   5e-151   Ricinus communis
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     460   5e-151   
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         460   7e-151   
ref|XP_004167057.1|  PREDICTED: subtilisin-like protease-like           456   2e-150   
ref|XP_008462019.1|  PREDICTED: subtilisin-like protease isoform X1     459   2e-150   
emb|CDY65695.1|  BnaA02g06820D                                          451   3e-150   
gb|KGN43389.1|  hypothetical protein Csa_7G030520                       456   7e-150   
ref|XP_008380083.1|  PREDICTED: subtilisin-like protease                451   7e-150   
ref|XP_007020377.1|  Xylem serine proteinase 1, putative                457   7e-150   
ref|XP_009794911.1|  PREDICTED: subtilisin-like protease SBT5.3         443   1e-149   
ref|XP_004144624.1|  PREDICTED: subtilisin-like protease-like           456   1e-149   
gb|KGN55997.1|  hypothetical protein Csa_3G045110                       451   3e-149   
ref|XP_006350127.1|  PREDICTED: subtilisin-like protease-like           455   3e-149   
gb|KHN03560.1|  Subtilisin-like protease                                450   4e-149   
ref|XP_011039899.1|  PREDICTED: subtilisin-like protease SBT5.4         459   6e-149   
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         453   4e-148   
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    452   7e-148   
gb|KHN40225.1|  Subtilisin-like protease                                451   8e-148   
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    452   1e-147   
ref|XP_003528716.1|  PREDICTED: subtilisin-like protease-like           451   2e-147   
emb|CBI29567.3|  unnamed protein product                                446   3e-147   
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         450   4e-147   
ref|XP_010096499.1|  Subtilisin-like protease                           450   5e-147   
emb|CDY65693.1|  BnaA02g06800D                                          449   7e-147   
ref|XP_010693559.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    459   8e-147   
ref|XP_008348301.1|  PREDICTED: subtilisin-like protease                449   8e-147   
ref|XP_002299064.1|  hypothetical protein POPTR_0001s47300g             451   8e-147   Populus trichocarpa [western balsam poplar]
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         449   1e-146   
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3         448   3e-146   
ref|XP_010063229.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    448   3e-146   
ref|XP_002530614.1|  Cucumisin precursor, putative                      448   4e-146   Ricinus communis
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         448   4e-146   
gb|EYU27629.1|  hypothetical protein MIMGU_mgv1a001914mg                446   5e-146   
emb|CDP06171.1|  unnamed protein product                                446   8e-146   
ref|XP_009126659.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    445   9e-146   
ref|XP_008810184.1|  PREDICTED: subtilisin-like protease SBT5.3         446   1e-145   
ref|XP_004499342.1|  PREDICTED: subtilisin-like protease-like           446   2e-145   
ref|XP_009126658.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    445   3e-145   
gb|AIC80771.1|  subtilase                                               445   3e-145   
ref|XP_004296137.1|  PREDICTED: subtilisin-like protease-like           445   4e-145   
ref|XP_010063230.1|  PREDICTED: subtilisin-like protease SBT5.4         444   6e-145   
ref|XP_010539197.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    444   8e-145   
ref|XP_004515894.1|  PREDICTED: subtilisin-like protease-like           444   1e-144   
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         443   2e-144   
ref|XP_006282063.1|  hypothetical protein CARUB_v10028308mg             442   1e-143   
ref|XP_006400913.1|  hypothetical protein EUTSA_v10015943mg             441   2e-143   
ref|XP_010063228.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    440   3e-143   
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3         440   4e-143   
ref|XP_003625338.1|  Subtilisin-like serine protease                    439   6e-143   
gb|KGN55998.1|  hypothetical protein Csa_3G045120                       439   9e-143   
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    456   1e-142   
ref|XP_010483626.1|  PREDICTED: subtilisin-like protease SBT5.4         427   1e-142   
ref|XP_010092373.1|  Subtilisin-like protease                           437   3e-142   
ref|XP_009396094.1|  PREDICTED: subtilisin-like protease SBT5.3         437   6e-142   
ref|XP_011095872.1|  PREDICTED: subtilisin-like protease SBT5.4         436   8e-142   
ref|XP_006449983.1|  hypothetical protein CICLE_v10018000mg             436   9e-142   
ref|XP_010443761.1|  PREDICTED: subtilisin-like protease SBT5.4         436   1e-141   
ref|XP_004159123.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    436   1e-141   
dbj|BAJ34472.1|  unnamed protein product                                424   2e-141   
gb|AES91027.2|  subtilisin-like serine protease                         436   2e-141   
ref|XP_009591665.1|  PREDICTED: subtilisin-like protease SBT5.3         450   2e-141   
ref|XP_011039898.1|  PREDICTED: subtilisin-like protease SBT5.4         436   2e-141   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         435   2e-141   
ref|XP_010455547.1|  PREDICTED: subtilisin-like protease SBT5.4         435   3e-141   
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         435   3e-141   
ref|XP_006447864.1|  hypothetical protein CICLE_v10017839mg             433   4e-141   
ref|XP_010108994.1|  Subtilisin-like protease                           437   4e-141   
ref|XP_010942532.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    436   5e-141   
ref|XP_010942533.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    436   5e-141   
gb|KGN64982.1|  hypothetical protein Csa_1G171040                       434   8e-141   
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like           433   9e-141   
ref|XP_009587856.1|  PREDICTED: subtilisin-like protease SBT5.4         433   2e-140   
ref|XP_009394691.1|  PREDICTED: subtilisin-like protease SBT5.3         433   3e-140   
ref|XP_004515893.1|  PREDICTED: subtilisin-like protease-like           432   6e-140   
ref|XP_002299063.2|  hypothetical protein POPTR_0001s47290g             432   7e-140   Populus trichocarpa [western balsam poplar]
ref|XP_009784573.1|  PREDICTED: subtilisin-like protease SBT5.4         432   1e-139   
gb|AAK74005.1|  At2g04160/T16B23.1                                      419   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464322.1|  PREDICTED: subtilisin-like protease                430   2e-139   
dbj|BAB08348.1|  serine protease-like protein                           430   3e-139   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200789.2|  Subtilase 5.4                                         430   3e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         429   4e-139   
ref|XP_010538433.1|  PREDICTED: subtilisin-like protease SBT5.4         429   6e-139   
ref|XP_009610677.1|  PREDICTED: subtilisin-like protease SBT5.4         429   1e-138   
gb|KDP29035.1|  hypothetical protein JCGZ_16424                         437   1e-138   
gb|KDO51018.1|  hypothetical protein CISIN_1g015812mg                   415   2e-138   
ref|XP_004172226.1|  PREDICTED: subtilisin-like protease-like           415   4e-138   
gb|AES91025.2|  subtilisin-like serine protease                         426   5e-138   
ref|XP_007206786.1|  hypothetical protein PRUPE_ppa025514mg             427   5e-138   
ref|XP_009759335.1|  PREDICTED: subtilisin-like protease SBT5.4         427   6e-138   
ref|XP_002866352.1|  subtilase family protein                           426   7e-138   
gb|KEH31721.1|  subtilisin-like serine protease                         422   7e-138   
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease                426   7e-138   
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3         426   1e-137   
emb|CDY65487.1|  BnaA03g57660D                                          426   2e-137   
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             425   2e-137   
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3         424   5e-137   
ref|XP_003614591.1|  Subtilisin-like protease                           421   6e-137   
gb|AES91026.2|  subtilisin-like serine protease                         424   8e-137   
gb|AAM15440.1|  subtilisin-like serine protease AIR3                    417   9e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449184.1|  PREDICTED: uncharacterized protein LOC103491134    439   1e-136   
ref|XP_003608828.1|  Subtilisin-like serine protease                    422   4e-136   
ref|XP_007154079.1|  hypothetical protein PHAVU_003G089100g             422   5e-136   
gb|AFW70718.1|  putative subtilase family protein                       416   6e-136   
ref|XP_002885743.1|  hypothetical protein ARALYDRAFT_899224             421   6e-136   
ref|XP_008464289.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    421   9e-136   
emb|CDY15084.1|  BnaC03g44450D                                          421   1e-135   
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3         421   1e-135   
ref|XP_006418604.1|  hypothetical protein EUTSA_v10002408mg             421   1e-135   
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    420   2e-135   
ref|XP_006398487.1|  hypothetical protein EUTSA_v10001201mg             420   2e-135   
emb|CDY37334.1|  BnaC02g33520D                                          419   3e-135   
ref|XP_003608829.1|  Subtilisin-like serine protease                    420   4e-135   
emb|CDY40408.1|  BnaA02g27220D                                          419   4e-135   
gb|KFK31799.1|  hypothetical protein AALP_AA6G160400                    419   5e-135   
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    418   9e-135   
gb|KCW70438.1|  hypothetical protein EUGRSUZ_F03663                     416   4e-134   
ref|XP_010063227.1|  PREDICTED: subtilisin-like protease SBT5.4         416   7e-134   
ref|XP_010466978.1|  PREDICTED: subtilisin-like protease SBT5.3         416   8e-134   
ref|NP_565309.2|  subtilisin-like serine endopeptidase family pro...    416   9e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107091.1|  PREDICTED: subtilisin-like protease SBT5.4         415   1e-133   
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4         416   1e-133   
ref|XP_003608830.1|  Subtilisin-like serine protease                    432   2e-133   
ref|XP_004951554.1|  PREDICTED: subtilisin-like protease-like iso...    415   2e-133   
ref|XP_006648425.1|  PREDICTED: subtilisin-like protease-like           414   2e-133   
gb|KGN55992.1|  hypothetical protein Csa_3G045060                       414   3e-133   
ref|XP_006857645.1|  hypothetical protein AMTR_s00061p00140690          414   3e-133   
ref|XP_010064971.1|  PREDICTED: subtilisin-like protease SBT5.4         414   3e-133   
ref|XP_004951553.1|  PREDICTED: subtilisin-like protease-like iso...    415   4e-133   
gb|KCW70439.1|  hypothetical protein EUGRSUZ_F03664                     414   4e-133   
ref|XP_008645399.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    415   5e-133   
ref|XP_006469402.1|  PREDICTED: subtilisin-like protease-like           413   9e-133   
ref|XP_008645398.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    414   1e-132   
ref|XP_003608826.1|  Subtilisin-like protease                           412   2e-132   
ref|XP_002453487.1|  hypothetical protein SORBIDRAFT_04g006740          406   2e-132   Sorghum bicolor [broomcorn]
ref|XP_004169297.1|  PREDICTED: subtilisin-like protease-like           414   3e-132   
ref|XP_010942695.1|  PREDICTED: subtilisin-like protease SBT5.3         412   3e-132   
ref|XP_006447860.1|  hypothetical protein CICLE_v10014355mg             411   7e-132   
gb|EAZ22112.1|  hypothetical protein OsJ_05774                          402   2e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004296127.1|  PREDICTED: subtilisin-like protease-like           408   7e-131   
ref|XP_004159122.1|  PREDICTED: subtilisin-like protease-like           406   5e-130   
dbj|BAC42673.1|  putative subtilisin-like protease                      405   7e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675634.1|  PREDICTED: subtilisin-like protease SBT5.4         405   1e-129   
gb|AAC62611.1|  subtilisin-like protease                                404   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004139596.1|  PREDICTED: subtilisin-like protease-like           405   1e-129   
gb|KGN64981.1|  hypothetical protein Csa_1G171030                       405   2e-129   
ref|XP_006447865.1|  hypothetical protein CICLE_v10018333mg             401   2e-129   
gb|EEE69917.1|  hypothetical protein OsJ_29768                          404   8e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006857622.1|  hypothetical protein AMTR_s00061p00122710          403   1e-128   
ref|XP_007026418.1|  Subtilase family protein, putative                 403   1e-128   
emb|CAJ75644.1|  subtilisin-like protease                               400   2e-128   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003608824.1|  Subtilisin-like protease                           402   2e-128   
dbj|BAK01624.1|  predicted protein                                      402   3e-128   
ref|XP_004957134.1|  PREDICTED: subtilisin-like protease-like           402   3e-128   
ref|NP_001046210.1|  Os02g0198700                                       401   7e-128   Oryza sativa Japonica Group [Japonica rice]
gb|KGN56002.1|  hypothetical protein Csa_3G045160                       397   8e-128   
gb|EAY84890.1|  hypothetical protein OsI_06255                          400   1e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_008449005.1|  PREDICTED: subtilisin-like protease isoform X2     397   1e-127   
ref|XP_006475104.1|  PREDICTED: subtilisin-like protease-like           399   2e-127   
ref|XP_008449002.1|  PREDICTED: subtilisin-like protease isoform X1     397   3e-127   
ref|XP_008794758.1|  PREDICTED: subtilisin-like protease SBT5.3         397   7e-127   
ref|XP_004148289.1|  PREDICTED: subtilisin-like protease-like           396   3e-126   
ref|XP_004162792.1|  PREDICTED: subtilisin-like protease-like           396   3e-126   
ref|XP_006452710.1|  hypothetical protein CICLE_v10010380mg             395   3e-126   
ref|XP_004148290.1|  PREDICTED: uncharacterized protein LOC101212014    412   8e-126   
ref|XP_004164572.1|  PREDICTED: subtilisin-like protease-like           395   9e-126   
ref|XP_008650860.1|  PREDICTED: uncharacterized protein LOC100192...    396   9e-126   
gb|KGN55995.1|  hypothetical protein Csa_3G045090                       394   1e-125   
ref|XP_008448997.1|  PREDICTED: subtilisin-like protease                395   1e-125   
ref|XP_010647520.1|  PREDICTED: subtilisin-like protease SBT5.3         392   3e-125   
gb|ACN85198.1|  subtilisin-like protease precursor                      393   6e-125   Oryza glaberrima
dbj|BAD35630.1|  putative subtilisin-like proteinase                    393   7e-125   Oryza sativa Japonica Group [Japonica rice]
gb|ACN85165.1|  subtilisin-like protease precursor                      393   8e-125   Oryza nivara
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    390   1e-124   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      392   2e-124   Ricinus communis
gb|ACN85269.1|  subtilisin-like protease precursor                      392   2e-124   Oryza alta
ref|XP_002530613.1|  Xylem serine proteinase 1 precursor, putative      390   2e-124   Ricinus communis
gb|EPS60041.1|  subtilase family protein                                389   3e-124   
emb|CBI38460.3|  unnamed protein product                                391   3e-124   
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    391   4e-124   
ref|XP_007155547.1|  hypothetical protein PHAVU_003G210900g             390   4e-124   
ref|XP_007155591.1|  hypothetical protein PHAVU_003G215100g             385   7e-124   
ref|XP_008661010.1|  PREDICTED: subtilisin-like protease SBT5.3         390   1e-123   
ref|XP_004296128.1|  PREDICTED: subtilisin-like protease-like           387   2e-123   
gb|ACN85315.1|  subtilisin-like protease precursor                      389   2e-123   Oryza brachyantha
ref|XP_003576659.2|  PREDICTED: subtilisin-like protease SBT5.4         385   5e-123   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      387   6e-123   Ricinus communis
ref|XP_002460418.1|  hypothetical protein SORBIDRAFT_02g027810          387   1e-122   Sorghum bicolor [broomcorn]
ref|XP_002437266.1|  hypothetical protein SORBIDRAFT_10g023870          387   2e-122   Sorghum bicolor [broomcorn]
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661              384   6e-122   
emb|CBI38463.3|  unnamed protein product                                386   1e-121   
ref|XP_004967192.1|  PREDICTED: subtilisin-like protease-like           385   1e-121   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         384   1e-121   
gb|AAM15483.1|  subtilisin-like serine protease AIR3                    383   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972076.1|  hypothetical protein SELMODRAFT_172478             383   2e-121   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         384   3e-121   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             383   3e-121   
gb|ACN85256.1|  subtilisin-like protease precursor                      384   3e-121   Oryza alta
gb|ACN85215.1|  subtilisin-like protease precursor                      383   8e-121   Oryza punctata
ref|XP_003600434.1|  Subtilisin-like protease                           382   9e-121   
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4         381   1e-120   Vitis vinifera
gb|AES70685.2|  subtilisin-like serine protease                         381   1e-120   
gb|ACN85243.1|  subtilisin-like protease precursor                      382   1e-120   Oryza officinalis
gb|KDP35557.1|  hypothetical protein JCGZ_08995                         382   2e-120   
gb|EMT31638.1|  Subtilisin-like protease                                379   2e-120   
emb|CBI38462.3|  unnamed protein product                                380   4e-120   
ref|XP_004515813.1|  PREDICTED: subtilisin-like protease-like           380   4e-120   
ref|XP_002309930.2|  hypothetical protein POPTR_0007s04500g             379   5e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g             378   1e-119   
emb|CDP06138.1|  unnamed protein product                                382   2e-119   
ref|XP_011022895.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    377   4e-119   
ref|XP_011022894.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    377   5e-119   
ref|XP_002456214.1|  hypothetical protein SORBIDRAFT_03g032240          374   9e-119   
dbj|BAC22315.1|  putative subtilisin-like serine protease AIR3          376   2e-118   
gb|KHN14107.1|  Subtilisin-like protease                                382   3e-118   
gb|KEH31720.1|  subtilisin-like serine protease                         375   3e-118   
ref|XP_006657123.1|  PREDICTED: subtilisin-like protease-like           374   6e-118   
ref|XP_006452708.1|  hypothetical protein CICLE_v10010806mg             372   3e-117   
ref|XP_006475105.1|  PREDICTED: subtilisin-like protease-like           376   4e-117   
gb|KDO74053.1|  hypothetical protein CISIN_1g047013mg                   372   5e-117   
gb|EEC80955.1|  hypothetical protein OsI_23669                          380   6e-117   
gb|KDO74052.1|  hypothetical protein CISIN_1g040503mg                   372   8e-117   
ref|NP_001131603.1|  uncharacterized protein LOC100192953               357   2e-116   
ref|XP_003571078.1|  PREDICTED: subtilisin-like protease SBT5.3         371   2e-116   
gb|KHN44767.1|  Subtilisin-like protease                                370   3e-116   
emb|CAN77862.1|  hypothetical protein VITISV_022393                     370   3e-116   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         370   4e-116   
ref|XP_010647023.1|  PREDICTED: subtilisin-like protease SBT5.4         356   7e-116   
ref|XP_006660048.1|  PREDICTED: subtilisin-like protease-like           368   9e-116   
ref|NP_001151755.1|  subtilisin-like protease precursor                 369   1e-115   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             368   1e-115   
tpg|DAA52605.1|  TPA: putative subtilase family protein                 369   1e-115   
ref|XP_002463463.1|  hypothetical protein SORBIDRAFT_01g000350          369   2e-115   
ref|XP_006380388.1|  hypothetical protein POPTR_0007s04520g             370   2e-115   
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3         367   5e-115   
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3         367   5e-115   
gb|EEC83379.1|  hypothetical protein OsI_28793                          375   3e-114   
ref|XP_003560594.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    365   3e-114   
ref|XP_010227516.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    365   3e-114   
gb|EAZ42320.1|  hypothetical protein OsJ_26892                          375   4e-114   
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3         365   5e-114   
emb|CBI38458.3|  unnamed protein product                                363   1e-113   
ref|XP_003545195.1|  PREDICTED: subtilisin-like protease-like           363   1e-113   
gb|AIC80772.1|  subtilase                                               362   2e-113   
ref|XP_004500162.1|  PREDICTED: subtilisin-like protease-like           363   2e-113   
ref|XP_006595826.1|  PREDICTED: subtilisin-like protease-like iso...    363   3e-113   
gb|KHN44769.1|  Subtilisin-like protease                                361   5e-113   
ref|XP_003571633.1|  PREDICTED: subtilisin-like protease SBT5.3         361   9e-113   
gb|EEC71345.1|  hypothetical protein OsI_03414                          360   2e-112   
gb|EEE66000.1|  hypothetical protein OsJ_21940                          366   2e-112   
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3         360   3e-112   
ref|XP_003617903.1|  Subtilisin-like protease                           354   3e-112   
ref|XP_004491541.1|  PREDICTED: subtilisin-like protease-like           359   5e-112   
ref|NP_001043993.2|  Os01g0702300                                       357   1e-111   
gb|EAZ13237.1|  hypothetical protein OsJ_03159                          357   2e-111   
dbj|BAK07347.1|  predicted protein                                      358   2e-111   
gb|EMT26574.1|  Subtilisin-like protease                                355   2e-111   
gb|AET00862.2|  subtilisin-like serine protease                         355   2e-110   
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like           355   3e-110   
ref|XP_007025243.1|  Subtilase family protein isoform 2                 353   5e-110   
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4         354   6e-110   
ref|XP_007025242.1|  Subtilase family protein, putative isoform 1       353   1e-109   
dbj|BAD81785.1|  P69E protein-like                                      357   2e-109   
ref|XP_011096454.1|  PREDICTED: subtilisin-like protease                350   2e-109   
ref|XP_008359025.1|  PREDICTED: subtilisin-like protease                347   8e-109   
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668              351   2e-108   
ref|XP_011102178.1|  PREDICTED: subtilisin-like protease                350   2e-108   
dbj|BAK05312.1|  predicted protein                                      350   3e-108   
ref|XP_011100610.1|  PREDICTED: subtilisin-like protease SBT5.4         350   3e-108   
ref|XP_002317314.1|  subtilase family protein                           349   4e-108   
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             351   5e-108   
ref|XP_011045349.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    348   8e-108   
gb|EYU28144.1|  hypothetical protein MIMGU_mgv1a001682mg                348   1e-107   
ref|XP_006449588.1|  hypothetical protein CICLE_v10014347mg             342   1e-107   
ref|XP_011010424.1|  PREDICTED: subtilisin-like protease SBT5.3         348   1e-107   
ref|XP_011045348.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    348   1e-107   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           346   4e-107   
ref|XP_003616914.1|  Subtilisin-like protease                           347   6e-107   
gb|KDO77991.1|  hypothetical protein CISIN_1g0040471mg                  339   8e-107   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                345   1e-106   
ref|XP_002517380.1|  Xylem serine proteinase 1 precursor, putative      344   1e-106   
gb|ACN28035.1|  unknown                                                 333   2e-106   
ref|XP_002967356.1|  hypothetical protein SELMODRAFT_408319             344   2e-106   
gb|KDO77986.1|  hypothetical protein CISIN_1g0040471mg                  339   2e-106   
ref|XP_010105478.1|  Subtilisin-like protease                           343   5e-106   
ref|XP_007139652.1|  hypothetical protein PHAVU_008G047900g             343   6e-106   
dbj|BAK04191.1|  predicted protein                                      343   9e-106   
dbj|BAK04840.1|  predicted protein                                      343   1e-105   
ref|XP_001777292.1|  predicted protein                                  341   1e-105   
ref|XP_006467568.1|  PREDICTED: subtilisin-like protease-like           342   1e-105   
ref|XP_010052139.1|  PREDICTED: subtilisin-like protease SBT5.3         342   2e-105   
ref|XP_006449587.1|  hypothetical protein CICLE_v10014347mg             342   2e-105   
ref|XP_002960359.1|  hypothetical protein SELMODRAFT_437460             341   4e-105   
ref|XP_007139650.1|  hypothetical protein PHAVU_008G047700g             340   6e-105   
gb|KDO74048.1|  hypothetical protein CISIN_1g044993mg                   338   1e-104   
ref|XP_009407016.1|  PREDICTED: subtilisin-like protease SBT5.3         339   1e-104   
ref|XP_010676115.1|  PREDICTED: subtilisin-like protease SBT5.4         339   1e-104   
ref|XP_006602868.1|  PREDICTED: subtilisin-like protease-like           340   2e-104   
gb|KHN40540.1|  Subtilisin-like protease                                340   2e-104   
ref|XP_007141639.1|  hypothetical protein PHAVU_008G213000g             340   2e-104   
gb|EEC84763.1|  hypothetical protein OsI_31779                          348   2e-104   
gb|ACN27710.1|  unknown                                                 337   2e-104   
ref|XP_006602865.1|  PREDICTED: subtilisin-like protease-like           340   2e-104   
ref|XP_006475103.1|  PREDICTED: subtilisin-like protease-like           339   2e-104   
ref|XP_010675509.1|  PREDICTED: subtilisin-like protease SBT5.4         340   2e-104   
gb|KCW76039.1|  hypothetical protein EUGRSUZ_D00408                     338   4e-104   
gb|EAY90937.1|  hypothetical protein OsI_12551                          330   4e-104   
gb|KHM99088.1|  Subtilisin-like protease                                338   7e-104   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           338   8e-104   
gb|EMS60673.1|  Subtilisin-like protease                                325   9e-104   
tpg|DAA50265.1|  TPA: putative subtilase family protein                 337   9e-104   
gb|KHN44005.1|  Subtilisin-like protease                                328   9e-104   
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease                338   1e-103   
ref|XP_009360803.1|  PREDICTED: subtilisin-like protease SBT5.3         338   1e-103   
ref|XP_006452712.1|  hypothetical protein CICLE_v10010631mg             338   1e-103   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             337   1e-103   
ref|XP_003545192.1|  PREDICTED: subtilisin-like protease-like           338   1e-103   
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3         337   1e-103   
ref|XP_002320086.2|  subtilase family protein                           337   2e-103   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                337   2e-103   
ref|XP_002988851.1|  hypothetical protein SELMODRAFT_128873             336   2e-103   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             336   2e-103   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             337   3e-103   
ref|XP_002964212.1|  hypothetical protein SELMODRAFT_81842              335   3e-103   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             336   3e-103   
ref|XP_010272679.1|  PREDICTED: subtilisin-like protease SBT5.4         336   5e-103   
ref|XP_006387513.1|  hypothetical protein POPTR_0909s00200g             320   5e-103   
ref|XP_004491111.1|  PREDICTED: subtilisin-like protease-like           336   6e-103   
ref|XP_008803738.1|  PREDICTED: subtilisin-like protease SBT5.3         330   1e-102   
ref|XP_002522297.1|  Xylem serine proteinase 1 precursor, putative      335   1e-102   
gb|EMT03237.1|  Subtilisin-like protease                                333   2e-102   
ref|XP_004492930.1|  PREDICTED: subtilisin-like protease-like iso...    333   2e-102   
ref|NP_001151549.1|  subtilisin-like protease precursor                 334   2e-102   
gb|EPS59495.1|  hypothetical protein M569_15309                         333   3e-102   
gb|KHN40543.1|  Subtilisin-like protease                                332   3e-102   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                333   5e-102   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                333   6e-102   
gb|KHN12975.1|  Subtilisin-like protease                                332   6e-102   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      332   6e-102   
gb|EMT15470.1|  Subtilisin-like protease                                332   7e-102   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           332   8e-102   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     332   8e-102   
emb|CAA59963.1|  subtilisin-like protease                               332   8e-102   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     332   9e-102   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                332   9e-102   
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           332   9e-102   
ref|XP_004492929.1|  PREDICTED: subtilisin-like protease-like iso...    333   9e-102   
emb|CBI30775.3|  unnamed protein product                                331   1e-101   
ref|XP_003533568.1|  PREDICTED: subtilisin-like protease-like           332   1e-101   
ref|XP_010052138.1|  PREDICTED: subtilisin-like protease SBT5.3         332   1e-101   
gb|KHG30296.1|  Subtilisin-like protease                                332   1e-101   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                332   2e-101   
ref|NP_569048.1|  subtilisin-like protease                              331   2e-101   
ref|XP_010688246.1|  PREDICTED: subtilisin-like protease SBT5.4         332   2e-101   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                331   2e-101   
emb|CDY63302.1|  BnaCnng41810D                                          331   2e-101   
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                332   3e-101   
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                331   3e-101   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                330   4e-101   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                330   4e-101   
gb|KHN11556.1|  Subtilisin-like protease                                331   5e-101   
ref|XP_002269555.2|  PREDICTED: subtilisin-like protease SBT5.3         330   5e-101   
emb|CBI30770.3|  unnamed protein product                                330   6e-101   
ref|XP_004492919.1|  PREDICTED: subtilisin-like protease-like           330   8e-101   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    330   9e-101   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         329   1e-100   
ref|XP_002269375.1|  PREDICTED: subtilisin-like protease SBT5.3         330   1e-100   
ref|XP_010090327.1|  Subtilisin-like protease                           330   1e-100   
gb|ADE77855.1|  unknown                                                 318   2e-100   
ref|XP_010095116.1|  Subtilisin-like protease                           329   2e-100   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             328   2e-100   
ref|XP_003624300.1|  Subtilisin-like protease                           329   2e-100   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           328   2e-100   
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           328   2e-100   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           328   3e-100   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                328   3e-100   
ref|NP_001234282.1|  SBT1 protein precursor                             328   3e-100   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                328   3e-100   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           328   3e-100   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    328   3e-100   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                328   4e-100   
gb|KHN13887.1|  Subtilisin-like protease                                326   4e-100   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                328   4e-100   
ref|XP_003597117.1|  Subtilisin-like protease                           328   5e-100   
ref|NP_001050634.1|  Os03g0605300                                       327   6e-100   
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease                328   7e-100   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             327   7e-100   
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                327   7e-100   
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                327   8e-100   
ref|XP_010105479.1|  Subtilisin-like protease                           327   9e-100   
gb|EPS68445.1|  hypothetical protein M569_06321                         323   1e-99    
gb|KDP21172.1|  hypothetical protein JCGZ_21643                         327   2e-99    
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           326   2e-99    
emb|CDY66924.1|  BnaAnng23240D                                          320   2e-99    
ref|XP_010694466.1|  PREDICTED: subtilisin-like protease SBT5.4         322   2e-99    
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                326   2e-99    
gb|AAM10321.1|  AT5g67360/K8K14_8                                       325   2e-99    
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           326   3e-99    
ref|XP_003570962.1|  PREDICTED: subtilisin-like protease SBT5.3         326   3e-99    
gb|ADE76648.1|  unknown                                                 314   4e-99    
emb|CAN81091.1|  hypothetical protein VITISV_040911                     315   4e-99    
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                326   4e-99    
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         325   4e-99    
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg             325   4e-99    
ref|XP_004295413.1|  PREDICTED: subtilisin-like protease-like           325   4e-99    
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  325   4e-99    
emb|CBI37888.3|  unnamed protein product                                326   4e-99    
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like           325   5e-99    
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                325   5e-99    
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           325   6e-99    
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                325   7e-99    
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease                325   7e-99    
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           325   7e-99    
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             325   8e-99    
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                324   8e-99    
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                324   9e-99    
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                324   9e-99    
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             324   9e-99    
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           324   1e-98    
gb|KHN04600.1|  Subtilisin-like protease                                323   1e-98    
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           324   1e-98    
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    323   1e-98    
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                324   2e-98    
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                324   2e-98    
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                324   2e-98    
ref|XP_010916217.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    322   2e-98    
gb|AIX97848.1|  SBT1.5                                                  323   2e-98    
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                323   2e-98    
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                323   2e-98    



>ref|XP_010256205.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3, 
partial [Nelumbo nucifera]
Length=803

 Score =   503 bits (1295),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 242/370 (65%), Positives = 293/370 (79%), Gaps = 2/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G LDPEK +GK+L CLRG TAR DK  QAA AGAVGMILAND  + NEIIADAH
Sbjct  433   ALLCKAGALDPEKVRGKILTCLRGETARVDKGEQAARAGAVGMILANDVTTANEIIADAH  492

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+TY+DGLA+F YIN T++PVA++TH  TLLGVKPAP +A+FSS+GPN + P+IL
Sbjct  493   VLPASHITYTDGLAVFAYINSTKSPVAYLTHGTTLLGVKPAPFMASFSSKGPNLVTPEIL  552

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEA G +  + DKRIV FN+ SGTSMSCPHV+GV GLLKTL+P W
Sbjct  553   KPDITAPGVNIIAAFTEAQGAASEN-DKRIVPFNIMSGTSMSCPHVSGVAGLLKTLHPDW  611

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA ++SAIMTTA  R N G+ I  + + ++ATPF+YGAGH+ PN A DPGLVYDL + D
Sbjct  612   SPAAVKSAIMTTAGARDNIGEQIL-NSSHVEATPFSYGAGHVQPNRAMDPGLVYDLTVKD  670

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y++F+CA GYN+T+I      PY CP   +L  FNYPSITVP+L G+ATVTRTLKNVG+P
Sbjct  671   YLDFLCALGYNQTQIETFSDKPYTCPKSATLMDFNYPSITVPNLSGSATVTRTLKNVGTP  730

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TYTASV +P G SV+V P  LKFEK+GEE++F++TLK    +A  DY FG L WSD  H
Sbjct  731   GTYTASVDAPNGISVSVEPASLKFEKMGEEKTFRLTLKTNKADAAMDYVFGQLIWSDGLH  790

Query  131   RVRSPIVVKA  102
              VRSPIVVKA
Sbjct  791   YVRSPIVVKA  800



>emb|CAN62337.1| hypothetical protein VITISV_004299 [Vitis vinifera]
Length=590

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 238/370 (64%), Positives = 287/370 (78%), Gaps = 1/370 (0%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK GTLD  K KGK+LVCLRG  AR DK  QAALAGAVGM+LAN+E +GNE+IAD H 
Sbjct  222   LLCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHV  281

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+H+ ++DG+A+F Y+N T++P+A+IT   T LG KPAP +AAFSS+GPN I P+ILK
Sbjct  282   LPASHINFTDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILK  341

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTL+P WS
Sbjct  342   PDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWS  401

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA IRSA+MTTA    NS +AI  + +  KATPF+YGAGH+ PN A +PGLVYDL + DY
Sbjct  402   PAAIRSAMMTTARTMDNSMEAIL-NASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDY  460

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +NF+CA GYN+T I      PY CP  ISL+ FNYPSITVP L G+ TVTRTLKNVG P 
Sbjct  461   LNFLCALGYNQTLIKMFSERPYTCPKPISLTNFNYPSITVPKLHGSITVTRTLKNVGPPG  520

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A +R P G SV+V P  LKF K+GEE++F +TL+A+   A  DY FG L WSD KH 
Sbjct  521   TYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHF  580

Query  128   VRSPIVVKAA  99
             VRSPIVVKAA
Sbjct  581   VRSPIVVKAA  590



>ref|XP_010657502.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=620

 Score =   493 bits (1269),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 238/370 (64%), Positives = 287/370 (78%), Gaps = 1/370 (0%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK GTLD  K KGK+LVCLRG  AR DK  QAALAGAVGM+LAN+E +GNE+IAD H 
Sbjct  252   LLCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHV  311

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+H+ ++DG+A+F Y+N T++P+A+IT   T LG KPAP +AAFSS+GPN I P+ILK
Sbjct  312   LPASHINFTDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILK  371

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTL+P WS
Sbjct  372   PDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWS  431

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA IRSA+MTTA    NS +AI  + +  KATPF+YGAGH+ PN A +PGLVYDL + DY
Sbjct  432   PAAIRSAMMTTARTMDNSMEAIL-NASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDY  490

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +NF+CA GYN+T I      PY CP  ISL+ FNYPSITVP L G+ TVTRTLKNVG P 
Sbjct  491   LNFLCALGYNQTLIKMFSERPYTCPKPISLTNFNYPSITVPKLHGSITVTRTLKNVGPPG  550

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A +R P G SV+V P  LKF K+GEE++F +TL+A+   A  DY FG L WSD KH 
Sbjct  551   TYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHF  610

Query  128   VRSPIVVKAA  99
             VRSPIVVKAA
Sbjct  611   VRSPIVVKAA  620



>ref|XP_011012624.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=769

 Score =   498 bits (1282),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 238/370 (64%), Positives = 295/370 (80%), Gaps = 3/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDPEKAKGK+LVCLRG+ AR DK  QAALAGAVGM+LAN++D+GNEI+AD H
Sbjct  400   ALLCKDGSLDPEKAKGKILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LP +H+ Y+ G+AIF YIN T  PVA+ITHP T +G+KPAPV+AAFSS+GPN + P+IL
Sbjct  460   VLPVSHIKYTSGVAIFKYINSTEYPVAYITHPVTRIGMKPAPVVAAFSSKGPNTVTPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+VGLLKT++P+W
Sbjct  520   KPDITAPGVSVIAAYTKAQGPTNQDFDTRRVLFNAVSGTSMSCPHVSGIVGLLKTMHPTW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA  + N+ + I  +    KA+PF+YGAGHI PN A DPGLVYDL + D
Sbjct  580   SPASIKSAIMTTAMTQDNTMEPIL-NANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVDD  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+CA GYN+T+I+     PY+CP   ISL+ FNYPSITVP   G+ T++RT+KNVGS
Sbjct  639   YLNFLCALGYNETQISTFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGS  698

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY   +R P G SV V PK L+F+KVGEE++F VTLK KG+ A  DY FG L WSDKK
Sbjct  699   PNTYKLRIRKPTGVSVYVEPKKLEFKKVGEEKAFTVTLKGKGK-AAKDYVFGELIWSDKK  757

Query  134   HRVRSPIVVK  105
             H VRSPIVVK
Sbjct  758   HHVRSPIVVK  767



>ref|XP_002320540.2| subtilisin-like protease family protein [Populus trichocarpa]
 gb|EEE98855.2| subtilisin-like protease family protein [Populus trichocarpa]
Length=769

 Score =   496 bits (1277),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 237/370 (64%), Positives = 294/370 (79%), Gaps = 3/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDPEKAKGK+LVCLRG+ AR DK  QAALAGAVGM+LAN++D+GNEI+AD H
Sbjct  400   ALLCKDGSLDPEKAKGKILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LP +H+ Y+ G+AIF YIN T  PVA+ITHP T +G KPAPV+AAFSS+GPN + P+IL
Sbjct  460   VLPVSHINYTSGVAIFKYINSTEYPVAYITHPVTRIGTKPAPVVAAFSSKGPNTVTPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+VGLLKTL+P+W
Sbjct  520   KPDITAPGVSVIAAYTKAQGPTNQDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPTW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA  + N+ + I  +    KA+PF+YGAGHI PN A DPGLVYDL + D
Sbjct  580   SPASIKSAIMTTAMTQDNTMEPIL-NANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVND  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+N +CA GYN+T+I+     PY+CP   ISL+ FNYPSITVP   G+ T++RT+KNVGS
Sbjct  639   YLNLLCALGYNETQISTFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGS  698

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P+TY   +R P G SV+V PK L+F+KVGEE++F VTLK KG+ A  DY FG L WSD K
Sbjct  699   PSTYKLRIRKPTGVSVSVEPKKLEFKKVGEEKAFTVTLKGKGK-AAKDYVFGELIWSDNK  757

Query  134   HRVRSPIVVK  105
             H VRSPIVVK
Sbjct  758   HHVRSPIVVK  767



>ref|XP_010644656.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=768

 Score =   494 bits (1273),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/370 (62%), Positives = 291/370 (79%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKPGTL+P+K KGK+LVCLRG   R DK  QAALAGAVG ILAND  SGNE+IAD H
Sbjct  400   AILCKPGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV +SDG A+F+YIN T+NP+A++T   T LG+KPAP +A+FSS+GPN I P+IL
Sbjct  460   VLPASHVNFSDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA++E+ GP+D  +DKR + FN +SGTSMSCPH++G+VGLLKTL+P W
Sbjct  520   KPDITAPGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMT+A  R ++ + +  + + LKATPF+YGAGH+ PN A DPGLVYD  + D
Sbjct  580   SPAAIKSAIMTSARTRDDNMEPML-NSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVND  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+CA GYN+T++      PYKCP   SL+ FNYPSIT P+L G+ T++RT+KNVG+P
Sbjct  639   YLNFLCAIGYNETQLQIFSQKPYKCPKSFSLTGFNYPSITAPNLSGSVTISRTVKNVGTP  698

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TYTASV++P G SV V P  L+F + GEE+SF++TLKAKG     DY FG L WSD +H
Sbjct  699   GTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQH  758

Query  131   RVRSPIVVKA  102
              VRS IVVKA
Sbjct  759   YVRSSIVVKA  768



>gb|KCW88587.1| hypothetical protein EUGRSUZ_A00964 [Eucalyptus grandis]
Length=421

 Score =   482 bits (1240),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 240/386 (62%), Positives = 288/386 (75%), Gaps = 1/386 (0%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     L+ +  + +LLCK GTLDP K KGK+LVCLRG  AR DK  QA LA AVGM+
Sbjct  35    LISAADARLSHVSANEALLCKNGTLDPRKVKGKILVCLRGDNARVDKGEQALLASAVGMV  94

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN+  SG+EI++D HFLPA+HV Y+DG AIF YIN T+ P A IT   T LGVKP+P +
Sbjct  95    LANNLVSGSEILSDPHFLPASHVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFM  154

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GPN I P+ILKPD++APGV+VIAA+TEA GP+D  YDKR V +N  SGTSMSCP
Sbjct  155   AAFSSKGPNTIIPEILKPDVTAPGVSVIAAYTEAAGPTDQAYDKRRVPYNAMSGTSMSCP  214

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+GV GLLKTL+P WSPA IRSAIMT+AT+  N+ ++I ++ +  KATPF+YGAGHI P
Sbjct  215   HVSGVAGLLKTLHPEWSPAAIRSAIMTSATILDNAMESIMNN-SFYKATPFSYGAGHIQP  273

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  360
             N A DPGLVYDL + DY+NF+C+ GYN  +I+ V    Y C   I L  FNYPSITVP L
Sbjct  274   NRAMDPGLVYDLGIIDYLNFLCSLGYNAMQISNVTDGAYDCSKRIGLLDFNYPSITVPKL  333

Query  359   KGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA  180
               + TVTRT+KNVG P TY AS+  P G  V V P  LKF+K+GEE+SFKV LK KG  A
Sbjct  334   SRSITVTRTVKNVGFPGTYRASILEPNGVLVLVKPAYLKFKKIGEEKSFKVMLKVKGAGA  393

Query  179   TADYAFGVLTWSDKKHRVRSPIVVKA  102
             T DY+FG L WSD +H VRSPIVVKA
Sbjct  394   TEDYSFGELIWSDTEHHVRSPIVVKA  419



>gb|ACP18876.1| subtilisin-like serine protease [Carica papaya]
Length=771

 Score =   493 bits (1270),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 239/376 (64%), Positives = 297/376 (79%), Gaps = 3/376 (1%)
 Frame = -3

Query  1220  NSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIA  1041
             N  ++LC+ G LDP+K KGK+LVCLRG+ AR DK  QAALAGAVGMILAN E +GNEIIA
Sbjct  397   NEEAILCEAGALDPKKVKGKILVCLRGLNARVDKGQQAALAGAVGMILANSELNGNEIIA  456

Query  1040  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  861
             DAH LPA+H++++DGL++F+YIN T +PVA++T P T L  KPAPV+AAFSS+GPN + P
Sbjct  457   DAHVLPASHISFTDGLSVFEYINLTNSPVAYMTRPKTKLPTKPAPVMAAFSSKGPNIVTP  516

Query  860   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  681
             +ILKPDI+APGVNVIAA+T A GP++ ++D+R V FN  SGTSMSCPHV+G+VGLLKTLY
Sbjct  517   EILKPDITAPGVNVIAAYTRAQGPTNQNFDRRRVQFNSVSGTSMSCPHVSGIVGLLKTLY  576

Query  680   PSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLK  501
             PSWSPA IRSAIMT+AT   N  ++I  + + +KATPF+YGAGH+ PN A +PGLVYDL 
Sbjct  577   PSWSPAAIRSAIMTSATTMDNINESIL-NASNVKATPFSYGAGHVQPNQAMNPGLVYDLN  635

Query  500   LTDYVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKN  324
               DY+ F+CA GY+KT I+      + CP  +ISL+ FNYPSITVP LKG  T++R +KN
Sbjct  636   TKDYLKFLCALGYSKTLISIFSNDKFNCPRTNISLADFNYPSITVPELKGLITLSRKVKN  695

Query  323   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  144
             VGSP TY  +V+ P G SVTV PKILKF+K GEE+SF VTLK K +N T +Y FG L WS
Sbjct  696   VGSPTTYRVTVQKPKGISVTVKPKILKFKKAGEEKSFTVTLKMKAKNPTKEYVFGELVWS  755

Query  143   DK-KHRVRSPIVVKAA  99
             D+ +H VRSPIVVKAA
Sbjct  756   DEDEHYVRSPIVVKAA  771



>emb|CBI39824.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   494 bits (1273),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 228/370 (62%), Positives = 291/370 (79%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKPGTL+P+K KGK+LVCLRG   R DK  QAALAGAVG ILAND  SGNE+IAD H
Sbjct  435   AILCKPGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPH  494

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV +SDG A+F+YIN T+NP+A++T   T LG+KPAP +A+FSS+GPN I P+IL
Sbjct  495   VLPASHVNFSDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEIL  554

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA++E+ GP+D  +DKR + FN +SGTSMSCPH++G+VGLLKTL+P W
Sbjct  555   KPDITAPGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDW  614

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMT+A  R ++ + +  + + LKATPF+YGAGH+ PN A DPGLVYD  + D
Sbjct  615   SPAAIKSAIMTSARTRDDNMEPML-NSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVND  673

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+CA GYN+T++      PYKCP   SL+ FNYPSIT P+L G+ T++RT+KNVG+P
Sbjct  674   YLNFLCAIGYNETQLQIFSQKPYKCPKSFSLTGFNYPSITAPNLSGSVTISRTVKNVGTP  733

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TYTASV++P G SV V P  L+F + GEE+SF++TLKAKG     DY FG L WSD +H
Sbjct  734   GTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQH  793

Query  131   RVRSPIVVKA  102
              VRS IVVKA
Sbjct  794   YVRSSIVVKA  803



>ref|XP_002266728.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
 emb|CBI28486.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   493 bits (1268),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 238/370 (64%), Positives = 287/370 (78%), Gaps = 1/370 (0%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK GTLD  K KGK+LVCLRG  AR DK  QAALAGAVGM+LAN+E +GNE+IAD H 
Sbjct  401   LLCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHV  460

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+H+ ++DG+A+F Y+N T++P+A+IT   T LG KPAP +AAFSS+GPN I P+ILK
Sbjct  461   LPASHINFTDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILK  520

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTL+P WS
Sbjct  521   PDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWS  580

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA IRSA+MTTA    NS +AI  + +  KATPF+YGAGH+ PN A +PGLVYDL + DY
Sbjct  581   PAAIRSAMMTTARTMDNSMEAIL-NASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDY  639

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +NF+CA GYN+T I      PY CP  ISL+ FNYPSITVP L G+ TVTRTLKNVG P 
Sbjct  640   LNFLCALGYNQTLIKMFSERPYTCPKPISLTNFNYPSITVPKLHGSITVTRTLKNVGPPG  699

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A +R P G SV+V P  LKF K+GEE++F +TL+A+   A  DY FG L WSD KH 
Sbjct  700   TYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHF  759

Query  128   VRSPIVVKAA  99
             VRSPIVVKAA
Sbjct  760   VRSPIVVKAA  769



>ref|XP_010107369.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC15620.1| Subtilisin-like protease [Morus notabilis]
Length=752

 Score =   491 bits (1264),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 236/370 (64%), Positives = 283/370 (76%), Gaps = 1/370 (0%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCKP TLDP+K  GK+LVCLRG  AR DK  QA  AGAVGMILAN+E +GNEIIAD H 
Sbjct  384   LLCKPATLDPKKVTGKILVCLRGQNARVDKGQQALEAGAVGMILANNELTGNEIIADPHV  443

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+H+ Y+DG+ +F YIN T++P  +IT   T LG KPAP +AAFSS+GPN + P+ILK
Sbjct  444   LPASHINYNDGINVFTYINSTKSPKGYITPATTKLGTKPAPFMAAFSSKGPNTVTPEILK  503

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV++IAA+TEA GP++ ++DKR +SFN  SGTSMSCPHV+G+VGLLKTL+P WS
Sbjct  504   PDITAPGVSIIAAYTEAQGPTNEEFDKRRISFNSISGTSMSCPHVSGIVGLLKTLHPDWS  563

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA I+SAIMTTA  R N  + +  + +  KATPF+YGAGH+NPNGA DPGLVYDL   DY
Sbjct  564   PAAIKSAIMTTARTRDNQMEPLL-NSSNFKATPFSYGAGHVNPNGAMDPGLVYDLSFNDY  622

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +NF+CA  YN T+I      PYKC   ISL+  NYPSITVP L G+  VTRTLKNVG+P 
Sbjct  623   LNFLCALRYNATQIEMFSEKPYKCSKKISLTNLNYPSITVPKLSGSIAVTRTLKNVGTPG  682

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A V +  G SV+V PK LKF++VGEE+SF +TLKAK   A  DYAFG L WSD  H 
Sbjct  683   TYRARVENQAGISVSVEPKSLKFKRVGEEKSFTLTLKAKNPKAAKDYAFGKLIWSDGTHY  742

Query  128   VRSPIVVKAA  99
             VRSPIVVKAA
Sbjct  743   VRSPIVVKAA  752



>ref|XP_002524587.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37795.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=771

 Score =   491 bits (1264),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 234/369 (63%), Positives = 290/369 (79%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LD +KAKGK+LVCLRGV AR DK  QAA AGAVGM+L ND+DSGNEI+AD H L
Sbjct  402   LCKAGSLDRKKAKGKILVCLRGVNARVDKGQQAARAGAVGMVLVNDKDSGNEILADVHIL  461

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ Y++G+AI +YIN T+ P+AH+T P T +G KPAP +AAFSSRGPN I P+ILKP
Sbjct  462   PASHLNYTNGVAILNYINSTKYPIAHVTRPETHIGTKPAPFMAAFSSRGPNTITPEILKP  521

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+VGLLK L+P+WSP
Sbjct  522   DITAPGVSIIAAYTQAAGPTNEDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKILHPTWSP  581

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I  + T  KA PF+YGAGHI PN A +PGLVYDL   DY+
Sbjct  582   AAIKSAIMTTAMTRDNNREPIL-NATYSKANPFSYGAGHIRPNQAMEPGLVYDLTANDYL  640

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSP-  312
             NF+CA GYN+T+I +    PYKCP+  ++L+ FNYPSITVP  KG+ TVTR +KNVGSP 
Sbjct  641   NFLCALGYNETQILSFSQAPYKCPNKLVNLANFNYPSITVPKFKGSITVTRRVKNVGSPS  700

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TY  S+R P G SV+V P+IL F ++GEE++FKVTLK K   A  +Y FG LTWSD  H
Sbjct  701   STYKVSIRKPTGISVSVEPEILNFREIGEEKTFKVTLKGKKFKARKEYVFGELTWSDSIH  760

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  761   RVRSPIVVK  769



>ref|XP_009611073.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=772

 Score =   491 bits (1264),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 283/368 (77%), Gaps = 1/368 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G LDP+K KG +LVCLRG  AR DK  QAALAGAVGMILAND  SGNEIIAD H L
Sbjct  405   LCKAGALDPKKVKGTILVCLRGDNARVDKGQQAALAGAVGMILANDYASGNEIIADPHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT ++Y+DGL +F Y+N TR P A ITHP T LG KPAPV+AAFSS GPN + P+ILKP
Sbjct  465   PATQISYTDGLELFAYLNSTRAPTASITHPTTQLGTKPAPVMAAFSSIGPNTVTPEILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAA+T A GP++ D+DKR V FN  SGTSMSCPH++GVVGLLKTL+P+WSP
Sbjct  525   DITAPGVSIIAAYTGAEGPTNQDFDKRRVKFNSVSGTSMSCPHISGVVGLLKTLHPTWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  R N+ + +  + + +K +PFAYGAGH+ PN A DPGLVYDL + DY+
Sbjct  585   SAIKSAIMTTARTRDNAIEPML-NASHIKTSPFAYGAGHVWPNRAMDPGLVYDLTMDDYL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+C QGYN+T+I      P+KCP+ ++    N PSITVP+L GT T+TRTLKNVGSPAT
Sbjct  644   SFLCGQGYNETQIKTFTQGPFKCPEPVNFIDMNLPSITVPNLNGTVTITRTLKNVGSPAT  703

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A +R P+G S  V P  L+F+ +GEE+SFK+TLK KG     DY FG L WSD KH V
Sbjct  704   YKARIRRPIGISAAVEPNSLEFKNIGEEKSFKITLKVKGSKGPKDYVFGQLIWSDSKHYV  763

Query  125   RSPIVVKA  102
             RSPIVVK+
Sbjct  764   RSPIVVKS  771



>ref|XP_009759676.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=623

 Score =   486 bits (1251),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 281/368 (76%), Gaps = 1/368 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G LDP+K KG +LVCLRG  AR DK  QAALAGAVGM+LAND  SGNEIIAD H L
Sbjct  256   LCKAGALDPKKVKGTILVCLRGDNARVDKGQQAALAGAVGMVLANDYASGNEIIADPHVL  315

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT ++Y+DGL +F Y+N TR P A ITHP T LG KPAPV+AAFSS GPN + P+ LKP
Sbjct  316   PATQISYTDGLELFAYVNSTRTPTASITHPKTQLGTKPAPVMAAFSSIGPNTVTPEFLKP  375

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTLYP+WSP
Sbjct  376   DITAPGVSVIAAYTGAEGPTNQDFDKRRVKFNSVSGTSMSCPHVSGIVGLLKTLYPTWSP  435

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  R N+ + +  + + +K +PFAYGAGH+ PN A DPGLVYDL + DY+
Sbjct  436   SAIKSAIMTTARTRDNAIEPML-NASYIKTSPFAYGAGHVRPNRAMDPGLVYDLTIDDYL  494

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CAQGYN+T+I      P+KCP+ I+    N PSITVP+L G+ TVTRTLKNVGSP T
Sbjct  495   SFLCAQGYNETQIKTFTQGPFKCPEPINFINMNLPSITVPNLNGSVTVTRTLKNVGSPGT  554

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A +R P+G S  V P  L+F+ +GE++SFK+TLK KG     DY FG L WS  KH V
Sbjct  555   YKACIRRPIGISAVVEPNSLEFKNIGEKKSFKLTLKVKGSKGPKDYVFGQLIWSYGKHYV  614

Query  125   RSPIVVKA  102
             RSPIVVK+
Sbjct  615   RSPIVVKS  622



>ref|XP_010045213.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW88581.1| hypothetical protein EUGRSUZ_A00959 [Eucalyptus grandis]
Length=769

 Score =   488 bits (1257),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 290/386 (75%), Gaps = 1/386 (0%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     L+ +    +LLC+ GTLDP K K K+LVCLRG  AR DK  QA LAGAVGM+
Sbjct  383   LISAADARLSHVSADEALLCQNGTLDPRKVKEKILVCLRGENARVDKGEQAFLAGAVGMV  442

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN+  SGNEI+AD HFLPA+HV Y+DG AIF YIN T+ P A IT   T LGVKP+P +
Sbjct  443   LANNILSGNEIVADPHFLPASHVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFM  502

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GPN I P+ILKPDI+APG++VIAA+TEA GP++ D D+R V FN  SGTSMSCP
Sbjct  503   AAFSSKGPNTITPEILKPDITAPGLSVIAAYTEAVGPTNEDIDQRRVPFNAVSGTSMSCP  562

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+GV GLLKTL+P WSPA IRSAIMT+AT+R N+ ++I  + +  KATPF+YGAGHI P
Sbjct  563   HVSGVAGLLKTLHPEWSPAVIRSAIMTSATIRDNAMESII-NASYYKATPFSYGAGHIQP  621

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  360
             N A DPGLVYDL + DY+NF+C+ GYN T+I+      Y C   I L  FNYPSITVP L
Sbjct  622   NRAMDPGLVYDLGIKDYLNFLCSLGYNATQISMFSDGAYNCSKRIGLLDFNYPSITVPKL  681

Query  359   KGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA  180
              G+ TVTRT+KNVG P TY ASV  P G SV V P  LKF+K+ EE+SFKV LKAKG NA
Sbjct  682   PGSITVTRTVKNVGLPGTYKASVLEPNGVSVHVKPAHLKFKKINEEKSFKVVLKAKGANA  741

Query  179   TADYAFGVLTWSDKKHRVRSPIVVKA  102
             T DY+FG L WSD +H VRSPIVVKA
Sbjct  742   TGDYSFGELIWSDTEHHVRSPIVVKA  767



>gb|KEH35215.1| subtilisin-like serine protease [Medicago truncatula]
Length=634

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 292/378 (77%), Gaps = 1/378 (0%)
 Frame = -3

Query  1235  LTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSG  1056
             L +  N  ++LC+ GTLDP+K KGK+++CLRG+ AR DK  QA LAGAVGM+LAND+ +G
Sbjct  257   LASATNEDAVLCQNGTLDPKKVKGKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTG  316

Query  1055  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  876
             NEIIAD H LPA+H+ +SDG+ +F Y+N +++PVA+ITHP T L  KPAP +AAFSS+GP
Sbjct  317   NEIIADPHVLPASHINFSDGVEVFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGP  376

Query  875   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  696
             N I P+ILKPDI+APGV+VIAA+TEA GP++ ++D R + FN  SGTSMSCPH++G+VGL
Sbjct  377   NTIIPEILKPDITAPGVSVIAAYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGL  436

Query  695   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGL  516
             L++LYPSW+PA I+SAIMTTAT   N  + I  + T+ +ATPF+YGAGH+ PN A DPGL
Sbjct  437   LRSLYPSWTPAAIKSAIMTTATTLDNKAEPIM-NATKSQATPFSYGAGHVQPNSAMDPGL  495

Query  515   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTR  336
             VYD+   DY NF+CA GYN+T+++     PYKC  + S+   NYPSITVP+L G+ TVTR
Sbjct  496   VYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKNFSILNLNYPSITVPNLSGSVTVTR  555

Query  335   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  156
             TLKNVG+P TY   V+SP G +++V P IL+F+KVGEE+ F+V LK K   AT  Y FG 
Sbjct  556   TLKNVGAPGTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGK  615

Query  155   LTWSDKKHRVRSPIVVKA  102
             + WSD KH V+SP+VVKA
Sbjct  616   MIWSDGKHYVKSPLVVKA  633



>emb|CDP06146.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   488 bits (1255),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 238/369 (64%), Positives = 285/369 (77%), Gaps = 1/369 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK GTLD  KAKGK+LVCLRG  AR DK  QAA  GAVGM+L ND+ SGNEIIAD H L
Sbjct  401   LCKAGTLDHSKAKGKILVCLRGDNARVDKGQQAAAVGAVGMVLTNDKLSGNEIIADPHVL  460

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ Y+DGLA+F YI  +R+P A+ITHP T LG KPAP +AAFSS+GPN + P++LKP
Sbjct  461   PASHINYTDGLAVFSYIYSSRSPKAYITHPTTELGTKPAPFMAAFSSKGPNTLTPELLKP  520

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAAFTEA GP+   +DKR V FN ESGTSMSCPHV+G+VGLLKTL+P WSP
Sbjct  521   DITAPGVSVIAAFTEAQGPTSEGFDKRRVLFNSESGTSMSCPHVSGIVGLLKTLHPDWSP  580

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMT+A  R N+ + I  + + +KA+PF+YGAGHI PN AADPGLVYDL   DY+
Sbjct  581   AAIRSAIMTSARSRDNAFEPII-NASYVKASPFSYGAGHIWPNRAADPGLVYDLTANDYL  639

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
              F+C+ GYN+++I      P KCP  ISL   NYPSITVP L+G+ TVTRTLKNVG+PAT
Sbjct  640   TFLCSLGYNESQIALFTQVPKKCPKPISLLDLNYPSITVPKLRGSITVTRTLKNVGAPAT  699

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YTA + SP G SV + PK L F ++GEE+SFK+TL+ K   A  DY FG L WSD KH V
Sbjct  700   YTAKIVSPPGVSVDIQPKSLTFARIGEEKSFKLTLQLKKPGAARDYVFGRLAWSDGKHFV  759

Query  125   RSPIVVKAA  99
             RSPIVVKA+
Sbjct  760   RSPIVVKAS  768



>gb|KEH35216.1| subtilisin-like serine protease [Medicago truncatula]
Length=649

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 292/378 (77%), Gaps = 1/378 (0%)
 Frame = -3

Query  1235  LTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSG  1056
             L +  N  ++LC+ GTLDP+K KGK+++CLRG+ AR DK  QA LAGAVGM+LAND+ +G
Sbjct  272   LASATNEDAVLCQNGTLDPKKVKGKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTG  331

Query  1055  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  876
             NEIIAD H LPA+H+ +SDG+ +F Y+N +++PVA+ITHP T L  KPAP +AAFSS+GP
Sbjct  332   NEIIADPHVLPASHINFSDGVEVFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGP  391

Query  875   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  696
             N I P+ILKPDI+APGV+VIAA+TEA GP++ ++D R + FN  SGTSMSCPH++G+VGL
Sbjct  392   NTIIPEILKPDITAPGVSVIAAYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGL  451

Query  695   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGL  516
             L++LYPSW+PA I+SAIMTTAT   N  + I  + T+ +ATPF+YGAGH+ PN A DPGL
Sbjct  452   LRSLYPSWTPAAIKSAIMTTATTLDNKAEPIM-NATKSQATPFSYGAGHVQPNSAMDPGL  510

Query  515   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTR  336
             VYD+   DY NF+CA GYN+T+++     PYKC  + S+   NYPSITVP+L G+ TVTR
Sbjct  511   VYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKNFSILNLNYPSITVPNLSGSVTVTR  570

Query  335   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  156
             TLKNVG+P TY   V+SP G +++V P IL+F+KVGEE+ F+V LK K   AT  Y FG 
Sbjct  571   TLKNVGAPGTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGK  630

Query  155   LTWSDKKHRVRSPIVVKA  102
             + WSD KH V+SP+VVKA
Sbjct  631   MIWSDGKHYVKSPLVVKA  648



>ref|XP_002269456.2| PREDICTED: subtilisin-like protease SBT5.4, partial [Vitis vinifera]
Length=575

 Score =   480 bits (1235),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 231/372 (62%), Positives = 277/372 (74%), Gaps = 1/372 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S+LC  GTLDPEK KGK+LVCLRGVT R +K  QAA  GAVGMIL NDE  GN ++AD H
Sbjct  205   SVLCLEGTLDPEKVKGKILVCLRGVTDRVEKGLQAARVGAVGMILCNDEYDGNSLVADPH  264

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
             FLPATH+ Y+DGLA+  YIN T+NP   IT P   +  KPAPV+AAFSSRGPN + P+IL
Sbjct  265   FLPATHINYTDGLAVLAYINSTKNPQGLITPPKGKIHTKPAPVMAAFSSRGPNTVTPEIL  324

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV++IAAFTEA  P++ D+D+R + F   SGTSMSCPHVAGV GLLKT++P W
Sbjct  325   KPDITAPGVDIIAAFTEAQSPTEQDFDERRLPFYSLSGTSMSCPHVAGVAGLLKTIHPHW  384

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP+ I+SAIMTTA+   N+ K+   D +  KATP AYGAGH+ PN AADPGLVYDL + D
Sbjct  385   SPSAIKSAIMTTASTSDNT-KSPMKDSSSDKATPLAYGAGHMQPNQAADPGLVYDLTVND  443

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y++F+CA GYN+T + A    PYKCP  +SL  FNYPSITVP+L G+ T+TR +KNVG P
Sbjct  444   YLDFLCALGYNQTMLKAFSDNPYKCPASVSLLDFNYPSITVPNLSGSVTLTRRVKNVGFP  503

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
               Y A +  P G SVTV P ILKF ++GEE+ FKVTLKA       DY FG L W+D KH
Sbjct  504   GIYAAHISQPTGVSVTVEPSILKFSRIGEEKKFKVTLKANTNGEAKDYVFGQLIWTDDKH  563

Query  131   RVRSPIVVKAAA  96
              VRSPIVV AAA
Sbjct  564   HVRSPIVVAAAA  575



>ref|XP_009759675.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Nicotiana 
sylvestris]
Length=772

 Score =   486 bits (1251),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 281/368 (76%), Gaps = 1/368 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G LDP+K KG +LVCLRG  AR DK  QAALAGAVGM+LAND  SGNEIIAD H L
Sbjct  405   LCKAGALDPKKVKGTILVCLRGDNARVDKGQQAALAGAVGMVLANDYASGNEIIADPHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT ++Y+DGL +F Y+N TR P A ITHP T LG KPAPV+AAFSS GPN + P+ LKP
Sbjct  465   PATQISYTDGLELFAYVNSTRTPTASITHPKTQLGTKPAPVMAAFSSIGPNTVTPEFLKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTLYP+WSP
Sbjct  525   DITAPGVSVIAAYTGAEGPTNQDFDKRRVKFNSVSGTSMSCPHVSGIVGLLKTLYPTWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  R N+ + +  + + +K +PFAYGAGH+ PN A DPGLVYDL + DY+
Sbjct  585   SAIKSAIMTTARTRDNAIEPML-NASYIKTSPFAYGAGHVRPNRAMDPGLVYDLTIDDYL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CAQGYN+T+I      P+KCP+ I+    N PSITVP+L G+ TVTRTLKNVGSP T
Sbjct  644   SFLCAQGYNETQIKTFTQGPFKCPEPINFINMNLPSITVPNLNGSVTVTRTLKNVGSPGT  703

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A +R P+G S  V P  L+F+ +GE++SFK+TLK KG     DY FG L WS  KH V
Sbjct  704   YKACIRRPIGISAVVEPNSLEFKNIGEKKSFKLTLKVKGSKGPKDYVFGQLIWSYGKHYV  763

Query  125   RSPIVVKA  102
             RSPIVVK+
Sbjct  764   RSPIVVKS  771



>ref|NP_001267495.1| SUB1 homolog precursor [Glycine max]
 gb|AAQ23176.1| subtilisin-like protease [Glycine max]
 gb|AFV08660.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   486 bits (1250),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 234/370 (63%), Positives = 288/370 (78%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC+ GTLDP KAKGK++VCLRG+ AR DK  QA LAGAVGM+LAND+ +GNEIIAD H
Sbjct  400   AVLCQNGTLDPNKAKGKIVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG A+F+YIN T+ PVA+ITHP T L  KPAP +AAFSS+GPN + P+IL
Sbjct  460   VLPASHINFTDGSAVFNYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTMVPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPHV+G+VGLL+ LYP+W
Sbjct  520   KPDITAPGVSVIAAYTEAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             S A I+SAIMTTAT   N  + +  + T  KATPF+YGAGH+ PN A DPGLVYD+ + D
Sbjct  580   STAAIKSAIMTTATTLDNEVEPLL-NATDGKATPFSYGAGHVQPNRAMDPGLVYDITIDD  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+CA GYN+T+I+     PYKC    SL   NYPSITVP L G+ TVTRTLKNVGSP
Sbjct  639   YLNFLCALGYNETQISVFTEGPYKCRKKFSLLNLNYPSITVPKLSGSVTVTRTLKNVGSP  698

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++P G +V+V P ILKF+ VGEE+SFK+T KA    AT +YAFG L WSD KH
Sbjct  699   GTYIAHVQNPYGITVSVKPSILKFKNVGEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKH  758

Query  131   RVRSPIVVKA  102
              V SPIVVKA
Sbjct  759   YVTSPIVVKA  768



>ref|XP_003601486.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES71737.1| subtilisin-like serine protease [Medicago truncatula]
Length=772

 Score =   484 bits (1245),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 292/378 (77%), Gaps = 1/378 (0%)
 Frame = -3

Query  1235  LTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSG  1056
             L +  N  ++LC+ GTLDP+K KGK+++CLRG+ AR DK  QA LAGAVGM+LAND+ +G
Sbjct  395   LASATNEDAVLCQNGTLDPKKVKGKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTG  454

Query  1055  NEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGP  876
             NEIIAD H LPA+H+ +SDG+ +F Y+N +++PVA+ITHP T L  KPAP +AAFSS+GP
Sbjct  455   NEIIADPHVLPASHINFSDGVEVFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGP  514

Query  875   NAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGL  696
             N I P+ILKPDI+APGV+VIAA+TEA GP++ ++D R + FN  SGTSMSCPH++G+VGL
Sbjct  515   NTIIPEILKPDITAPGVSVIAAYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGL  574

Query  695   LKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGL  516
             L++LYPSW+PA I+SAIMTTAT   N  + I  + T+ +ATPF+YGAGH+ PN A DPGL
Sbjct  575   LRSLYPSWTPAAIKSAIMTTATTLDNKAEPIM-NATKSQATPFSYGAGHVQPNSAMDPGL  633

Query  515   VYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTR  336
             VYD+   DY NF+CA GYN+T+++     PYKC  + S+   NYPSITVP+L G+ TVTR
Sbjct  634   VYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKNFSILNLNYPSITVPNLSGSVTVTR  693

Query  335   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGV  156
             TLKNVG+P TY   V+SP G +++V P IL+F+KVGEE+ F+V LK K   AT  Y FG 
Sbjct  694   TLKNVGAPGTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGK  753

Query  155   LTWSDKKHRVRSPIVVKA  102
             + WSD KH V+SP+VVKA
Sbjct  754   MIWSDGKHYVKSPLVVKA  771



>gb|AFV08661.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   483 bits (1244),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 233/370 (63%), Positives = 287/370 (78%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC+ GTLDP KAKGK++VCLRG+ AR DK  QA LAGAVGM+LAND+ +GNEIIAD H
Sbjct  400   AVLCQNGTLDPNKAKGKIVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG A+F+YIN T+ PVA+ITHP T L  KPAP +AAFSS+GPN + P+IL
Sbjct  460   VLPASHINFTDGSAVFNYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTMVPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPHV+G+VGLL+ LYP+W
Sbjct  520   KPDITAPGVSVIAAYTEAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             S A I+SAIMTTAT   N  + +  + T  KATPF+YGAGH+ PN A DPGLVYD+ + D
Sbjct  580   STAAIKSAIMTTATTLDNEVEPLL-NATDGKATPFSYGAGHVQPNRAMDPGLVYDITIDD  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+CA GYN+T+I+     PYKC    SL   NYP ITVP L G+ TVTRTLKNVGSP
Sbjct  639   YLNFLCALGYNETQISVFTEGPYKCRKKFSLLNLNYPLITVPKLSGSVTVTRTLKNVGSP  698

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++P G +V+V P ILKF+ VGEE+SFK+T KA    AT +YAFG L WSD KH
Sbjct  699   GTYIAHVQNPYGITVSVKPSILKFKNVGEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKH  758

Query  131   RVRSPIVVKA  102
              V SPIVVKA
Sbjct  759   YVTSPIVVKA  768



>ref|XP_006469398.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=642

 Score =   478 bits (1230),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 294/389 (76%), Gaps = 3/389 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS             +LLC+ GTLDP+K KGK+LVCLRG  AR DK  QA LAGAVGM+
Sbjct  255   LISAADAKAANASTEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMV  314

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN  ++GNE++AD H LPA+HV Y+DG  +F Y+N T+ PV ++T   T LG+KPAP++
Sbjct  315   LANALENGNELLADPHLLPASHVNYTDGADLFRYVNSTKRPVGYLTRATTELGLKPAPIM  374

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GP++I P+ILKPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCP
Sbjct  375   AAFSSKGPSSIAPEILKPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCP  434

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+G+VGLLKTL+P WSPA I+SAIMTTA+++ N+   I  + +  KATPF+YGAGHI P
Sbjct  435   HVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQP  493

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  360
             N A DPGLVYDL   DY+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L
Sbjct  494   NLAMDPGLVYDLTENDYLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKL  553

Query  359   KGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGEN  183
              G+  V+RT++NVGSP TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   
Sbjct  554   SGSIIVSRTVRNVGSPGTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRA  613

Query  182   ATADYAFGVLTWS-DKKHRVRSPIVVKAA  99
             AT DY FG L W+ DK+H+VRSPIVV  A
Sbjct  614   ATKDYVFGDLVWADDKQHQVRSPIVVNPA  642



>ref|XP_002299062.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
 gb|EEE83867.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
Length=772

 Score =   483 bits (1242),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 279/369 (76%), Gaps = 1/369 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCKPG LDP+K KGK+LVCLRG   R DK HQA LAGAVGMILANDE+SGNEIIAD H
Sbjct  403   ALLCKPGALDPKKVKGKILVCLRGENGRVDKGHQALLAGAVGMILANDENSGNEIIADTH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA HV ++DG A+F Y+N T+ P+A +T+  T L  KPAP +A+FSSRGPN I   IL
Sbjct  463   VLPAAHVNFTDGEAVFSYLNFTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESIL  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAAFT+A GPSD +YDKR   +N +SGTSMSCPHV+G+VGLLKTL+P W
Sbjct  523   KPDITAPGVSVIAAFTQAIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIVGLLKTLHPEW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTTAT R N+G+ I  D T  KATPFA GAGH+ PN AADPGL+YDL + D
Sbjct  583   SPAAIRSAIMTTATTRDNNGEPIM-DSTNTKATPFADGAGHVQPNHAADPGLIYDLTVND  641

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             ++NF+C +G  K  I      PY CP   SL+ FNYPSITV +L  + TVTR +KNVGSP
Sbjct  642   FLNFLCNRGNTKKNIKLFSDKPYTCPKSFSLADFNYPSITVTNLNDSITVTRRVKNVGSP  701

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY   +R+P G +V+V P IL+F+K+GEE+ FKVT K   +    DY FG+LTW D KH
Sbjct  702   GTYNIHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKLAPKAVLTDYVFGMLTWGDGKH  761

Query  131   RVRSPIVVK  105
              VRSP+VV+
Sbjct  762   FVRSPLVVR  770



>ref|XP_007213363.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
 gb|EMJ14562.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
Length=740

 Score =   481 bits (1238),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 233/370 (63%), Positives = 279/370 (75%), Gaps = 2/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC  GTLDP+K KGK+L CLRG TAR DK  QAALAGAVGMIL ND+ SGNEIIAD H
Sbjct  371   AMLCIGGTLDPQKVKGKILACLRGDTARIDKGEQAALAGAVGMILCNDKASGNEIIADPH  430

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y+DG+A+  YIN T +P   IT P   L  KPAP +A+FSS+GPN I P+IL
Sbjct  431   VLPASQINYTDGIAVVSYINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEIL  490

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA+T+AT P++  +DKR ++FN ESGTSMSCPHV+GVVGLLKTLYP W
Sbjct  491   KPDITAPGVNIIAAYTQATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDW  550

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP+ IRSAIMTTA  R N+   +  + + ++ATPF+YGAGHI PN A DPGL+YDL + D
Sbjct  551   SPSAIRSAIMTTARTRDNTANPM-KNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVND  609

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYNKT +     +P YKCP   SL  FNYPSI VP L G+ TVTR +KNVGS
Sbjct  610   YLDFLCAIGYNKTMMQLFSESPNYKCPKSASLLDFNYPSIVVPELSGSVTVTRRVKNVGS  669

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY      P+G SVTV P ILKF+ +GEE+SFKVTLKAKG   T DY FG L WSD K
Sbjct  670   PGTYAVRAHKPLGVSVTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKDYVFGGLIWSDGK  729

Query  134   HRVRSPIVVK  105
             H VRSPIV K
Sbjct  730   HYVRSPIVFK  739



>ref|XP_004294696.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=771

 Score =   482 bits (1240),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 233/372 (63%), Positives = 284/372 (76%), Gaps = 2/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLDPEK KGK+L CLRG  AR DK  Q+ LAGAVGMILANDE +GNEII+D H
Sbjct  401   ALLCKAGTLDPEKVKGKILACLRGDNARVDKGEQSLLAGAVGMILANDEVNGNEIISDPH  460

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA H+ ++DG  +F YIN+T +P A+I  P T+LG KPAP +AAFSS+GPN+I PDIL
Sbjct  461   VLPAAHINFTDGALVFAYINETTSPRAYIKRPTTMLGTKPAPFMAAFSSKGPNSITPDIL  520

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA++EA GP++ ++D+R + FN  SGTSMSCPH++G+VGLLKTLYP W
Sbjct  521   KPDITAPGVSVIAAYSEAQGPTNQEFDRRRIPFNSVSGTSMSCPHISGIVGLLKTLYPHW  580

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA  + N+ + +  + +  +ATPF+YGAGH+ PN A DPGLVYDL   D
Sbjct  581   SPAAIKSAIMTTAKTQDNNREPLL-NASNSEATPFSYGAGHVKPNSAMDPGLVYDLDTDD  639

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+N +CA GYNKT+I       YKCP   ISL+  NYPSITVP L G+  V RTLKNVG 
Sbjct  640   YLNVLCALGYNKTQIETFSQESYKCPSPAISLTNLNYPSITVPKLSGSLVVKRTLKNVGE  699

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TYTA + +P G  V+V PK LKF+KVGEE+SF V L+AK  NA  +Y FG L WSD K
Sbjct  700   PGTYTARITNPDGILVSVEPKSLKFKKVGEEKSFNVVLEAKDSNAAKNYVFGKLIWSDGK  759

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVKAA
Sbjct  760   HNVRSPIVVKAA  771



>gb|KCW75459.1| hypothetical protein EUGRSUZ_E04225 [Eucalyptus grandis]
Length=751

 Score =   481 bits (1238),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 276/368 (75%), Gaps = 0/368 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S+LCKPGTLDP+K KGK++VCLRG TAR DK  Q+  AGAVGMIL ND  SGNEIIAD H
Sbjct  381   SMLCKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVGMILCNDVLSGNEIIADPH  440

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ +TY DGL +F YIN T NPV  IT P   L  KPAP +AAFSSRGPN + P+IL
Sbjct  441   LLPASQLTYKDGLQVFAYINSTANPVGFITAPTAKLNTKPAPFMAAFSSRGPNLVTPEIL  500

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAAF+EA  P+D D+D R V FN ESGTSMSCPHVAGVVGLL+ L+P W
Sbjct  501   KPDVTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSMSCPHVAGVVGLLRALHPDW  560

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             S + IRSAIMTTA  R N+ +A+ D  + L+ATPF +G+GH+ PN A DPGLVYDL   +
Sbjct  561   SVSAIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGHMRPNRAMDPGLVYDLSTDN  620

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y +F+CA GYN+T + +    PY+CP   SL  FNYPSI VP+L G+ATVTR +KNVGSP
Sbjct  621   YFDFLCALGYNRTLMRSFSKDPYECPKSFSLLDFNYPSIMVPNLHGSATVTRRVKNVGSP  680

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V  P G SV+V P+ L F++VGEE+SFKVTLKAK      +Y FG L WSD +H
Sbjct  681   GTYAAQVIEPPGISVSVEPRTLTFDRVGEEKSFKVTLKAKSARHATEYVFGGLRWSDGRH  740

Query  131   RVRSPIVV  108
              VRSPIVV
Sbjct  741   YVRSPIVV  748



>ref|XP_010059708.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=781

 Score =   481 bits (1237),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 276/368 (75%), Gaps = 0/368 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S+LCKPGTLDP+K KGK++VCLRG TAR DK  Q+  AGAVGMIL ND  SGNEIIAD H
Sbjct  411   SMLCKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVGMILCNDVLSGNEIIADPH  470

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ +TY DGL +F YIN T NPV  IT P   L  KPAP +AAFSSRGPN + P+IL
Sbjct  471   LLPASQLTYKDGLQVFAYINSTANPVGFITAPTAKLNTKPAPFMAAFSSRGPNLVTPEIL  530

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAAF+EA  P+D D+D R V FN ESGTSMSCPHVAGVVGLL+ L+P W
Sbjct  531   KPDVTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSMSCPHVAGVVGLLRALHPDW  590

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             S + IRSAIMTTA  R N+ +A+ D  + L+ATPF +G+GH+ PN A DPGLVYDL   +
Sbjct  591   SVSAIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGHMRPNRAMDPGLVYDLSTDN  650

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y +F+CA GYN+T + +    PY+CP   SL  FNYPSI VP+L G+ATVTR +KNVGSP
Sbjct  651   YFDFLCALGYNRTLMRSFSKDPYECPKSFSLLDFNYPSIMVPNLHGSATVTRRVKNVGSP  710

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V  P G SV+V P+ L F++VGEE+SFKVTLKAK      +Y FG L WSD +H
Sbjct  711   GTYAAQVIEPPGISVSVEPRTLTFDRVGEEKSFKVTLKAKSARHATEYVFGGLRWSDGRH  770

Query  131   RVRSPIVV  108
              VRSPIVV
Sbjct  771   YVRSPIVV  778



>ref|XP_003524185.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   480 bits (1236),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 232/370 (63%), Positives = 283/370 (76%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC+ GTLDP K KGK++VCLRG+ AR DK  QA LAGAVGM+LAND+ +GNEIIAD H
Sbjct  400   AVLCQNGTLDPNKVKGKIVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG A+F YIN T+ PVA+ITHP T L  KPAP +AAFSS+GPN I P+IL
Sbjct  460   VLPASHINFTDGSAVFTYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTIVPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPHV+G+VGLL+ LYP+W
Sbjct  520   KPDITAPGVSVIAAYTEAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT   N  + +  + T  KATPF+YGAGH+ PN A DPGLVYD  + D
Sbjct  580   SPAAIKSAIMTTATTLDNEVEPLL-NATDGKATPFSYGAGHVQPNRAMDPGLVYDTTIDD  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+CA GYN T+I+     PY+C    SL   NYPSITVP L G+ TVTR LKNVGSP
Sbjct  639   YLNFLCALGYNATQISVFTEGPYQCRKKFSLLNLNYPSITVPKLSGSVTVTRRLKNVGSP  698

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++P G +++V P ILKF+ VGEE+SFKVT KA    AT +Y FG L WSD KH
Sbjct  699   GTYIAHVQNPHGITISVKPSILKFKNVGEEKSFKVTFKAMQGKATNNYVFGKLIWSDGKH  758

Query  131   RVRSPIVVKA  102
              V SPIVVKA
Sbjct  759   YVTSPIVVKA  768



>ref|XP_008384293.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=775

 Score =   480 bits (1236),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 233/376 (62%), Positives = 285/376 (76%), Gaps = 5/376 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC  G+LDP+K KGK+L CLRG++AR DK  QA+LAGA GMIL NDE SGNE+IAD H
Sbjct  399   AMLCLGGSLDPKKVKGKILACLRGLSARVDKGQQASLAGAAGMILCNDEASGNELIADPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y+DG+A+F+YIN T +P+  IT P   L  KPAP +A+FSS+GPN I P+IL
Sbjct  459   VLPASQINYTDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA+T+AT P+D D+DKR V FN ESGTSMSCPHV+GVVGLLKTLYP W
Sbjct  519   KPDITAPGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHW  578

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP+ IRSAIMTTA  R N+   +    + ++ATPF+YG+GHI PN A DPGL+YDL   D
Sbjct  579   SPSAIRSAIMTTARTRDNTXNPMM-SASFVEATPFSYGSGHIRPNRAMDPGLIYDLTAND  637

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYNKT I      P YKCP+  SL  FNYPSI+VP L G+ TVTR LKNVGS
Sbjct  638   YLDFLCAIGYNKTTIQLFSEGPNYKCPESASLLDFNYPSISVPRLSGSVTVTRRLKNVGS  697

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK---GENATADYAFGVLTWS  144
             P TY   ++   G SV+V P +L+F+ VGEE+SF+VTLKAK   G  A  DY FG LTWS
Sbjct  698   PGTYAVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAKGDYVFGGLTWS  757

Query  143   DKKHRVRSPIVVKAAA  96
             D KH VRSPIVV +AA
Sbjct  758   DGKHYVRSPIVVASAA  773



>gb|EYU34388.1| hypothetical protein MIMGU_mgv1a001745mg [Erythranthe guttata]
Length=765

 Score =   479 bits (1233),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/371 (64%), Positives = 283/371 (76%), Gaps = 4/371 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +K KGK+LVCLRG  AR DK  QAAL GAVGM+LAN++ SGNEI+AD H
Sbjct  395   ALLCKAGTLDAKKVKGKILVCLRGDNARVDKGEQAALCGAVGMVLANNQISGNEILADPH  454

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y+DGLA+F YIN TR+P+A+IT   T LG KPAP +AAFSS GPN +NP+IL
Sbjct  455   VLPASHINYTDGLALFSYINSTRSPIAYITKGTTELGTKPAPFMAAFSSNGPNTLNPEIL  514

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++ D+D R V FN  SGTSMSCPHV+GVVGLLKTL+P W
Sbjct  515   KPDITAPGVSVIAAYTEAQGPTNQDFDTRRVLFNSVSGTSMSCPHVSGVVGLLKTLHPHW  574

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAI+TTA  R N+ K +T + +  KATPF YG GHI PN A DPGLVYDL   D
Sbjct  575   SPAAIKSAIITTAKTRDNTMKPLT-NASYSKATPFNYGGGHIQPNRAMDPGLVYDLSAND  633

Query  491   YVNFICAQGYNKTEITAVLGTP--YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             Y++F+CA GYN T+I         YKC D ISL  FNYPSITVP LKGT TV+R +KNVG
Sbjct  634   YLDFLCALGYNATQIQQFSNESQTYKCRDPISLIDFNYPSITVPSLKGTVTVSRKVKNVG  693

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             +P TY A VRSP G SV V P  L+FE+ GEE+ ++VTL AK ++   DY FG LTWSD 
Sbjct  694   TPGTYKARVRSPRGISVRVEPNSLRFEREGEEKGYRVTLMAK-KSGVRDYVFGQLTWSDG  752

Query  137   KHRVRSPIVVK  105
             +H VRS IVVK
Sbjct  753   RHYVRSSIVVK  763



>ref|XP_007217687.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
 gb|EMJ18886.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
Length=773

 Score =   479 bits (1232),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 230/372 (62%), Positives = 284/372 (76%), Gaps = 2/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +K KGK+L CLRG +AR DK  QA LAGAVGMILANDE SGNE+I+D H
Sbjct  403   ALLCKAGTLDLKKVKGKILACLRGESARVDKGEQALLAGAVGMILANDELSGNEVISDPH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG  +F YIN T++P A+I  P T LG KPAP +AAFSS+GPN I PDIL
Sbjct  463   VLPASHINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAAFSSKGPNTITPDIL  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA+TEA GP++  +D+R V FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  523   KPDITAPGVNIIAAYTEAQGPTNQMFDERRVLFNSVSGTSMSCPHISGICGLLKTLYPHW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + NS + +  + +  +ATPF+YGAGH+NPN A DPGLVYDL L D
Sbjct  583   SPAAIKSAIMTTATTQDNSREPVL-NASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLND  641

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+C+ GYNK +I  V    YKCP   IS +  NYPSITVP L G+  VTRT+KNVG+
Sbjct  642   YLNFLCSNGYNKRQIEMVSEETYKCPKPAISRTNLNYPSITVPKLNGSLVVTRTVKNVGT  701

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A +++P G SV+V P  L+F+K+GEE+SFK+ L+ K   A  +Y FG L WSD K
Sbjct  702   PGTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGK  761

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVK A
Sbjct  762   HYVRSPIVVKVA  773



>ref|XP_009374900.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Pyrus x bretschneideri]
Length=775

 Score =   478 bits (1231),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 231/375 (62%), Positives = 285/375 (76%), Gaps = 5/375 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             +LC  G+LDP+K KGK+L CLRG++AR DK  QA+LAGAVGMIL NDE SGNE+IAD H 
Sbjct  400   MLCLGGSLDPKKVKGKILACLRGLSARVDKGQQASLAGAVGMILCNDEASGNELIADPHV  459

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+ + Y+DG+A+F+YIN T +P+  IT P   L  KPAP +A+FSS+GPN I P+ILK
Sbjct  460   LPASQINYTDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEILK  519

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PD++APGVN+IAA+T+AT P+D D+DKR V FN ESGTSMSCPHV+GVVGLLKTLYP WS
Sbjct  520   PDVTAPGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHWS  579

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             P+ IRSAIMTTA  R N+   +  + + ++ATPF+YG+GHI PN A DPGL+YDL   DY
Sbjct  580   PSAIRSAIMTTARTRDNTVNPMM-NASFVEATPFSYGSGHIRPNRAMDPGLIYDLTANDY  638

Query  488   VNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             ++F+CA GYNKT I      P YKCP+  SL  FNYPSI+VP L G+ TVTR LKNVG+P
Sbjct  639   LDFLCAIGYNKTTIQLFSEGPNYKCPESASLLDFNYPSISVPRLSGSVTVTRRLKNVGAP  698

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK---GENATADYAFGVLTWSD  141
              TY   ++   G SV+V P +L+F+ VGEE+SF+VTLKAK   G  A  DY FG LTWSD
Sbjct  699   GTYAVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAKGDYVFGGLTWSD  758

Query  140   KKHRVRSPIVVKAAA  96
              KH VRSP VV +AA
Sbjct  759   GKHYVRSPFVVASAA  773



>ref|XP_011082896.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=769

 Score =   478 bits (1231),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 277/368 (75%), Gaps = 2/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK GTLDP K KGK+LVCLRG  AR DK  QAALAGAVGM+LAN++ SGNEI+AD H L
Sbjct  401   LCKAGTLDPTKVKGKILVCLRGDNARVDKGEQAALAGAVGMVLANNQISGNEILADPHVL  460

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ + Y+DGLA+F YI  TR+PVA+IT   T L  KPAP +AAFSS+GPN I P+ILKP
Sbjct  461   PASQINYTDGLALFSYIKSTRSPVAYITKATTQLHTKPAPFMAAFSSKGPNTITPEILKP  520

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAA+T+A  P++ D+DKR V FN  SGTSMSCPHV+GVVGLLKTL+P+WSP
Sbjct  521   DITAPGVSIIAAYTKAQAPTNQDFDKRRVLFNSVSGTSMSCPHVSGVVGLLKTLHPNWSP  580

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ K +T D + LKATP  YG GH+ PN A DPGLVYDL   DY+
Sbjct  581   AAIKSAIMTTARTRDNTLKPLT-DASYLKATPLNYGGGHVQPNRAMDPGLVYDLGANDYL  639

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CA GYN+T+I      PY CP  I L   NYPSITVP L G+ TVTR +KNVGSP T
Sbjct  640   NFLCALGYNQTQIQLFSEEPYACPQPIRLIDLNYPSITVPGLTGSVTVTRKVKNVGSPGT  699

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGE-NATADYAFGVLTWSDKKHR  129
             Y A VRSP G SV V P  LKFE+ GEE+ F+VTL+ K    A  DY FG L WSD +H 
Sbjct  700   YRARVRSPHGISVHVEPDSLKFERAGEEKRFRVTLQVKKPGGAVKDYVFGQLIWSDGRHY  759

Query  128   VRSPIVVK  105
             VRSPIVVK
Sbjct  760   VRSPIVVK  767



>ref|XP_004243217.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=774

 Score =   478 bits (1230),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 229/367 (62%), Positives = 276/367 (75%), Gaps = 1/367 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G LDP+K KG +LVCLRG  AR DK  QAALAGAV M+LAND  SGNEIIAD H L
Sbjct  407   LCKAGALDPKKVKGTILVCLRGENARVDKGQQAALAGAVAMVLANDYASGNEIIADPHVL  466

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT ++Y+DGL +  Y+N TR P A ITHP T LG KPAPV+AAFSS GPN + P ILKP
Sbjct  467   PATQISYTDGLDVIAYVNSTRAPTAFITHPTTQLGTKPAPVMAAFSSIGPNTVTPQILKP  526

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAAFT A GP++  +DKR V FN  SGTSMSCPHV+G+VGLLKTL+P+WSP
Sbjct  527   DITAPGVSIIAAFTGAQGPTEQAFDKRRVKFNSVSGTSMSCPHVSGIVGLLKTLHPTWSP  586

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  R NS + +  + + +K +PFAYGAGH+ PN A DPGLVYDL + DY+
Sbjct  587   SAIKSAIMTTARTRDNSVEPML-NASYIKTSPFAYGAGHVRPNRAMDPGLVYDLTIDDYL  645

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CAQGYN+T+I       +KCPD I+    N PSITVP+L  + T+TRTLKNVGSP T
Sbjct  646   SFLCAQGYNETQIKTFTLGSFKCPDPINFIDMNLPSITVPNLNSSVTITRTLKNVGSPGT  705

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A +R P+G S  V P  L+F+ + EE+SFK+TLK KG  A  DY FG L WSD KH V
Sbjct  706   YKARIRHPIGISAVVEPNSLEFKNINEEKSFKLTLKVKGSKAPKDYVFGQLIWSDNKHYV  765

Query  125   RSPIVVK  105
             RSPIVVK
Sbjct  766   RSPIVVK  772



>ref|XP_006447869.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
 gb|ESR61109.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
Length=773

 Score =   478 bits (1229),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 294/389 (76%), Gaps = 3/389 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS             +LLC+ GTLDP+K KGK+LVCLRG  AR DK  QA LAGAVGM+
Sbjct  386   LISAADAKAANASTEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMV  445

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN  ++GNE++AD H LPA+HV Y+DG  +F Y+N T+ PV ++T   T LG+KPAP++
Sbjct  446   LANALENGNELLADPHLLPASHVNYTDGADLFRYVNSTKRPVGYLTRATTELGLKPAPIM  505

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GP++I P+ILKPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCP
Sbjct  506   AAFSSKGPSSIAPEILKPDITAPGVTIIAAYTEAVGPTNEDYDRRRIPFNALSGTSMSCP  565

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+G+VGLLKTL+P WSPA I+SAIMTTA+++ N+   I  + +  KATPF+YGAGHI P
Sbjct  566   HVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQP  624

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  360
             N A DPGLVYDL   DY+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L
Sbjct  625   NLAMDPGLVYDLTENDYLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKL  684

Query  359   KGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGEN  183
              G+  V+RT++NVGSP TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   
Sbjct  685   SGSIIVSRTVRNVGSPGTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRA  744

Query  182   ATADYAFGVLTWS-DKKHRVRSPIVVKAA  99
             AT DY FG L W+ DK+H+VRSPIVV  A
Sbjct  745   ATKDYVFGDLVWADDKQHQVRSPIVVNPA  773



>ref|XP_006469397.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
Length=773

 Score =   478 bits (1229),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 294/389 (76%), Gaps = 3/389 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS             +LLC+ GTLDP+K KGK+LVCLRG  AR DK  QA LAGAVGM+
Sbjct  386   LISAADAKAANASTEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMV  445

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN  ++GNE++AD H LPA+HV Y+DG  +F Y+N T+ PV ++T   T LG+KPAP++
Sbjct  446   LANALENGNELLADPHLLPASHVNYTDGADLFRYVNSTKRPVGYLTRATTELGLKPAPIM  505

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GP++I P+ILKPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCP
Sbjct  506   AAFSSKGPSSIAPEILKPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCP  565

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+G+VGLLKTL+P WSPA I+SAIMTTA+++ N+   I  + +  KATPF+YGAGHI P
Sbjct  566   HVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQP  624

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  360
             N A DPGLVYDL   DY+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L
Sbjct  625   NLAMDPGLVYDLTENDYLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKL  684

Query  359   KGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGEN  183
              G+  V+RT++NVGSP TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   
Sbjct  685   SGSIIVSRTVRNVGSPGTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRA  744

Query  182   ATADYAFGVLTWS-DKKHRVRSPIVVKAA  99
             AT DY FG L W+ DK+H+VRSPIVV  A
Sbjct  745   ATKDYVFGDLVWADDKQHQVRSPIVVNPA  773



>ref|XP_008224681.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   477 bits (1228),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/367 (63%), Positives = 277/367 (75%), Gaps = 2/367 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC  GTLDP+K KGK+L CLRG TAR DK  QAALAGAVGMIL ND+ SGNEIIAD H
Sbjct  399   AMLCIGGTLDPQKVKGKILACLRGDTARADKGEQAALAGAVGMILCNDKASGNEIIADPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y+DG+A+  YIN T +P   IT P   L  KPAP +A+FSS+GPN I P+IL
Sbjct  459   VLPASQINYTDGIAVVSYINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA+T+AT P++  +DKR ++FN ESGTSMSCPHV+GVVGLLKTLYP W
Sbjct  519   KPDITAPGVNIIAAYTQATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDW  578

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP+ IRSAIMTTA  R N+   +  + + ++ATPF+YGAGHI PN A DPGL+YDL + D
Sbjct  579   SPSAIRSAIMTTARTRDNTANPM-KNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVND  637

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYNKT +     +P YKCP   SL  FNYPSI VP L G+ TVTR +KNVGS
Sbjct  638   YLDFLCAIGYNKTMMQLFSESPNYKCPKSASLLDFNYPSIAVPELSGSVTVTRRVKNVGS  697

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY   +  P+G SVTV P ILKF+ +GEE+SFKVTLKAKG   T  Y FG L WSD K
Sbjct  698   PGTYAVRIHKPLGVSVTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKGYVFGGLIWSDGK  757

Query  134   HRVRSPI  114
             H VRSPI
Sbjct  758   HYVRSPI  764



>ref|XP_007214967.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
 gb|EMJ16166.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
Length=773

 Score =   477 bits (1227),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/372 (62%), Positives = 283/372 (76%), Gaps = 2/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +K KGK+L CLRG +AR DK  QA LAGAVGMILANDE SGNEII+D H
Sbjct  403   ALLCKAGTLDLKKVKGKILACLRGDSARVDKGEQALLAGAVGMILANDELSGNEIISDPH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG  +F YIN T++P A+I  P T LG KPAP +A FSS+GPN I PDIL
Sbjct  463   VLPASHINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAEFSSKGPNTITPDIL  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV++IAAFTEA GP++  +DKR V FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  523   KPDITAPGVSIIAAFTEAQGPTNQMFDKRRVLFNSLSGTSMSCPHISGICGLLKTLYPHW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + NS + +  + +  +ATPF+YGAGH+NPN   DPGLVYDL L D
Sbjct  583   SPAAIKSAIMTTATTQDNSREPVL-NASFYRATPFSYGAGHVNPNSVMDPGLVYDLSLND  641

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+C+ GYNKT+I  V    YKCP   IS +  NYPSITVP L G+  VTRT+KNVG+
Sbjct  642   YLNFLCSNGYNKTQIEMVSEETYKCPKPAISGTNLNYPSITVPKLDGSLVVTRTVKNVGT  701

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A +++P G  V+V P  L+F+K+GEE+SFK+ L+ K   A  +Y FG L WSD K
Sbjct  702   PGTYKARIQNPDGILVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGK  761

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVKAA
Sbjct  762   HYVRSPIVVKAA  773



>ref|XP_008229767.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=773

 Score =   476 bits (1225),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 230/372 (62%), Positives = 286/372 (77%), Gaps = 2/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +K KGK+L CL+G +A  DK  QA LAGAVGMILANDE SGNEII+D H
Sbjct  403   ALLCKAGTLDLKKVKGKILACLQGDSATVDKGEQALLAGAVGMILANDELSGNEIISDPH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG  +F YIN T++P A+I  P T LG KPAPV+AAFSS+GPN I PDIL
Sbjct  463   VLPASHINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPVMAAFSSKGPNTITPDIL  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV++IAA+TEA GP++  +DKR V FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  523   KPDITAPGVSIIAAYTEAQGPTNQMFDKRRVLFNSVSGTSMSCPHISGICGLLKTLYPHW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + NS + +  + +  +ATPF+YGAGH+NPN A DPGLVYDL L D
Sbjct  583   SPAAIKSAIMTTATTQDNSREPLL-NASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLND  641

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+C+ GYNKT+I  V    Y+CP   +SL+  NYPSITVP L G+  VTRT+KNVG+
Sbjct  642   YLNFLCSNGYNKTQIEMVSEEAYECPKPAVSLTNLNYPSITVPKLNGSLVVTRTVKNVGT  701

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A +++P G SV+V P  L+F+K+GEE+SFK+ L+     A  +Y FG L WSD K
Sbjct  702   PGTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVIDAKAAKNYVFGKLIWSDGK  761

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVKAA
Sbjct  762   HYVRSPIVVKAA  773



>ref|XP_007049441.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOX93598.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=624

 Score =   471 bits (1213),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/370 (64%), Positives = 283/370 (76%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC+ GT+DPEKA GK LVCLRG  AR DK  QAALAGAVGM+LAN+  +GNEIIADAH
Sbjct  255   ALLCQAGTIDPEKASGKFLVCLRGQNARVDKGQQAALAGAVGMVLANNILAGNEIIADAH  314

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y+DGLA+F YIN T+ P A+IT   T +G KPAP +AAFSS+GPN I P+IL
Sbjct  315   VLPASHINYTDGLAVFTYINSTKYPTAYITPVTTQIGTKPAPFMAAFSSKGPNTITPEIL  374

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTLYP W
Sbjct  375   KPDITAPGVSVIAAYTEAQGPTNEDFDKRRVQFNCVSGTSMSCPHVSGIVGLLKTLYPDW  434

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMT+AT   N  + I  + + +KA PF+YGAGHI PN A DPGLVYDL  TD
Sbjct  435   SPAAIKSAIMTSATTWDNMKEPIL-NASNIKAGPFSYGAGHIQPNLAMDPGLVYDLAATD  493

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+C  GYN+T I+     PYKCP  ISL+ FNYPSI VP+L G+ TVTRT+KNVGSP
Sbjct  494   YLNFLCTLGYNETLISMFSQNPYKCPKPISLANFNYPSIAVPNLVGSITVTRTVKNVGSP  553

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V+ P G SV V PK LKF+KVGEE++F VTL     +   +Y FG L WSD  H
Sbjct  554   GTYRAQVQRPTGISVQVKPKKLKFKKVGEEKTFSVTLNVMKAHPVKEYVFGQLIWSDHVH  613

Query  131   RVRSPIVVKA  102
              V SPIVVKA
Sbjct  614   HVSSPIVVKA  623



>ref|XP_010067699.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=901

 Score =   480 bits (1235),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 240/386 (62%), Positives = 288/386 (75%), Gaps = 1/386 (0%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     L+ +  + +LLCK GTLDP K KGK+LVCLRG  AR DK  QA LA AVGM+
Sbjct  470   LISAADARLSHVSANEALLCKNGTLDPRKVKGKILVCLRGDNARVDKGEQALLASAVGMV  529

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN+  SG+EI++D HFLPA+HV Y+DG AIF YIN T+ P A IT   T LGVKP+P +
Sbjct  530   LANNLVSGSEILSDPHFLPASHVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFM  589

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GPN I P+ILKPD++APGV+VIAA+TEA GP+D  YDKR V +N  SGTSMSCP
Sbjct  590   AAFSSKGPNTIIPEILKPDVTAPGVSVIAAYTEAAGPTDQAYDKRRVPYNAMSGTSMSCP  649

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+GV GLLKTL+P WSPA IRSAIMT+AT+  N+ ++I ++ +  KATPF+YGAGHI P
Sbjct  650   HVSGVAGLLKTLHPEWSPAAIRSAIMTSATILDNAMESIMNN-SFYKATPFSYGAGHIQP  708

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  360
             N A DPGLVYDL + DY+NF+C+ GYN  +I+ V    Y C   I L  FNYPSITVP L
Sbjct  709   NRAMDPGLVYDLGIIDYLNFLCSLGYNAMQISNVTDGAYDCSKRIGLLDFNYPSITVPKL  768

Query  359   KGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA  180
               + TVTRT+KNVG P TY AS+  P G  V V P  LKF+K+GEE+SFKV LK KG  A
Sbjct  769   SRSITVTRTVKNVGFPGTYRASILEPNGVLVLVKPAYLKFKKIGEEKSFKVMLKVKGAGA  828

Query  179   TADYAFGVLTWSDKKHRVRSPIVVKA  102
             T DY+FG L WSD +H VRSPIVVKA
Sbjct  829   TEDYSFGELIWSDTEHHVRSPIVVKA  854



>gb|KCW88582.1| hypothetical protein EUGRSUZ_A00959 [Eucalyptus grandis]
Length=788

 Score =   476 bits (1226),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 245/405 (60%), Positives = 290/405 (72%), Gaps = 20/405 (5%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     L+ +    +LLC+ GTLDP K K K+LVCLRG  AR DK  QA LAGAVGM+
Sbjct  383   LISAADARLSHVSADEALLCQNGTLDPRKVKEKILVCLRGENARVDKGEQAFLAGAVGMV  442

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN+  SGNEI+AD HFLPA+HV Y+DG AIF YIN T+ P A IT   T LGVKP+P +
Sbjct  443   LANNILSGNEIVADPHFLPASHVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFM  502

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GPN I P+ILKPDI+APG++VIAA+TEA GP++ D D+R V FN  SGTSMSCP
Sbjct  503   AAFSSKGPNTITPEILKPDITAPGLSVIAAYTEAVGPTNEDIDQRRVPFNAVSGTSMSCP  562

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTT-------------------ATVRANSGKAITD  597
             HV+GV GLLKTL+P WSPA IRSAIMT+                   AT+R N+ ++I  
Sbjct  563   HVSGVAGLLKTLHPEWSPAVIRSAIMTSGVSKMRNVLIDLCPVCLLAATIRDNAMESII-  621

Query  596   DETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKC  417
             + +  KATPF+YGAGHI PN A DPGLVYDL + DY+NF+C+ GYN T+I+      Y C
Sbjct  622   NASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIKDYLNFLCSLGYNATQISMFSDGAYNC  681

Query  416   PDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFE  237
                I L  FNYPSITVP L G+ TVTRT+KNVG P TY ASV  P G SV V P  LKF+
Sbjct  682   SKRIGLLDFNYPSITVPKLPGSITVTRTVKNVGLPGTYKASVLEPNGVSVHVKPAHLKFK  741

Query  236   KVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVKA  102
             K+ EE+SFKV LKAKG NAT DY+FG L WSD +H VRSPIVVKA
Sbjct  742   KINEEKSFKVVLKAKGANATGDYSFGELIWSDTEHHVRSPIVVKA  786



>gb|KDP45154.1| hypothetical protein JCGZ_15019 [Jatropha curcas]
Length=771

 Score =   476 bits (1224),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 228/372 (61%), Positives = 290/372 (78%), Gaps = 4/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G LDP+KAKGK+LVCLRG  AR +K  QAALAGAV M+LAND+DS NEI+AD H
Sbjct  400   ALLCKAGALDPKKAKGKILVCLRGSNARVEKGEQAALAGAVAMVLANDKDSENEILADPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV Y +G+AIF+YIN T++ V +IT P T +G KPAP++AAFSS+GPN I P+IL
Sbjct  460   VLPASHVNYINGVAIFNYINNTKSSVGYITRPKTQVGTKPAPIMAAFSSKGPNTIAPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+T+A GP++ D+D R V FN  SGTSMSCPHV+G+  LLKTL+P+W
Sbjct  520   KPDITAPGVSVIAAYTKAEGPTNEDFDMRRVQFNSMSGTSMSCPHVSGIAALLKTLHPNW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SA+MTTAT   NS + I  + +  KATPF+YGAGHI PN A DPGL+YDL + D
Sbjct  580   SPAAIKSAVMTTATTLDNSKEEIL-NASHSKATPFSYGAGHIRPNEAMDPGLIYDLSVND  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG-  318
             Y+NF+C  GY++ +I +   T +KCP   +SL+ FNYPSIT+P   G+ TVTR +KNVG 
Sbjct  639   YLNFLCTLGYSEAQILSFSQTSFKCPKKPVSLANFNYPSITIPKFSGSITVTRKVKNVGV  698

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD-  141
             SP+ Y A ++ P GFS++V PK+LKF+K+GEE+SF+VTLK+K   A  DY FG L WSD 
Sbjct  699   SPSIYQAHIKKPSGFSISVEPKVLKFKKIGEEKSFRVTLKSKKSYAIKDYVFGELVWSDS  758

Query  140   KKHRVRSPIVVK  105
              K+ VRSPIVVK
Sbjct  759   NKYYVRSPIVVK  770



>ref|XP_011005797.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=773

 Score =   475 bits (1223),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 275/369 (75%), Gaps = 1/369 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCKP +LD EKAKGKV+VCLRG T R DK +QAAL GA GMIL ND+ SGNEIIAD H
Sbjct  399   ALLCKPKSLDHEKAKGKVVVCLRGETGRMDKGYQAALVGAAGMILCNDKASGNEIIADPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA  +TY+DGLA+F YIN T + + +I+ P   LG KPAP +AAFSSRGPN + P+IL
Sbjct  459   VLPAAQITYTDGLAVFAYINSTDHALGYISAPTAKLGTKPAPSMAAFSSRGPNTVTPEIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAF+EA  P+D D+DKR   F  ESGTSMSCPHVAGVVGLLKTL+P W
Sbjct  519   KPDITAPGVNIIAAFSEAISPTDFDFDKRKSPFITESGTSMSCPHVAGVVGLLKTLHPDW  578

Query  671   SPAEIRSAIMTTATVRANSGKAI-TDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             SPA IRSA+MTTA  RAN+   I  D    L+ATPF+YG+GHI PN A DPGLVYDL + 
Sbjct  579   SPAAIRSAMMTTARTRANTMTPILVDGRDGLEATPFSYGSGHIRPNRAQDPGLVYDLSIN  638

Query  494   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             DY++F+CA GYN T I      PYKCP+  S+  FN PSIT+  L+ + +V R +KNVG 
Sbjct  639   DYLDFLCASGYNSTMIEHFSDGPYKCPESTSIFDFNNPSITIRQLRNSMSVIRKVKNVGL  698

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A VR P G SV+V P IL FE  G+E+SF+VT KAK +  T DY FG LTW+D +
Sbjct  699   PGTYAAHVREPYGISVSVEPNILTFENKGDEKSFEVTFKAKWDGVTEDYEFGTLTWTDGR  758

Query  134   HRVRSPIVV  108
             H VRSPIVV
Sbjct  759   HYVRSPIVV  767



>ref|XP_007153620.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 ref|XP_007153621.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25614.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25615.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
Length=778

 Score =   474 bits (1220),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 231/371 (62%), Positives = 283/371 (76%), Gaps = 2/371 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC+ GTLDP+K KGK++VCLRG+ AR DK  QA LAGAVGM+LAND+ SGNEIIAD H
Sbjct  402   AVLCQNGTLDPKKVKGKIVVCLRGINARVDKGEQALLAGAVGMVLANDKASGNEIIADPH  461

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG+A+F+YIN TR PVA+ITHP T L  KPAP +AAFSS+GPN + P+IL
Sbjct  462   VLPASHINFTDGIAVFNYINSTRFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTVVPEIL  521

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV+VIAA+TEA GP++  +DKR + +N  SGTSMSCPHVAG+V LL+  YPSW
Sbjct  522   KPDVTAPGVSVIAAYTEAQGPTNQVFDKRRIPYNSVSGTSMSCPHVAGIVALLRASYPSW  581

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT   N  + +  + T  +ATPF+YGAGH+ PN A DPGLVYD  + D
Sbjct  582   SPAAIKSAIMTTATTLDNEVEPLL-NATDGRATPFSYGAGHVQPNTAMDPGLVYDTTIGD  640

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+CA GYN T+I+     P Y C    SL   NYPSITVP+L G+ TVTRTLKNVGS
Sbjct  641   YLNFLCALGYNGTKISVFTEGPSYVCRKKFSLLNLNYPSITVPNLSGSVTVTRTLKNVGS  700

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A V++P G +V+V P IL F KVGEE+ FKVT K     AT +Y FG L WSD K
Sbjct  701   PRTYIAHVQNPKGITVSVKPSILNFTKVGEEKRFKVTFKIVKGKATNNYVFGKLIWSDGK  760

Query  134   HRVRSPIVVKA  102
             H VRSPIVVKA
Sbjct  761   HYVRSPIVVKA  771



>ref|XP_011039832.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=772

 Score =   474 bits (1219),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 226/369 (61%), Positives = 275/369 (75%), Gaps = 1/369 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCKPG LD +K KGK+LVCLRG   R DK HQA LAGA GMILANDE+SGNEIIAD H
Sbjct  403   ALLCKPGALDSKKVKGKILVCLRGENGRVDKGHQALLAGAAGMILANDENSGNEIIADTH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA H+ ++DG A+F Y+  T+ P+A +T+  T L  KPAP +A+FSSRGPN I   IL
Sbjct  463   VLPAAHINFTDGEAVFSYLKLTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESIL  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG++VIAAFTEA GPSD +YDKR   +N +SGTSMSCPHV+G+ GLLKTL+P W
Sbjct  523   KPDITAPGISVIAAFTEAIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIAGLLKTLHPKW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTTAT R N+G+ I  D T  KATPFA GAGH+ PN AADPGL+YDL + D
Sbjct  583   SPAAIRSAIMTTATTRDNNGEPIL-DSTNTKATPFADGAGHVQPNRAADPGLIYDLTVND  641

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             ++NF+C +G  K  I      PY CP   SL+ FNYPSITV +L  + TVTR +KNVGSP
Sbjct  642   FLNFLCNRGNTKKNIKLFSDKPYTCPKSFSLADFNYPSITVTNLNDSITVTRRVKNVGSP  701

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TY   +R+P G +V+V P IL+F+K+GEE+ FKVT K        DY FG+LTW D KH
Sbjct  702   STYNIHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKLAPNAVLTDYVFGMLTWGDGKH  761

Query  131   RVRSPIVVK  105
              VRSP+VV+
Sbjct  762   FVRSPLVVR  770



>gb|KDO78650.1| hypothetical protein CISIN_1g048642mg [Citrus sinensis]
Length=782

 Score =   474 bits (1219),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 228/369 (62%), Positives = 277/369 (75%), Gaps = 1/369 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G LD EK KGK+LVCLRG TAR DK  QAA+AGAVGMIL ND+ SGNEI AD HFL
Sbjct  407   LCKNGALDHEKVKGKILVCLRGDTARVDKGRQAAVAGAVGMILCNDKSSGNEITADPHFL  466

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ +TY DG+ + DYI  + NP+ +IT P+T L  KP+P +A+FSS GPN I P+ILKP
Sbjct  467   PASQITYKDGVKVLDYIKSSDNPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPEILKP  526

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN+IAAFT A G ++  YD R + +N+ SGTSMSCPHVAGVVGLLKT +P WSP
Sbjct  527   DITAPGVNIIAAFTGAIGATELPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHPDWSP  586

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + IRSAIMTTA  R N+   + D   + KATPF+YG+GHI PN A DPGLVYDL   DY+
Sbjct  587   SAIRSAIMTTARTRDNTANPMRDGSFK-KATPFSYGSGHIRPNRAMDPGLVYDLSEDDYL  645

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+C+ GYN+T I    GT Y+C    +L  FNYPSI+VP + G+ T++R LKNVGSP+ 
Sbjct  646   DFLCSIGYNQTTIKRFFGTQYECSKSANLEDFNYPSISVPMISGSVTLSRKLKNVGSPSN  705

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y ASVR P+G SV+V PKIL F+K+GEE+SFKVTLK K   A  +Y FG LTW+D KH V
Sbjct  706   YAASVREPLGISVSVEPKILAFKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDGKHYV  765

Query  125   RSPIVVKAA  99
             RSPIVV  A
Sbjct  766   RSPIVVNQA  774



>ref|XP_006468177.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=784

 Score =   474 bits (1219),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 228/369 (62%), Positives = 277/369 (75%), Gaps = 1/369 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G LD EK KGK+LVCLRG TAR DK  QAA+AGAVGMIL ND+ SGNEI AD HFL
Sbjct  409   LCKNGALDHEKVKGKILVCLRGDTARVDKGRQAAVAGAVGMILCNDKSSGNEITADPHFL  468

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ +TY DG+ + DYI  + NP+ +IT P+T L  KP+P +A+FSS GPN I P+ILKP
Sbjct  469   PASQITYKDGVKVLDYIKSSDNPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPEILKP  528

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN+IAAFT A G ++  YD R + +N+ SGTSMSCPHVAGVVGLLKT +P WSP
Sbjct  529   DITAPGVNIIAAFTGAIGATELPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHPDWSP  588

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + IRSAIMTTA  R N+   + D   + KATPF+YG+GHI PN A DPGLVYDL   DY+
Sbjct  589   SAIRSAIMTTARTRDNTANPMRDGSFK-KATPFSYGSGHIRPNRAMDPGLVYDLSEDDYL  647

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+C+ GYN+T I    GT Y+C    +L  FNYPSI+VP + G+ T++R LKNVGSP+ 
Sbjct  648   DFLCSIGYNQTTIKRFFGTQYECSKSANLEDFNYPSISVPMISGSVTLSRKLKNVGSPSN  707

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y ASVR P+G SV+V PKIL F+K+GEE+SFKVTLK K   A  +Y FG LTW+D KH V
Sbjct  708   YAASVREPLGISVSVEPKILAFKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDGKHYV  767

Query  125   RSPIVVKAA  99
             RSPIVV  A
Sbjct  768   RSPIVVNQA  776



>ref|XP_002308740.2| hypothetical protein POPTR_0006s00370g [Populus trichocarpa]
 gb|EEE92263.2| hypothetical protein POPTR_0006s00370g [Populus trichocarpa]
Length=686

 Score =   470 bits (1210),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 228/367 (62%), Positives = 271/367 (74%), Gaps = 0/367 (0%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCKP +LD EKAKGKV+VCLRG T R DK +QAAL GA GMIL ND+ SGNEIIAD H 
Sbjct  314   LLCKPKSLDHEKAKGKVVVCLRGETGRMDKGYQAALVGAAGMILCNDKASGNEIIADPHV  373

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA  +TY+DGLA+F YIN T + + +I+ P   LG KPAP IAAFSSRGPN + P+ILK
Sbjct  374   LPAAQITYTDGLAVFAYINSTDHALGYISAPTAKLGTKPAPSIAAFSSRGPNTVTPEILK  433

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGVN+IAAF+EA  P+D D+DKR   F  ESGTSMSCPHVAG VGLLKTL+P WS
Sbjct  434   PDITAPGVNIIAAFSEAISPTDFDFDKRKSPFITESGTSMSCPHVAGAVGLLKTLHPDWS  493

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA IRSAIMTTA  RAN+   + D    L+ATPF+YG+GHI PN A DPGLVYDL + DY
Sbjct  494   PAAIRSAIMTTARTRANTMTPMVDGRDGLEATPFSYGSGHIRPNRAQDPGLVYDLSINDY  553

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             ++F+CA GYN T I      PYKCP+  S+  FN PSIT+  L+ + +V R +KNVG   
Sbjct  554   LDFLCASGYNSTMIEPFSDGPYKCPESTSIFDFNNPSITIRQLRNSMSVIRKVKNVGLTG  613

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A VR P G  V+V P IL FE  G+E+SFKVT +AK +  T D+ FG LTW+D +H 
Sbjct  614   TYAAHVREPYGILVSVEPSILTFENKGDEKSFKVTFEAKWDGVTEDHEFGTLTWTDGRHY  673

Query  128   VRSPIVV  108
             VRSPIVV
Sbjct  674   VRSPIVV  680



>gb|KDO42093.1| hypothetical protein CISIN_1g038881mg [Citrus sinensis]
Length=794

 Score =   474 bits (1219),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 294/389 (76%), Gaps = 3/389 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS             +LLC+ GTLDP+K KGK+LVCLRG  AR DK  QA LAGAVGM+
Sbjct  407   LISAADAKAANASTEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMV  466

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LAN +++GNE++AD H LPA+H+ ++DG  +F  +N T+ PV ++T   T LG+KPAP++
Sbjct  467   LANAQENGNELLADPHLLPASHINFTDGADLFRDVNSTKRPVGYLTRATTELGLKPAPIM  526

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSS+GP+++ P+ILKPDI+APGV +IAA+TEA GP++ DYD+R + FN  SGTSMSCP
Sbjct  527   AAFSSKGPSSVAPEILKPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCP  586

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+G+VGLLKTL+P WSPA I+SAIMTTA+++ N+   I  + +  KATPF+YGAGHI P
Sbjct  587   HVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQDNNKGQIL-NASSYKATPFSYGAGHIQP  645

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL  360
             N A DPGLVYDL   DY+NF+CA GYNKT+I       Y+CP+++S + FNYPSITVP L
Sbjct  646   NLAMDPGLVYDLTENDYLNFLCALGYNKTQIALFSDKTYRCPEYVSTANFNYPSITVPKL  705

Query  359   KGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKA-KGEN  183
              G+  V+RT++NVGSP TY A VR+P G SV+V P+ LKF +VGEE++FKVT+K  K   
Sbjct  706   SGSIIVSRTVRNVGSPGTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKVRKVRA  765

Query  182   ATADYAFGVLTWS-DKKHRVRSPIVVKAA  99
             AT DY FG L W+ DK+H+VRSPIVV  A
Sbjct  766   ATKDYVFGDLVWADDKQHQVRSPIVVNPA  794



>ref|XP_010252985.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
 ref|XP_010252986.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=777

 Score =   472 bits (1215),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/372 (63%), Positives = 282/372 (76%), Gaps = 3/372 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK GTLDPEK KGK+L CLRGV  R  K  QAALAGAVGMILANDE +GNEII D H 
Sbjct  407   LLCKAGTLDPEKVKGKILACLRGVNGRVQKGIQAALAGAVGMILANDEINGNEIIVDTHV  466

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA H+ Y DGL +F YIN T++P+A+IT P T + VKPAP +A+FSSRGPN I P+ILK
Sbjct  467   LPAAHIIYKDGLDLFAYINSTKSPIAYITRPVTQMAVKPAPFMASFSSRGPNTITPEILK  526

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV++IAA+T+ATGP+    D+R V FN ESGTSMSCPHVAG+ GLLKTL+P WS
Sbjct  527   PDITAPGVSIIAAYTQATGPTGEKSDERRVQFNSESGTSMSCPHVAGISGLLKTLHPDWS  586

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             P+ IRSAIMT+A  R N  + +  + + +KA PF YGAGH+ PN A DPGLVYDL + DY
Sbjct  587   PSAIRSAIMTSARTRDNKREPML-NSSYVKANPFDYGAGHVRPNRAMDPGLVYDLTVKDY  645

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +NF+CA GYN+T+I +    PY+CP+H+ L  FNYPSITVP L G  T++RT+KNVG+P 
Sbjct  646   LNFLCALGYNETKIKSFWEEPYECPNHVRLLDFNYPSITVPRLSGPTTISRTVKNVGTPG  705

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSF--KVTLKAKGENATADYAFGVLTWSDKK  135
             TY A  R P G SV+V P  LKF+K+GEE+SF   + LKAK   A ++Y FG L WSD  
Sbjct  706   TYKARFRPPPGISVSVEPLTLKFDKLGEEKSFKLTLKLKAKKAPAASNYVFGRLIWSDGN  765

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVKAA
Sbjct  766   HYVRSPIVVKAA  777



>ref|XP_007049440.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOX93597.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=794

 Score =   472 bits (1215),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/370 (64%), Positives = 283/370 (76%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC+ GT+DPEKA GK LVCLRG  AR DK  QAALAGAVGM+LAN+  +GNEIIADAH
Sbjct  425   ALLCQAGTIDPEKASGKFLVCLRGQNARVDKGQQAALAGAVGMVLANNILAGNEIIADAH  484

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y+DGLA+F YIN T+ P A+IT   T +G KPAP +AAFSS+GPN I P+IL
Sbjct  485   VLPASHINYTDGLAVFTYINSTKYPTAYITPVTTQIGTKPAPFMAAFSSKGPNTITPEIL  544

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++ D+DKR V FN  SGTSMSCPHV+G+VGLLKTLYP W
Sbjct  545   KPDITAPGVSVIAAYTEAQGPTNEDFDKRRVQFNCVSGTSMSCPHVSGIVGLLKTLYPDW  604

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMT+AT   N  + I  + + +KA PF+YGAGHI PN A DPGLVYDL  TD
Sbjct  605   SPAAIKSAIMTSATTWDNMKEPIL-NASNIKAGPFSYGAGHIQPNLAMDPGLVYDLAATD  663

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+C  GYN+T I+     PYKCP  ISL+ FNYPSI VP+L G+ TVTRT+KNVGSP
Sbjct  664   YLNFLCTLGYNETLISMFSQNPYKCPKPISLANFNYPSIAVPNLVGSITVTRTVKNVGSP  723

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V+ P G SV V PK LKF+KVGEE++F VTL     +   +Y FG L WSD  H
Sbjct  724   GTYRAQVQRPTGISVQVKPKKLKFKKVGEEKTFSVTLNVMKAHPVKEYVFGQLIWSDHVH  783

Query  131   RVRSPIVVKA  102
              V SPIVVKA
Sbjct  784   HVSSPIVVKA  793



>ref|XP_006377976.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
 gb|ERP55773.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
Length=775

 Score =   471 bits (1213),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/367 (62%), Positives = 277/367 (75%), Gaps = 1/367 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKPGTLD +K KGK+LVCLRGV  R +K H A LAGAVGMILANDE+SGN I+ADAH L
Sbjct  405   LCKPGTLDSKKVKGKILVCLRGVNPRVEKGHVALLAGAVGMILANDEESGNGILADAHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA H+  +DG A+F Y+N T++P A+IT+  T LG KPAP +A+FSSRGPN +   ILKP
Sbjct  465   PAAHIISTDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAAFT ATGP+D  YDKR + FN ESGTSMSCPHV+G+VGLLK+L+P WSP
Sbjct  525   DITAPGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT R N+G  I  D +  +ATPFAYGAGH+ PN AADPGLVYDL + D++
Sbjct  585   AAIRSAIMTTATTRDNNGDPIL-DSSNTRATPFAYGAGHVQPNRAADPGLVYDLTVNDFL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             N++C++GY   ++      PY CP   SL+ FNYPSI+  +L  T TVTR +KNVGSP  
Sbjct  644   NYLCSRGYTAKDLKLFTDKPYTCPKSFSLTDFNYPSISAINLNDTITVTRRVKNVGSPGK  703

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y   VR P G  V+V P  L+F+K+GEE++FKVT K   +    DY FG+LTWSD KH V
Sbjct  704   YYIHVREPTGVLVSVAPTTLEFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGKHFV  763

Query  125   RSPIVVK  105
             RSP+VV+
Sbjct  764   RSPLVVR  770



>ref|XP_008342263.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=777

 Score =   471 bits (1212),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 230/372 (62%), Positives = 281/372 (76%), Gaps = 2/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCKP TLDP+K KGK+L CLRG  AR DK  QA LAGAVGMILAN+E +GNEIIAD H
Sbjct  407   ALLCKPNTLDPKKVKGKILACLRGDNARVDKGEQALLAGAVGMILANNELTGNEIIADPH  466

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG  +F YIN T++P A+I    T LG KP+P +AAFSSRGPN I P IL
Sbjct  467   VLPASHINFTDGNLVFTYINSTKSPRAYIKRAITELGTKPSPFMAAFSSRGPNTITPGIL  526

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  527   KPDITAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHW  586

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA  R NS + +  + +  +ATPF+YGAGH+NPN A DPGLVYDL L D
Sbjct  587   SPAAIKSAIMTTAVTRDNSMEPLL-NASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLND  645

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+CA GYN+T+I       Y C    ISL++ NYPSITVP + G+  VTRT+KNVGS
Sbjct  646   YLNFLCAIGYNETQIEMFSEEMYMCSKPAISLTSLNYPSITVPKISGSLEVTRTVKNVGS  705

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A +++P G SV+V PK LKF+K+GEE+SFKV L+        +Y FG L WSD K
Sbjct  706   PGTYKARIQNPBGISVSVEPKELKFKKIGEEKSFKVLLQVXEAKQDKNYVFGKLIWSDGK  765

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVKAA
Sbjct  766   HYVRSPIVVKAA  777



>ref|XP_004502100.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=772

 Score =   470 bits (1209),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 222/368 (60%), Positives = 282/368 (77%), Gaps = 1/368 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC   TLDP K KGK+++CLRG+ AR DK  QA LAGAVGM+L ND+ +GNE+IAD H L
Sbjct  405   LCMNRTLDPSKVKGKIVICLRGINARVDKGEQALLAGAVGMVLVNDKINGNEVIADPHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+T+SDGLA+F+YIN +++PV +ITHP T L  KPAP +AAFSS+GPN I P+ILKP
Sbjct  465   PATHITFSDGLALFNYINSSKSPVVYITHPTTRLHTKPAPFMAAFSSKGPNTIVPEILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+TEA GP++ ++D R + +N  SGTSMSCPH++G+ GLLKTL+PSWSP
Sbjct  525   DITAPGVSVIAAYTEAEGPTNQEFDYRRIPYNSVSGTSMSCPHISGIAGLLKTLHPSWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTAT   N  + I  + T  +ATPF+YGAGH+ PN A DPGLVYD  + DY+
Sbjct  585   AAIKSAIMTTATTLDNEAEPIL-NATESQATPFSYGAGHVQPNKAMDPGLVYDTTVNDYL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CA GY++T+I+     P+ C  + SL   NYPSITVP+L G+ TVTRTLKNVGSPAT
Sbjct  644   NFLCALGYDETQISVFSKAPHPCHKNFSLINLNYPSITVPNLSGSVTVTRTLKNVGSPAT  703

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A V++P G +V+V P IL+F+ VGEE+ F++ LK +       Y FG L WSD KH V
Sbjct  704   YIARVQNPNGITVSVKPNILEFKNVGEEKRFEIRLKVRKGKGKEKYVFGKLIWSDGKHYV  763

Query  125   RSPIVVKA  102
             +SPIVVKA
Sbjct  764   KSPIVVKA  771



>ref|XP_009361505.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=777

 Score =   469 bits (1207),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/372 (62%), Positives = 282/372 (76%), Gaps = 2/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCKP TLDP+K KGK+L CLRG  AR DK  QA LAGAVGMILAN+E +GNEIIAD H
Sbjct  407   ALLCKPNTLDPKKVKGKILACLRGDNARVDKGEQAFLAGAVGMILANNELTGNEIIADPH  466

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ ++DG  +F YI  T++P A+I    T LG KP+P +AAFSS+GPNAI P IL
Sbjct  467   VLPASHINFTDGNLVFAYIYSTKSPRAYIKRAITELGTKPSPFMAAFSSKGPNAITPGIL  526

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP++  +DKR + FN  SGTSMSCPH++G+ GLLKTLYP W
Sbjct  527   KPDITAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHW  586

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA  + NS + +  + +  +ATPF+YGAGH+NPN A DPGLVYDL L D
Sbjct  587   SPAAIKSAIMTTAVTQDNSMEPLL-NASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLND  645

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+CA GYN+T+I       YKC    ISL+  NYPSITVP + G+  VTRT+KNVGS
Sbjct  646   YLNFLCAIGYNETQIEMFSEEMYKCSKPAISLTNLNYPSITVPKISGSLEVTRTVKNVGS  705

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A +++P G SV+V PK LKF+K+GEE+SFKV L+ +      +Y FG L WSD K
Sbjct  706   PGTYKARIQNPDGISVSVEPKELKFKKIGEEKSFKVLLQVREAKQDKNYVFGKLIWSDGK  765

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVKAA
Sbjct  766   HYVRSPIVVKAA  777



>ref|XP_010048342.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW89053.1| hypothetical protein EUGRSUZ_A01377 [Eucalyptus grandis]
Length=770

 Score =   468 bits (1203),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 230/370 (62%), Positives = 275/370 (74%), Gaps = 1/370 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++ CK GTLDP K KG +LVCL G  A   +  QA LAGAVGM+LAN   SGNEI+AD H
Sbjct  401   AIFCKDGTLDPRKVKGNILVCLWGENATVHEGEQAFLAGAVGMVLANSILSGNEILADPH  460

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV Y DG AIF YI  T+ P A IT   T LGVKP+P++AAFSS+GPN I P+IL
Sbjct  461   LLPASHVNYGDGAAIFSYIKSTKFPTAQITRVVTNLGVKPSPLMAAFSSKGPNTITPEIL  520

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+VIAA+TEA GP+D ++DKR V FN  SGTSMSCPHV+GV GLLKTL+P W
Sbjct  521   KPDITAPGVSVIAAYTEAAGPTDEEFDKRRVPFNAVSGTSMSCPHVSGVAGLLKTLHPEW  580

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMT+AT++ N+ ++I  + +  KATPF+YGAGHI PN A DPGLVYDL + D
Sbjct  581   SPAAIRSAIMTSATIQDNAMESII-NASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIED  639

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y NF+C+ GYN  +I+      Y C  HI L  FNYPSITVP L G+  VTRT+KNVG P
Sbjct  640   YPNFLCSLGYNAMQISMFSDGAYNCSKHIGLLDFNYPSITVPKLSGSIMVTRTVKNVGLP  699

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY AS+  P G SV V P  LKF+K+ E++SFKV LKAKG + T DY+FG L WSD +H
Sbjct  700   GTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLKAKGASVTGDYSFGELIWSDTEH  759

Query  131   RVRSPIVVKA  102
              VRSPIVVKA
Sbjct  760   YVRSPIVVKA  769



>ref|XP_006601388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=561

 Score =   461 bits (1185),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 276/368 (75%), Gaps = 2/368 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S LC  GT+DPEKA+GK+LVCLRGVTAR +KS  A  AGA GMIL NDE SGNE+IAD H
Sbjct  191   STLCMRGTIDPEKARGKILVCLRGVTARVEKSLVALKAGAAGMILCNDELSGNELIADPH  250

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DGLA++ Y+N T+NP+ +I  P T L +KPAP +AAFSSRGPN + P+IL
Sbjct  251   LLPASQINYEDGLAVYAYMNSTKNPLGYIDPPKTKLQIKPAPSMAAFSSRGPNIVTPEIL  310

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAA++E   P+D ++DKR V F   SGTSMSCPHVAGVVGLLKTL+P W
Sbjct  311   KPDVTAPGVNIIAAYSEGVSPTDMNFDKRRVPFITMSGTSMSCPHVAGVVGLLKTLHPDW  370

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP  I+SA++TTA  R N+GK + D      ATPFAYG+GHI PN A DPGLVYDL   D
Sbjct  371   SPTVIKSALLTTARTRDNTGKPMLDGGNNANATPFAYGSGHIRPNRAMDPGLVYDLTNND  430

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+C  GYN+++I    G  Y+CPD I++  FNYP+IT+P L G+ ++TR +KNVGSP
Sbjct  431   YLNFLCVSGYNQSQIEMFSGAHYRCPDIINILDFNYPTITIPKLYGSVSLTRRVKNVGSP  490

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TYTA ++ PVG S++V P +LKF+ +GEE+SFK+T++           FG +TWSD KH
Sbjct  491   GTYTARLKVPVGLSISVEPNVLKFDNIGEEKSFKLTVEVTRPGVAT--TFGGITWSDGKH  548

Query  131   RVRSPIVV  108
             +VRS IVV
Sbjct  549   QVRSQIVV  556



>ref|XP_011000330.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=775

 Score =   467 bits (1202),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/367 (61%), Positives = 275/367 (75%), Gaps = 1/367 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKPGTLD +K KGK+LVCLRG+  R +K H A LAGAVGMILANDE+SGN I+ADAH L
Sbjct  405   LCKPGTLDSKKVKGKILVCLRGINPRVEKGHVALLAGAVGMILANDEESGNGILADAHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA H+   DG A+F Y+N T++P A+IT+  T LG KPAP +A+FSSRGPN +   ILKP
Sbjct  465   PAAHIISKDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAAFT ATGP+D  YDKR + FN ESGTSMSCPHV+G+VGLLK+L+P WSP
Sbjct  525   DITAPGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT R N+G  I  D +  +ATPFAYGAGH+ PN A+DPGLVYDL + D++
Sbjct  585   AAIRSAIMTTATTRDNNGDPIL-DSSNTRATPFAYGAGHVQPNRASDPGLVYDLTVNDFL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             N++C++GY   ++      PY CP   SL+ FNYPSI+  +L  T TV+R +KNVGSP  
Sbjct  644   NYLCSRGYTAKDLKLFTDKPYTCPKSFSLTDFNYPSISAINLNDTITVSRRVKNVGSPGK  703

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y   VR P G  V+V P  L F+K+GEE++FKVT K   +    DY FG+LTWSD KH V
Sbjct  704   YYIHVREPTGVLVSVTPTTLDFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGKHFV  763

Query  125   RSPIVVK  105
             RSP+VV+
Sbjct  764   RSPLVVR  770



>gb|KEH32715.1| subtilisin-like serine protease [Medicago truncatula]
Length=770

 Score =   467 bits (1201),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 225/366 (61%), Positives = 282/366 (77%), Gaps = 4/366 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GT+DPEKA+G++LVCLRG++AR +KS  A  A AVGMIL ND+ +GNE+IAD HFL
Sbjct  404   LCMNGTIDPEKARGRILVCLRGISARVEKSFVALEAEAVGMILCNDQSNGNELIADPHFL  463

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +TY+DG+A+F YIN T+NP+ +I  P T L +KPAP +AAFSSRGPN I P+ILKP
Sbjct  464   PATQITYADGVALFAYINSTKNPLGYIHPPTTKLNIKPAPSMAAFSSRGPNPITPEILKP  523

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN+IAA++ A  P++ D+DKR V F   SGTSMSCPHVAGVVGLLKTL+P+WSP
Sbjct  524   DVTAPGVNIIAAYSGAISPTELDFDKRRVPFITMSGTSMSCPHVAGVVGLLKTLHPNWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  R N+ K I DD T +KATPFAYG+GHI PN A DPGLVY+L + DY+
Sbjct  584   SAIKSAIMTTARTRDNTHKPILDD-TNVKATPFAYGSGHIRPNRAMDPGLVYELNINDYL  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+C  GYN+ +IT   GTPY C D I++  FNYP+IT+P L G+ T++R LKNVG P T
Sbjct  643   NFLCFLGYNQAQITMFSGTPYHCED-INILDFNYPTITIPKLYGSVTLSRKLKNVGPPGT  701

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YTAS+R PVG S++V PK LKF+K+GEE+SF +T++           FG LTWSD  H V
Sbjct  702   YTASLRVPVGLSISVQPKKLKFDKIGEEKSFSLTIEVTRSGMAT--VFGGLTWSDGTHYV  759

Query  125   RSPIVV  108
             RSPI V
Sbjct  760   RSPIAV  765



>ref|XP_009339280.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=815

 Score =   468 bits (1203),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/367 (62%), Positives = 273/367 (74%), Gaps = 3/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKPGTLD +KAKGK+LVC+RG   R DK  QA LAGAVGMIL ND+ SGNEIIAD H L
Sbjct  446   LCKPGTLDKKKAKGKILVCVRGQNPRADKGQQAILAGAVGMILVNDKLSGNEIIADPHLL  505

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HV YSDG ++F Y+  T+NP+A+I    T  G KPAP +A+FSSRGPNAI   ILKP
Sbjct  506   PASHVNYSDGKSVFAYMKSTKNPMAYINRVKTEQGTKPAPFMASFSSRGPNAIEQSILKP  565

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAA+T+ATGP+   +D R VSFN +SGTSMSCPHV+G+VGLLKTL+P+WSP
Sbjct  566   DITAPGVSIIAAYTQATGPTGQKFDNRRVSFNTQSGTSMSCPHVSGIVGLLKTLHPTWSP  625

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA+ R NS K    D ++ +ATPFAYGAGH  PN A DPGLVYDL   DY+
Sbjct  626   AAIKSAIMTTASKRDNS-KGTMLDSSKARATPFAYGAGHFQPNRAMDPGLVYDLTTDDYL  684

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSPA  309
             NF+CA+GYN T +      P+KC    SLS FNYPSITVP+L+ T  TVTR +KNVGSP 
Sbjct  685   NFLCARGYNATLLKVFSKEPHKCSKAYSLSDFNYPSITVPNLRDTPVTVTRRVKNVGSPG  744

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   ++ PVG SVTV P  L+F+  GEE+ F V LK K +    DY FG L W D KH 
Sbjct  745   TYVVRIKEPVGVSVTVKPSTLQFKSSGEEKKFNVVLKPKVQ-GPEDYVFGELNWMDGKHN  803

Query  128   VRSPIVV  108
             VRSPIVV
Sbjct  804   VRSPIVV  810



>ref|XP_008344750.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=627

 Score =   461 bits (1186),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 226/367 (62%), Positives = 276/367 (75%), Gaps = 3/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKP TLD +KA+GK+LVC+RG  AR +K  QA LAGAVGMIL ND+ SGNEIIAD H L
Sbjct  260   LCKPSTLDKKKAEGKILVCVRGENARANKGQQAILAGAVGMILVNDKLSGNEIIADPHLL  319

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HV +SD  ++F YI  T+ P+A+IT   T LG KPAP +A+FSSRGPN +   ILKP
Sbjct  320   PASHVNFSDXESVFAYIKSTKIPMAYITRVKTELGTKPAPFMASFSSRGPNPVEQSILKP  379

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAA+T+ATGP+D ++D R V FN ESGTSMSCPHV+G+VGLLKTL+P+W+P
Sbjct  380   DITAPGVSIIAAYTQATGPTDGEFDTRRVPFNTESGTSMSCPHVSGIVGLLKTLHPTWTP  439

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ K    D ++ +ATPFAYGAGH+ PN A DPGLVYDL   DY+
Sbjct  440   AAIKSAIMTTARKRDNN-KGTMLDSSKARATPFAYGAGHVQPNXAMDPGLVYDLTTDDYL  498

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSPA  309
             NF+CA+GYN T +      P+KCP   SLS FNYPSITVP+L+ T  TVTR +KNVGSP 
Sbjct  499   NFLCARGYNATLLKVFSKEPHKCPKAYSLSDFNYPSITVPNLRDTPVTVTRRVKNVGSPG  558

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   V+ PVG SVTV P  L+F+  GEE+ F V LKA+ +    DY FG L W+D KH 
Sbjct  559   TYVVRVKEPVGVSVTVKPGTLQFKSNGEEKKFTVVLKAQVQ-GPQDYVFGELNWTDGKHN  617

Query  128   VRSPIVV  108
             VRSPIVV
Sbjct  618   VRSPIVV  624



>gb|KDP32632.1| hypothetical protein JCGZ_13182 [Jatropha curcas]
Length=769

 Score =   466 bits (1198),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 223/371 (60%), Positives = 275/371 (74%), Gaps = 2/371 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC P  LDP+K KGK+LVCLRG   R +K  QA LAGAVGM+L NDE SGNEI+AD H
Sbjct  398   AMLCLPEALDPKKVKGKILVCLRGEIGRVNKGQQALLAGAVGMVLINDEKSGNEILADPH  457

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA HV +SDG A+  YIN T+ P+A++T   T    KPAPV+AAFSSRGP+ ++P IL
Sbjct  458   VLPAAHVNFSDGEAVLAYINSTKVPMAYMTRSRTQFDTKPAPVMAAFSSRGPSYVDPSIL  517

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV++IAAF+ A  P++ D+DKR ++FN ESGTSMSCPHV+G+VGLLKTL+P W
Sbjct  518   KPDITAPGVSIIAAFSLAVSPTEEDFDKRRIAFNTESGTSMSCPHVSGIVGLLKTLHPDW  577

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSA+MTTA  R N+ + I D  T  +ATPF YGAGH+NPN A DPGL+YDL   D
Sbjct  578   SPAAIRSALMTTARTRGNNMEPIIDSSTNKEATPFDYGAGHVNPNKAMDPGLIYDLTEND  637

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTAT-VTRTLKNVGS  315
             Y+NF+CA+GYNKT+I      PY CP    ++ FNYPSIT+P L      VTR +KNVGS
Sbjct  638   YLNFLCAKGYNKTQIRLFSSKPYSCPKSFKIADFNYPSITIPSLISLGGPVTRRVKNVGS  697

Query  314   -PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
              P+ Y A+V++P G SV V PK L+FEK GEE+ FKV LK+  +N   DY FG L WSD 
Sbjct  698   GPSKYCANVKAPHGVSVLVEPKCLEFEKTGEEKIFKVALKSLVKNEVKDYVFGKLIWSDG  757

Query  137   KHRVRSPIVVK  105
             KH VRSPIVV+
Sbjct  758   KHYVRSPIVVR  768



>ref|XP_010092360.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51036.1| Subtilisin-like protease [Morus notabilis]
Length=732

 Score =   464 bits (1194),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 226/374 (60%), Positives = 283/374 (76%), Gaps = 4/374 (1%)
 Frame = -3

Query  1217  SCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             S +LLCK GTLDP+K KGK++VCLRG  ART+K   A+LAGAVGMILAND  SGNEIIAD
Sbjct  358   SEALLCKNGTLDPKKVKGKIVVCLRGDIARTEKGQYASLAGAVGMILANDLQSGNEIIAD  417

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
             AH LPA+H+ ++DG ++F Y+N T+ P+A++T   T +G+KPAP +A+FSSRGPN I   
Sbjct  418   AHLLPASHINFTDGNSVFAYLNSTKTPMAYMTRVKTEVGIKPAPFMASFSSRGPNTIEEA  477

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             +LKPDI+APGVN+IAA+T+A GP+D D+DKR V FN ESGTSMSCPHV+G+VGLLKTL+P
Sbjct  478   LLKPDITAPGVNIIAAYTQAAGPTDQDFDKRRVPFNTESGTSMSCPHVSGIVGLLKTLHP  537

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
              WSPA I+SAIMT+A  R ++ + + D   + KATPFAYGAGHI PN A DPGLVYDL  
Sbjct  538   DWSPAAIKSAIMTSARTRDDNKEPLLDSSMK-KATPFAYGAGHIQPNHAMDPGLVYDLTT  596

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA-TVTRTLKNV  321
              DY+NF+CA+GYN+T +      P+ CP   +L+ FNYPSI VP+L   +  V+R +KNV
Sbjct  597   DDYLNFLCARGYNETLLKLFSDKPHNCPKSFTLANFNYPSIVVPNLGSESIVVSRRVKNV  656

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATAD-YAFGVLTW  147
             G+P  YT  V+ P G SV+V PK LKF K+GEE+ F V +K KG   +T D Y FG L W
Sbjct  657   GTPGIYTVYVKQPAGVSVSVWPKSLKFSKIGEEKKFNVFVKTKGVGKSTKDGYVFGHLKW  716

Query  146   SDKKHRVRSPIVVK  105
             SD KH VRSPIVVK
Sbjct  717   SDGKHNVRSPIVVK  730



>ref|XP_008357992.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=583

 Score =   459 bits (1181),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 222/371 (60%), Positives = 276/371 (74%), Gaps = 2/371 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK GTLDP+K KGK+L CLRG  A  DK  QA LAGAVGMILAN+  +GNEII+D H 
Sbjct  214   LLCKAGTLDPKKVKGKILACLRGDNAXVDKGEQALLAGAVGMILANNAJNGNEIISDPHV  273

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+H+ ++DG+ +F YIN T++P A+I    T LG KP+P +A FSS+GPN I P IL 
Sbjct  274   LPASHINFTDGILVFAYINSTKSPRAYIKRAITELGTKPSPFMAXFSSKGPNTITPGILX  333

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV+VIAA+T+A GP++  +D R + FN  SGTSMSCPH++G+ GLLKTLYP WS
Sbjct  334   PDITAPGVSVIAAYTKAXGPTNQMFDXRRIPFNSXSGTSMSCPHISGICGLLKTLYPHWS  393

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA I+SAIMTTA  R NS   +  + +  +ATPF+YGAGH++PN A DPGLVYDL   DY
Sbjct  394   PAAIKSAIMTTAITRDNSMXPLL-NASFYEATPFSYGAGHVBPNSAMDPGLVYDLSXNDY  452

Query  488   VNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             +NF+CA GYN+TE+       Y+CP   IS +  NYPSITVP L G+  VTRT+KNVGSP
Sbjct  453   LNFLCAMGYNETEMEMFSEDTYECPKPAISPTNLNYPSITVPKLSGSLEVTRTVKNVGSP  512

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A+++SP G S++V PK LKF K+GEE+SFKV L+ K  N   +Y FG L WSD KH
Sbjct  513   GTYKANIQSPDGVSISVEPKKLKFMKIGEEKSFKVLLQVKEANQAKNYVFGKLIWSDGKH  572

Query  131   RVRSPIVVKAA  99
              VRSPIVVKA+
Sbjct  573   YVRSPIVVKAS  583



>ref|XP_008353281.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=773

 Score =   463 bits (1192),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 228/371 (61%), Positives = 279/371 (75%), Gaps = 3/371 (1%)
 Frame = -3

Query  1217  SCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             S + LCKP TLD +KA+GK+LVC+RG  AR +K  QA LAGAVGMIL ND+ SGNEIIAD
Sbjct  402   SEAQLCKPSTLDKKKAEGKILVCVRGENARANKGQQAILAGAVGMILVNDKLSGNEIIAD  461

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
              H LPA+HV +SD  ++F YI  T+ P+A+IT   T LG KPAP +A+FSSRGPN +   
Sbjct  462   PHLLPASHVNFSDXESVFAYIKSTKIPMAYITRVKTELGTKPAPFMASFSSRGPNPVEQS  521

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI+APGV++IAA+T+ATGP+D ++D R V FN ESGTSMSCPHV+G+VGLLKTL+P
Sbjct  522   ILKPDITAPGVSIIAAYTQATGPTDGEFDTRRVPFNTESGTSMSCPHVSGIVGLLKTLHP  581

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             +W+PA I+SAIMTTA  R N+ K    D ++ +ATPFAYGAGH+ PN A DPGLVYDL  
Sbjct  582   TWTPAAIKSAIMTTARKRDNN-KGTMLDSSKARATPFAYGAGHVQPNXAMDPGLVYDLTT  640

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKNV  321
              DY+NF+CA+GYN T +      P+KCP   SLS FNYPSITVP+L+ T  TVTR +KNV
Sbjct  641   DDYLNFLCARGYNATLLKVFSKEPHKCPKAYSLSDFNYPSITVPNLRDTPVTVTRRVKNV  700

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
             GSP TY   V+ PVG SVTV P  L+F+  GEE+ FKV LKA+ +    DY FG L W+D
Sbjct  701   GSPGTYVVRVKEPVGVSVTVKPGTLQFKSNGEEKKFKVVLKARVQ-GPQDYIFGELNWTD  759

Query  140   KKHRVRSPIVV  108
              KH VRSPIVV
Sbjct  760   GKHNVRSPIVV  770



>ref|XP_008218932.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   463 bits (1191),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 226/372 (61%), Positives = 275/372 (74%), Gaps = 3/372 (1%)
 Frame = -3

Query  1220  NSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIA  1041
             +S + LCK G+L+ +K +GK+LVC+RG  AR DK  QA LAGAVGMIL ND+ SGNEIIA
Sbjct  402   SSDAQLCKAGSLEKKKVEGKILVCIRGENARADKGQQAVLAGAVGMILVNDKLSGNEIIA  461

Query  1040  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  861
             D H LP +HV YSDG A+F YI  T+ PVA++T   T +G KPAP +A+FSSRGPN I  
Sbjct  462   DPHLLPTSHVNYSDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPAPFMASFSSRGPNTIEQ  521

Query  860   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  681
              ILKPDI+APGV++IAA+T A GP+D  +DKR VSFN ESGTSMSCPHV+G+VGLLKTL+
Sbjct  522   SILKPDITAPGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSMSCPHVSGIVGLLKTLH  581

Query  680   PSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLK  501
             PSWSPA I+SAIMTTA  R N+ +A+  D ++ +ATPFAYGAGH+ PN A DPGLVYDL 
Sbjct  582   PSWSPAAIKSAIMTTARKRDNNKEAM-QDSSKARATPFAYGAGHVQPNRAMDPGLVYDLT  640

Query  500   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKN  324
               DY+NF+CA+GYN T +      P+ CP   SL+ FNYPS+TVP L      VTR +KN
Sbjct  641   TDDYLNFLCARGYNATLLKVFSNEPHTCPKAYSLADFNYPSVTVPDLHDKPVAVTRRVKN  700

Query  323   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  144
             VGSP TY   ++ P G SV+V P  L+F+ VGEE+ FKV LK K +  T DY FG L WS
Sbjct  701   VGSPGTYVVHIKEPAGVSVSVKPSSLQFKTVGEEKKFKVVLKPKVQ-GTQDYVFGELNWS  759

Query  143   DKKHRVRSPIVV  108
             D KH VRSPIVV
Sbjct  760   DGKHNVRSPIVV  771



>ref|XP_008462020.1| PREDICTED: subtilisin-like protease isoform X2 [Cucumis melo]
Length=655

 Score =   458 bits (1179),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/368 (61%), Positives = 275/368 (75%), Gaps = 2/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK GTLDP KAKGK+LVCLRG  AR DK  QA LAGA GMILAN+E SGNEI+AD H L
Sbjct  287   LCKAGTLDPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  346

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA H+ Y+DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  347   PALHINYTDGSAVFAYINSTKFPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  406

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APG++VIAA+TEA GP++ ++D R V FN  SGTSMSCPHV+G+ GLL+TLYP WSP
Sbjct  407   DITAPGLSVIAAYTEAEGPTNQEFDNRRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSP  466

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA+   N+ + +  + +   ATPF YGAGH++PNGA DPGLVYD+ + +Y+
Sbjct  467   AAIKSAIMTTASTLDNNFEPLL-NASYFVATPFNYGAGHVHPNGATDPGLVYDIDVNEYL  525

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CA GY+K +I+     P+ C + ISL+  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  526   SFLCALGYDKAQISQFSDGPFNCSEPISLTNLNYPSITVPKLSRSITITRRLKNVGSPGT  585

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  129
             Y A +R P G SV V PK L F K+GEE SFKV +K KG   A  +Y +G L WSD KH 
Sbjct  586   YEAKIRKPAGISVWVKPKKLNFTKLGEELSFKVFMKVKGHKVAKKNYVYGDLIWSDGKHH  645

Query  128   VRSPIVVK  105
             VRSPIVVK
Sbjct  646   VRSPIVVK  653



>ref|XP_008384613.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=776

 Score =   462 bits (1188),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 227/367 (62%), Positives = 273/367 (74%), Gaps = 3/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKPGTLD +KAKGK+LVC+RG   R +K  QA LAGAVGMIL ND+ SGNEIIAD H L
Sbjct  407   LCKPGTLDKKKAKGKILVCVRGQNPRANKGQQAILAGAVGMILVNDKLSGNEIIADPHLL  466

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HV YSDG ++  YI  T+NP+A+I    T  G KPAP +A+FSSRGPN I   ILKP
Sbjct  467   PASHVNYSDGKSVXAYIKSTKNPMAYINRVKTEQGTKPAPFMASFSSRGPNXIEQSILKP  526

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAA+T+ATGP+   +D R VSFN +SGTSMSCPHV+G+VGLLKTL+P+WSP
Sbjct  527   DITAPGVSIIAAYTQATGPTGQKFDNRRVSFNTQSGTSMSCPHVSGIVGLLKTLHPTWSP  586

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA+ R NS K    D ++ +ATPFAYGAGH+ PN A DPGLVYDL   DY+
Sbjct  587   AAIKSAIMTTASKRDNS-KGTMLDSSKARATPFAYGAGHVQPNRAMDPGLVYDLTTDDYL  645

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSPA  309
             NF+CA+GYN T +      P+KC    SL  FNYPSITVP+L+ T  TVTR +KNVGSP 
Sbjct  646   NFLCARGYNATLLKVFSKEPHKCSKAYSLFDFNYPSITVPNLRDTPVTVTRRVKNVGSPG  705

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   ++ PVG SVTV P  L+F+  GEE+ FKV LK K +    DY FG L W+D KH 
Sbjct  706   TYVVRIKEPVGVSVTVKPSTLQFKNSGEEKKFKVVLKPKVQ-GPEDYVFGELNWTDGKHN  764

Query  128   VRSPIVV  108
             VRSPIVV
Sbjct  765   VRSPIVV  771



>ref|XP_007207992.1| hypothetical protein PRUPE_ppa015005mg, partial [Prunus persica]
 gb|EMJ09191.1| hypothetical protein PRUPE_ppa015005mg, partial [Prunus persica]
Length=746

 Score =   461 bits (1185),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 226/372 (61%), Positives = 274/372 (74%), Gaps = 3/372 (1%)
 Frame = -3

Query  1220  NSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIA  1041
             +S + LCK G+L+ +K +GK+LVC+RG  AR DK  QA LAGAVGMIL ND+ SGNEIIA
Sbjct  374   SSDAQLCKAGSLEKKKVEGKILVCIRGENARADKGQQAVLAGAVGMILVNDKLSGNEIIA  433

Query  1040  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  861
             D H LP +HV YSDG A+F YI  T+ PVA++T   T +G KPAP +A+FSSRGPN I  
Sbjct  434   DPHLLPTSHVNYSDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPAPFMASFSSRGPNTIEQ  493

Query  860   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  681
              ILKPDI+APGV++IAA+T A GP+D  +DKR VSFN ESGTSMSCPHV+G+VGLLKTL+
Sbjct  494   SILKPDITAPGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSMSCPHVSGIVGLLKTLH  553

Query  680   PSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLK  501
             PSWSPA I+SAIMTTA  R N  +A+  D ++ +ATPFAYGAGH+ PN A DPGLVYDL 
Sbjct  554   PSWSPAAIKSAIMTTARKRDNKKEAM-QDSSKARATPFAYGAGHVQPNRAMDPGLVYDLT  612

Query  500   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKN  324
               DY+NF+C +GYN T +      P+ CP   SL+ FNYPSITVP L     TVTR +KN
Sbjct  613   TDDYLNFLCFRGYNATLLKVFSNEPHTCPKAYSLADFNYPSITVPDLHDKPVTVTRRVKN  672

Query  323   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  144
             VGSP TY   ++ P G SV+V P  L+F+ +GEE+ FKV LK K + A  DY FG L WS
Sbjct  673   VGSPGTYVVHIKEPAGVSVSVKPGSLQFKTIGEEKKFKVVLKPKVQGAQ-DYVFGELNWS  731

Query  143   DKKHRVRSPIVV  108
             D KH VRSPIVV
Sbjct  732   DGKHNVRSPIVV  743



>ref|XP_002525223.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37189.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=761

 Score =   460 bits (1184),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 220/356 (62%), Positives = 268/356 (75%), Gaps = 1/356 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKPG+LDP+K KGK+L CLRG  AR DK  QAA AGA GMIL ND+ SGNE+IAD H L
Sbjct  402   LCKPGSLDPKKVKGKILACLRGDNARVDKGRQAAEAGAAGMILCNDKASGNEVIADPHVL  461

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ Y+DGLA+  YIN + NP+A+IT P    GVKPAP +AAFSS GPN + P+ILKP
Sbjct  462   PASHLNYADGLAVLTYINTSSNPLAYITTPTAATGVKPAPFMAAFSSIGPNTVTPEILKP  521

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN+IAAFTEAT P+D ++DKR V +   SGTSMSCPHV+GV GLLK L+P WSP
Sbjct  522   DITAPGVNIIAAFTEATSPTDLEFDKRRVPYTTMSGTSMSCPHVSGVAGLLKKLHPDWSP  581

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSA+ TTA  R N+   + D  T  K+TPF++G+GHI PN A DPGLVYDL + DY+
Sbjct  582   AAIRSALTTTARSRDNTVHPMLDGSTFEKSTPFSHGSGHIRPNRAMDPGLVYDLGVNDYL  641

Query  485   NFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +F+CA GYN+T I A+  G PY+CP   SL  FNYPS+TVP L+G+ T TR LKNVGSP 
Sbjct  642   DFLCALGYNETSIKALNDGEPYECPKSASLLDFNYPSMTVPKLRGSVTATRKLKNVGSPG  701

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
              Y   V+ P G SV+V P+ L F+K+GEE+SFKVT +AK E A  DY FG LTW+D
Sbjct  702   KYQVVVKQPYGISVSVEPRALTFDKIGEEKSFKVTFRAKWEGAAKDYEFGGLTWTD  757



>gb|KCW89054.1| hypothetical protein EUGRSUZ_A01380 [Eucalyptus grandis]
Length=764

 Score =   460 bits (1184),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 234/387 (60%), Positives = 281/387 (73%), Gaps = 2/387 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCL-RGVTARTDKSHQAALAGAVGM  1083
             LIS     L+ +    +L CK GTLDP K KG +LVCL  G  A   +  QA LAGAVGM
Sbjct  378   LISAADARLSHVSAHEALFCKDGTLDPRKVKGNILVCLLEGEYATVYEGAQAFLAGAVGM  437

Query  1082  ILANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPV  903
             +LAN   SGNEI+AD H LPA+HV Y DG AIF YI  T+ P A IT   T LGVKP+P+
Sbjct  438   VLANSILSGNEILADPHLLPASHVNYDDGAAIFSYIKSTKFPTARITRVVTNLGVKPSPL  497

Query  902   IAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSC  723
             +AAFSSRGPN I P+ILKPDI+APGV+VIAA++EA GP++ + DKR V FN ESGTSMSC
Sbjct  498   MAAFSSRGPNTITPEILKPDITAPGVSVIAAYSEAAGPTNEEIDKRRVPFNAESGTSMSC  557

Query  722   PHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHIN  543
             PHV+GV GLLKTL+P WSPA IRSAIMT+AT++ N+ ++I  + +  KATPF+YGAGHI 
Sbjct  558   PHVSGVAGLLKTLHPEWSPAAIRSAIMTSATIQDNAMESII-NASYYKATPFSYGAGHIQ  616

Query  542   PNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH  363
             PN A DPGLVYDL + DY+N +C+ GYN T+I+      Y C   I L  FNYPSITVP 
Sbjct  617   PNRAMDPGLVYDLGIKDYLNLLCSLGYNATQISLFSDGAYNCSKRIGLLDFNYPSITVPK  676

Query  362   LKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  183
             L G+  VTRT+KNVG P TY AS+  P G SV V P  LKF+K+ E++SFKV LKAKG +
Sbjct  677   LSGSIMVTRTVKNVGLPGTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLKAKGAS  736

Query  182   ATADYAFGVLTWSDKKHRVRSPIVVKA  102
              T DY+FG L WSD +H VRSPIVVKA
Sbjct  737   VTGDYSFGELIWSDTEHYVRSPIVVKA  763



>ref|XP_010048355.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=781

 Score =   460 bits (1184),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 234/387 (60%), Positives = 281/387 (73%), Gaps = 2/387 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCL-RGVTARTDKSHQAALAGAVGM  1083
             LIS     L+ +    +L CK GTLDP K KG +LVCL  G  A   +  QA LAGAVGM
Sbjct  395   LISAADARLSHVSAHEALFCKDGTLDPRKVKGNILVCLLEGEYATVYEGAQAFLAGAVGM  454

Query  1082  ILANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPV  903
             +LAN   SGNEI+AD H LPA+HV Y DG AIF YI  T+ P A IT   T LGVKP+P+
Sbjct  455   VLANSILSGNEILADPHLLPASHVNYDDGAAIFSYIKSTKFPTARITRVVTNLGVKPSPL  514

Query  902   IAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSC  723
             +AAFSSRGPN I P+ILKPDI+APGV+VIAA++EA GP++ + DKR V FN ESGTSMSC
Sbjct  515   MAAFSSRGPNTITPEILKPDITAPGVSVIAAYSEAAGPTNEEIDKRRVPFNAESGTSMSC  574

Query  722   PHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHIN  543
             PHV+GV GLLKTL+P WSPA IRSAIMT+AT++ N+ ++I  + +  KATPF+YGAGHI 
Sbjct  575   PHVSGVAGLLKTLHPEWSPAAIRSAIMTSATIQDNAMESII-NASYYKATPFSYGAGHIQ  633

Query  542   PNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH  363
             PN A DPGLVYDL + DY+N +C+ GYN T+I+      Y C   I L  FNYPSITVP 
Sbjct  634   PNRAMDPGLVYDLGIKDYLNLLCSLGYNATQISLFSDGAYNCSKRIGLLDFNYPSITVPK  693

Query  362   LKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  183
             L G+  VTRT+KNVG P TY AS+  P G SV V P  LKF+K+ E++SFKV LKAKG +
Sbjct  694   LSGSIMVTRTVKNVGLPGTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLKAKGAS  753

Query  182   ATADYAFGVLTWSDKKHRVRSPIVVKA  102
              T DY+FG L WSD +H VRSPIVVKA
Sbjct  754   VTGDYSFGELIWSDTEHYVRSPIVVKA  780



>ref|XP_004167057.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=673

 Score =   456 bits (1173),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/368 (60%), Positives = 277/368 (75%), Gaps = 2/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK GTL+P KAKGK+LVCLRG  AR DK  QA LAGA GMILAN+E SGNEI+AD H L
Sbjct  305   LCKAGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  364

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ ++DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  365   PASHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  424

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APG++VIAA+TEA GP++ ++D R + FN  SGTSMSCPHV+G+ GLLKTLYP WSP
Sbjct  425   DITAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSP  484

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA++  N+ + + +    + A+PF YGAGH++PNGAADPGLVYD+++ +Y+
Sbjct  485   AAIKSAIMTTASILDNNFEPLLNASYSV-ASPFNYGAGHVHPNGAADPGLVYDIEVNEYL  543

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CA GYNK +I+     P+ C D IS +  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  544   SFLCALGYNKAQISQFSNGPFNCSDPISPTNLNYPSITVPKLSRSITITRRLKNVGSPGT  603

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  129
             Y A +R P G SV V PK L F ++GEE SFKV +K K    A  +Y +G L WSD KH 
Sbjct  604   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHH  663

Query  128   VRSPIVVK  105
             VRSPIVVK
Sbjct  664   VRSPIVVK  671



>ref|XP_008462019.1| PREDICTED: subtilisin-like protease isoform X1 [Cucumis melo]
Length=773

 Score =   459 bits (1181),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/368 (61%), Positives = 275/368 (75%), Gaps = 2/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK GTLDP KAKGK+LVCLRG  AR DK  QA LAGA GMILAN+E SGNEI+AD H L
Sbjct  405   LCKAGTLDPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA H+ Y+DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  465   PALHINYTDGSAVFAYINSTKFPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APG++VIAA+TEA GP++ ++D R V FN  SGTSMSCPHV+G+ GLL+TLYP WSP
Sbjct  525   DITAPGLSVIAAYTEAEGPTNQEFDNRRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA+   N+ + +  + +   ATPF YGAGH++PNGA DPGLVYD+ + +Y+
Sbjct  585   AAIKSAIMTTASTLDNNFEPLL-NASYFVATPFNYGAGHVHPNGATDPGLVYDIDVNEYL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CA GY+K +I+     P+ C + ISL+  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  644   SFLCALGYDKAQISQFSDGPFNCSEPISLTNLNYPSITVPKLSRSITITRRLKNVGSPGT  703

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  129
             Y A +R P G SV V PK L F K+GEE SFKV +K KG   A  +Y +G L WSD KH 
Sbjct  704   YEAKIRKPAGISVWVKPKKLNFTKLGEELSFKVFMKVKGHKVAKKNYVYGDLIWSDGKHH  763

Query  128   VRSPIVVK  105
             VRSPIVVK
Sbjct  764   VRSPIVVK  771



>emb|CDY65695.1| BnaA02g06820D [Brassica napus]
Length=541

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 271/373 (73%), Gaps = 3/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK  +LDPEK KGK++VCLRG  AR DK  QAA AGAVGMIL ND+ SGNEII+DAH
Sbjct  171   ALLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEIISDAH  230

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T++P  +IT PNT L  KPAP +A+FSSRGPN I P IL
Sbjct  231   VLPASQINYKDGEAVFSYLNSTKDPKGYITAPNTQLHTKPAPFMASFSSRGPNTITPGIL  290

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVNV+AA+TEATGP+D + D R   FNVESGTSMSCPH++G+VGLLKTL P W
Sbjct  291   KPDITAPGVNVVAAYTEATGPTDIESDNRRTPFNVESGTSMSCPHISGIVGLLKTLRPQW  350

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N+ K +  D T  KATPF YGAGH+ PN A+ PGLVYDL   D
Sbjct  351   SPAAIRSAIMTTSRTRDNTRKPMV-DATFHKATPFGYGAGHVQPNKASHPGLVYDLNTGD  409

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GY    +      P Y C +  +L  FNYPSITVP L  + T+TR L NVG 
Sbjct  410   YLDFLCAIGYENKVVQLFADDPLYTCREGANLLDFNYPSITVPKLTDSVTITRKLTNVGP  469

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P+TY +   +P+G  V+V PK L F KVGEE+ F++T+ A  E A   Y FG LTW+D K
Sbjct  470   PSTYRSYFHAPLGVEVSVEPKQLTFSKVGEEKMFQMTIGATSEKALG-YVFGELTWTDSK  528

Query  134   HRVRSPIVVKAAA  96
             H VR+PIVV+ ++
Sbjct  529   HYVRTPIVVQLSS  541



>gb|KGN43389.1| hypothetical protein Csa_7G030520 [Cucumis sativus]
Length=736

 Score =   456 bits (1174),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 220/368 (60%), Positives = 277/368 (75%), Gaps = 2/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK GTL+P KAKGK+LVCLRG  AR DK  QA LAGA GMILAN+E SGNEI+AD H L
Sbjct  368   LCKAGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  427

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ ++DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  428   PASHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  487

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APG++VIAA+TEA GP++ ++D R + FN  SGTSMSCPHV+G+ GLLKTLYP WSP
Sbjct  488   DITAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSP  547

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA++  N+ + + +    + A+PF YGAGH++PNGAADPGLVYD+++ +Y+
Sbjct  548   AAIKSAIMTTASILDNNFEPLLNASYSV-ASPFNYGAGHVHPNGAADPGLVYDIEVNEYL  606

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CA GYNK +I+     P+ C D IS +  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  607   SFLCALGYNKAQISQFSNGPFNCSDPISPTNLNYPSITVPKLSRSITITRRLKNVGSPGT  666

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  129
             Y A +R P G SV V PK L F ++GEE SFKV +K K    A  +Y +G L WSD KH 
Sbjct  667   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHH  726

Query  128   VRSPIVVK  105
             VRSPIVVK
Sbjct  727   VRSPIVVK  734



>ref|XP_008380083.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=593

 Score =   451 bits (1161),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 276/371 (74%), Gaps = 2/371 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK GTLDP+K KGK+L CLRG  A  DK  QA LAGAVGMILAN+  +GNEII+D H 
Sbjct  224   LLCKAGTLDPKKVKGKILACLRGDNAXVDKGEQALLAGAVGMILANNAJNGNEIISDPHV  283

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+H+ ++DG+ +F YIN T++P A+I    T LG KP+P +A FSS+GPN I P ILK
Sbjct  284   LPASHINFTDGILVFAYINSTKSPRAYIKRAITELGTKPSPFMAXFSSKGPNTITPGILK  343

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV+VIAA+T+A GP++  +D+R + FN  SGTSMSCPH++G+ GLLKTLYP WS
Sbjct  344   PDITAPGVSVIAAYTKARGPTNQMFDQRRIPFNSASGTSMSCPHISGICGLLKTLYPHWS  403

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA I+SAIMTTA  R NS   +  + +  +ATPF+YGAGH++PN A DPGLVYDL L DY
Sbjct  404   PAAIKSAIMTTAITRDNSMGPLL-NASFYEATPFSYGAGHVDPNSAMDPGLVYDLSLNDY  462

Query  488   VNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             +NF+CA GYN+TE+       Y+CP   IS +  NYPSIT+P L G+  VTRT+KNVGSP
Sbjct  463   LNFLCAMGYNETEMEMFSEDTYECPKPAISPTNLNYPSITIPKLSGSLEVTRTVKNVGSP  522

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A ++SP G SV+V PK LKF+K+GEE+SFKV L+ K      +Y  G L  SD KH
Sbjct  523   GTYKAYIQSPDGVSVSVEPKKLKFKKIGEEKSFKVLLQVKEAKQAKNYVXGKLIXSDGKH  582

Query  131   RVRSPIVVKAA  99
              VRSPIVVKA+
Sbjct  583   XVRSPIVVKAS  593



>ref|XP_007020377.1| Xylem serine proteinase 1, putative [Theobroma cacao]
 gb|EOY11902.1| Xylem serine proteinase 1, putative [Theobroma cacao]
Length=770

 Score =   457 bits (1176),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 227/368 (62%), Positives = 278/368 (76%), Gaps = 1/368 (0%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             +LC+PGTLDP+K KGK++VC+RGV ARTDKS QA LAGAVGMILANDE SGN I+AD H 
Sbjct  402   ILCQPGTLDPKKVKGKIIVCVRGVNARTDKSQQALLAGAVGMILANDEKSGNGIMADPHL  461

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPATH++++DG  +F YIN T+ P A+IT   T LG KPAP +A+FSSRGPN I P ILK
Sbjct  462   LPATHISFTDGETVFAYINSTKKPTAYITPAKTELGSKPAPFMASFSSRGPNVIEPSILK  521

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV++IAAF+EA GPS+   DKR + F   SGTSMSCPHV+G+VGLLK+L+P WS
Sbjct  522   PDITAPGVSIIAAFSEAVGPSEETSDKRRMPFTSMSGTSMSCPHVSGIVGLLKSLHPDWS  581

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             P+ I+SAIMT+A  R N+G  +  D T  KATPFAYG GH+ PN A DPGLVYDL + DY
Sbjct  582   PSAIKSAIMTSARTRDNTGNPMV-DSTNKKATPFAYGGGHVRPNRAMDPGLVYDLTVDDY  640

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +N++C++GYN++ I      PY CP   SLS FNYPSI+V    G+ATV+R +KNVGSP 
Sbjct  641   LNYLCSRGYNQSMIRLFSDKPYTCPKSFSLSDFNYPSISVDKFGGSATVSRKVKNVGSPG  700

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A VRSP G +V+VNP  L FEK GEE+ F+VT KAK     A + FG L WS+  H 
Sbjct  701   TYRARVRSPAGVTVSVNPSTLTFEKKGEEKKFEVTFKAKSNGQPAGFVFGQLIWSNGHHY  760

Query  128   VRSPIVVK  105
             VRSP+VVK
Sbjct  761   VRSPLVVK  768



>ref|XP_009794911.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=374

 Score =   443 bits (1139),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 217/372 (58%), Positives = 266/372 (72%), Gaps = 1/372 (0%)
 Frame = -3

Query  1214  CSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADA  1035
             CS  C  GTLDP+K KG +LVC RG +   DK  QA L GAVG+++ N    GNE+ A+ 
Sbjct  4     CSNFCIGGTLDPKKTKGAILVCHRGGSPGFDKCTQATLVGAVGIVILNSAFFGNEMYAEP  63

Query  1034  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  855
             +  PAT ++YSD L +  Y+N TR P A+IT P T LG KPAP++AAFSS GPN + P+I
Sbjct  64    YICPATLISYSDALEVLAYLNSTRKPTAYITRPTTELGTKPAPIVAAFSSIGPNRVTPEI  123

Query  854   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             LKPDI APGV++IAA+T    P+   +D R V FN  +GTSMSCPHVAGVVGLLK L+P+
Sbjct  124   LKPDIIAPGVSIIAAYTGVQPPTQMGFDDRRVKFNTMTGTSMSCPHVAGVVGLLKALHPT  183

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WS A I+SAIMT+A  R N+ K +T + T LK TPFAYGAG+I PN A DPGLVYDL + 
Sbjct  184   WSAAAIKSAIMTSARTRDNTFKPMT-NSTNLKVTPFAYGAGNIWPNRAMDPGLVYDLTID  242

Query  494   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             DY++F+CAQGYN+T+I       +KCP+ IS    N PSITVP L G+  VTRTLKNVGS
Sbjct  243   DYMSFLCAQGYNETQINIFSQGYFKCPEPISFINLNLPSITVPKLNGSVVVTRTLKNVGS  302

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A +RSP G SV + P  L+F K+GEE+SFK+TLK +G  A  DY FG L WSD K
Sbjct  303   PGTYKARIRSPAGISVVIEPNTLEFNKIGEEKSFKLTLKVRGNKAPKDYVFGQLIWSDGK  362

Query  134   HRVRSPIVVKAA  99
             H VRSPIVVKA+
Sbjct  363   HNVRSPIVVKAS  374



>ref|XP_004144624.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=758

 Score =   456 bits (1174),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 220/368 (60%), Positives = 277/368 (75%), Gaps = 2/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK GTL+P KAKGK+LVCLRG  AR DK  QA LAGA GMILAN+E SGNEI+AD H L
Sbjct  390   LCKAGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVL  449

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ ++DG A+F YIN T+ P A+IT   T LG++PAP +AAFSS GPN + P+ILKP
Sbjct  450   PASHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKP  509

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APG++VIAA+TEA GP++ ++D R + FN  SGTSMSCPHV+G+ GLLKTLYP WSP
Sbjct  510   DITAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSP  569

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA++  N+ + + +    + A+PF YGAGH++PNGAADPGLVYD+++ +Y+
Sbjct  570   AAIKSAIMTTASILDNNFEPLLNASYSV-ASPFNYGAGHVHPNGAADPGLVYDIEVNEYL  628

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CA GYNK +I+     P+ C D IS +  NYPSITVP L  + T+TR LKNVGSP T
Sbjct  629   SFLCALGYNKAQISQFSNGPFNCSDPISPTNLNYPSITVPKLSRSITITRRLKNVGSPGT  688

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKKHR  129
             Y A +R P G SV V PK L F ++GEE SFKV +K K    A  +Y +G L WSD KH 
Sbjct  689   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHH  748

Query  128   VRSPIVVK  105
             VRSPIVVK
Sbjct  749   VRSPIVVK  756



>gb|KGN55997.1| hypothetical protein Csa_3G045110 [Cucumis sativus]
Length=632

 Score =   451 bits (1161),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 212/367 (58%), Positives = 271/367 (74%), Gaps = 2/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDPEK KGK+++CLRG  AR DK + A  AGAVGMILAN E++G+EIIADAH L
Sbjct  264   LCLVGSLDPEKVKGKIIICLRGENARADKGYAAVKAGAVGMILANAEENGDEIIADAHLL  323

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             P +HV+Y+DG +I+ YIN T+ P+A++TH  T LG+KPAPV+A+FSSRGPN +   ILKP
Sbjct  324   PVSHVSYTDGQSIYQYINSTKTPMAYMTHVRTELGIKPAPVMASFSSRGPNTVEETILKP  383

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN++AA++E   PS + +DKR + FN+ SGTSMSCPH++G+VGLLKTLYP+WSP
Sbjct  384   DITAPGVNILAAYSEDASPSGSFFDKRRIPFNIVSGTSMSCPHISGIVGLLKTLYPNWSP  443

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  RAN    I +    LKA  FAYGAGH+ PN A +PGLVYDL   DY+
Sbjct  444   AAIKSAIMTTAESRANDMHPIQNG-GNLKANSFAYGAGHVQPNRAMNPGLVYDLTTKDYM  502

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSPA  309
             NF+CAQGYNK++I+      + C     L+ FNYPSI++P +K G  T+ R +KNVG P+
Sbjct  503   NFLCAQGYNKSQISKFSAMSFVCSKSFKLTDFNYPSISIPDMKSGVVTIKRRVKNVGKPS  562

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A V+ P G SV+V P+ LKF ++ EE+SFKV + +   N    Y FG L W D KH 
Sbjct  563   TYVARVKVPHGVSVSVEPRTLKFTRIDEEKSFKVVIGSVANNKHKGYVFGSLIWEDGKHH  622

Query  128   VRSPIVV  108
             VRSPIVV
Sbjct  623   VRSPIVV  629



>ref|XP_006350127.1| PREDICTED: subtilisin-like protease-like, partial [Solanum tuberosum]
Length=760

 Score =   455 bits (1171),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 271/367 (74%), Gaps = 1/367 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GTLDP+KAKG +LVC RG +   +K  QA   GAVG+++ N    GNE+ A+ +  
Sbjct  389   FCIEGTLDPKKAKGTILVCHRGGSPAFNKCTQATSVGAVGIVILNSAFFGNEMYAEPYLC  448

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH++YSDGL +  Y+N TR   A+IT P T LG KPAPV+AAFSS GPN + P+ILKP
Sbjct  449   PATHISYSDGLQVSSYVNSTRKATAYITRPTTELGTKPAPVMAAFSSIGPNRVTPEILKP  508

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+++AA+T   GP++ D D R V FN  +GTSMSCPHVAGVVGLLKTL+P+WSP
Sbjct  509   DITAPGVSILAAYTGVQGPTETDLDNRRVKFNTMTGTSMSCPHVAGVVGLLKTLHPTWSP  568

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMT+A  R N+   +T + T LKA+PFAYG+GHI PN A DPGLVYDL + DY+
Sbjct  569   AAIKSAIMTSARTRDNTINPMT-NSTHLKASPFAYGSGHIWPNRAMDPGLVYDLTINDYM  627

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CAQGY +T+I+      +KCPD IS S  N PSITVP L G+  VTRTLKNVGSP T
Sbjct  628   NFLCAQGYKETQISFFTQGHFKCPDPISFSNLNLPSITVPKLNGSIVVTRTLKNVGSPGT  687

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A +RSP+G +V V P  L+F+K+GEE+SFK+TLK KG  A  DY FG L WSD KH V
Sbjct  688   YKAHIRSPIGITVVVEPNTLEFKKIGEEKSFKITLKVKGHKAPKDYVFGHLIWSDNKHYV  747

Query  125   RSPIVVK  105
             RSPIVVK
Sbjct  748   RSPIVVK  754



>gb|KHN03560.1| Subtilisin-like protease, partial [Glycine soja]
Length=609

 Score =   450 bits (1158),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 213/366 (58%), Positives = 271/366 (74%), Gaps = 7/366 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GT+DPEKA+GK+LVCLRGVTAR +KS  A  AGA GMIL NDE SGNE+IAD H L
Sbjct  246   LCMRGTIDPEKARGKILVCLRGVTARVEKSLVALKAGAAGMILCNDELSGNELIADPHLL  305

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ + Y DGLA++ Y+N T+NP+ +I  P T L +KPAP +AAFSSRGPN + P+ILKP
Sbjct  306   PASQINYEDGLAVYAYMNSTKNPLGYIDPPKTKLQIKPAPSMAAFSSRGPNIVTPEILKP  365

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN+IAA++E   P+D D+DKR V F      +MSCPHVAGVVGLLKTL+P WSP
Sbjct  366   DVTAPGVNIIAAYSEGVSPTDMDFDKRRVPF-----ITMSCPHVAGVVGLLKTLHPDWSP  420

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
               I+SA++TTA  R N+GK + D      ATPFAYG+GHI PN A DPGLVYDL   DY+
Sbjct  421   TVIKSALLTTARTRDNTGKPMLDGGNNANATPFAYGSGHIRPNRAMDPGLVYDLTNNDYL  480

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+C  GYN ++I    G  Y+CPD I++  FNYP+IT+P L G+ ++TR +KNVGSP T
Sbjct  481   NFLCVSGYNHSQIEMFSGAHYRCPDIINILDFNYPTITIPKLYGSVSLTRRVKNVGSPGT  540

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YTA ++ PVG S++V P +LKF+ +GEE+SFK+T++           FG +TWSD KH+V
Sbjct  541   YTARLKVPVGLSISVEPNVLKFDNIGEEKSFKLTVEVTRPGVAT--TFGGITWSDGKHQV  598

Query  125   RSPIVV  108
             RS IVV
Sbjct  599   RSQIVV  604



>ref|XP_011039899.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=894

 Score =   459 bits (1180),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 224/370 (61%), Positives = 276/370 (75%), Gaps = 2/370 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC+ GTLDP+K  GK++VCLRG+ +R  K H+A LAGAVGMILAN+E+SG+E+++D H L
Sbjct  526   LCQNGTLDPKKVAGKIIVCLRGINSRVVKGHEAELAGAVGMILANNEESGSELLSDPHVL  585

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA H+T++DG A+ DYI  T+NP A I+  +T LGV P PV+AAFSSRGP+ I P ILKP
Sbjct  586   PAAHLTFTDGQAVMDYIKSTKNPTASISPVHTDLGVVPNPVMAAFSSRGPSVIEPAILKP  645

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGV+VIAAFTEA GPS+  +DKR   +   SGTSMSCPHV+G+VGLL+ ++P WSP
Sbjct  646   DVTAPGVDVIAAFTEAIGPSELPFDKRRTPYITMSGTSMSCPHVSGIVGLLRAIHPDWSP  705

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  ++NS K I D + +  ATPFAYGAGH+NPN AADPGLVYD  + DY+
Sbjct  706   AAIKSAIMTTAKTKSNSKKRILDADGQ-PATPFAYGAGHVNPNLAADPGLVYDTNVIDYL  764

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CA GYN T I    G PYKCP+  SL+ FNYPSITVP L G  TVTR +KNVG+P T
Sbjct  765   NFLCAHGYNSTFILEFSGVPYKCPEKASLAEFNYPSITVPDLNGPVTVTRRVKNVGAPGT  824

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK-HR  129
             YT   ++P   SV V P  L+F+K GEE+ FKVT K        DY FG LTWSD   HR
Sbjct  825   YTVKAKAPPQVSVVVEPSSLEFKKAGEEKIFKVTFKPVVNGTPKDYTFGHLTWSDSNGHR  884

Query  128   VRSPIVVKAA  99
             VRSP+VVK A
Sbjct  885   VRSPLVVKHA  894



>gb|KDP29034.1| hypothetical protein JCGZ_16423 [Jatropha curcas]
Length=782

 Score =   453 bits (1165),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 221/366 (60%), Positives = 266/366 (73%), Gaps = 2/366 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC PGTLDP K KGK+L CLRG TAR DK  QAALAGAVGMIL NDE  G+ I  DAH L
Sbjct  414   LCLPGTLDPAKVKGKILACLRGETARVDKGAQAALAGAVGMILCNDESDGDSINTDAHLL  473

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+TY DGLA+F YIN TR+P+  IT  + + G KPAP +AAFSS GPN + P ILKP
Sbjct  474   PASHITYKDGLALFSYINSTRDPLGFITPTSEIFGTKPAPFMAAFSSVGPNTVTPQILKP  533

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IA++T ++ P+  D+DKR   F   SGTSMSCPHVAGVV LLKTL+P WSP
Sbjct  534   DITAPGVDIIASYTGSSSPTGLDFDKRRTPFITMSGTSMSCPHVAGVVALLKTLHPEWSP  593

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + + D  + +KATPF YG+GHI PN A +PGLVYDL + DY+
Sbjct  594   AAIKSAIMTTARTRDNTPQPLLDGSS-VKATPFNYGSGHIRPNRAMNPGLVYDLSVNDYL  652

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CA GYN++ I A     +KCP   SL  FNYPSIT+P L G+ TV+R LKNVGS   
Sbjct  653   DFLCAIGYNQSSIDA-FSADHKCPKSASLLDFNYPSITIPKLSGSVTVSRKLKNVGSAGK  711

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y   ++ P G SV+V P  L FEK GEE+SFK T KAK E A  +Y FG LTW+D  H V
Sbjct  712   YAVRIKEPYGISVSVEPSALTFEKTGEEKSFKATFKAKWEGAAKNYEFGGLTWTDGVHYV  771

Query  125   RSPIVV  108
             RSPIVV
Sbjct  772   RSPIVV  777



>ref|XP_010942534.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Elaeis 
guineensis]
Length=782

 Score =   452 bits (1164),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 279/371 (75%), Gaps = 2/371 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDPEK +GK++VCLRG+ AR +K     LAG  GM+L ND+ SGNEIIADAH L
Sbjct  410   LCYLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLL  469

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILKP
Sbjct  470   PATHITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKP  529

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+V+AA++EA GP+   +D R V+FN +SGTSMSCPH++GVVGLLK+L+P W+P
Sbjct  530   DITAPGVSVLAAYSEAVGPTGLPFDTRRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWNP  589

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  + N  + +  + + +KATPF+YG+GH+ PN A DPGLVYDL   DY+
Sbjct  590   SAIKSAIMTTARTQDNMDEPVL-NSSYVKATPFSYGSGHVRPNRAMDPGLVYDLTTNDYL  648

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             NF+C+ GYN T+I       + CP     L   NYPSIT+P+L G+ TVTRTLKNVGSP 
Sbjct  649   NFLCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITIPYLFGSITVTRTLKNVGSPG  708

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   +R P G SV+VNP  L ++K+GEE+ F+VTLK K  +A+ DY FG L WSD KH 
Sbjct  709   TYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVKKGHASMDYVFGGLIWSDGKHY  768

Query  128   VRSPIVVKAAA  96
             VR+P+VV AA 
Sbjct  769   VRTPLVVSAAG  779



>gb|KHN40225.1| Subtilisin-like protease [Glycine soja]
Length=739

 Score =   451 bits (1160),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 216/366 (59%), Positives = 273/366 (75%), Gaps = 2/366 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GT+DPEKA+GK+LVCLRGVTAR +KS  A  AGA GMIL NDE SGNE+IAD H L
Sbjct  371   LCMRGTIDPEKARGKILVCLRGVTARVEKSLVALEAGAAGMILCNDELSGNELIADPHLL  430

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ + Y DGLA++ ++N T+NP+ +I  P T L +KPAP +AAFSSRGPN + P+ILKP
Sbjct  431   PASQINYKDGLAVYAFMNSTKNPLGYIYPPKTKLQIKPAPAMAAFSSRGPNTVTPEILKP  490

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D+ APGVN+IAA++E   P++  +DKR V F   SGTSMSCPHVAGVVGLLKTL+P WSP
Sbjct  491   DVIAPGVNIIAAYSEGVSPTNLGFDKRRVPFITMSGTSMSCPHVAGVVGLLKTLHPDWSP  550

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SA+MTTA  R N+GK + D     KATPFAYG+GHI PN A DPGLVYDL   DY+
Sbjct  551   AVIKSALMTTARTRDNTGKPMLDGGNDAKATPFAYGSGHIRPNRAMDPGLVYDLTNNDYL  610

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+C   YN+++I    G  Y+CPD I++  FNYP+IT+P L G+ +VTR +KNVG P T
Sbjct  611   NFLCFSIYNQSQIEMFNGARYRCPDIINILDFNYPTITIPKLYGSVSVTRRVKNVGPPGT  670

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YTA ++ P   S++V P +LKF+ +GEE+SFK+T++      T   AFG +TWSD K +V
Sbjct  671   YTARLKVPARLSISVEPNVLKFDNIGEEKSFKLTVEVTRPGETT--AFGGITWSDGKRQV  728

Query  125   RSPIVV  108
             RSPIVV
Sbjct  729   RSPIVV  734



>ref|XP_010942535.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X4 [Elaeis 
guineensis]
Length=775

 Score =   452 bits (1162),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 279/371 (75%), Gaps = 2/371 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDPEK +GK++VCLRG+ AR +K     LAG  GM+L ND+ SGNEIIADAH L
Sbjct  403   LCYLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLL  462

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILKP
Sbjct  463   PATHITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKP  522

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+V+AA++EA GP+   +D R V+FN +SGTSMSCPH++GVVGLLK+L+P W+P
Sbjct  523   DITAPGVSVLAAYSEAVGPTGLPFDTRRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWNP  582

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  + N  + +  + + +KATPF+YG+GH+ PN A DPGLVYDL   DY+
Sbjct  583   SAIKSAIMTTARTQDNMDEPVL-NSSYVKATPFSYGSGHVRPNRAMDPGLVYDLTTNDYL  641

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             NF+C+ GYN T+I       + CP     L   NYPSIT+P+L G+ TVTRTLKNVGSP 
Sbjct  642   NFLCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITIPYLFGSITVTRTLKNVGSPG  701

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   +R P G SV+VNP  L ++K+GEE+ F+VTLK K  +A+ DY FG L WSD KH 
Sbjct  702   TYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVKKGHASMDYVFGGLIWSDGKHY  761

Query  128   VRSPIVVKAAA  96
             VR+P+VV AA 
Sbjct  762   VRTPLVVSAAG  772



>ref|XP_003528716.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   451 bits (1161),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/366 (59%), Positives = 273/366 (75%), Gaps = 2/366 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GT+DPEKA+GK+LVCLRGVTAR +KS  A  AGA GMIL NDE SGNE+IAD H L
Sbjct  405   LCMRGTIDPEKARGKILVCLRGVTARVEKSLVALEAGAAGMILCNDELSGNELIADPHLL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ + Y DGLA++ ++N T+NP+ +I  P T L +KPAP +AAFSSRGPN + P+ILKP
Sbjct  465   PASQINYKDGLAVYAFMNSTKNPLGYIYPPKTKLQIKPAPAMAAFSSRGPNTVTPEILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D+ APGVN+IAA++E   P++  +DKR V F   SGTSMSCPHVAGVVGLLKTL+P WSP
Sbjct  525   DVIAPGVNIIAAYSEGVSPTNLGFDKRRVPFITMSGTSMSCPHVAGVVGLLKTLHPDWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SA+MTTA  R N+GK + D     KATPFAYG+GHI PN A DPGLVYDL   DY+
Sbjct  585   AVIKSALMTTARTRDNTGKPMLDGGNDAKATPFAYGSGHIRPNRAMDPGLVYDLTNNDYL  644

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+C   YN+++I    G  Y+CPD I++  FNYP+IT+P L G+ +VTR +KNVG P T
Sbjct  645   NFLCFSIYNQSQIEMFNGARYRCPDIINILDFNYPTITIPKLYGSVSVTRRVKNVGPPGT  704

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YTA ++ P   S++V P +LKF+ +GEE+SFK+T++      T   AFG +TWSD K +V
Sbjct  705   YTARLKVPARLSISVEPNVLKFDNIGEEKSFKLTVEVTRPGETT--AFGGITWSDGKRQV  762

Query  125   RSPIVV  108
             RSPIVV
Sbjct  763   RSPIVV  768



>emb|CBI29567.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   446 bits (1147),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 260/351 (74%), Gaps = 1/351 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S+LC  GTLDPEK KGK+LVCLRGVT R +K  QAA  GAVGMIL NDE  GN ++AD H
Sbjct  204   SVLCLEGTLDPEKVKGKILVCLRGVTDRVEKGLQAARVGAVGMILCNDEYDGNSLVADPH  263

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
             FLPATH+ Y+DGLA+  YIN T+NP   IT P   +  KPAPV+AAFSSRGPN + P+IL
Sbjct  264   FLPATHINYTDGLAVLAYINSTKNPQGLITPPKGKIHTKPAPVMAAFSSRGPNTVTPEIL  323

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV++IAAFTEA  P++ D+D+R + F   SGTSMSCPHVAGV GLLKT++P W
Sbjct  324   KPDITAPGVDIIAAFTEAQSPTEQDFDERRLPFYSLSGTSMSCPHVAGVAGLLKTIHPHW  383

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP+ I+SAIMTTA+   N+ K+   D +  KATP AYGAGH+ PN AADPGLVYDL + D
Sbjct  384   SPSAIKSAIMTTASTSDNT-KSPMKDSSSDKATPLAYGAGHMQPNQAADPGLVYDLTVND  442

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y++F+CA GYN+T + A    PYKCP  +SL  FNYPSITVP+L G+ T+TR +KNVG P
Sbjct  443   YLDFLCALGYNQTMLKAFSDNPYKCPASVSLLDFNYPSITVPNLSGSVTLTRRVKNVGFP  502

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFG  159
               Y A +  P G SVTV P ILKF ++GEE+ FKVTLKA       DY  G
Sbjct  503   GIYAAHISQPTGVSVTVEPSILKFSRIGEEKKFKVTLKANTNGEAKDYIDG  553



>ref|XP_009394968.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   450 bits (1158),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 213/368 (58%), Positives = 271/368 (74%), Gaps = 2/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC   +LDPEK +GK++VCLRG  AR +K      AG +GM+LANDE +GNEIIADAH L
Sbjct  403   LCLKRSLDPEKVRGKIVVCLRGENARVEKGDVVHQAGGIGMVLANDESTGNEIIADAHVL  462

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH++Y DGLAI  Y+N +++   +IT P T++G KPAPV+AAFSS+GPN +NP+ILKP
Sbjct  463   PATHISYDDGLAILSYLNSSKSLFGYITSPKTIIGTKPAPVMAAFSSQGPNTVNPEILKP  522

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAAF+EATGP+   +D R V FN ESGTSMSCPH+AG+ GLLK L+P WS 
Sbjct  523   DITAPGVSIIAAFSEATGPTGLTFDDRRVLFNSESGTSMSCPHIAGIAGLLKALHPDWSH  582

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  R N  + +  + + +K +PF+YG+GH+ PN A DPGLVYDL   DY+
Sbjct  583   SAIKSAIMTTARTRDNMKEPMF-NSSFVKTSPFSYGSGHVQPNRAMDPGLVYDLTTNDYL  641

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             NF+CA GYN T+I      P+ CP   + +   NYPSIT+P+L G +T+TRT+KNVG P+
Sbjct  642   NFLCALGYNSTQIATFSTEPFVCPSKPLKIEDLNYPSITIPNLSGASTITRTIKNVGLPS  701

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   V  P G SVTV P+ LKF+K+GEE+ F V LK K  N   +Y FG LTWSD KH 
Sbjct  702   TYKVRVEEPAGVSVTVKPRKLKFKKLGEEKKFTVALKDKRSNLAREYTFGGLTWSDGKHY  761

Query  128   VRSPIVVK  105
             VRSPIVVK
Sbjct  762   VRSPIVVK  769



>ref|XP_010096499.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB64619.1| Subtilisin-like protease [Morus notabilis]
Length=771

 Score =   450 bits (1157),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 218/370 (59%), Positives = 274/370 (74%), Gaps = 3/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCK GTLDP K KGK+L CLRG  AR +K   AA AGAVGMIL ND+ SGN ++ADAH
Sbjct  399   AILCKTGTLDPTKVKGKILACLRGENARVEKGLNAARAGAVGMILCNDDLSGNGVLADAH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
             FLPA+H+TY DG ++  YIN T+NP A +  P    G KPAP +A+FSS GPN + P+IL
Sbjct  459   FLPASHLTYEDGQSLLQYINTTKNPQATLLPPIATFGSKPAPSMASFSSTGPNTVTPEIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV++IAA++EA  P+  ++DKR   FNVESGTSMSCPHVAGVVGLL+T++  W
Sbjct  519   KPDITAPGVSIIAAYSEAVSPTGLEFDKRRFPFNVESGTSMSCPHVAGVVGLLRTIHRDW  578

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAI+TTA  R N+G +      + KA+PF YG GHI PN A DPGLVYDL   D
Sbjct  579   SPAAIRSAIVTTARTRDNTGNS-AKTALKQKASPFNYGNGHIRPNRAMDPGLVYDLGTND  637

Query  491   YVNFICAQGYNKTEITAVLGTPYKCP-DHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y+NF+C+ GYNKT+I A+   P+KCP  ++++  FNYPS+T P+L G+ TVTRT+KNVG 
Sbjct  638   YLNFLCSLGYNKTQIQALNDKPHKCPAKNVTVLDFNYPSVTAPNLSGSVTVTRTVKNVGQ  697

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY   V  PVG SV+V PKIL+F+  GEE+SF++TLK +G      Y FGV  W+D K
Sbjct  698   PGTYVVKVHEPVGVSVSVEPKILEFKHHGEEKSFRITLKDRGYGLKG-YHFGVFVWTDGK  756

Query  134   HRVRSPIVVK  105
             H VRSPIVV+
Sbjct  757   HYVRSPIVVQ  766



>emb|CDY65693.1| BnaA02g06800D [Brassica napus]
Length=763

 Score =   449 bits (1156),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 271/373 (73%), Gaps = 3/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK  +LDPEK KGK++VCLRG  AR DK  QAA AGAVGMIL ND+ SGNEII+DAH
Sbjct  393   ALLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEIISDAH  452

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T++P  +IT PNT L  KPAP +A+FSSRGPN I P IL
Sbjct  453   VLPASQINYKDGEAVFSYLNSTKDPKGYITAPNTQLHTKPAPFMASFSSRGPNTITPGIL  512

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVNV+AA+TEATGP+D + D R   FNVESGTSMSCPH++G+VGLLKTL P W
Sbjct  513   KPDITAPGVNVVAAYTEATGPTDIESDNRRTPFNVESGTSMSCPHISGIVGLLKTLRPQW  572

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N+ K +  D T  KATPF YGAGH+ PN A+ PGLVYDL   D
Sbjct  573   SPAAIRSAIMTTSRTRDNTRKPMV-DATFHKATPFGYGAGHVQPNKASHPGLVYDLNTGD  631

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GY    +      P Y C +  +L  FNYPSITVP L  + T+TR L NVG 
Sbjct  632   YLDFLCAIGYENKVVQLFADDPLYTCREGANLLDFNYPSITVPKLTDSVTITRKLTNVGP  691

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P+TY +   +P+G  V+V PK L F KVGEE+ F++T+ A  E A   Y FG LTW+D K
Sbjct  692   PSTYRSYFHAPLGVEVSVEPKQLTFSKVGEEKMFQMTIGATSEKALG-YVFGELTWTDSK  750

Query  134   HRVRSPIVVKAAA  96
             H VR+PIVV+ ++
Sbjct  751   HYVRTPIVVQLSS  763



>ref|XP_010693559.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Beta vulgaris subsp. vulgaris]
Length=1098

 Score =   459 bits (1180),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 224/377 (59%), Positives = 274/377 (73%), Gaps = 6/377 (2%)
 Frame = -3

Query  1217  SCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             S +LLCKPGTLD +K KGK+L CLRG  AR DK  QA LAGA GMIL NDE  GNE+IAD
Sbjct  723   SDALLCKPGTLDEKKVKGKILACLRGGNARVDKGMQAKLAGAAGMILCNDELDGNEVIAD  782

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
              H LPA H++Y+DG A+F YIN T  P+ ++TH      VKPAP +AAFSS+GPN + P+
Sbjct  783   LHVLPAAHISYADGSAVFKYINSTAKPMGYLTHSKATFDVKPAPYMAAFSSKGPNTVTPE  842

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             +LKPDI+APGV+VIAA+++A  P+D   D R VS+ ++SGTSMSCPH++G+VGLLKTL+P
Sbjct  843   LLKPDITAPGVDVIAAYSQAVSPTDEPSDHRRVSYMMDSGTSMSCPHISGIVGLLKTLHP  902

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             +WSPA IRSAIMTTA  R N+   + +D    KATPF YGAGH+ P  A DPGL+YDL  
Sbjct  903   TWSPAAIRSAIMTTARTRDNTINPM-EDANYAKATPFGYGAGHVRPTRAMDPGLIYDLNA  961

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCP----DHISLSTFNYPSITVPHLKGTATVTRTL  330
             TDY+ F+C+ GYNKT I       +KC     +  +L  FNYPSITVP L G+ TVTRT+
Sbjct  962   TDYLQFLCSIGYNKTTIETFYNGSHKCSKSSYNKENLLNFNYPSITVPKLSGSVTVTRTV  1021

Query  329   KNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVL  153
             KNVGSP  Y A VR P+  SVTV PK++KFEKVGEE+ FKVTL +K     + +Y FG L
Sbjct  1022  KNVGSPGVYVARVRQPLRVSVTVTPKMMKFEKVGEEKKFKVTLTSKVRGGKSEEYRFGEL  1081

Query  152   TWSDKKHRVRSPIVVKA  102
              WSD KH VRSPIVV A
Sbjct  1082  LWSDGKHYVRSPIVVAA  1098



>ref|XP_008348301.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=775

 Score =   449 bits (1156),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 220/371 (59%), Positives = 273/371 (74%), Gaps = 2/371 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK GTLDP+K KGK+L CLRG  A  DK  QA LAGAVGMILAN+  +GNEII+D H 
Sbjct  406   LLCKAGTLDPKKVKGKILACLRGDNAXVDKGEQALLAGAVGMILANNAJNGNEIISDPHV  465

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+H+ ++DG+ +F YIN T++P A+I    T LG KP+P +A FSS+GPN I P ILK
Sbjct  466   LPASHINFTDGILVFAYINSTKSPRAYIKRAITELGTKPSPFMAXFSSKGPNTITPGILK  525

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV+VIAA+T+A GP++  +D+R + FN  SGTSMSCPH++G+ GLLKTLYP WS
Sbjct  526   PDITAPGVSVIAAYTKARGPTNQMFDQRRIPFNSASGTSMSCPHISGICGLLKTLYPHWS  585

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA I+SAIMTTA  R NS   +  + +  +ATPF+YGAGH++PN A DPGLVYDL L DY
Sbjct  586   PAAIKSAIMTTAITRDNSMGPLL-NASFYEATPFSYGAGHVBPNSAMDPGLVYDLSLNDY  644

Query  488   VNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             +NF+CA GYN+TE+       Y+CP   IS +  NYPSIT+P L G   VTRT+KNVGSP
Sbjct  645   LNFLCAMGYNETEMEMFSEDTYECPKPAISPTNLNYPSITIPKLSGXLEVTRTVKNVGSP  704

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A ++SP G S +V PK LKF K+GEE+SFKV L+ K      +Y  G L  SD KH
Sbjct  705   GTYKAXIQSPDGVSXSVEPKKLKFXKIGEEKSFKVLLQVKEAXQAKNYVXGKLIXSDGKH  764

Query  131   RVRSPIVVKAA  99
              VRSPIVVKA+
Sbjct  765   XVRSPIVVKAS  775



>ref|XP_002299064.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
 gb|EEE83869.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
Length=810

 Score =   451 bits (1159),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 274/370 (74%), Gaps = 2/370 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC+ GTLDP+K  GK++VCLRG+ +R  K H+A LAGAVGMILANDE+SG+EI++D H L
Sbjct  442   LCQNGTLDPKKVAGKIIVCLRGINSRVVKGHEAELAGAVGMILANDEESGSEILSDPHML  501

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA H+T++DG A+ +YI  T+NP A I+  +T LGV P PV+AAFSSRGP+ I P ILKP
Sbjct  502   PAAHLTFTDGQAVMNYIKSTKNPTASISPVHTDLGVVPNPVMAAFSSRGPSLIEPAILKP  561

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGV+VIAA+TEA GPS+  +DKR   +   SGTSMSCPHV+G+VGLL+ ++P WSP
Sbjct  562   DVTAPGVDVIAAYTEALGPSELPFDKRRTPYITMSGTSMSCPHVSGIVGLLRAIHPDWSP  621

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A ++SAIMTTA   +NS K I D + +  ATPFAYGAGH+NPN AADPGLVYD    DY+
Sbjct  622   AALKSAIMTTAKTISNSKKRILDADGQ-PATPFAYGAGHVNPNRAADPGLVYDTNEIDYL  680

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CA GYN T I    G PYKCP++ SL+ FNYPSITVP L G  TVTR +KNVG+P T
Sbjct  681   NFLCAHGYNSTFIIEFSGVPYKCPENASLAEFNYPSITVPDLNGPVTVTRRVKNVGAPGT  740

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK-HR  129
             YT   ++P   SV V P  L+F+K GEE+ FKVT K        DY FG LTWSD   H 
Sbjct  741   YTVKAKAPPEVSVVVEPSSLEFKKAGEEKIFKVTFKPVVNGMPKDYTFGHLTWSDSNGHH  800

Query  128   VRSPIVVKAA  99
             V+SP+VVK A
Sbjct  801   VKSPLVVKHA  810



>ref|XP_010542042.1| PREDICTED: subtilisin-like protease SBT5.3 [Tarenaya hassleriana]
Length=772

 Score =   449 bits (1155),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/374 (60%), Positives = 276/374 (74%), Gaps = 3/374 (1%)
 Frame = -3

Query  1220  NSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIA  1041
             +S + LCK G+LDP KAKGK+LVCLRG+  R +K    ALAG VGM+L N    GN++ A
Sbjct  399   SSDAQLCKLGSLDPVKAKGKILVCLRGLNGRVEKGQTVALAGGVGMVLVNTNVMGNDLTA  458

Query  1040  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  861
             DAH LPATH+TY DG+++  Y+++T+NPVAHIT P T+LG KPAPV+AAFSS+GPN + P
Sbjct  459   DAHVLPATHITYKDGVSLSRYLSQTQNPVAHITPPRTILGTKPAPVVAAFSSKGPNIVTP  518

Query  860   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  681
             +ILKPDI APGV+VIAA+TEA  P++ ++D+R V FN  SGTSMSCPH++G+VGLLKTLY
Sbjct  519   EILKPDIIAPGVSVIAAYTEAVSPTNEEFDERRVMFNAVSGTSMSCPHISGIVGLLKTLY  578

Query  680   PSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLK  501
             PSWSPA I SAIMTTAT   +    I  + T + ATPF+YGAGH+ PN A DPGLVYDL 
Sbjct  579   PSWSPAAIHSAIMTTATTMDDIPGPIR-NATDMTATPFSYGAGHVRPNLAMDPGLVYDLT  637

Query  500   LTDYVNFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKN  324
             + DY+NF+C+ GYN T+++   G  + CP+   S    NYPSITVP+L    TV RTLKN
Sbjct  638   IKDYLNFLCSLGYNSTQMSVFSGKSFACPNPKPSALDLNYPSITVPNLSSVVTVKRTLKN  697

Query  323   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGVLTW  147
             VG P TY   V +P G SV+V PK LKF K GEE+SF+VTL  KG    A  Y FG L W
Sbjct  698   VGKPGTYAVHVTNPKGVSVSVKPKGLKFTKDGEEKSFRVTLVKKGNGDVAKGYGFGELVW  757

Query  146   SDKKHRVRSPIVVK  105
             SDK+H VRSPIVV+
Sbjct  758   SDKEHYVRSPIVVR  771



>ref|XP_004251819.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=772

 Score =   448 bits (1152),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/367 (59%), Positives = 271/367 (74%), Gaps = 1/367 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GTLDP+KAKG +LVC RG +A   K  QA   GAVG+++ N    G+E+ A+ +  
Sbjct  401   FCIEGTLDPKKAKGTILVCHRGGSAAFSKCIQATSVGAVGIVILNSAFFGDEMYAEPYLC  460

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT ++YSDGL +  Y++ TR   A+IT P T LG KPAPV+A+FSS GPN + P+ILKP
Sbjct  461   PATFISYSDGLQVSSYVSSTRKATAYITRPTTELGTKPAPVMASFSSIGPNRVTPEILKP  520

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+++AA+T   GP+D++ D R V FN  +GTSMSCPHVAGVVGLLK+L+P+WSP
Sbjct  521   DITAPGVSILAAYTGVQGPADSELDNRRVKFNTMTGTSMSCPHVAGVVGLLKSLHPTWSP  580

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMT+A  R N+   +T+  T LK +PFAYG+GHI PN A DPGLVYDL + DY+
Sbjct  581   AAIKSAIMTSARTRDNTINPMTNS-THLKVSPFAYGSGHIWPNRAMDPGLVYDLTIDDYM  639

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CAQGYN+T+I+      +KCPD IS S  N PSITVP LKG+  VTRTLKNVG+P T
Sbjct  640   NFLCAQGYNETQISFFTQGHFKCPDPISFSNLNLPSITVPKLKGSIVVTRTLKNVGTPGT  699

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A +RSP+G +V V P  L+F K+GEE+SFK+TLK  G+ A  DY FG L WSD KH V
Sbjct  700   YKAHIRSPIGITVVVEPNTLEFRKIGEEKSFKITLKVNGQKAPKDYVFGHLIWSDNKHYV  759

Query  125   RSPIVVK  105
             RSPIVVK
Sbjct  760   RSPIVVK  766



>ref|XP_010063229.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70437.1| hypothetical protein EUGRSUZ_F03662 [Eucalyptus grandis]
Length=769

 Score =   448 bits (1152),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/369 (58%), Positives = 269/369 (73%), Gaps = 1/369 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +K KGK+L CL     R     QAALAGAVGM+LANDE +GN+++ADAH
Sbjct  400   ALLCKAGTLDRKKVKGKILACLLVDNKRIVVGQQAALAGAVGMVLANDEANGNDVVADAH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA H+++ DG  +F YIN T  P+A+IT   T+L   PAP +A+FSSRGPN + P IL
Sbjct  460   VLPAAHISFVDGKVLFAYINSTAFPMAYITRVKTMLNTTPAPFMASFSSRGPNIVEPAIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG+N+IAA+T A GP+  D+DKR   F+ ESGTSMSCPHVAG+VGLLKTLYPSW
Sbjct  520   KPDITAPGLNIIAAYTLAVGPAGQDFDKRKTPFSAESGTSMSCPHVAGIVGLLKTLYPSW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA  R N  + +  D +  KATPF+YGAGHI PN A +PGLVYDL   D
Sbjct  580   SPAAIQSAIMTTARTRDNKLEPML-DASFAKATPFSYGAGHIRPNRAMNPGLVYDLTAND  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y++F+CA+GYN++++       ++CP H   S  NYPSITVP L GT  VTR +KNVG+P
Sbjct  639   YLDFLCARGYNESQLRLFTNETHRCPKHFKTSDLNYPSITVPDLNGTMVVTRRMKNVGTP  698

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY+A +++P G S++V P+ LKFEK GEE+ FKV LK K      D+ FG L WSD  H
Sbjct  699   GTYSAHIKAPAGVSLSVQPQNLKFEKCGEEKEFKVVLKPKVAGKPVDHVFGKLIWSDGVH  758

Query  131   RVRSPIVVK  105
              VRSP+VVK
Sbjct  759   YVRSPLVVK  767



>ref|XP_002530614.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF31757.1| Cucumisin precursor, putative [Ricinus communis]
Length=771

 Score =   448 bits (1152),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/369 (57%), Positives = 276/369 (75%), Gaps = 1/369 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC+ G+LD  K  GK++VCLRG + R  K    A  GAVGMILAND+ S NE++AD HFL
Sbjct  404   LCEEGSLDKAKVAGKIIVCLRGDSDRLAKGQVVASLGAVGMILANDQLSANELLADPHFL  463

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+TY+DG A+++YI  T+NP A I+   T +GVKPAPV+A+FSSRGPNA+ P +LKP
Sbjct  464   PASHITYTDGQAVYNYIKTTKNPTASISPVKTEVGVKPAPVMASFSSRGPNAVFPGLLKP  523

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN++AA++ A  PS+ + DKR V F V SGTSMSCPHV+G+VGLLK+++P WSP
Sbjct  524   DVTAPGVNILAAYSGAISPSEEESDKRRVPFTVMSGTSMSCPHVSGIVGLLKSIHPDWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A ++SAIMTTA  RAN+G++I D + +  ATPFAYGAGH+ PN AADPGLVYDL +TDY 
Sbjct  584   AAVKSAIMTTAKTRANNGRSILDSDGK-TATPFAYGAGHVRPNLAADPGLVYDLTITDYA  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             N +C  GYN++ + + +G  Y CP + +++ FNYPSITV +L  +  VTR  KNVG+P T
Sbjct  643   NSLCGFGYNESVVKSFIGESYTCPKNFNMADFNYPSITVANLNASIVVTRKAKNVGTPGT  702

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YTA V+ P G SVTV P  L F K+GEE+ +KV LKA    +  +Y FG L WSD KH+V
Sbjct  703   YTAHVKVPGGISVTVEPAQLTFTKLGEEKEYKVNLKASVNGSPKNYVFGQLVWSDGKHKV  762

Query  125   RSPIVVKAA  99
             RSP+VVK A
Sbjct  763   RSPLVVKHA  771



>ref|XP_008794749.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=776

 Score =   448 bits (1152),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/371 (57%), Positives = 273/371 (74%), Gaps = 2/371 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDPEK +GK++VCLRG+TAR +K      AG  GM+L ND+ SGNEIIADAH L
Sbjct  404   LCYLGSLDPEKVRGKIVVCLRGITARVEKGEAVLQAGGSGMVLVNDQSSGNEIIADAHLL  463

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TY+DG ++F Y+  T++P+ +IT P T L  KPAP +AAFSS+GPN +N +ILKP
Sbjct  464   PATHITYNDGFSLFSYLKSTKSPLGYITTPITQLDTKPAPFMAAFSSQGPNTVNAEILKP  523

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+V+AA+T A GP+   +D R V+FN +SGTSMSCPH++GVVGLLK+L+P WSP
Sbjct  524   DITAPGVSVLAAYTGAAGPTGLAFDTRRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  + +  + +  + + +KATPF+YG+GH+ PN A DPGLVYDL   DY+
Sbjct  584   SAIKSAIMTTARTQDSMDEPVL-NSSYVKATPFSYGSGHVQPNRAMDPGLVYDLTTNDYL  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             NF+CA GYN T+I       + CP     L   NYPSIT+P L G+ TVTR +KNVGSP 
Sbjct  643   NFLCALGYNSTQIAIFSNDSFSCPSKPPKLEDLNYPSITIPDLSGSITVTRAMKNVGSPG  702

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   VR P G SV+VNP  L ++K+GEE+ F+VTLK K  +A+ DY FG L WSD KH 
Sbjct  703   TYIVRVREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVKKGHASTDYVFGGLIWSDGKHY  762

Query  128   VRSPIVVKAAA  96
             VR+PIVV AA 
Sbjct  763   VRTPIVVSAAG  773



>gb|EYU27629.1| hypothetical protein MIMGU_mgv1a001914mg [Erythranthe guttata]
Length=740

 Score =   446 bits (1148),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/369 (59%), Positives = 273/369 (74%), Gaps = 2/369 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCK  TLD +KAKGK++VCLRG  AR +K  +A  AGA GMIL NDE SGNE+IADAH
Sbjct  368   AILCKEKTLDSKKAKGKIVVCLRGENARLEKGEEALRAGAAGMILCNDESSGNELIADAH  427

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPAT + Y+DGL +F Y+  T+NP   IT P ++L VKPAP +A+FSSRGPNAI P IL
Sbjct  428   ILPATQLNYTDGLIVFSYLKNTKNPQGLITEPKSVLNVKPAPFMASFSSRGPNAITPAIL  487

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN++AA++E+T P++   DKR   F +ESGTSM+CPHV+GV GLLKTL+P W
Sbjct  488   KPDITAPGVNIMAAYSESTSPTEVPSDKRTTPFYIESGTSMACPHVSGVAGLLKTLHPDW  547

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP  IRSAIMTTA  R N+G  + D + + KATPF YG+GHI PN A +PGLVYDL + D
Sbjct  548   SPGAIRSAIMTTARTRDNTGSPMKDADYQ-KATPFMYGSGHIRPNRAMNPGLVYDLTVND  606

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y++F+C  GYN T +    G  Y CP++ ++  FN PSI+VP L  +  VTR LKNVG P
Sbjct  607   YLDFLCGIGYNSTMVGQFAGAYYDCPNNYNILNFNNPSISVPDLTRSVVVTRKLKNVGKP  666

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDKK  135
              TY A +RSP G+SVTV P +LKFEK+GEE+SFK+++K  G   A + + FG L WSD K
Sbjct  667   GTYAARIRSPPGYSVTVKPNLLKFEKIGEEKSFKLSIKVNGRRGAKSVFQFGELLWSDGK  726

Query  134   HRVRSPIVV  108
             H VRSPIVV
Sbjct  727   HYVRSPIVV  735



>emb|CDP06171.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   446 bits (1148),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 273/376 (73%), Gaps = 3/376 (1%)
 Frame = -3

Query  1220  NSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIA  1041
             +SCS  C  G LDP KAKGK++VCL G     +K   AA AGAVGM+LAND   GNEI +
Sbjct  378   SSCSTFCMAGCLDPIKAKGKIVVCLTGENGIVEKGINAASAGAVGMVLANDVSDGNEISS  437

Query  1040  DAHFLPATHVTYSDGLAIFDYINKT-RNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAIN  864
             DAH LPA  + Y+DG A+F YIN T RNP A+I+ P+TLLG+KPAPV+A FSSRGPN + 
Sbjct  438   DAHVLPAVQIRYTDGAAVFAYINSTVRNPTAYISPPSTLLGIKPAPVMAPFSSRGPNTVT  497

Query  863   PDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  684
             P+ILKPDI+APGV+VIAA++EA GP+   +DKR   + V+SGTSMSCPHV+G+ GLLKTL
Sbjct  498   PEILKPDITAPGVDVIAAYSEAQGPTGESFDKRRTPYFVDSGTSMSCPHVSGIAGLLKTL  557

Query  683   YPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDL  504
             +P WSPA IRSAIMT+   R N+ + ITDD   +KATPFAYGAGH++P+ A DPGL+YDL
Sbjct  558   HPDWSPAAIRSAIMTSGKTRDNAVERITDD-GHIKATPFAYGAGHVHPSQAMDPGLIYDL  616

Query  503   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKN  324
                DY+ F+C+ GYN+T I       + CP  ISL   NYPSI VP L G+ TVTRT+KN
Sbjct  617   TNQDYLTFLCSLGYNETTILLFTHETFTCPKPISLVNLNYPSIAVPKLNGSITVTRTVKN  676

Query  323   VG-SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             VG SPATYTA V +P G SV V PK L F  +G+++SF VT+ A    A  DY FG+LTW
Sbjct  677   VGSSPATYTALVVNPPGLSVDVQPKTLAFATIGDQKSFNVTITATKAGANRDYVFGMLTW  736

Query  146   SDKKHRVRSPIVVKAA  99
             SD KH VRS I VK +
Sbjct  737   SDGKHYVRSQIAVKTS  752



>ref|XP_009126659.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X2 [Brassica 
rapa]
Length=725

 Score =   445 bits (1145),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 270/373 (72%), Gaps = 3/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK  +LDPEK KGK++VCLRG  AR DK  QAA AGAVGMIL ND+ SGNEII+DAH
Sbjct  355   ALLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEIISDAH  414

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T++P  +IT PNT L  KPAP +A+FSSRGPN I P IL
Sbjct  415   VLPASQINYKDGEAVFSYLNSTKDPKGYITAPNTQLHTKPAPFMASFSSRGPNTITPGIL  474

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVNV+AA+TEATGP+D + D R   FNVESGTSMSCPH++G+VGLLKTL P W
Sbjct  475   KPDITAPGVNVVAAYTEATGPTDIESDNRRTPFNVESGTSMSCPHISGIVGLLKTLRPQW  534

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N+ K +  D T  KATPF YG+GH+ PN A+ PGLVYDL   D
Sbjct  535   SPAAIRSAIMTTSRTRDNTRKPMV-DATFHKATPFGYGSGHVQPNKASHPGLVYDLNTGD  593

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GY    +      P Y C    +L  FNYPSITVP L  + T+TR L NVG 
Sbjct  594   YLDFLCAIGYENKVVQLFADDPLYTCRQGANLLDFNYPSITVPKLTDSVTITRKLTNVGP  653

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P+TY +   +P+G  V+V PK L F KVGEE+ F++T+ A  E A   Y FG LTW+D K
Sbjct  654   PSTYRSYFHAPLGVEVSVEPKQLTFSKVGEEKMFQMTIGATSEKALG-YVFGELTWTDSK  712

Query  134   HRVRSPIVVKAAA  96
             + VR+PIVV+ ++
Sbjct  713   YYVRTPIVVQLSS  725



>ref|XP_008810184.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=775

 Score =   446 bits (1148),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 279/389 (72%), Gaps = 2/389 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS K    T + +  +  C  G+L+P K +GKV+VCLRG   R +K      AG VGMI
Sbjct  385   LISSKEAKATNMSSEDATQCLLGSLEPAKVRGKVVVCLRGNNGRVEKGEAVRQAGGVGMI  444

Query  1079  LANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVI  900
             LANDE +GNEIIADAH LPATH++YSDG+A+  YIN T++P+ +IT P T+L   PAP +
Sbjct  445   LANDESTGNEIIADAHVLPATHISYSDGVALLSYINSTKSPLGYITTPKTMLDTYPAPFM  504

Query  899   AAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCP  720
             AAFSSRGPN INP+ILKPDI+APGV++IAA+T A+GP+   +D R V FN ESGTSMSCP
Sbjct  505   AAFSSRGPNTINPEILKPDITAPGVSIIAAYTGASGPTGLPFDSRRVLFNSESGTSMSCP  564

Query  719   HVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINP  540
             HV+G+ GLLK L+P WSP+ I+SAI+T+A  + N+ + ++ + + +KA PF+YG+GH+ P
Sbjct  565   HVSGIAGLLKALHPDWSPSAIKSAIVTSARTQDNTLEPMS-NSSFVKADPFSYGSGHVRP  623

Query  539   NGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPH  363
             N A DPGLVYDL   DY+NF+C+ GYN T+       PY CP   +++   NYPSI++P+
Sbjct  624   NRAMDPGLVYDLTTNDYLNFLCSLGYNSTQNALFNVEPYLCPSRPLNIGDLNYPSISIPY  683

Query  362   LKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  183
             L G  +V RT+KNVG+P TY   V  P G SV+V P  LKF KVGEE+ FKVTLKAK  +
Sbjct  684   LSGAVSVIRTVKNVGTPGTYRVRVIEPAGISVSVKPTSLKFMKVGEEKKFKVTLKAKSRD  743

Query  182   ATADYAFGVLTWSDKKHRVRSPIVVKAAA  96
             A  DYAFG L WSD  H VRSPIVVKA  
Sbjct  744   AAGDYAFGKLIWSDGMHYVRSPIVVKAGG  772



>ref|XP_004499342.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score =   446 bits (1146),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 219/369 (59%), Positives = 275/369 (75%), Gaps = 6/369 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC  GT+DP+KA+G++LVCLRG TAR +KS  A  AGA GMIL ND  SGNE+I+D H
Sbjct  400   AILCMEGTIDPKKARGQILVCLRGETARVEKSLVAFEAGAAGMILCNDMTSGNELISDPH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
             FLP +H+ Y DG+A++ YIN T+NP+ +I  P T L +K +P +A FSSRGPN I P+IL
Sbjct  460   FLPTSHINYEDGVAVYAYINSTKNPLGYIHPPITKLNIKHSPSMATFSSRGPNTITPEIL  519

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAA++ A  P++ ++DKR V F   SGTSMSCPHVAG+VGLLKTL+P W
Sbjct  520   KPDVTAPGVNIIAAYSGAVSPTEMEFDKRRVPFITMSGTSMSCPHVAGIVGLLKTLHPDW  579

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP+ I+SAIMTTA  R N+ K I D+   +KATPFAYG+GHI PN A DPGLVY+L + D
Sbjct  580   SPSAIKSAIMTTARTRDNTAKPILDNNN-MKATPFAYGSGHIRPNRAMDPGLVYELNIND  638

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+C  GYNKT+I    G  Y C D I++  FNYPSITVP L G+ T+TR LKNVG P
Sbjct  639   YLNFLCFLGYNKTQIKMFSGNHYHCHD-INILDFNYPSITVPKLYGSVTLTRKLKNVGPP  697

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSDKK  135
              TY AS+R P G  + V P ILKF+ +GEE+SFKV ++ A+   AT    FG LTWSD K
Sbjct  698   GTYVASLRVPKGLFIFVEPNILKFDNIGEEKSFKVIIEVARSGVAT---VFGGLTWSDGK  754

Query  134   HRVRSPIVV  108
             H VRSPIVV
Sbjct  755   HYVRSPIVV  763



>ref|XP_009126658.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X1 [Brassica 
rapa]
Length=763

 Score =   445 bits (1145),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 270/373 (72%), Gaps = 3/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK  +LDPEK KGK++VCLRG  AR DK  QAA AGAVGMIL ND+ SGNEII+DAH
Sbjct  393   ALLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEIISDAH  452

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T++P  +IT PNT L  KPAP +A+FSSRGPN I P IL
Sbjct  453   VLPASQINYKDGEAVFSYLNSTKDPKGYITAPNTQLHTKPAPFMASFSSRGPNTITPGIL  512

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVNV+AA+TEATGP+D + D R   FNVESGTSMSCPH++G+VGLLKTL P W
Sbjct  513   KPDITAPGVNVVAAYTEATGPTDIESDNRRTPFNVESGTSMSCPHISGIVGLLKTLRPQW  572

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N+ K +  D T  KATPF YG+GH+ PN A+ PGLVYDL   D
Sbjct  573   SPAAIRSAIMTTSRTRDNTRKPMV-DATFHKATPFGYGSGHVQPNKASHPGLVYDLNTGD  631

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GY    +      P Y C    +L  FNYPSITVP L  + T+TR L NVG 
Sbjct  632   YLDFLCAIGYENKVVQLFADDPLYTCRQGANLLDFNYPSITVPKLTDSVTITRKLTNVGP  691

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P+TY +   +P+G  V+V PK L F KVGEE+ F++T+ A  E A   Y FG LTW+D K
Sbjct  692   PSTYRSYFHAPLGVEVSVEPKQLTFSKVGEEKMFQMTIGATSEKALG-YVFGELTWTDSK  750

Query  134   HRVRSPIVVKAAA  96
             + VR+PIVV+ ++
Sbjct  751   YYVRTPIVVQLSS  763



>gb|AIC80771.1| subtilase [Cicer arietinum]
Length=757

 Score =   445 bits (1144),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/369 (59%), Positives = 275/369 (75%), Gaps = 6/369 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC  GT+DP+KA+G++LVCLRG TAR +KS  A  AGA GMIL ND  SGNE+I+D H
Sbjct  389   AILCMEGTIDPKKARGQILVCLRGETARVEKSLVAFEAGAAGMILCNDMTSGNELISDPH  448

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
             FLP +H+ Y DG+A++ YIN T+NP+ +I  P T L +K +P +A FSSRGPN I P+IL
Sbjct  449   FLPTSHINYEDGVAVYAYINSTKNPLGYIHPPITKLNIKHSPSMATFSSRGPNTITPEIL  508

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAA++ A  P++ ++DKR V F   SGTSMSCPHVAG+VGLLKTL+P W
Sbjct  509   KPDVTAPGVNIIAAYSGAVSPTEMEFDKRRVPFITMSGTSMSCPHVAGIVGLLKTLHPDW  568

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SP+ I+SAIMTTA  R N+ K I D+   +KATPFAYG+GHI PN A DPGLVY+L + D
Sbjct  569   SPSAIKSAIMTTARTRDNTAKPILDNNN-MKATPFAYGSGHIRPNRAMDPGLVYELNIND  627

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+C  GYNKT+I    G  Y C D I++  FNYPSITVP L G+ T+TR LKNVG P
Sbjct  628   YLNFLCFLGYNKTQIKMFSGNHYHCHD-INILDFNYPSITVPKLYGSVTLTRKLKNVGPP  686

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSDKK  135
              TY AS+R P G  + V P ILKF+ +GEE+SFKV ++ A+   AT    FG LTWSD K
Sbjct  687   GTYVASLRVPKGLFIFVEPNILKFDNIGEEKSFKVIIEVARSGVAT---VFGGLTWSDGK  743

Query  134   HRVRSPIVV  108
             H VRSPIVV
Sbjct  744   HYVRSPIVV  752



>ref|XP_004296137.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=774

 Score =   445 bits (1145),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 222/369 (60%), Positives = 273/369 (74%), Gaps = 8/369 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             SLLC  GTLDP+K KGK+LVC RG  ART+K   AALAGAVGM+L NDE SGNEIIAD H
Sbjct  410   SLLCLNGTLDPKKVKGKILVCQRGKNARTEKGEMAALAGAVGMVLVNDEASGNEIIADPH  469

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPATH+TY+DG  +F      + P AHIT   T+ G KPAP +AAFSSRGP+AI P IL
Sbjct  470   VLPATHLTYADGKRVF------QTPFAHITPVKTVYGTKPAPFMAAFSSRGPSAIEPSIL  523

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV++IAA+T A GP+++  DKR   +  ESGTSMSCPHV+G+VGLLKTLYPSW
Sbjct  524   KPDVTAPGVDIIAAYTGAAGPTESKSDKRRPRYITESGTSMSCPHVSGIVGLLKTLYPSW  583

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAI+TTA  R N+ ++I  D T+ +ATP AYGAGH+NPN AA+PGLVYDL   D
Sbjct  584   SPAAIRSAIITTARRRDNNEESIL-DSTKEQATPLAYGAGHVNPNRAANPGLVYDLTTDD  642

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVTRTLKNVGS  315
             Y+NF+CA+GYN + +      P KC +  S++  NYP+I +P L+    TVTR +KNVG+
Sbjct  643   YLNFLCARGYNASLLKLFSDKPVKCSNTSSIADLNYPTIAIPDLQDKPITVTRRVKNVGT  702

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A V +P G S++V P+ L+F+ VGEE+ FKVTLKA G+    DY FG L WSD K
Sbjct  703   PGTYVAHVHTPAGVSISVKPQKLEFKSVGEEKEFKVTLKANGKVGNPDYVFGELKWSDGK  762

Query  134   HRVRSPIVV  108
             H VRSPI V
Sbjct  763   HSVRSPIAV  771



>ref|XP_010063230.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
 gb|KCW70440.1| hypothetical protein EUGRSUZ_F03665 [Eucalyptus grandis]
Length=769

 Score =   444 bits (1143),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 275/368 (75%), Gaps = 1/368 (0%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLC  GTLDP+K KGK+L C+RG  AR +K +QAALAGAVGMILANDE +GNE++ADAH 
Sbjct  401   LLCLAGTLDPKKVKGKILACVRGENARVEKGYQAALAGAVGMILANDEANGNELLADAHV  460

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA H++++DG  +F YIN T+ P A++T   T+L  KPAP IA+FSSRGPN + P ILK
Sbjct  461   LPAAHISFADGKILFSYINSTKFPGAYLTRVKTILNTKPAPFIASFSSRGPNMVEPAILK  520

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGV++IAA+T A  P++  +DKR   FNVESGTSMSCPHV+G+VGLLKTLYPSWS
Sbjct  521   PDITAPGVDIIAAYTLAVAPTNLGFDKRRTPFNVESGTSMSCPHVSGIVGLLKTLYPSWS  580

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA IRSAIMTTA  R N  + +  D + +KATPF+YGAGHI PN AADPGLVYDL + DY
Sbjct  581   PAAIRSAIMTTAKTRDNRNETLL-DSSFVKATPFSYGAGHIRPNRAADPGLVYDLTVKDY  639

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             ++F+CA+GY ++++       + CP H + +  NYPSIT+P+L GT  VTR ++NVG+P 
Sbjct  640   LDFLCARGYKESQLRLFTNETHICPKHFNTADLNYPSITIPNLNGTVVVTRRVRNVGTPG  699

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY+  V++P G SV+V P+ L FE+  EE+ FKV  K        DY FG LTWSD  H 
Sbjct  700   TYSVQVKAPAGVSVSVQPQSLVFERFDEEKEFKVVFKPYVAGKPVDYVFGRLTWSDGTHY  759

Query  128   VRSPIVVK  105
             VRSP+VVK
Sbjct  760   VRSPLVVK  767



>ref|XP_010539197.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Tarenaya hassleriana]
Length=774

 Score =   444 bits (1143),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 224/372 (60%), Positives = 269/372 (72%), Gaps = 1/372 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +++C  G+LDP+  KGK++VCLRG  AR +K  QAA AGA GMIL N+E SGNEII+DAH
Sbjct  402   AMVCMKGSLDPKMVKGKIIVCLRGENARVEKGAQAAAAGAAGMILCNEEASGNEIISDAH  461

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LP +H+ Y DGL +F Y+N TRNP  ++  PN+ L  KPAP +A+FSSRGPN I PDIL
Sbjct  462   VLPTSHINYQDGLKVFSYLNSTRNPKGYLRPPNSKLNTKPAPFMASFSSRGPNTITPDIL  521

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEAT P+D D DKR   FN ESGTSMSCPH++GVVGLLKTL+P W
Sbjct  522   KPDITAPGVNIIAAFTEATSPTDLDSDKRKTPFNTESGTSMSCPHISGVVGLLKTLHPDW  581

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTTA  R N    I D  T  KATPFAYG+GH+ PN A DPGLVYDL   D
Sbjct  582   SPAAIRSAIMTTARSRDNRMAPILDG-TFEKATPFAYGSGHVRPNRAGDPGLVYDLSTGD  640

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+NF+CA GY +T I      PYKC +  +L  FNYPSITV  L G+ TVTR LKNVG  
Sbjct  641   YLNFLCAVGYTETMIRKFAEQPYKCREGANLLDFNYPSITVASLTGSVTVTRRLKNVGGA  700

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
               Y A VR+PVG SV+V P  L+F ++GEE+ F++TL  K    ++ Y FG LTW+D  H
Sbjct  701   GKYMARVRAPVGVSVSVKPTQLEFGELGEEKVFQMTLSPKPNWRSSGYVFGSLTWTDGHH  760

Query  131   RVRSPIVVKAAA  96
              VRSPI V+  A
Sbjct  761   YVRSPITVQVEA  772



>ref|XP_004515894.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   444 bits (1141),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 215/372 (58%), Positives = 270/372 (73%), Gaps = 4/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +L+CK G+LDPEK KGK++VCLRG T RTDK  Q A AG VGMIL + E+S N ++AD H
Sbjct  402   ALVCKGGSLDPEKVKGKIVVCLRGETGRTDKGEQVARAGGVGMILTSAEESDNSVLADPH  461

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV + DG  IF+YIN+T++P+A I+   T LGVKPAPV+A+FSSRGPN ++P IL
Sbjct  462   VLPASHVNFKDGRYIFNYINQTKSPIASISRVETELGVKPAPVMASFSSRGPNIVDPTIL  521

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI APGV++IAA++E   PSD   DKR  SF   SGTSMSCPHV+GVVGLLK+L+P W
Sbjct  522   KPDIIAPGVDIIAAYSEVQSPSDLPSDKRKTSFITMSGTSMSCPHVSGVVGLLKSLHPDW  581

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT+  N+GK + D      ATPFAYGAG I PN AADPGLVYDL +TD
Sbjct  582   SPAAIKSAIMTTATITGNTGKQLMDSSLE-SATPFAYGAGQIRPNRAADPGLVYDLNVTD  640

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  318
             Y+N++C  GY    ++   G PY CP+  SL  FNYP+IT+P LK   +  VTRTL NVG
Sbjct  641   YMNYLCNHGYEGDRLSIFYGKPYTCPESFSLVDFNYPTITIPDLKTGSSLNVTRTLTNVG  700

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVLTWSD  141
             +P+ Y   + +P  F V+V PKIL F+  GE++ F+VTL  +  N  T DY FG+L W+D
Sbjct  701   APSIYRVHIEAPPEFLVSVEPKILNFKNKGEKKEFRVTLSLRPLNKLTNDYVFGMLDWTD  760

Query  140   KKHRVRSPIVVK  105
              KH VRS I +K
Sbjct  761   GKHHVRSSIAIK  772



>ref|XP_010689355.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   443 bits (1140),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/368 (58%), Positives = 270/368 (73%), Gaps = 1/368 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK  T+DP KA+GK++VC+RG  AR DK  Q ALAG VGMILAND D+ NEI+AD H L
Sbjct  400   LCKSRTIDPRKARGKIVVCIRGDNARVDKGQQVALAGGVGMILANDHDTANEILADPHVL  459

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ YS+G+ +  YIN T+ P A IT  +T LG+ PAP +AAFSS+GPN I P+ILKP
Sbjct  460   PASHINYSNGILVSTYINSTKFPKASITRTSTRLGINPAPFMAAFSSKGPNTITPEILKP  519

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+TEA GP++  +DKR V FN  SGTSMSCPH++G+VGLLKTLYP WSP
Sbjct  520   DITAPGVSVIAAYTEAQGPTNQVFDKRRVQFNSISGTSMSCPHISGIVGLLKTLYPHWSP  579

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA+V  N  + IT + + ++A PF YGAGH+ PN A DPGLVYD+  TDY+
Sbjct  580   AAIKSAIMTTASVIDNVHEPIT-NASNIQANPFHYGAGHVQPNRAVDPGLVYDMTTTDYL  638

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CA GYN+  I       Y CP + S+   NYPSITVP LK T TVTRT+KNVGSP  
Sbjct  639   NFLCALGYNEKSIALFHAGHYLCPKNFSILDLNYPSITVPRLKNTITVTRTVKNVGSPGK  698

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A V++P G S+ V+P IL+F  + +E+SF +TL+      + +YAFG + WSD  H V
Sbjct  699   YKAHVQNPRGISIFVSPPILEFTTLCQEKSFHLTLEVVKGKISKNYAFGRIIWSDGYHNV  758

Query  125   RSPIVVKA  102
              SPIVV A
Sbjct  759   SSPIVVMA  766



>ref|XP_006282063.1| hypothetical protein CARUB_v10028308mg [Capsella rubella]
 gb|EOA14961.1| hypothetical protein CARUB_v10028308mg [Capsella rubella]
Length=781

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/372 (59%), Positives = 267/372 (72%), Gaps = 3/372 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             LLCK G+LDP K KGK++VCLRG  AR +K  Q A AG +GMIL ND+ SGNEII+DAH 
Sbjct  412   LLCKKGSLDPVKVKGKIVVCLRGDNARVEKGQQVAAAGGLGMILCNDKASGNEIISDAHV  471

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+ + Y DG A+F Y+N T++P  +I  P + L  KPAP +A+FSSRGPN + P ILK
Sbjct  472   LPASQIDYKDGEAVFAYLNSTKDPKGYIKAPTSTLNTKPAPFMASFSSRGPNTVTPGILK  531

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGVNVIAAFTEAT P+D   D R   FN ESGTSMSCPH+AGVVGLLKTL+P WS
Sbjct  532   PDITAPGVNVIAAFTEATSPTDLASDHRRTPFNTESGTSMSCPHIAGVVGLLKTLHPQWS  591

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             P  IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN AA PGLVYDL   DY
Sbjct  592   PGAIRSAIMTTSRTRDNRRKPMV-DESFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGDY  650

Query  488   VNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             ++F+CA GYN T +        Y C    +L  FNYPSITVP+L  + TVTR LKNVG+P
Sbjct  651   LDFLCAVGYNNTVVQLFAEDKQYMCRQGANLLDFNYPSITVPNLTDSITVTRKLKNVGTP  710

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             ATY A +R P+G SV+V PK LKF KVGE + F++TL+ K   ++  Y FG LTW+D  H
Sbjct  711   ATYIARLREPLGVSVSVEPKQLKFSKVGEVKMFQMTLRPKSAKSSR-YVFGELTWTDSHH  769

Query  131   RVRSPIVVKAAA  96
              VRSPI V+ A+
Sbjct  770   YVRSPIAVELAS  781



>ref|XP_006400913.1| hypothetical protein EUTSA_v10015943mg [Eutrema salsugineum]
 gb|ESQ42366.1| hypothetical protein EUTSA_v10015943mg [Eutrema salsugineum]
Length=761

 Score =   441 bits (1133),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/370 (58%), Positives = 269/370 (73%), Gaps = 3/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK  +LDPEK KGK++VCLRG  AR DK  QAA AGAVGMIL ND+ SGNEI++DAH
Sbjct  393   ALLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGAVGMILCNDKASGNEILSDAH  452

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T+ P  +I+ P + L  KPAP +A+FSSRGPN + P IL
Sbjct  453   VLPASQIDYEDGEAVFSYLNSTKEPKGYISPPASKLNTKPAPFMASFSSRGPNTVTPGIL  512

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVNVIAAFTEAT P+D D D R   +N ESGTSMSCPH++G+VGLLKTL+P W
Sbjct  513   KPDITAPGVNVIAAFTEATSPTDLDSDNRRTPYNTESGTSMSCPHISGIVGLLKTLHPQW  572

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMT++  R N  K +  D++  K+TPF+YG+GH+ PN A+ PGLVYDL   D
Sbjct  573   SPAAIRSAIMTSSRTRDNRRKPMV-DQSFNKSTPFSYGSGHVQPNKASHPGLVYDLTTGD  631

Query  491   YVNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +        Y C    +L  FNYPSITVP+L  + TVTR LKNVG 
Sbjct  632   YLDFLCAIGYNNTIVQLFAEDRHYICRQGANLLDFNYPSITVPNLTDSVTVTRKLKNVGP  691

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P+TY A  R P+G SV+V PK LKF ++GE + F++TL+ K   +   Y FG L W+D K
Sbjct  692   PSTYNAHFREPLGVSVSVEPKQLKFNEIGEVKMFQMTLRPKSSKSLG-YVFGELKWTDSK  750

Query  134   HRVRSPIVVK  105
             H VRSPIVVK
Sbjct  751   HYVRSPIVVK  760



>ref|XP_010063228.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X1 [Eucalyptus 
grandis]
Length=778

 Score =   440 bits (1132),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 215/378 (57%), Positives = 269/378 (71%), Gaps = 10/378 (3%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +K KGK+L CL     R     QAALAGAVGM+LANDE +GN+++ADAH
Sbjct  400   ALLCKAGTLDRKKVKGKILACLLVDNKRIVVGQQAALAGAVGMVLANDEANGNDVVADAH  459

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA H+++ DG  +F YIN T  P+A+IT   T+L   PAP +A+FSSRGPN + P IL
Sbjct  460   VLPAAHISFVDGKVLFAYINSTAFPMAYITRVKTMLNTTPAPFMASFSSRGPNIVEPAIL  519

Query  851   K---------PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVG  699
             K         PDI+APG+N+IAA+T A GP+  D+DKR   F+ ESGTSMSCPHVAG+VG
Sbjct  520   KHLIVVGVLQPDITAPGLNIIAAYTLAVGPAGQDFDKRKTPFSAESGTSMSCPHVAGIVG  579

Query  698   LLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPG  519
             LLKTLYPSWSPA I+SAIMTTA  R N  + + D  +  KATPF+YGAGHI PN A +PG
Sbjct  580   LLKTLYPSWSPAAIQSAIMTTARTRDNKLEPMLD-ASFAKATPFSYGAGHIRPNRAMNPG  638

Query  518   LVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVT  339
             LVYDL   DY++F+CA+GYN++++       ++CP H   S  NYPSITVP L GT  VT
Sbjct  639   LVYDLTANDYLDFLCARGYNESQLRLFTNETHRCPKHFKTSDLNYPSITVPDLNGTMVVT  698

Query  338   RTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFG  159
             R +KNVG+P TY+A +++P G S++V P+ LKFEK GEE+ FKV LK K      D+ FG
Sbjct  699   RRMKNVGTPGTYSAHIKAPAGVSLSVQPQNLKFEKCGEEKEFKVVLKPKVAGKPVDHVFG  758

Query  158   VLTWSDKKHRVRSPIVVK  105
              L WSD  H VRSP+VVK
Sbjct  759   KLIWSDGVHYVRSPLVVK  776



>ref|XP_008794759.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score =   440 bits (1132),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 210/371 (57%), Positives = 272/371 (73%), Gaps = 4/371 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDPEK +GK++VCLRG+TAR +K      AG  GM+L ND+ SGNEI ADAH L
Sbjct  409   LCYLGSLDPEKVRGKIVVCLRGITARVEKGEAVLQAGGSGMVLVNDQSSGNEISADAHLL  468

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TY+DG ++F Y+  T++P+ +IT P T L  KPAP++AAFSS+GPN IN +ILKP
Sbjct  469   PATHITYNDGFSLFSYLKSTKSPLGYITTPITQLDTKPAPLMAAFSSQGPNTINAEILKP  528

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+V+AAFT A GP+   +D R V+FN+  GTSMSCPH++GVVGLLK+L+P WSP
Sbjct  529   DITAPGVSVLAAFTGAAGPTGLAFDTRRVAFNLLYGTSMSCPHISGVVGLLKSLHPDWSP  588

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTAT + N  + +  + + +KATPF+YG+GH+ PN A DPGLVYDL   DY+
Sbjct  589   SAIKSAIMTTATTQDNMDEPVL-NSSYVKATPFSYGSGHVQPNRAMDPGLVYDLTTNDYL  647

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             NF+CA GY  T+I  +    + CP     L   NYPSIT+P L G+ TVTR +KNVGSP 
Sbjct  648   NFLCALGYTSTQIALISNDSFLCPSKPPKLEDLNYPSITIPDLSGSITVTRAMKNVGSPG  707

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   VR P+G SV+VNP  L ++K+GEE+ F+VTLK    +A  DY FG L WSD KH 
Sbjct  708   TYIVRVREPIGISVSVNPTSLTYDKIGEEKKFEVTLKEG--HAPTDYVFGELIWSDGKHY  765

Query  128   VRSPIVVKAAA  96
             V++P+VV AA 
Sbjct  766   VQTPLVVSAAG  776



>ref|XP_003625338.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES81556.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   439 bits (1130),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 214/366 (58%), Positives = 267/366 (73%), Gaps = 4/366 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GT+DPEKA G++LVCLRG+  + +KS  A  A AVGMIL ND   GNE+  D HFL
Sbjct  400   LCMNGTIDPEKASGRILVCLRGINGKVEKSLVALEAKAVGMILFNDRSHGNELTDDPHFL  459

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             P  H+ Y DG+A+F YIN T+NP+ +I  P T L +KPAP +A FSSRGPN I P+ILKP
Sbjct  460   PTAHIIYEDGVAVFAYINSTKNPLGYIHPPTTKLKIKPAPSMAVFSSRGPNTITPEILKP  519

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN+IAA++ A  P+  D DKR V F   SGTSMSCPHVAGVVGLLKTL+P+WSP
Sbjct  520   DVTAPGVNIIAAYSGAVSPTKLDSDKRRVPFMTMSGTSMSCPHVAGVVGLLKTLHPTWSP  579

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTTA  R N+ K I DD   +KATPF YG+GHI PN A DPGLVY+L + DY+
Sbjct  580   SAIKSAIMTTARTRDNTVKPIVDD-INVKATPFDYGSGHIRPNRAMDPGLVYELNINDYI  638

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+C  GYN+T+I+   GT + C D I++  FNYP+IT+P L G+ T++R LKNVG P T
Sbjct  639   NFLCFLGYNQTQISMFSGTNHHC-DGINILDFNYPTITIPILYGSVTLSRKLKNVGPPGT  697

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YTAS+R P G S++V PK LKF+K+GEE+SF +T++           FG LTWSD KH V
Sbjct  698   YTASLRVPAGLSISVQPKKLKFDKIGEEKSFNLTIEVTRSGGAT--VFGGLTWSDGKHHV  755

Query  125   RSPIVV  108
             RSPI V
Sbjct  756   RSPITV  761



>gb|KGN55998.1| hypothetical protein Csa_3G045120 [Cucumis sativus]
Length=760

 Score =   439 bits (1128),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 270/373 (72%), Gaps = 5/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC+ G+LDP+K  GK+++CLRG  AR  K + AA AGAVGMILAN E++G+EI+ADAH
Sbjct  386   ALLCEEGSLDPKKVNGKIIICLRGDNARVAKGYVAAKAGAVGMILANAEENGDEILADAH  445

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+TYSDG  ++ YIN T+ P+A++TH  T  G+KPAPV+A+FSSRGPN ++P IL
Sbjct  446   LLPASHITYSDGQLVYQYINSTKIPMAYMTHVRTEEGIKPAPVMASFSSRGPNTVDPSIL  505

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG N++AA++    P+  D+DKR V FNVESGTSMSCPHV+G+VGLLKTLYP W
Sbjct  506   KPDITAPGENILAAYSRDASPTGTDFDKRRVPFNVESGTSMSCPHVSGIVGLLKTLYPKW  565

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTTA  +AN    I       KA  FAYGAGH++PN AADPGLVYDL   D
Sbjct  566   SPAAIRSAIMTTAGTKANDLTPILSTNQE-KANAFAYGAGHVSPNRAADPGLVYDLSTKD  624

Query  491   YVNFICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKGTATV--TRTLKNV  321
             Y+N++CAQGYN  +I      T + C     L+  NYPSI++P L+    V   R LKNV
Sbjct  625   YLNYLCAQGYNTAQIKQFSNDTSFVCSKSFKLTDLNYPSISIPILEYDVAVKIKRKLKNV  684

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATA-DYAFGVLTWS  144
             GSP TY   V+ P+G SV+V P  LKF  + EE+SF+V LK+   N +   Y FG L WS
Sbjct  685   GSPGTYVVQVKEPLGVSVSVEPTSLKFTGIDEEKSFRVVLKSYEPNGSGPKYLFGKLEWS  744

Query  143   DKKHRVRSPIVVK  105
             D KHRVRSPIVV+
Sbjct  745   DGKHRVRSPIVVR  757



>ref|XP_008449186.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103491136 
[Cucumis melo]
Length=1529

 Score =   456 bits (1173),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 281/392 (72%), Gaps = 6/392 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC+ G+LDP+K KGK+++CLRG  AR DK + AA AGAVGMILAN E +G+E+IADAH L
Sbjct  403   LCQAGSLDPKKVKGKIILCLRGENARVDKGYAAAQAGAVGMILANAEQNGDELIADAHLL  462

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             P +HV+Y+DG +I+ YIN T+ P+A++TH  T LG+KPAPV+A+FSSRGPN I   ILKP
Sbjct  463   PVSHVSYTDGQSIYQYINFTKTPMAYMTHVRTELGIKPAPVMASFSSRGPNTIEESILKP  522

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN++AA++E   PS + +D R + FN+ SGTSMSCPH++G+VGLLKTLYP+WSP
Sbjct  523   DITAPGVNILAAYSEDASPSGSLFDNRRIPFNIVSGTSMSCPHISGIVGLLKTLYPTWSP  582

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  RAN    I  +   LKA PFAYGAGH+ PN A +PGLVYDL   DY+
Sbjct  583   AAIKSAIMTTAETRANDLHPIL-NTVNLKANPFAYGAGHVQPNRAMNPGLVYDLTTNDYM  641

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSPA  309
             NF+CAQGYNK++I+    T + C     L+ FNYPSI++P +K G  T+ R +KNVG P+
Sbjct  642   NFLCAQGYNKSQISKFSATSFVCSKSFKLTDFNYPSISIPDMKSGVVTINRRVKNVGKPS  701

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A V+ P G SV+V P+ LKF  + EE+SFKV + +   N    Y FG L W D KH 
Sbjct  702   TYVARVKVPQGVSVSVEPRTLKFTGIDEEKSFKVVIGSVANNKHRGYVFGSLIWEDGKHH  761

Query  128   VRSPIVVKAAA*MTIIMDQVHTPQCIVNPDSI  33
             VRSPIVV   + +  +    H     +NP SI
Sbjct  762   VRSPIVVNLGSYIVYLGSHSHG----LNPSSI  789


 Score =   434 bits (1117),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 217/387 (56%), Positives = 272/387 (70%), Gaps = 6/387 (2%)
 Frame = -3

Query  1250  YKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILAN  1071
             Y   I    YN C  LC+  +LDPEK KGK++VCLRG  ART+K +  A AG VGMILAN
Sbjct  1141  YAXQIXMCCYNYCRQLCEIESLDPEKVKGKIVVCLRGDNARTEKGYVVAKAGGVGMILAN  1200

Query  1070  DEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAF  891
              E++G++I ADAH LPA+H+TYSDG  ++ YIN T+ P+A++THP T  GVKPAP++A+F
Sbjct  1201  AEENGDDISADAHLLPASHITYSDGQLVYQYINSTKIPMAYLTHPRTESGVKPAPIMASF  1260

Query  890   SSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVA  711
             SSRGPN+I+P ILKPDI+APG N++AA++E   PS   +DKR V FNVESGTSMSCPHV+
Sbjct  1261  SSRGPNSIDPSILKPDITAPGENILAAYSEDGSPSGLYFDKRRVPFNVESGTSMSCPHVS  1320

Query  710   GVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGA  531
             G+VGLLKTLYP WSPA IRSAIMTTA  +AN    I   +   KA  +AYGAGH+ PN A
Sbjct  1321  GIVGLLKTLYPKWSPAAIRSAIMTTAGTKANDLNPILSTKQE-KANEWAYGAGHVRPNKA  1379

Query  530   ADPGLVYDLKLTDYVNFICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKG  354
             ADPGLVYDL   DY+N++CA GY   +I      T + C     ++  NYPSI++P+L+ 
Sbjct  1380  ADPGLVYDLSTEDYLNYLCALGYKIKQIKQFSNDTSFVCSKSFKITDLNYPSISIPNLES  1439

Query  353   TAT--VTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA  180
                  + R LKNVGSP TY   V +P+G SV+V P  LKF  + EE+SF+V LK+   N 
Sbjct  1440  DVALKIKRRLKNVGSPGTYVVQVNAPLGVSVSVEPTSLKFTGIDEEKSFRVVLKSNVPNG  1499

Query  179   TA-DYAFGVLTWSD-KKHRVRSPIVVK  105
                +Y FG L WSD   HRVRSPIVVK
Sbjct  1500  FHPEYVFGKLEWSDGNNHRVRSPIVVK  1526



>ref|XP_010483626.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=422

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 216/374 (58%), Positives = 270/374 (72%), Gaps = 3/374 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDPEK KGK++VCLRG  AR +K  QAA AGA GMIL ND+ SGNEII+DAH
Sbjct  50    ALLCKKGSLDPEKVKGKIVVCLRGDNARVEKGQQAAAAGAAGMILCNDKASGNEIISDAH  109

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T++P  +I  P + L +KPAP +A+FSSRGPN++ P IL
Sbjct  110   VLPASQIDYKDGEAVFKYLNSTKDPKGYIKAPTSALNIKPAPFMASFSSRGPNSVTPGIL  169

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEAT P+D D D R   +N ESGTSMSCPH++G+VGLLKTL+P W
Sbjct  170   KPDITAPGVNIIAAFTEATSPTDLDSDHRRTPYNTESGTSMSCPHISGIVGLLKTLHPQW  229

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN AA PGLVYDL   D
Sbjct  230   SPAAIRSAIMTTSRTRDNRRKPMV-DESFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGD  288

Query  491   YVNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +        Y C    +L  FNYPSIT+ +L  + TVTR LKNVG 
Sbjct  289   YLDFLCAVGYNNTVVQLFAEDKQYMCRQGANLLDFNYPSITILNLTDSITVTRKLKNVGP  348

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATADYAFGVLTWSDK  138
             PATY A  R P+G SV V PK L F K GE + F++TL+ K  + + + Y FG LTW+D 
Sbjct  349   PATYNAHFREPLGVSVNVEPKQLNFNKTGEVKMFQMTLRPKSVKPSGSGYVFGELTWTDS  408

Query  137   KHRVRSPIVVKAAA  96
              H VRSPIVV+ ++
Sbjct  409   HHYVRSPIVVQLSS  422



>ref|XP_010092373.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51049.1| Subtilisin-like protease [Morus notabilis]
Length=745

 Score =   437 bits (1124),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 270/369 (73%), Gaps = 1/369 (0%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +L CKPG LDP+K KGK+LVCL       +   QAALAGAVGMILAND +SGN + AD H
Sbjct  376   ALYCKPGALDPKKVKGKILVCLWKEMTSIEMGEQAALAGAVGMILANDIESGNRVNADLH  435

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LP +H+TY+DG  + DY+N ++NP+A++T   T +GV+PAP++A+FSSRGPN I P IL
Sbjct  436   VLPVSHITYNDGKLVLDYLNSSKNPMAYMTGVKTEVGVRPAPLMASFSSRGPNTIEPAIL  495

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV++IAA+++A  P+    D R VSF  +SGTS SCPHV+G+ GLLKTL+P W
Sbjct  496   KPDITAPGVDIIAAYSKAAPPTYLTSDTRRVSFIAQSGTSTSCPHVSGIAGLLKTLHPDW  555

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA  R N+ + + +   + + TPFAYGAGHI PN A DPGLVYDL + D
Sbjct  556   SPAAIKSAIMTTARARDNNMEPMLNSSMK-RETPFAYGAGHIRPNRAMDPGLVYDLTIDD  614

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y++F+CA GYN+T +      P+KC    +++ FNYPSI VP+L  +  VTR LKNVG+P
Sbjct  615   YLDFLCAHGYNQTLVRKFSDKPHKCSKSFTMANFNYPSIAVPNLSKSVIVTRKLKNVGTP  674

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++P+G S+ V PK LKF+++GEE+ FK+ +K K    + DY FG L WSD KH
Sbjct  675   GTYKAYVKAPIGVSIYVKPKSLKFDRIGEEKRFKIVVKPKAVGKSKDYVFGHLKWSDGKH  734

Query  131   RVRSPIVVK  105
              VRSPIVVK
Sbjct  735   FVRSPIVVK  743



>ref|XP_009396094.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=780

 Score =   437 bits (1124),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 217/369 (59%), Positives = 268/369 (73%), Gaps = 4/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KA GK++VCLRGVTAR +K      AG VGM+LAND  +GNEI+ADAH L
Sbjct  406   LCYLGSLDPVKATGKIVVCLRGVTARVEKGEAVLQAGGVGMVLANDAFNGNEILADAHVL  465

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TYSDGL +F Y+    +P+ +IT P T LG KPAP +AAFSS GPN I P+ILKP
Sbjct  466   PATHITYSDGLTLFSYLESNESPLGYITSPKTELGTKPAPFMAAFSSLGPNTITPEILKP  525

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA++ A GP++ D+D R V+FN  SGTSMSCPHV+G+ GLLKTL+P WSP
Sbjct  526   DITAPGVSVIAAYSAAVGPTNLDFDTRRVAFNSVSGTSMSCPHVSGIAGLLKTLHPDWSP  585

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N  + +  + + +KAT FAYG+GH+ PN A DPGLVYDL   DY+
Sbjct  586   AAIKSAIMTTARTRDNMEEPVL-NSSFVKATSFAYGSGHVRPNRAMDPGLVYDLTTNDYL  644

Query  485   NFICAQGYNKTEITAVLGTP-YKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             +F+CA GYN T++        Y CP   + +   NYPSITVP L  +ATVTR +KNVGSP
Sbjct  645   DFLCALGYNSTQLAMFSKEEAYSCPPTPLRIEDLNYPSITVPELSVSATVTRVVKNVGSP  704

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVLTWSDKK  135
              TY A V  P G +V VNP  L FEKVGEE+ F+VT+KAK   +  +DY FG L WSD K
Sbjct  705   GTYVARVIEPSGVAVAVNPARLVFEKVGEEKKFEVTMKAKDRKSWNSDYVFGALIWSDGK  764

Query  134   HRVRSPIVV  108
             H VR+P+VV
Sbjct  765   HYVRTPLVV  773



>ref|XP_011095872.1| PREDICTED: subtilisin-like protease SBT5.4 [Sesamum indicum]
Length=768

 Score =   436 bits (1122),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 210/372 (56%), Positives = 273/372 (73%), Gaps = 5/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LC   TLD +KAKGK++VCLRG  AR +K H+A  AGA GMIL ND +SGNEIIAD H
Sbjct  399   AILCLNNTLDSKKAKGKIVVCLRGENARVEKGHEAYRAGAAGMILCNDAESGNEIIADPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPATH+ ++DG  +FDY+   RNP   IT P    G+KPAP +A+FSSRGPN + P+IL
Sbjct  459   ILPATHINFTDGRIVFDYLKTARNPQGLITTPKAEYGIKPAPFMASFSSRGPNMVTPEIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAA++EA  P+   +D R   FN ESGTSMSCPHV+GV GL+KT +P W
Sbjct  519   KPDVTAPGVNIIAAYSEAVSPT-GAFDVRKTPFNTESGTSMSCPHVSGVAGLIKTRHPDW  577

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTTA +R N+  ++ D + +  ATPFAYG+GHI PN A DPGLVYDL + D
Sbjct  578   SPAAIRSAIMTTARIRDNTVNSMRDADYQ-AATPFAYGSGHIRPNRALDPGLVYDLTVND  636

Query  491   YVNFICAQGYNKTEITAVLGTPY-KCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+C  GY++ +I+ V G  Y KCP++ S+  FN PSITV +++GT  VTRT+K VG 
Sbjct  637   YLDFLCGIGYSQRQISQVAGIHYHKCPENYSMLNFNNPSITVLNVRGTVNVTRTVKLVGK  696

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P  Y + VR+P G+S+ V P++L+FEK GEE+SF++++  K   AT  Y FG L WSD  
Sbjct  697   PGIYASRVRAPFGYSLAVEPRLLQFEKTGEEKSFQLSITVK--RATTVYGFGELVWSDST  754

Query  134   HRVRSPIVVKAA  99
             H VRSPIV+ AA
Sbjct  755   HYVRSPIVLSAA  766



>ref|XP_006449983.1| hypothetical protein CICLE_v10018000mg [Citrus clementina]
 gb|ESR63223.1| hypothetical protein CICLE_v10018000mg [Citrus clementina]
Length=760

 Score =   436 bits (1121),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 210/348 (60%), Positives = 260/348 (75%), Gaps = 1/348 (0%)
 Frame = -3

Query  1142  GVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLPATHVTYSDGLAIFDYINKTR  963
             G TAR DK  QAA+AGAVGMIL ND+ SGNEI AD HFLPA+ +TY DG+ + DYI  + 
Sbjct  406   GDTARVDKGRQAAVAGAVGMILCNDKSSGNEITADPHFLPASQITYKDGVKVLDYIKSSD  465

Query  962   NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSD  783
             +P+ +IT P+T L  KP+P +A+FSS GPN I P+ILKPDI+APGVN+IAAFT A G ++
Sbjct  466   DPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPEILKPDITAPGVNIIAAFTGAIGATE  525

Query  782   NDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAI  603
               YD R + +N+ SGTSMSCPHVAGVVGLLKT +P WSP+ IRSAIMTTA  R N+   +
Sbjct  526   LPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHPDWSPSAIRSAIMTTARTRDNTANPM  585

Query  602   TDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPY  423
              D   + KATPF+YG+GHI PN A DPGLVYDL   DY++F+C+ GYN+T I    G+ Y
Sbjct  586   RDGSFK-KATPFSYGSGHIRPNRAMDPGLVYDLSEDDYLDFLCSIGYNQTTIKRFFGSQY  644

Query  422   KCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILK  243
             +C    +L  FNYPSI+VP + G+ T++R LKNVGSP+ Y ASVR P+G SV+V PKIL 
Sbjct  645   ECSKSANLEDFNYPSISVPMISGSVTLSRKLKNVGSPSNYAASVREPLGISVSVEPKILT  704

Query  242   FEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVKAA  99
             F+K+GEE+SFKVTLK K   A  +Y FG LTW+D KH VRSPIVV  A
Sbjct  705   FKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDGKHYVRSPIVVNQA  752



>ref|XP_010443761.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=777

 Score =   436 bits (1122),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 220/374 (59%), Positives = 271/374 (72%), Gaps = 3/374 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDPEK KGK+LVCLRG  AR +K  QAA AGAVGMIL ND+ SGNEII+DAH
Sbjct  405   ALLCKKGSLDPEKVKGKILVCLRGDNARVEKGQQAAAAGAVGMILCNDKASGNEIISDAH  464

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T++P  +I  P + L +KPAP +A+FSSRGPN++ P IL
Sbjct  465   VLPASQIDYKDGEAVFKYLNSTKDPKGYIKAPTSALNIKPAPFMASFSSRGPNSVTPGIL  524

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEAT P+D D D R   +N ESGTSMSCPH++G+VGLLKTL+P W
Sbjct  525   KPDITAPGVNIIAAFTEATSPTDLDSDHRRTPYNTESGTSMSCPHISGIVGLLKTLHPQW  584

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN AA PGLVYDL   D
Sbjct  585   SPAAIRSAIMTTSRTRDNRRKPMV-DESFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGD  643

Query  491   YVNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +        Y C    +L  FNYPSIT+PHL  T TVTR LKNVG 
Sbjct  644   YLDFLCAVGYNNTVVQLFAEDKQYMCRQGANLLDFNYPSITIPHLTDTITVTRKLKNVGP  703

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATADYAFGVLTWSDK  138
             PATY A  R P+G SV V PK L F K GE + F++TL+ K  + + + Y FG LTW+D 
Sbjct  704   PATYNAHFREPLGVSVDVEPKQLNFNKTGEVKMFQMTLRPKSVKPSGSGYVFGELTWTDS  763

Query  137   KHRVRSPIVVKAAA  96
              H VR PIVV+ ++
Sbjct  764   HHYVRIPIVVQLSS  777



>ref|XP_004159123.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=751

 Score =   436 bits (1120),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/373 (57%), Positives = 265/373 (71%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL NDE SG E IAD H
Sbjct  379   AMLCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDELSGFETIADPH  438

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y+DG A+F YI  T+NP+ ++  P   +  KPAP +AAFSSRGPN I+P+I+
Sbjct  439   VLPASHINYNDGQAVFSYIKSTKNPMGYLIPPTAKVNTKPAPTMAAFSSRGPNLISPEII  498

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+P W
Sbjct  499   KPDVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLHPQW  558

Query  671   SPAEIRSAIMTTATVRANSGKAITDDET--RLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             SP+ I+SAIMT+A +R N  K + D  +     +TPFAYG+GHI P GA DPGLVYDL  
Sbjct  559   SPSAIKSAIMTSARIRDNQKKPMLDGGSPDLAPSTPFAYGSGHIRPTGAIDPGLVYDLSP  618

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
              DY+ F+CA GYN+  I A    P+KCP   S+   NYPSI V +L G+ TVTR LKNV 
Sbjct  619   NDYLEFLCASGYNEKTIQAFSDGPFKCPASASILNLNYPSIGVQNLTGSVTVTRKLKNVS  678

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             +P  Y   VR P G  V V PK+LKFE+VGEE+SF++T+   G+        GVL W+D 
Sbjct  679   TPGVYKGRVRHPNGVKVLVKPKVLKFERVGEEKSFELTI--TGDVPEDQVVDGVLIWTDG  736

Query  137   KHRVRSPIVVKAA  99
             KH VRSPIVV ++
Sbjct  737   KHFVRSPIVVSSS  749



>dbj|BAJ34472.1| unnamed protein product [Thellungiella halophila]
Length=421

 Score =   424 bits (1089),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 263/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  53    LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  112

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +++ D LA+  YI++T  P+AHIT   T+LG KPAPV+AAFSS+GP+++ P+ILKP
Sbjct  113   PATQLSFKDSLALSRYISQTNKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKP  172

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  173   DITAPGVSVIAAYTGAVSPTNEQFDARRLLFNAVSGTSMSCPHISGIAGLLKTRYPSWSP  232

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  233   AAIRSAIMTTATTMDDIPGPI-QNSTNMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  291

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKG-TATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L     TV+RT+KNVG P
Sbjct  292   NFLCSLGYNASQISVFSGKNFACKSRKTSLYNLNYPSITVPNLSSRKVTVSRTVKNVGRP  351

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT    +P G  V V P  L F KVGE+++FKVTL  +       Y FG L WSDKKH
Sbjct  352   STYTVQANNPHGVYVAVKPTSLNFTKVGEQKTFKVTLVKRKGKVAKGYVFGELVWSDKKH  411

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  412   RVRSPIVVK  420



>gb|AES91027.2| subtilisin-like serine protease [Medicago truncatula]
Length=787

 Score =   436 bits (1121),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 270/371 (73%), Gaps = 4/371 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             L C  G LDP KAKGK+LVCLRG + R DK  +A+  GA+GMILAND+ SG EII DAH 
Sbjct  415   LFCNHGALDPHKAKGKILVCLRGDSNRVDKGVEASRVGAIGMILANDKGSGGEIIDDAHV  474

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+HV++ DG  IF Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN ++P ILK
Sbjct  475   LPASHVSFKDGDLIFKYVNNTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNRLDPSILK  534

Query  848   PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWS  669
             PDI+APGVN+IAA++EA  P++N YDKR   F   SGTSMSCPHVAG+VGLLK+++P WS
Sbjct  535   PDITAPGVNIIAAYSEAISPTENSYDKRRTPFITMSGTSMSCPHVAGLVGLLKSIHPDWS  594

Query  668   PAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDY  489
             PA I+SAIMTTAT + N G  +  D ++ +ATP AYGAGH+ PN AADPGLVYDL +TDY
Sbjct  595   PAAIKSAIMTTATTKNNIGGHVL-DSSQEEATPNAYGAGHVRPNLAADPGLVYDLNITDY  653

Query  488   VNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVGS  315
             +NF+C +GYN +++    G  Y CP   +L  FNYP+ITVP +K      VTRT+ NVGS
Sbjct  654   LNFLCGRGYNSSQLKLFYGRSYTCPKSFNLIDFNYPAITVPDIKIGQPLNVTRTVTNVGS  713

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSDK  138
             P+ Y   +++P    V+VNP+ L F+K GE++ FKVTL   KG     DY FG L W+D 
Sbjct  714   PSKYRVLIQAPAELLVSVNPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKLVWNDG  773

Query  137   KHRVRSPIVVK  105
             KH+V +PI +K
Sbjct  774   KHQVGTPIAIK  784



>ref|XP_009591665.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=1380

 Score =   450 bits (1158),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/369 (60%), Positives = 268/369 (73%), Gaps = 1/369 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GTLDP+K KG +LVC RG +   DK  QA L GAVG+++ N E  GNE+ A+ +F 
Sbjct  1013  FCLGGTLDPKKTKGAILVCHRGGSPGLDKCTQATLVGAVGIVILNSEFFGNEMYAEPYFC  1072

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT ++YSDGL +  Y+N TR P A+IT P T LG KPAP++AAFSS GPN + P+ILKP
Sbjct  1073  PATLISYSDGLEVLAYLNSTRTPTAYITRPTTELGTKPAPIVAAFSSIGPNRVTPEILKP  1132

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV++IAA+T    P+   +D R V FN  +GTSMSCPHVAGVVGLLK L+P+WS 
Sbjct  1133  DITAPGVSIIAAYTGVQPPTQIGFDDRRVKFNTMTGTSMSCPHVAGVVGLLKALHPTWSA  1192

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMT+A  R N+ K +T+  T LK TPFAYGAG+I PN A DPGLVYDL + DY+
Sbjct  1193  AAIKSAIMTSARTRDNTFKPMTNS-TDLKVTPFAYGAGNIWPNRAMDPGLVYDLTIDDYM  1251

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CAQGYNKT+I       +KCP+ IS    N PSITVP L G+  VTRTLKNVGSP T
Sbjct  1252  SFLCAQGYNKTQINIFSQGYFKCPEPISFINLNLPSITVPKLNGSVVVTRTLKNVGSPGT  1311

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A +RSP G SV V P  L+F K+GEE+SFK+TLK KG  A  DY FG L WSD KH V
Sbjct  1312  YRARIRSPAGISVVVEPNTLEFNKIGEEKSFKLTLKVKGNKAPKDYVFGQLIWSDGKHNV  1371

Query  125   RSPIVVKAA  99
             RSPIVVKA+
Sbjct  1372  RSPIVVKAS  1380



>ref|XP_011039898.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=794

 Score =   436 bits (1121),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/367 (57%), Positives = 268/367 (73%), Gaps = 1/367 (0%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GTLDP K  GK+++CLRG + R  K ++A  AGAVGM+L ND  SG+E+  +A+ L
Sbjct  427   LCLDGTLDPNKVSGKIILCLRGQSPRLPKGYEAERAGAVGMVLVNDIISGDELYLEAYEL  486

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             P+ H+TY+DG ++ DYI  TRNP A I+   T  GVKP+P +A FSSRGP+ I P +LKP
Sbjct  487   PSAHITYADGESVMDYIKATRNPTASISPAITNFGVKPSPAMAKFSSRGPSKIEPAVLKP  546

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAAFTEA GPS   +DKR   + V SGTSMSCPHV+G+VGLL+ ++P WSP
Sbjct  547   DITAPGVDVIAAFTEAMGPSRRPFDKRRTPYMVMSGTSMSCPHVSGIVGLLRAIHPDWSP  606

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A ++SAIMTTA  ++N+ K + D + +L ATPF YGAGH+ PN AADPGLVYD  + DY+
Sbjct  607   AALKSAIMTTAKTKSNNKKRMLDYDGQL-ATPFMYGAGHVQPNLAADPGLVYDTNVNDYL  665

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             +F+CA GYNKT + A    PY CP++ S + FNYPSITVP LKG  TVTR +KNVG+P T
Sbjct  666   SFLCAHGYNKTLLNAFSDGPYTCPENFSFADFNYPSITVPDLKGPVTVTRRVKNVGAPGT  725

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YT S+++P   SV V P  L+F++ GEEQ FK+T K   +    DY FG LTWSD  HRV
Sbjct  726   YTVSIKAPAKVSVVVEPSSLEFKQAGEEQLFKLTFKPIMDGMPKDYEFGHLTWSDGLHRV  785

Query  125   RSPIVVK  105
             +SP+VVK
Sbjct  786   KSPLVVK  792



>ref|XP_010942943.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=772

 Score =   435 bits (1119),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 264/368 (72%), Gaps = 2/368 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             C  G LDP K +GK+++C+RG   R +K      AG +GMILANDE SGNE+IADAH LP
Sbjct  406   CISGALDPTKVRGKIVICIRGTNDRVEKGEAVRQAGGIGMILANDESSGNEVIADAHVLP  465

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             ATH++YSDG+++  Y+   ++P+ +IT P T+L   PAP +AAFSSRGPN I P+ILKPD
Sbjct  466   ATHISYSDGVSLLSYVKSAKSPLGYITSPKTMLDAFPAPFMAAFSSRGPNTITPEILKPD  525

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             I+APGV++IAA+T A GP+  D+D R V FN +SGTSMSCPHV+GV GLLK L+P WSP+
Sbjct  526   ITAPGVSIIAAYTGALGPTSLDFDSRRVLFNTDSGTSMSCPHVSGVAGLLKALHPDWSPS  585

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SAI+T+A  + N+ + ++ + T  KA PF+YG+GH+ PN A DPGLVYDL   DY+N
Sbjct  586   AIKSAIITSARTQDNTLEPMS-NSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLN  644

Query  482   FICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             F+C+ GYN T+I      PY CP   + +   NYPSI + +L G  ++ RT+KNVG+P T
Sbjct  645   FLCSLGYNSTQIAGFNREPYSCPSKPLKIEDLNYPSIAISNLTGAVSLIRTVKNVGTPGT  704

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y   V  P G SV+V P+ LKF+KVGEE+ F VTLKAK  +   DYAFG L WSD KH V
Sbjct  705   YKVRVMEPAGISVSVKPRKLKFDKVGEEKKFVVTLKAKRRDVAGDYAFGKLVWSDGKHYV  764

Query  125   RSPIVVKA  102
             R+PI VKA
Sbjct  765   RTPIAVKA  772



>ref|XP_010455547.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=777

 Score =   435 bits (1119),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 219/374 (59%), Positives = 272/374 (73%), Gaps = 3/374 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDPEK KGK++VCLRG  AR +K  QAA AGAVGMIL ND+ SGNEII+DAH
Sbjct  405   ALLCKKGSLDPEKVKGKIVVCLRGDNARVEKGQQAAAAGAVGMILCNDKASGNEIISDAH  464

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG A+F Y+N T++P  +I  P + L +KPAP +A+FSSRGPN++ P IL
Sbjct  465   VLPASQIDYKDGEAVFSYLNSTKDPKGYIKAPTSALNIKPAPFMASFSSRGPNSVTPGIL  524

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEAT P+D D D R   +N ESGTSMSCPH+AG+VGLLKTL+P W
Sbjct  525   KPDITAPGVNIIAAFTEATSPTDLDSDHRRTPYNTESGTSMSCPHIAGIVGLLKTLHPQW  584

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN A+ PGLVYDL   D
Sbjct  585   SPAAIRSAIMTTSRTRDNRRKPMV-DESFKKANPFSYGSGHVQPNKASHPGLVYDLTTGD  643

Query  491   YVNFICAQGYNKTEITAVL-GTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +        Y C    +L  FNYPSIT+P+L  T TVTR LKNVG 
Sbjct  644   YLDFLCAVGYNNTVVQLFAEDKQYMCRQGANLLDFNYPSITIPNLTDTITVTRKLKNVGP  703

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATADYAFGVLTWSDK  138
             PATY A  R P+G SV V PK L F K GE + F++TL+ K  + + + Y FG LTW+D 
Sbjct  704   PATYNAHFRQPLGVSVNVEPKQLSFNKTGEVKMFQMTLRPKSVKPSGSGYVFGELTWTDS  763

Query  137   KHRVRSPIVVKAAA  96
              H VRSPIVV+ ++
Sbjct  764   HHYVRSPIVVQLSS  777



>ref|XP_010942942.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=771

 Score =   435 bits (1118),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 202/368 (55%), Positives = 264/368 (72%), Gaps = 2/368 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             C  G LDP K  GK+++C+RG  +R +K      AG  GMILANDE +GNE++ADAH LP
Sbjct  405   CISGALDPAKVTGKIVICIRGTNSRVEKGETVRQAGGTGMILANDESTGNEVLADAHVLP  464

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             ATH++YSDG+++  YI   ++P+ +IT P T+L   PAP +AAFSSRGPN + P ILKPD
Sbjct  465   ATHISYSDGVSLLSYIKSAKSPLGYITDPKTMLDTFPAPFMAAFSSRGPNTVTPGILKPD  524

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             I+APGV++IAA+T + GP+  D+D R V FN ESGTSMSCPHV+G+ GLLK L+P WSP+
Sbjct  525   ITAPGVSIIAAYTGSLGPTSLDFDSRRVLFNSESGTSMSCPHVSGISGLLKALHPDWSPS  584

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SAI+T+A  + N+ + I+ + T  KA PF+YG+GH+ PN A DPGLVYDL   DY+N
Sbjct  585   AIKSAIITSARTQDNTLEPIS-NSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLN  643

Query  482   FICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             F+C+ GYN T+I    G PY CP   + +   NYPSI + +L+G  ++ RT+KNVG+P T
Sbjct  644   FLCSLGYNSTQIAGFNGEPYSCPSKPLKIEDLNYPSIAISNLRGAVSLIRTVKNVGTPGT  703

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y   V  P G SV+V P+ LKF+KVGEE+ F VTLKAK  +   DYAFG L WSD KH V
Sbjct  704   YKVRVMEPAGISVSVKPRKLKFDKVGEEKKFVVTLKAKSRDVAGDYAFGKLVWSDGKHYV  763

Query  125   RSPIVVKA  102
             R+PI VKA
Sbjct  764   RTPIAVKA  771



>ref|XP_006447864.1| hypothetical protein CICLE_v10017839mg [Citrus clementina]
 gb|ESR61104.1| hypothetical protein CICLE_v10017839mg [Citrus clementina]
Length=716

 Score =   433 bits (1114),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 219/370 (59%), Positives = 274/370 (74%), Gaps = 4/370 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             CK GTLDP+K KGK+LVCL   T+  DK  QAALAGAVG++L N +D G +  AD H LP
Sbjct  347   CKKGTLDPKKVKGKILVCLDVNTSSVDKGLQAALAGAVGVVLINIQDFGYDRTADPHVLP  406

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             A+ ++++DG ++  Y+N T++PV  IT P T  G KP+P +AAFSS+GPN I P+ILKPD
Sbjct  407   ASAISFNDGDSLLGYVNSTKHPVGFITRPTTEFGAKPSPFMAAFSSKGPNHITPEILKPD  466

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             I+APG N+IAA+TEA  P++ + DK  + FN  SGTSMSCPH++G+ GLLKTL+P WSPA
Sbjct  467   ITAPGENIIAAYTEAESPTNLNEDKHRIPFNSISGTSMSCPHISGIAGLLKTLHPDWSPA  526

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SAIMTTAT   N+ + I  + +  +ATPF+YGAGH+ PN A DPGLVYDL + DY+N
Sbjct  527   AIQSAIMTTATTLDNNKQQIL-NASFAEATPFSYGAGHVQPNLAMDPGLVYDLTVNDYLN  585

Query  482   FICAQGYNKTEITAV-LGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             F+CA GYNK  I+       Y CP + ISL  FNYP+ITVP L G+ TVTR +KNVGSP 
Sbjct  586   FLCALGYNKNVISLFSTNCSYTCPKNAISLVNFNYPAITVPKLSGSITVTRRVKNVGSPG  645

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD-KKH  132
             TY A V++P G SVT+ PK LKF  VGEE+SFKV +KAK  + T DYAFG L WSD K+H
Sbjct  646   TYQARVKTPEGVSVTIAPKSLKFINVGEEKSFKVIIKAKNASVTKDYAFGELIWSDEKQH  705

Query  131   RVRSPIVVKA  102
             RVRSPIVVKA
Sbjct  706   RVRSPIVVKA  715



>ref|XP_010108994.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20634.1| Subtilisin-like protease [Morus notabilis]
Length=833

 Score =   437 bits (1123),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/368 (57%), Positives = 268/368 (73%), Gaps = 2/368 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             CK G LDP+K KG +LVC+ G  AR++   QA  +GAVGMILAND    N++IAD H LP
Sbjct  464   CKRGALDPKKVKGNILVCVWGKFARSEMGEQAFHSGAVGMILANDIRRWNDVIADPHLLP  523

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             A+H+ ++DG  IF+Y+N T+ P+A++T   T LGVKPAP++A FSSRGPN I P ILKPD
Sbjct  524   ASHINFTDGEFIFEYLNSTKTPMAYMTRVKTQLGVKPAPLVAFFSSRGPNLIEPTILKPD  583

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             ++APGV++IAA++E TG  +   D+R V FN++SGTSMSCPH++GV+GLLKTL+P WSPA
Sbjct  584   LTAPGVSIIAAYSEGTGALEVTTDERRVPFNIKSGTSMSCPHISGVIGLLKTLHPYWSPA  643

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              +RSAIMTTA  R ++ + + D  T  +ATPFAYGAGH+ PN A DPGLVYDL + DY+N
Sbjct  644   ALRSAIMTTARTRDSNREQMLDAATMQRATPFAYGAGHVQPNRAMDPGLVYDLTIDDYLN  703

Query  482   FICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL--KGTATVTRTLKNVGSPA  309
              +CA GYN+T I      PYKC    +L  FNYPSI VP+L  +    VTR +KNVG P 
Sbjct  704   LLCAHGYNETTIKLFSNKPYKCSKSFTLVNFNYPSIAVPNLGSEQVNIVTRKVKNVGIPG  763

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TYTA V++P G SV+V PK LKF+++GEE++FK+ +K K      DY FG L WSD KH 
Sbjct  764   TYTAYVKAPAGVSVSVKPKTLKFKRIGEEKTFKIIMKPKIAGKPRDYVFGWLKWSDGKHC  823

Query  128   VRSPIVVK  105
             VRS IVVK
Sbjct  824   VRSHIVVK  831



>ref|XP_010942532.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Elaeis 
guineensis]
Length=816

 Score =   436 bits (1121),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 213/405 (53%), Positives = 279/405 (69%), Gaps = 36/405 (9%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDPEK +GK++VCLRG+ AR +K     LAG  GM+L ND+ SGNEIIADAH L
Sbjct  410   LCYLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLL  469

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK-  849
             PATH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILK 
Sbjct  470   PATHITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKV  529

Query  848   ---------------------------------PDISAPGVNVIAAFTEATGPSDNDYDK  768
                                              PDI+APGV+V+AA++EA GP+   +D 
Sbjct  530   YEKFYYLFLVAHRVLLIRQFNFLLAASYHCTFQPDITAPGVSVLAAYSEAVGPTGLPFDT  589

Query  767   RIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDET  588
             R V+FN +SGTSMSCPH++GVVGLLK+L+P W+P+ I+SAIMTTA  + N  + + +  +
Sbjct  590   RRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPVLN-SS  648

Query  587   RLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDH  408
              +KATPF+YG+GH+ PN A DPGLVYDL   DY+NF+C+ GYN T+I       + CP  
Sbjct  649   YVKATPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSK  708

Query  407   I-SLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKV  231
                L   NYPSIT+P+L G+ TVTRTLKNVGSP TY   +R P G SV+VNP  L ++K+
Sbjct  709   PPRLEDLNYPSITIPYLFGSITVTRTLKNVGSPGTYIIRIREPRGISVSVNPTSLTYDKI  768

Query  230   GEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVKAAA  96
             GEE+ F+VTLK K  +A+ DY FG L WSD KH VR+P+VV AA 
Sbjct  769   GEEKKFEVTLKVKKGHASMDYVFGGLIWSDGKHYVRTPLVVSAAG  813



>ref|XP_010942533.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Elaeis 
guineensis]
Length=809

 Score =   436 bits (1120),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 213/405 (53%), Positives = 279/405 (69%), Gaps = 36/405 (9%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDPEK +GK++VCLRG+ AR +K     LAG  GM+L ND+ SGNEIIADAH L
Sbjct  403   LCYLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGGSGMVLVNDQSSGNEIIADAHLL  462

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK-  849
             PATH+TY+DGL+++ Y++ TR+P+ +IT P TLL  KPAP +AAFSS+GPN +N +ILK 
Sbjct  463   PATHITYNDGLSLYLYLSYTRSPLGYITTPITLLDTKPAPFMAAFSSQGPNTVNAEILKV  522

Query  848   ---------------------------------PDISAPGVNVIAAFTEATGPSDNDYDK  768
                                              PDI+APGV+V+AA++EA GP+   +D 
Sbjct  523   YEKFYYLFLVAHRVLLIRQFNFLLAASYHCTFQPDITAPGVSVLAAYSEAVGPTGLPFDT  582

Query  767   RIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDET  588
             R V+FN +SGTSMSCPH++GVVGLLK+L+P W+P+ I+SAIMTTA  + N  + + +  +
Sbjct  583   RRVAFNSDSGTSMSCPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPVLN-SS  641

Query  587   RLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDH  408
              +KATPF+YG+GH+ PN A DPGLVYDL   DY+NF+C+ GYN T+I       + CP  
Sbjct  642   YVKATPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSK  701

Query  407   I-SLSTFNYPSITVPHLKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKV  231
                L   NYPSIT+P+L G+ TVTRTLKNVGSP TY   +R P G SV+VNP  L ++K+
Sbjct  702   PPRLEDLNYPSITIPYLFGSITVTRTLKNVGSPGTYIIRIREPRGISVSVNPTSLTYDKI  761

Query  230   GEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVRSPIVVKAAA  96
             GEE+ F+VTLK K  +A+ DY FG L WSD KH VR+P+VV AA 
Sbjct  762   GEEKKFEVTLKVKKGHASMDYVFGGLIWSDGKHYVRTPLVVSAAG  806



>gb|KGN64982.1| hypothetical protein Csa_1G171040 [Cucumis sativus]
Length=757

 Score =   434 bits (1115),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 214/372 (58%), Positives = 265/372 (71%), Gaps = 6/372 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL NDE SG E IAD H L
Sbjct  387   LCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDELSGFETIADPHVL  446

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ Y+DG A+F YI  T+NP+ ++  P   +  KPAP +AAFSSRGPN I+P+I+KP
Sbjct  447   PASHINYNDGQAVFSYIKTTKNPMGYLIPPTAKVNTKPAPTMAAFSSRGPNLISPEIIKP  506

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+P WSP
Sbjct  507   DVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLHPQWSP  566

Query  665   AEIRSAIMTTATVRANSGKAITDDET--RLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             + I+SAIMT+A +R N+ K + D  +     +TPFAYG+GHI P GA DPGLVYDL   D
Sbjct  567   SAIKSAIMTSARIRDNTKKPMLDGGSPDLAPSTPFAYGSGHIRPTGAIDPGLVYDLSPND  626

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+ F+CA GYN+  I A    P+KCP   S+   NYPSI V +L G+ TVTR LKNV +P
Sbjct  627   YLEFLCASGYNEKTIQAFSDGPFKCPASASILNLNYPSIGVQNLTGSVTVTRKLKNVSTP  686

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAFGVLTWSDKK  135
               Y   VR P G  V V PK+LKFE+VGEE+SF++T+     E+   D   GVL W+D K
Sbjct  687   GVYKGRVRHPNGVKVLVKPKVLKFERVGEEKSFELTITGDVPEDQVVD---GVLIWTDGK  743

Query  134   HRVRSPIVVKAA  99
             H VRSPIVV ++
Sbjct  744   HFVRSPIVVSSS  755



>ref|XP_004139597.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=751

 Score =   433 bits (1114),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 264/371 (71%), Gaps = 4/371 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL NDE SG E IAD H L
Sbjct  381   LCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDELSGFETIADPHVL  440

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ Y+DG A+F YI  T+NP+ ++  P   +  KPAP +AAFSSRGPN I+P+I+KP
Sbjct  441   PASHINYNDGQAVFSYIKTTKNPMGYLIPPTAKVNTKPAPTMAAFSSRGPNLISPEIIKP  500

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+P WSP
Sbjct  501   DVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLHPQWSP  560

Query  665   AEIRSAIMTTATVRANSGKAITDDET--RLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             + I+SAIMT+A +R N+ K + D  +     +TPFAYG+GHI P GA DPGLVYDL   D
Sbjct  561   SAIKSAIMTSARIRDNTKKPMLDGGSPDLAPSTPFAYGSGHIRPTGAIDPGLVYDLSPND  620

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             Y+ F+CA GYN+  I A    P+KCP   S+   NYPSI V +L G+ TVTR LKNV +P
Sbjct  621   YLEFLCASGYNEKTIQAFSDGPFKCPASASILNLNYPSIGVQNLTGSVTVTRKLKNVSTP  680

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
               Y   VR P G  V V PK+LKFE+VGEE+SF++T+   G+        GVL W+D KH
Sbjct  681   GVYKGRVRHPNGVKVLVKPKVLKFERVGEEKSFELTI--TGDVPEDQVVDGVLIWTDGKH  738

Query  131   RVRSPIVVKAA  99
              VRSPIVV ++
Sbjct  739   FVRSPIVVSSS  749



>ref|XP_009587856.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana tomentosiformis]
Length=777

 Score =   433 bits (1114),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/375 (58%), Positives = 262/375 (70%), Gaps = 7/375 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK  TLD  K KGK+LVCLRG   R DK HQA + GAVGMIL ND+ SGN+IIAD H L
Sbjct  403   LCKQATLDASKVKGKILVCLRGNNTRVDKGHQAVIGGAVGMILCNDQTSGNDIIADVHLL  462

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+TY+DGLA+F YIN T N +  IT P  +LG+KPAP +A+FSSRGPN I P ILKP
Sbjct  463   PASHITYNDGLAVFAYINSTNNAMGSITAPKAILGIKPAPTMASFSSRGPNLITPAILKP  522

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVNVIAA+TE   PS+  +D R  +FNV SGTSMSCPHV+GVVGLLK ++P WSP
Sbjct  523   DITAPGVNVIAAYTEGNNPSNEVFDNRRTTFNVMSGTSMSCPHVSGVVGLLKAIHPDWSP  582

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSA+MTTA+   N+GK +  D T+  ATPFA GAGHI PN A+DPGLVYDL++ DY+
Sbjct  583   AAIRSALMTTASPIDNTGKPLL-DTTKEAATPFASGAGHIRPNLASDPGLVYDLEVNDYL  641

Query  485   NFICAQGYNKTEITAVLGTPYKCP--DHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             NF+CA GY+   I      PY CP   + SL  FNYPSITVP L G   VTRTL NVG P
Sbjct  642   NFLCASGYDSQVIRTFNKAPYICPPLSNSSLLEFNYPSITVPALSGNLIVTRTLTNVGPP  701

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN----ATADYAFGVLTWS  144
             +TYTA V  P G SV V P +L F+  G+++ F + +KA            + +G L WS
Sbjct  702   STYTARVGQPPGISVVVEPNVLIFKSQGQKERFSLHIKAVNTTYYLAGVDQHVYGELVWS  761

Query  143   DKKHRVRSPIVVKAA  99
             D  H V SPI V+ A
Sbjct  762   DGTHTVTSPITVEIA  776



>ref|XP_009394691.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=784

 Score =   433 bits (1113),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/372 (56%), Positives = 265/372 (71%), Gaps = 3/372 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP K KGK++VCLRG+TAR +K      AG +GM+LAND D+GNEI+ADAH L
Sbjct  409   LCYLGSLDPAKVKGKIVVCLRGITARVEKGEAVHQAGGIGMVLANDVDNGNEIVADAHVL  468

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TYSDGL +F Y+  T++P+ +IT P T LG KPAP +AAFSS+GPN I P+ILKP
Sbjct  469   PATHITYSDGLTLFSYLGATKSPLGYITRPKTKLGAKPAPFMAAFSSKGPNTITPEILKP  528

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGV+V+AA++ A GP+   +D R V+FN ESGTSMSCPH++GV GLLKTL+P WSP
Sbjct  529   DVTAPGVSVLAAYSGAVGPTGLVFDGRRVAFNAESGTSMSCPHISGVAGLLKTLHPDWSP  588

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N  + + +     KATP  YG+GH+ PN A DPGLVYD+  TDY+
Sbjct  589   AAIKSAIMTTARTRDNMKEPMLNSSFN-KATPLGYGSGHVRPNHAMDPGLVYDMTTTDYL  647

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +F+C+ GY   ++    G PY CP   + +   NYPSIT+P L+ +  V R +KNVG P 
Sbjct  648   DFLCSLGYTTAQLAMFNGEPYACPSTPLHIRDLNYPSITIPDLQSSTKVARVVKNVGPPG  707

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAFGVLTWSDKKH  132
             TY   V  P G SVTV+P  L FEKVGEE+ F+VT   K G+     Y FG L WSD KH
Sbjct  708   TYVVRVVEPRGVSVTVSPASLTFEKVGEEKRFEVTAGIKEGKTDGGGYVFGGLIWSDGKH  767

Query  131   RVRSPIVVKAAA  96
              VRSP+VVK ++
Sbjct  768   YVRSPLVVKCSS  779



>ref|XP_004515893.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=767

 Score =   432 bits (1110),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 268/375 (71%), Gaps = 5/375 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G +DP K  GK+LVCLRG + R DK  QA+ AGA+GMILANDE SG E+IAD H
Sbjct  393   ALLCKEGAIDPHKVNGKILVCLRGGSGRVDKGVQASRAGAIGMILANDEASGGEVIADPH  452

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV ++ G  IFDYIN T+ PVA+I+   T LGV+P P++A+FSSRGPN I P +L
Sbjct  453   LLPASHVNFTIGNYIFDYINSTKLPVAYISRVKTKLGVRPTPIMASFSSRGPNYIAPSLL  512

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA+++AT PS+   DKR + F   SGTSMSCPHV G+VGLLK+L+P W
Sbjct  513   KPDITAPGVNIIAAYSKATSPSEEASDKRRIPFTTMSGTSMSCPHVTGLVGLLKSLHPDW  572

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + N    + D     KATPFAYGAGHI PN AADPGLVYDL +TD
Sbjct  573   SPAAIKSAIMTTATTKDNIDSQMLDSSLD-KATPFAYGAGHIRPNRAADPGLVYDLNITD  631

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVP--HLKGTATVTRTLKNVG  318
             Y+NF+C +GY  +++T   G PY CP+  +L  FNYP+IT+P  ++  +  VTR L NVG
Sbjct  632   YLNFLCRRGYTSSQLTLFYGRPYDCPESFNLVDFNYPAITIPTFNVGHSLNVTRILTNVG  691

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKV--TLKAKGENATADYAFGVLTWS  144
             SP+ Y   +++P  F V+V P  L+F K GE++ FKV  TLK        DY FG L WS
Sbjct  692   SPSKYRVRIQAPSEFLVSVEPSRLRFVKKGEKKEFKVTFTLKPNYSKYITDYVFGKLVWS  751

Query  143   DKKHRVRSPIVVKAA  99
             + KHRV + I ++ A
Sbjct  752   NGKHRVATRISIRYA  766



>ref|XP_002299063.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
 gb|EEE83868.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
Length=786

 Score =   432 bits (1110),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 269/373 (72%), Gaps = 7/373 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GTLDP K  GK+++CLRG + R  K ++A  AGAVGMILAND  SG+E+  +A+ L
Sbjct  413   LCLDGTLDPNKVSGKIILCLRGQSPRLPKGYEAERAGAVGMILANDIISGDELYLEAYEL  472

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK-  849
             P+ H+TY+DG ++ DYI  TRNP A I+   T  GVKP+P +A FSSRGP+ I P +LK 
Sbjct  473   PSAHITYADGESVMDYIKATRNPTASISPAITNFGVKPSPAMAKFSSRGPSKIEPAVLKV  532

Query  848   -----PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTL  684
                  PD++APGV+VIAAFTEA GPS   +DKR   + V SGTSMSCPHV+G+VGLL+ +
Sbjct  533   SSASLPDVTAPGVDVIAAFTEAIGPSRRPFDKRRTPYMVMSGTSMSCPHVSGIVGLLRAI  592

Query  683   YPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDL  504
             +P WSPA ++SAIMTTA  + N+ K + D + +L ATPF YGAGH+ PN AADPGLVYD 
Sbjct  593   HPDWSPAALKSAIMTTAKTKCNNKKRMLDYDGQL-ATPFMYGAGHVQPNLAADPGLVYDT  651

Query  503   KLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKN  324
              + DY++F+CA GYNKT + A    PY CP++ S + FNYPSITVP LKG  TVTR +KN
Sbjct  652   NVNDYLSFLCAHGYNKTLLNAFSDGPYTCPENFSFADFNYPSITVPDLKGPVTVTRRVKN  711

Query  323   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  144
             VG+P TYT S+++P   SV V P  L+F++ GEEQ FK+TLK   +    DY FG LTWS
Sbjct  712   VGAPGTYTVSIKAPAKVSVVVEPSSLEFKQAGEEQLFKLTLKPIMDGMPKDYEFGHLTWS  771

Query  143   DKKHRVRSPIVVK  105
             D  HRV+SP+VVK
Sbjct  772   DGLHRVKSPLVVK  784



>ref|XP_009784573.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana sylvestris]
Length=786

 Score =   432 bits (1110),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 213/376 (57%), Positives = 278/376 (74%), Gaps = 8/376 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++ CK GTLDP+K KGK+L CLRG TA  DK HQAALAGAVGMIL N++ +G+EI A  H
Sbjct  402   AIRCKKGTLDPKKVKGKILACLRGETALIDKGHQAALAGAVGMILCNNKTTGSEIFAIPH  461

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA HV Y+DG+ +F+YI  +++P A+IT P T+L  KPAP +A+FSS GPN++ P IL
Sbjct  462   VLPAIHVNYTDGVQVFEYIGSSKDPRAYITTPETVLRTKPAPFMASFSSTGPNSVTPQIL  521

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV++IAA++EA  P++ DYDKR  SFN+ SGTSMSCPHVAGVVGLLK+L+P W
Sbjct  522   KPDVTAPGVDIIAAYSEAANPTEEDYDKRKTSFNMISGTSMSCPHVAGVVGLLKSLHPDW  581

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTTA  R N+G  + D+  + KAT F YGAGH+ PN A +PGLVYDL + D
Sbjct  582   SPAAIRSAIMTTARTRDNTGNPMRDETEKDKATQFNYGAGHMRPNRAMNPGLVYDLTVND  641

Query  491   YVNFICAQGYNKTEITAVLGT--PYKCPDH--ISLSTFNYPSITVPHLKGTA--TVTRTL  330
             Y++F+C+ GYN+  IT   GT   Y+C     ++L  FN P+IT+P++  +A  T+TRTL
Sbjct  642   YLDFLCSLGYNQKNITKFSGTRSTYQCHKKHGLNLLDFNNPAITIPNISPSAPVTITRTL  701

Query  329   KNVGSPATYTASVRSPVG-FSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGV  156
             KNVGSP  Y A+VR P   FSV+V P +L F+ +G+E+SFK+T++ K   A  D Y  G 
Sbjct  702   KNVGSPGVYAANVRLPRRMFSVSVEPSVLMFDHIGQEKSFKLTIEVKDAKAVKDGYVPGE  761

Query  155   LTWSDKKHRVRSPIVV  108
             L W+D+ H VRSPI V
Sbjct  762   LLWTDRLHYVRSPIAV  777



>gb|AAK74005.1| At2g04160/T16B23.1 [Arabidopsis thaliana]
 gb|AAL15409.1| At2g04160/T16B23.1 [Arabidopsis thaliana]
Length=421

 Score =   419 bits (1077),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 261/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP K KGK+LVCLRG   R +K    AL G +GM+L N   +GN+++AD H L
Sbjct  53    LCKLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVL  112

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D  A+  YI++T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  113   PATQLTSKDSFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKP  172

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  173   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  232

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT+  +    I  + T +KATPF++GAGH+ PN A +PGLVYDL + DY+
Sbjct  233   AAIRSAIMTTATIMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYL  291

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C    ISL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  292   NFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  351

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             + YT  V +P G  V V P  L F KVGE+++FKV L     N    Y FG L WSDKKH
Sbjct  352   SMYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGELVWSDKKH  411

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  412   RVRSPIVVK  420



>ref|XP_008464322.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=776

 Score =   430 bits (1106),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 213/374 (57%), Positives = 265/374 (71%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL ND+ SG E IAD H
Sbjct  404   AMLCKPKTLDHSKVKGKILVCLRGDTARVDKGEQAALAGAVGMILCNDKLSGFETIADPH  463

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y+DG A+F YI  T+NP+  +  P+  +  KPAP +AAFSSRGPN I+P+I+
Sbjct  464   VLPASHINYNDGQAVFSYIKSTKNPMGSLIPPSAKVNTKPAPSMAAFSSRGPNLISPEII  523

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAAF+EA  P+   +D R V F   SGTSMSCPHV+G+VGLL+TL+P W
Sbjct  524   KPDVTAPGVNIIAAFSEAVSPTGEPFDNRTVPFITMSGTSMSCPHVSGLVGLLRTLHPHW  583

Query  671   SPAEIRSAIMTTATVRANSGKAITDDET--RLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             SP+ I+SAIMT+A +R N+ K + D  +     ATPFAYG+GHI P GA DPGLVYDL  
Sbjct  584   SPSAIKSAIMTSARIRDNTKKPMLDGGSPDLAPATPFAYGSGHIRPTGAIDPGLVYDLSP  643

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
              DY+ F+CA GYN+  I A    P+KCP   S+  FNYPSI V +L G+ T+TR LKNV 
Sbjct  644   NDYLEFLCASGYNEKTIQAFSDGPFKCPASASILNFNYPSIGVQNLTGSVTLTRKLKNVS  703

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAFGVLTWSD  141
             +P  Y A V  P G  V V PK+LKFE+VGEE+ F++ +     EN   D   GVL W+D
Sbjct  704   TPGVYKARVMHPNGVKVLVKPKVLKFERVGEEKRFELIITGDVPENQVVD---GVLIWTD  760

Query  140   KKHRVRSPIVVKAA  99
              KH VRSPIVV + 
Sbjct  761   GKHFVRSPIVVSSG  774



>dbj|BAB08348.1| serine protease-like protein [Arabidopsis thaliana]
Length=760

 Score =   430 bits (1105),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 220/373 (59%), Positives = 267/373 (72%), Gaps = 3/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDP+K KGK+LVCLRG  AR DK  QAA AGA GM+L ND+ SGNEII+DAH
Sbjct  390   ALLCKKGSLDPKKVKGKILVCLRGDNARVDKGMQAAAAGAAGMVLCNDKASGNEIISDAH  449

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN I P IL
Sbjct  450   VLPASQIDYKDGETLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNTITPGIL  509

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEATGP+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P W
Sbjct  510   KPDITAPGVNIIAAFTEATGPTDLDSDNRRTPFNTESGTSMSCPHISGVVGLLKTLHPHW  569

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN AA PGLVYDL   D
Sbjct  570   SPAAIRSAIMTTSRTRNNRRKPMV-DESFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGD  628

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +      P Y C    +L  FNYPSITVP+L G+ TVTR LKNVG 
Sbjct  629   YLDFLCAVGYNNTVVQLFAEDPQYTCRQGANLLDFNYPSITVPNLTGSITVTRKLKNVGP  688

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             PATY A  R P+G  V+V PK L F K GE + F++TL+      +  Y FG LTW+D  
Sbjct  689   PATYNARFREPLGVRVSVEPKQLTFNKTGEVKIFQMTLRPLPVTPSG-YVFGELTWTDSH  747

Query  134   HRVRSPIVVKAAA  96
             H VRSPIVV+ ++
Sbjct  748   HYVRSPIVVQLSS  760



>ref|NP_200789.2| Subtilase 5.4 [Arabidopsis thaliana]
 sp|F4JXC5.1|SBT54_ARATH RecName: Full=Subtilisin-like protease SBT5.4; AltName: Full=Subtilase 
subfamily 5 member 4; Short=AtSBT5.4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED97236.1| Subtilase family protein [Arabidopsis thaliana]
Length=778

 Score =   430 bits (1106),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 220/373 (59%), Positives = 267/373 (72%), Gaps = 3/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDP+K KGK+LVCLRG  AR DK  QAA AGA GM+L ND+ SGNEII+DAH
Sbjct  408   ALLCKKGSLDPKKVKGKILVCLRGDNARVDKGMQAAAAGAAGMVLCNDKASGNEIISDAH  467

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN I P IL
Sbjct  468   VLPASQIDYKDGETLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNTITPGIL  527

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEATGP+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P W
Sbjct  528   KPDITAPGVNIIAAFTEATGPTDLDSDNRRTPFNTESGTSMSCPHISGVVGLLKTLHPHW  587

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN AA PGLVYDL   D
Sbjct  588   SPAAIRSAIMTTSRTRNNRRKPMV-DESFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGD  646

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +      P Y C    +L  FNYPSITVP+L G+ TVTR LKNVG 
Sbjct  647   YLDFLCAVGYNNTVVQLFAEDPQYTCRQGANLLDFNYPSITVPNLTGSITVTRKLKNVGP  706

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             PATY A  R P+G  V+V PK L F K GE + F++TL+      +  Y FG LTW+D  
Sbjct  707   PATYNARFREPLGVRVSVEPKQLTFNKTGEVKIFQMTLRPLPVTPSG-YVFGELTWTDSH  765

Query  134   HRVRSPIVVKAAA  96
             H VRSPIVV+ ++
Sbjct  766   HYVRSPIVVQLSS  778



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   429 bits (1104),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/369 (55%), Positives = 267/369 (72%), Gaps = 3/369 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVT-ARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             C PGTLDPEK +GK++VC R  + AR +K      AG  GMILAN ++ GN ++AD HFL
Sbjct  398   CYPGTLDPEKVRGKIVVCTRDTSFARVEKGVDVLKAGGAGMILANSDEEGNSLLADPHFL  457

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ +TY D L +  Y+  T++P A I+   T+LGVKPAP +A+FSSRGPN INP+ILKP
Sbjct  458   PASMITYKDALRLSSYLKSTKSPTATISPVTTVLGVKPAPAMASFSSRGPNLINPEILKP  517

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+++AAFTE  GP+  D DKR V FNV SGTSMSCPH++GV GLLK L+P WSP
Sbjct  518   DITAPGVDILAAFTEEVGPTMLDLDKRRVRFNVMSGTSMSCPHISGVAGLLKKLHPRWSP  577

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSA+MTTA  R N+   + DD  R KA PF YGAGH+ PN A DPGLVYD+  TDYV
Sbjct  578   AVIRSAVMTTARTRDNTRTPMKDDN-REKAIPFDYGAGHVRPNRAMDPGLVYDITFTDYV  636

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +F+C++GYN + +   +G  + CP   +     NYPSITVP+L+ + TV+RT++NVG+P 
Sbjct  637   HFLCSRGYNASNMAQFIGKRFACPSKTMRAEDLNYPSITVPNLQKSFTVSRTVRNVGTPG  696

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   +++P G  V+V P+ L+F KVGEE++F+V L+++ E+    Y FG LTW+D KH 
Sbjct  697   TYNVRIKAPFGIHVSVKPQTLEFAKVGEEKTFQVRLRSRSESVGVGYVFGGLTWTDGKHY  756

Query  128   VRSPIVVKA  102
             VRSP+VV A
Sbjct  757   VRSPLVVNA  765



>ref|XP_010538433.1| PREDICTED: subtilisin-like protease SBT5.4 [Tarenaya hassleriana]
Length=767

 Score =   429 bits (1103),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 215/370 (58%), Positives = 269/370 (73%), Gaps = 3/370 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             CK GTLDPEKAKGK++VCLRG +AR +K  QAALAGAVGMIL ND+ +GN+IIAD HFLP
Sbjct  398   CKEGTLDPEKAKGKIMVCLRGDSARVEKGRQAALAGAVGMILCNDKSTGNDIIADPHFLP  457

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             A+ + Y DGL++F YIN T +P+ +IT P    G+KPAP +A FSS+GPN++ P ILKPD
Sbjct  458   ASQINYVDGLSVFSYINSTHDPMGYITAPTAAYGIKPAPFMADFSSQGPNSVTPGILKPD  517

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             ++APGVN+IAA+T    P+  + D R  ++  ESGTSM+CPHVAGV GLLKT++PSWSPA
Sbjct  518   VTAPGVNIIAAYTREQSPTGLESDTRTTAYITESGTSMACPHVAGVAGLLKTMHPSWSPA  577

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              IRSAIMTTA  R N    +  + + +KA  F YG+GH+ PN A DPGLVYDL   DY++
Sbjct  578   AIRSAIMTTARTRDNRVSPMM-NASYVKANSFNYGSGHLRPNRAGDPGLVYDLTADDYLD  636

Query  482   FICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKN-VGSPAT  306
             F+CA GYN+T +      PYKCP+  SL  FNYPSITVP+LKG  TVTR LKN  G    
Sbjct  637   FLCAIGYNQTMMELFSDGPYKCPEGASLLDFNYPSITVPNLKGPVTVTRKLKNVGGGGGR  696

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGVLTWSDKKHR  129
             Y   VR P G SV V P++L+FE+V + +SF++TLK K + A ++ Y FG L WSD  H 
Sbjct  697   YVVRVREPYGVSVKVEPRVLEFERVSQVKSFEMTLKPKWDGAASNGYVFGGLIWSDGIHF  756

Query  128   VRSPIVVKAA  99
             VRSPIVV AA
Sbjct  757   VRSPIVVAAA  766



>ref|XP_009610677.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana tomentosiformis]
Length=786

 Score =   429 bits (1103),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/376 (56%), Positives = 276/376 (73%), Gaps = 8/376 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++ CK GTLDP+K KGK+L CLRG TA  DK HQAALAGAVGMIL N++ +G+EI A  H
Sbjct  402   AIRCKKGTLDPKKVKGKILACLRGETALIDKGHQAALAGAVGMILCNNKTTGSEIFAIPH  461

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA HV Y+DG+ +FDYI  +++P A+IT P T+L  KPAP +A+FSS GPN++ P IL
Sbjct  462   VLPAIHVNYTDGVQVFDYIASSKDPRAYITTPETVLHKKPAPFMASFSSTGPNSVTPQIL  521

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV++IAA++EA  P++ DYDKR  SFN+ SGTSMSCPHVAGVVGLLK+L+P W
Sbjct  522   KPDVTAPGVDIIAAYSEAANPTEEDYDKRKTSFNMISGTSMSCPHVAGVVGLLKSLHPDW  581

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTTA  R N+G  + D+  + KAT F YGAGH+ PN A +PGLVYDL + D
Sbjct  582   SPAAIRSAIMTTARTRDNTGNPMRDETEKDKATQFNYGAGHMRPNRAMNPGLVYDLTVND  641

Query  491   YVNFICAQGYNKTEITAVLGT--PYKCPDH--ISLSTFNYPSITVPHLKGT--ATVTRTL  330
             Y++F+C+ GYN+  IT   GT   Y+C     +++  FN P+IT+P++  +   T+TRTL
Sbjct  642   YLDFLCSLGYNQKNITKFSGTGSTYQCHKKHGLNILDFNNPAITIPNISPSVPVTITRTL  701

Query  329   KNVGSPATYTASVRSPVG-FSVTVNPKILKFEKVGEEQSFKVTLKAKGENATAD-YAFGV  156
             KNVGSP  Y A VR P   FSV+V P +L F+ +G+E+SFK+T++ K   A  D Y  G 
Sbjct  702   KNVGSPGVYAAHVRLPRRMFSVSVEPSVLMFDHIGQEKSFKLTIEVKNAKAVKDGYVPGE  761

Query  155   LTWSDKKHRVRSPIVV  108
             L W+D+ H VRSPI V
Sbjct  762   LLWTDRLHYVRSPIAV  777



>gb|KDP29035.1| hypothetical protein JCGZ_16424 [Jatropha curcas]
Length=1089

 Score =   437 bits (1123),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 216/368 (59%), Positives = 265/368 (72%), Gaps = 3/368 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             C  G+LDP K KGK+L CLRG + R +K  QAALAGAVG IL+ND+  G+EI  D H LP
Sbjct  725   CLAGSLDPAKVKGKILACLRGGSDRMEKGQQAALAGAVGFILSNDKSFGDEISQDLHMLP  784

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             A+H+ Y DGLA++ YIN T +PVA IT P + +   PAP +A FSS GPN I P+ILKPD
Sbjct  785   ASHINYRDGLALYSYINSTDDPVAFIT-PTSEMLAGPAPFMADFSSVGPNIITPEILKPD  843

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             ++APGVN+IAAF+EA  PS++ +DKR  +FN+ SGTSMSCPHVAGVV LLKTLYP WSPA
Sbjct  844   VTAPGVNIIAAFSEAASPSESYFDKRRTAFNLNSGTSMSCPHVAGVVALLKTLYPYWSPA  903

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              IRSAIMTTA  R N+   + D  ++ KATPF YG+GH+ PN A +PGLVYDL + DY++
Sbjct  904   AIRSAIMTTARTRDNTIHPMRDGYSK-KATPFHYGSGHMRPNRAMNPGLVYDLSVNDYLD  962

Query  482   FICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  303
             F+CA GYN+T I A     +KCP   SL  FNYPSI V  L G+ TV+R LKNVGSP  Y
Sbjct  963   FLCAIGYNQTLIHA-FSVGHKCPKSASLLEFNYPSIAVLKLSGSVTVSRKLKNVGSPGKY  1021

Query  302   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVR  123
                ++ P G SV+V P++L F+K GEE+SFK T  AK E A  +Y FG L W+D  H VR
Sbjct  1022  AVRIKEPYGISVSVEPRVLTFDKNGEEKSFKATFTAKWEGAAKEYEFGGLIWTDGLHYVR  1081

Query  122   SPIVVKAA  99
             SPIVV AA
Sbjct  1082  SPIVVSAA  1089


 Score =   141 bits (355),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             C  G+LDP K KGK+L CLRG + R +K  QAALAGAVG IL+ND+  G+EI  D H LP
Sbjct  390   CLAGSLDPAKVKGKILACLRGGSDRMEKGQQAALAGAVGFILSNDKSFGDEISQDLHMLP  449

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             A+H+ Y DGLA++ YIN T +PVA IT P + +   PAP +A FSS GPN I P+ILK  
Sbjct  450   ASHINYRDGLALYSYINSTDDPVAFIT-PTSEMLAGPAPFMADFSSVGPNIITPEILK--  506

Query  842   ISAPGVNVIA  813
             +  P   V+A
Sbjct  507   VCGPNQKVLA  516



>gb|KDO51018.1| hypothetical protein CISIN_1g015812mg [Citrus sinensis]
Length=400

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 270/373 (72%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +L+CK GTLDP+K KGK+LVCL   T   DK  QAALAGA G++L N  + GN+ + D H
Sbjct  28    ALICKKGTLDPKKVKGKILVCLDVNTRSVDKGLQAALAGAAGIVLVNLPEYGNDRMTDPH  87

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + ++D +++F YI   ++PV +IT P T  G KPAP +AAFSS+GPN I P+IL
Sbjct  88    VLPASDINFNDSVSLFSYITSIKHPVGYITRPTTEFGTKPAPFMAAFSSKGPNIITPEIL  147

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG N+IAA+TEA  P+  +YDKR   FN  SGTSMSCPH++G+  LLK L+P W
Sbjct  148   KPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSMSCPHISGIASLLKILHPDW  207

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA+   N+ + I  + +  +ATPF+YGAGH+ PN A DPGLVYDL   D
Sbjct  208   SPAAIQSAIMTTASTHDNNKQQIL-NASFAEATPFSYGAGHVQPNLAMDPGLVYDLTAND  266

Query  491   YVNFICAQGYNKTEITAV-LGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             Y+NF+C  GYNK EI        Y CP+H ISL  FNYPSI+VP L G+ TVTR +KNVG
Sbjct  267   YLNFLCTLGYNKKEIFWFSKNYTYTCPNHTISLVDFNYPSISVPKLSGSITVTRKVKNVG  326

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS-D  141
             SP TY A ++SP G SVT+ PK LKF  VGEE+SFKV +KA+  + T DYAFG L WS D
Sbjct  327   SPGTYQALLKSPKGVSVTIAPKSLKFINVGEEKSFKVIIKAQNASVTKDYAFGELIWSDD  386

Query  140   KKHRVRSPIVVKA  102
             K H+VRSPIVVKA
Sbjct  387   KHHQVRSPIVVKA  399



>ref|XP_004172226.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=404

 Score =   415 bits (1066),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 255/368 (69%), Gaps = 3/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KAKGK++VCLRG  AR +K      AG VGMIL N ++ G+   ADAH L
Sbjct  35    LCHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMILVNGKNGGSGTTADAHIL  94

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH++Y+DGLA+  YIN T+ PVAHIT   T LG+KP+PV+A FSSRGPN I   +LKP
Sbjct  95    PATHLSYTDGLAVAQYINSTKTPVAHITPVQTQLGIKPSPVMADFSSRGPNPITEAMLKP  154

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+ PG++++A+ T     +   +D R V FNVESGTSMSCPH++GVVGLLKTLYP+WSP
Sbjct  155   DITGPGMSILASVTTDVTATTFPFDTRRVPFNVESGTSMSCPHISGVVGLLKTLYPTWSP  214

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I+D+  + KATPF YGAGH++PN A DPGLVYD  + DY+
Sbjct  215   AAIKSAIMTTAKTRDNTMRTISDN-VKPKATPFDYGAGHVHPNSAMDPGLVYDTTIDDYL  273

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GYN          P+ C    +L+  NYPSI++P L+  A  TV R +KNVG+P
Sbjct  274   NFLCARGYNSLTFKNFYNKPFVCAKSFTLTDLNYPSISIPKLQFGAPVTVNRRVKNVGTP  333

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V +     VTV P  L+F  VGEE++FKV  + KG      Y FG L WSD KH
Sbjct  334   GTYVARVNASSKILVTVEPSTLQFNSVGEEKAFKVVFEYKGNEQDKGYVFGTLIWSDGKH  393

Query  131   RVRSPIVV  108
              VRSPIVV
Sbjct  394   NVRSPIVV  401



>gb|AES91025.2| subtilisin-like serine protease [Medicago truncatula]
Length=747

 Score =   426 bits (1095),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 211/372 (57%), Positives = 269/372 (72%), Gaps = 4/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC  G+LD  KAKGK+LVCL G  +R DK  +A+  GAVGMILAND+ SG EII DAH
Sbjct  374   ALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEIIPDAH  433

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + P IL
Sbjct  434   VLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILAPSIL  493

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK+++P W
Sbjct  494   KPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKSIHPDW  553

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + N G  +  D ++ +ATP AYGAGH+ PN AADPGLVYDL +TD
Sbjct  554   SPAAIKSAIMTTATTKNNIGGHVL-DSSQEEATPNAYGAGHVRPNLAADPGLVYDLNITD  612

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  318
             Y+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT+ NVG
Sbjct  613   YLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRTVTNVG  672

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSD  141
             SP+ Y   +++PV F V+VNP+ L F+K GE++ FKVTL   KG     DY FG L W+D
Sbjct  673   SPSKYRVHIQAPVEFLVSVNPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKLVWTD  732

Query  140   KKHRVRSPIVVK  105
              KH+V  PI +K
Sbjct  733   GKHQVGIPISIK  744



>ref|XP_007206786.1| hypothetical protein PRUPE_ppa025514mg [Prunus persica]
 gb|EMJ07985.1| hypothetical protein PRUPE_ppa025514mg [Prunus persica]
Length=772

 Score =   427 bits (1097),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 266/372 (72%), Gaps = 3/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVT--ARTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             +++C+ GTLDP K KGK+LVCL+     ART+KS QA +AGAVGMIL NDE SGN+++AD
Sbjct  399   AIICQGGTLDPRKVKGKILVCLQEYNDNARTEKSWQADMAGAVGMILVNDEQSGNDVVAD  458

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
              H L  +HV Y+DG  IFDYI  T+ P+A++T   T  G KPAP +A FSSRGPN +   
Sbjct  459   PHVLLVSHVNYTDGKYIFDYIKSTKTPMAYLTRVKTEFGSKPAPFVATFSSRGPNLLEQG  518

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI APGV++IAA+TEA GP+    D R V FNV++G+SM+CPH +G+ GLL+TL+P
Sbjct  519   ILKPDIIAPGVSIIAAYTEAAGPTSQISDTRRVPFNVQTGSSMACPHASGIAGLLRTLHP  578

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
              WSPA I+SAIMTTAT   +S + I DD + +KATPFAYG+GHI PN A DPGLVY+L  
Sbjct  579   DWSPAAIKSAIMTTATTEDDSMEPIPDDSSYVKATPFAYGSGHIQPNKAMDPGLVYNLTT  638

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL-KGTATVTRTLKNV  321
              DY+NF+CA+GYN+T I +   + YKC    SL+ FNYPSI+VP+L + + T+ R + NV
Sbjct  639   LDYLNFLCARGYNETMIKSFSNSIYKCSKSFSLADFNYPSISVPNLSEDSVTINRKVTNV  698

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
             GSP TY   V+ P    V V P+ LKF+++GE + FKV LKAK +     Y FG L WSD
Sbjct  699   GSPGTYKVHVKEPSEVEVLVKPRRLKFKRIGEVKMFKVILKAKVKGKPQGYVFGELIWSD  758

Query  140   KKHRVRSPIVVK  105
               H V+SP+ VK
Sbjct  759   GSHYVKSPLAVK  770



>ref|XP_009759335.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana sylvestris]
Length=776

 Score =   427 bits (1097),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 213/374 (57%), Positives = 261/374 (70%), Gaps = 6/374 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK  TLD  K KG++LVCLRG   R DK HQA + GAVGMIL ND+ SGN+IIAD H L
Sbjct  403   LCKQATLDASKVKGRILVCLRGNNTRVDKGHQAVMGGAVGMILCNDQTSGNDIIADVHLL  462

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+TY+DGLA+F YIN T N +  IT P   LG+KPAP +A+FSSRGPN I P ILKP
Sbjct  463   PASHITYNDGLAVFAYINSTNNAMGSITAPKATLGIKPAPTMASFSSRGPNLITPAILKP  522

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN+IAA+TE   PS+  +D R  ++NV SGTSMSCPHV+G+VGLLK ++P WSP
Sbjct  523   DITAPGVNIIAAYTEGNNPSNEVFDNRRTAYNVMSGTSMSCPHVSGIVGLLKAIHPDWSP  582

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSA+MTTA+   N+GK +  D T+  ATPFA GAG I PN A+DPGL+YDL++ DY+
Sbjct  583   AAIRSALMTTASPIDNTGKPLL-DTTKEAATPFACGAGPIRPNLASDPGLIYDLEVDDYL  641

Query  485   NFICAQGYNKTEITAVLGTPYKCP--DHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP  312
             NF+CA GY+   I      PY CP   + SL  FNYPSITVP L G   VTRTL NVG P
Sbjct  642   NFLCASGYDSQVIRTFNKAPYICPPLSNSSLLEFNYPSITVPALSGNLIVTRTLTNVGPP  701

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATA---DYAFGVLTWSD  141
              T+TA V  P G SV V P +L F+  G+++ F + +KA      A    + +G L WSD
Sbjct  702   GTFTARVGQPPGISVVVEPNVLIFKSQGQKERFSLHIKAVNTTYLAGVDQHKYGELVWSD  761

Query  140   KKHRVRSPIVVKAA  99
               H VRSPI V+ A
Sbjct  762   GTHTVRSPITVEIA  775



>ref|XP_002866352.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42611.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   426 bits (1096),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 218/370 (59%), Positives = 265/370 (72%), Gaps = 3/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDPEK KGK++VCLRG  AR DK  QA  AGA GMIL ND+ SGNEII+DAH
Sbjct  408   ALLCKKGSLDPEKVKGKIVVCLRGDNARVDKGQQALAAGAAGMILCNDKASGNEIISDAH  467

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y +G  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN+I P IL
Sbjct  468   VLPASQIDYKEGEVLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNSITPGIL  527

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEAT P+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P W
Sbjct  528   KPDITAPGVNIIAAFTEATSPTDLDSDHRRTPFNTESGTSMSCPHISGVVGLLKTLHPQW  587

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN AA PGLVYDL + D
Sbjct  588   SPAAIRSAIMTTSRTRDNRRKPMV-DESFKKANPFSYGSGHVQPNKAAHPGLVYDLTIGD  646

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +      P Y C    +L  FNYPSITVP+L  + TVTR L NVG 
Sbjct  647   YLDFLCAVGYNNTVVQLFAEDPQYMCRQGANLLDFNYPSITVPNLTDSITVTRKLTNVGP  706

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             PATY A  R P+G SV+V PK L F K GE + F++TL+ K    +  Y FG LTW+D  
Sbjct  707   PATYNAHFREPLGVSVSVEPKQLTFNKTGEVKIFQMTLRPKSAKPSG-YVFGELTWTDSH  765

Query  134   HRVRSPIVVK  105
             H VRSPIVV+
Sbjct  766   HYVRSPIVVE  775



>gb|KEH31721.1| subtilisin-like serine protease [Medicago truncatula]
Length=627

 Score =   422 bits (1084),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 268/372 (72%), Gaps = 4/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +KAKGK++VCLRG   RTDK  QAA AGAVGMILAN+ +SGN++++D H
Sbjct  254   ALLCKKGTLDSKKAKGKIVVCLRGDNDRTDKGVQAARAGAVGMILANNIESGNDVLSDPH  313

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y DG  IF Y+N T++P A I+   T LG  P+P++A+FSSRGPN I+P IL
Sbjct  314   VLPASHLGYDDGSYIFSYLNNTKSPKASISKVETKLGQSPSPIMASFSSRGPNIIDPSIL  373

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+ PGV+++AA++EA  PS    DKR   F   SGTSMS PHV+G+VG++K+L+P W
Sbjct  374   KPDITGPGVDIVAAYSEAASPSQQKSDKRRSPFITLSGTSMSTPHVSGIVGIIKSLHPDW  433

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA ++ N+GK I  D TR+ A PFAYGAG + PN A DPGLVYDL +TD
Sbjct  434   SPAAIKSAIMTTARIKDNTGKPIL-DSTRINANPFAYGAGQVQPNHAVDPGLVYDLNITD  492

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  318
             Y N++C +GY  + +T   G  Y CP   +L  FNYPSI++P+LK      VTRTL NVG
Sbjct  493   YTNYLCNRGYKGSRLTIFYGKRYICPKSFNLLDFNYPSISIPNLKIRDFLNVTRTLTNVG  552

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATADYAFGVLTWSD  141
             SP+TY   +++P    V+V PK+L F++ GE++ F+VT   K   N + DY FG L WSD
Sbjct  553   SPSTYKVHIQAPHEVLVSVEPKVLNFKEKGEKKEFRVTFSLKTLTNNSTDYLFGSLDWSD  612

Query  140   KKHRVRSPIVVK  105
              KH VRS IV+K
Sbjct  613   CKHHVRSSIVIK  624



>ref|XP_008218944.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score =   426 bits (1096),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 266/372 (72%), Gaps = 3/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVT--ARTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             +++C+ GTLDP K KGK+LVCLR     ART+KS QA +AGAVGMIL NDE SGN+++AD
Sbjct  399   AIICQGGTLDPRKVKGKILVCLREYNDNARTEKSWQAEMAGAVGMILVNDEQSGNDVVAD  458

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
              H L  +HV Y+DG  IFDYI  T+ P+A++T   T LG KPAP +A FSSRGPN     
Sbjct  459   PHVLLVSHVNYTDGKYIFDYIKSTKTPMAYLTRVKTELGSKPAPFVATFSSRGPNLQEQG  518

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI APGV++IAA+TEA GP+    D R V FNV++G+SM+CPH +G+ GLL+TL+P
Sbjct  519   ILKPDIIAPGVSIIAAYTEAAGPTSQISDTRRVPFNVQTGSSMACPHASGIAGLLRTLHP  578

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
              WSPA I+SAIMTTAT + +  + I DD + ++ATPFAYG+GHI PN A DPGLVY+L  
Sbjct  579   DWSPAAIKSAIMTTATTQDDHMEPILDDSSYVEATPFAYGSGHIQPNKAMDPGLVYNLTT  638

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHL-KGTATVTRTLKNV  321
              DY+NF+CA+GYN+T I +   + YKC    SL+ FNYPSI+VP+L + + T+ R + NV
Sbjct  639   LDYLNFLCARGYNETMIKSFSNSTYKCSKSFSLADFNYPSISVPNLSEDSVTINRKVTNV  698

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
             GSP TY   V+ P    V V P+ LKF+++GE + FKV LKAK +     Y FG L WSD
Sbjct  699   GSPGTYKVHVKEPSEVEVLVKPRRLKFKRIGEVKMFKVILKAKVKGKPQGYVFGELIWSD  758

Query  140   KKHRVRSPIVVK  105
               H V+SP+ VK
Sbjct  759   GSHYVKSPLAVK  770



>ref|XP_009136129.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=775

 Score =   426 bits (1094),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/369 (56%), Positives = 268/369 (73%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG+  R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  407   LCKIGSLDPQKAKGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVL  466

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +++ D L++  YI++T+ P+AHIT   T+LG KPAPV+AAFSS+GP+++ P+ILKP
Sbjct  467   PATQISFKDSLSLSRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKP  526

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  527   DITAPGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  586

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  587   AAIRSAIMTTATTMDDIPGPIL-NSTYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  645

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  646   NFLCSLGYNASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP  705

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT  V +P G SV V P  L F KVGE+++FKVT+  +       Y FG L WSDKKH
Sbjct  706   STYTVRVNNPEGVSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKH  765

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  766   RVRSPIVVK  774



>emb|CDY65487.1| BnaA03g57660D [Brassica napus]
Length=775

 Score =   426 bits (1094),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/369 (56%), Positives = 268/369 (73%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG+  R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  407   LCKIGSLDPQKAKGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVL  466

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +++ D L++  YI++T+ P+AHIT   T+LG KPAPV+AAFSS+GP+++ P+ILKP
Sbjct  467   PATQISFKDSLSLSRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKP  526

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  527   DITAPGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  586

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  587   AAIRSAIMTTATTMDDIPGPIL-NSTYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  645

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  646   NFLCSLGYNASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP  705

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT  V +P G SV V P  L F KVGE+++FKVT+  +       Y FG L WSDKKH
Sbjct  706   STYTVRVNNPEGVSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKH  765

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  766   RVRSPIVVK  774



>ref|XP_006297035.1| hypothetical protein CARUB_v10013025mg [Capsella rubella]
 gb|EOA29933.1| hypothetical protein CARUB_v10013025mg [Capsella rubella]
Length=770

 Score =   425 bits (1093),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/370 (58%), Positives = 270/370 (73%), Gaps = 5/370 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++IAD H L
Sbjct  402   LCKIGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLIADPHVL  461

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T +D LA+  YI++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  462   PATQLTSTDSLAVSRYISQTKNPIAHITPSRTDLGLKPAPVMASFSSKGPSTVAPEILKP  521

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  522   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  581

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  582   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGVKDYL  640

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTA-TVTRTLKNVGSP  312
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  T++RT+KNVG P
Sbjct  641   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKITISRTVKNVGRP  700

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTL-KAKGENATADYAFGVLTWSDKK  135
             +TYT  V +P G  V V P  L F KVGE+++FKVTL K KG N   DY FG L WSDKK
Sbjct  701   STYTVRVTNPQGVYVAVKPTSLNFTKVGEQKTFKVTLVKVKG-NVAKDYVFGELVWSDKK  759

Query  134   HRVRSPIVVK  105
             HRVRSPIVVK
Sbjct  760   HRVRSPIVVK  769



>ref|XP_009396709.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=770

 Score =   424 bits (1090),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 209/374 (56%), Positives = 266/374 (71%), Gaps = 8/374 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC PG+LDP K KGK++VCLRG +AR  K      AG VGM+LAN    GNEIIAD H L
Sbjct  401   LCLPGSLDPAKVKGKIVVCLRGSSAREAKGETVREAGGVGMVLANSGSFGNEIIADVHVL  460

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+T+SDGLA++ Y+N T++P+ +I    T LG +PAP +A+FSSRGPN I P ILKP
Sbjct  461   PATHITFSDGLALYSYLNSTKSPLGYIAVHMTKLGAEPAPAMASFSSRGPNTITPGILKP  520

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+V+AA T    P++ D+D+R V+F ++SGTSMSCPH++GVVGLLK L+P WSP
Sbjct  521   DITAPGVDVLAASTGDVSPTELDFDRRRVAFMLKSGTSMSCPHISGVVGLLKALHPGWSP  580

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA V  N    + D+ T L A+PF YG+GH+ PN A DPGLVYDL  TDY+
Sbjct  581   AAIKSAIMTTARVWDNEKLPLLDEATFLDASPFNYGSGHVRPNRAMDPGLVYDLTTTDYL  640

Query  485   NFICAQGYNKTEITAVLGTPYKCPD---HISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             NF+C  GYN T++       Y CP    HI     NYPSIT+P L  +  VTR +KNVGS
Sbjct  641   NFLCGLGYNSTQLAEF--RSYSCPSKPPHI--KDLNYPSITIPDLSSSTKVTRVVKNVGS  696

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGE-NATADYAFGVLTWSDK  138
             P TY   V  P G SVTV+P  L F++VGEE+ F+VTLK   E  ++A+Y FG L W+D+
Sbjct  697   PGTYAVRVIEPRGISVTVSPTNLTFDEVGEEKKFEVTLKKIKEGESSAEYVFGRLIWTDR  756

Query  137   KHRVRSPIVVKAAA  96
             KH VR+P+VVK+ +
Sbjct  757   KHYVRTPLVVKSTS  770



>ref|XP_003614591.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES97549.1| subtilisin-like serine endopeptidase family protein [Medicago 
truncatula]
Length=670

 Score =   421 bits (1082),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 209/372 (56%), Positives = 265/372 (71%), Gaps = 4/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC  G+LD  KAKGK+LVCLRG   R  K  +A+  GAVGMILANDE SG EII+DAH
Sbjct  297   ALLCINGSLDSHKAKGKILVCLRGNNGRVKKGVEASRVGAVGMILANDEASGGEIISDAH  356

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV + DG  I  Y+N T++P+A+IT   T LGVK +P IAAFSSRGPN + P IL
Sbjct  357   VLPASHVNFKDGNVILKYVNYTKSPIAYITRVKTQLGVKASPSIAAFSSRGPNILAPSIL  416

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV +IAA++EA   S ++ DKR   FN+ SGTSM+CPHVAG+V LLK+++P W
Sbjct  417   KPDITAPGVKIIAAYSEALPRSPSESDKRRTPFNIMSGTSMACPHVAGLVALLKSVHPDW  476

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + N G  +  D ++ +ATP AYGAGH+ PN AADPGLVYDL +TD
Sbjct  477   SPAVIKSAIMTTATTKDNIGGHLL-DSSQEEATPNAYGAGHVRPNLAADPGLVYDLNITD  535

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  318
             Y+NF+C  GYN +++    G PY CP   +L  FNYP+I VP+ K      VTRT+ NVG
Sbjct  536   YLNFLCGHGYNNSQLKLFYGRPYTCPKSFNLIDFNYPAIIVPNFKIGQPLNVTRTVTNVG  595

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSD  141
             SP+ Y   +++P GF V+V P  L F+K GE++ FKVTL   KG     DY FG L W+D
Sbjct  596   SPSRYRVHIQAPTGFLVSVKPNRLNFKKNGEKREFKVTLTLKKGTTYKTDYVFGKLIWTD  655

Query  140   KKHRVRSPIVVK  105
              KH+V +PI +K
Sbjct  656   GKHQVATPIAIK  667



>gb|AES91026.2| subtilisin-like serine protease [Medicago truncatula]
Length=790

 Score =   424 bits (1090),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 209/372 (56%), Positives = 268/372 (72%), Gaps = 4/372 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC  G+LD  KAKGK+LVCL G  +R DK  +A+  GAVGMILAND+ SG EII DAH
Sbjct  417   ALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEIIPDAH  476

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + P IL
Sbjct  477   VLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILAPSIL  536

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK+++P W
Sbjct  537   KPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKSIHPDW  596

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + N G  +  D ++ +ATP AYGAGH+ PN AADPGLVYDL +TD
Sbjct  597   SPAAIKSAIMTTATTKDNIGGHVL-DSSQEEATPHAYGAGHVRPNLAADPGLVYDLNITD  655

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  318
             Y+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT+ NVG
Sbjct  656   YLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRTVTNVG  715

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSD  141
             SP+ Y   +++P  F V+V P+ L F+K GE++ FKVTL   KG     DY FG L W+D
Sbjct  716   SPSKYRVHIQAPAEFLVSVEPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKLVWTD  775

Query  140   KKHRVRSPIVVK  105
              KH+V +PI +K
Sbjct  776   GKHQVGTPIAIK  787



>gb|AAM15440.1| subtilisin-like serine protease AIR3, partial [Arabidopsis thaliana]
Length=578

 Score =   417 bits (1073),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 261/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP K KGK+LVCLRG   R +K    AL G +GM+L N   +GN+++AD H L
Sbjct  210   LCKLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVL  269

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D  A+  YI++T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  270   PATQLTSKDSFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKP  329

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  330   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  389

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT+  +    I  + T +KATPF++GAGH+ PN A +PGLVYDL + DY+
Sbjct  390   AAIRSAIMTTATIMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYL  448

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C    ISL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  449   NFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  508

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             + YT  V +P G  V V P  L F KVGE+++FKV L     N    Y FG L WSDKKH
Sbjct  509   SMYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGELVWSDKKH  568

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  569   RVRSPIVVK  577



>ref|XP_008449184.1| PREDICTED: uncharacterized protein LOC103491134 [Cucumis melo]
Length=1511

 Score =   439 bits (1130),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 212/374 (57%), Positives = 269/374 (72%), Gaps = 3/374 (1%)
 Frame = -3

Query  1220  NSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIA  1041
             +  +LLC+ G+LDP KAKGK+++CLRG +AR DKS +   AG +G+IL ND++ GN+I A
Sbjct  1137  DKLALLCEDGSLDPAKAKGKIVLCLRGDSARMDKSFEVRRAGGIGLILVNDKEDGNDITA  1196

Query  1040  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  861
             D HFLPA+H+ Y+DG+AIF YIN T++P+A ITH  T +G+KP+P++A FSSRGPN I  
Sbjct  1197  DPHFLPASHLNYADGIAIFQYINSTKSPMAFITHVKTEMGIKPSPMVADFSSRGPNPIID  1256

Query  860   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  681
              ++KPDI+APGV+++AAF+E    +D   D R VSFN ESGTSM+CPH++GVVGLLKTLY
Sbjct  1257  SMIKPDIAAPGVSILAAFSEYATATDFPLDTRRVSFNFESGTSMACPHISGVVGLLKTLY  1316

Query  680   PSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLK  501
             P WSPA I+SAIMTTA  R NS K+I  D  + KATPF YGAGH++PN A DPGLVYD  
Sbjct  1317  PKWSPAAIKSAIMTTAKTRDNSMKSIL-DYNKAKATPFQYGAGHVHPNNAIDPGLVYDTT  1375

Query  500   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GT-ATVTRTLK  327
             + DY+NFICAQGYN T +      PY CP    L+  NYPSI+VP L  G   T+ R LK
Sbjct  1376  IEDYMNFICAQGYNSTTLKRFYNKPYLCPKSFPLTDLNYPSISVPKLTIGVPVTINRRLK  1435

Query  326   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             NVG+P TY A V+     SVTV P  L+F  VGEE++FKV  + KG+     + FG L W
Sbjct  1436  NVGTPGTYVARVKVSSKVSVTVKPSTLQFNSVGEEKAFKVVFEYKGKGQGKGHVFGTLIW  1495

Query  146   SDKKHRVRSPIVVK  105
             SD  H VRSP+ VK
Sbjct  1496  SDGNHFVRSPMAVK  1509


 Score =   417 bits (1073),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 210/375 (56%), Positives = 261/375 (70%), Gaps = 4/375 (1%)
 Frame = -3

Query  1220  NSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIA  1041
             +S +  C+ G+LDP K KGK++VCLRGVTAR +K +    AG VGMIL ND+  G+ +I+
Sbjct  396   DSFAQKCETGSLDPAKVKGKIVVCLRGVTARVEKGYVVLQAGGVGMILVNDKTDGSGLIS  455

Query  1040  DAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINP  861
             D+H LPAT +TY+DGLA+  YIN T  PVA IT   T LGVKP+PV+A FSSRGPN I  
Sbjct  456   DSHILPATSLTYTDGLAVAQYINSTTTPVALITPVETQLGVKPSPVMAGFSSRGPNPITD  515

Query  860   DILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLY  681
              +LKPDI+ PGVN++A+ T     +   +D R V FNVESGTSMSCPH+AGV GLLKTLY
Sbjct  516   AMLKPDITGPGVNILASVTTDVTATKFPFDTRRVPFNVESGTSMSCPHIAGVSGLLKTLY  575

Query  680   PSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLK  501
             P+WSPA I+SAIMTTA  R NS   ++ D  + KATPF YGAGH+NPN A DPGLVYD  
Sbjct  576   PTWSPAAIKSAIMTTAKTRDNSMHTLS-DTVKAKATPFDYGAGHVNPNNAMDPGLVYDTT  634

Query  500   LTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLK  327
             + DY+NF+CA+GYN   + +    P+ C    +L+  NYPSI++P LK  A  TV R +K
Sbjct  635   IDDYLNFLCARGYNAQTLMSFHSKPFVCATPFTLTDLNYPSISIPELKSGAPVTVNRRVK  694

Query  326   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             NVG+P TY A V++    SVTV P  L+F  VGEE++FKV  + KG      Y FG L W
Sbjct  695   NVGTPGTYVARVKASSKISVTVEPSTLQFNSVGEEKAFKVLFEYKGTGQGKSYVFGTLIW  754

Query  146   SDK-KHRVRSPIVVK  105
             SD  KH VRSPIVVK
Sbjct  755   SDNGKHNVRSPIVVK  769



>ref|XP_003608828.1| Subtilisin-like serine protease [Medicago truncatula]
Length=778

 Score =   422 bits (1085),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 269/373 (72%), Gaps = 5/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC  G+LD  KAKGK+LVCL G  +R DK  +A+  GAVGMILAND+ SG EII DAH
Sbjct  404   ALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEIIPDAH  463

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + P IL
Sbjct  464   VLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILAPSIL  523

Query  851   K-PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             K PDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK+++P 
Sbjct  524   KVPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKSIHPD  583

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WSPA I+SAIMTTAT + N G  +  D ++ +ATP AYGAGH+ PN AADPGLVYDL +T
Sbjct  584   WSPAAIKSAIMTTATTKNNIGGHVL-DSSQEEATPNAYGAGHVRPNLAADPGLVYDLNIT  642

Query  494   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNV  321
             DY+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT+ NV
Sbjct  643   DYLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRTVTNV  702

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWS  144
             GSP+ Y   +++PV F V+VNP+ L F+K GE++ FKVTL   KG     DY FG L W+
Sbjct  703   GSPSKYRVHIQAPVEFLVSVNPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKLVWT  762

Query  143   DKKHRVRSPIVVK  105
             D KH+V  PI +K
Sbjct  763   DGKHQVGIPISIK  775



>ref|XP_007154079.1| hypothetical protein PHAVU_003G089100g [Phaseolus vulgaris]
 gb|ESW26073.1| hypothetical protein PHAVU_003G089100g [Phaseolus vulgaris]
Length=788

 Score =   422 bits (1085),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 258/352 (73%), Gaps = 17/352 (5%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  GT+DPEKA+GK+LVCLRG+  R +KS  A  AGA GMIL NDE SGNE+IAD H L
Sbjct  422   LCIRGTIDPEKARGKILVCLRGINPRVEKSLVALEAGAAGMILCNDELSGNELIADPHLL  481

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK-  849
             PA+ VTY DGLA++ Y+N T+NP+ +I  P T L  KPAPV+ AFSSRGPN + P+ILK 
Sbjct  482   PASQVTYKDGLAVYAYVNSTKNPLGYIEPPETKLRTKPAPVMTAFSSRGPNLVTPEILKV  541

Query  848   -PDIS--------------APGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHV  714
              P +                PGVN+IAA++ A  P++ ++DKR V F   SGTSMSCPHV
Sbjct  542   CPFVHYVVPFKFAQNLMSPLPGVNIIAAYSGAVSPTELNFDKRRVPFITMSGTSMSCPHV  601

Query  713   AGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNG  534
             AGVVGLL+TLYP+WSPA I+SAIMTTA  R N+GK + D     KATPFAYG+GHI PN 
Sbjct  602   AGVVGLLRTLYPTWSPAAIKSAIMTTARTRDNTGKPMLDGNNG-KATPFAYGSGHIRPNR  660

Query  533   AADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKG  354
             A DPGLVY+L + DY+NF+C  GYN+T+I    G  Y+CPD I +  FNYP++T+P L G
Sbjct  661   AMDPGLVYELTMNDYLNFLCISGYNQTQIKTFSGAHYRCPDIIDILDFNYPTMTIPKLYG  720

Query  353   TATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK  198
             +A+ TR +KNVGSP TYTAS+R P G S++V P +LKF+K+GEE+S+K+TLK
Sbjct  721   SASFTRRVKNVGSPGTYTASLRVPAGLSISVEPNVLKFDKIGEEKSYKLTLK  772



>gb|AFW70718.1| putative subtilase family protein [Zea mays]
Length=585

 Score =   416 bits (1068),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 256/372 (69%), Gaps = 4/372 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KAKGK++VCLRG+  R  K      AG VGM+LAND  +GNEIIADAH L
Sbjct  211   LCMIGSLDPAKAKGKIVVCLRGINPRVAKGEAVKQAGGVGMVLANDASTGNEIIADAHVL  270

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT + Y DGL ++ Y+N T+ P   IT P T+LG KPAP +AAFSS+GPN I P ILKP
Sbjct  271   PATQIKYRDGLLLYSYVNSTKKPTGFITRPATVLGTKPAPFMAAFSSQGPNIITPGILKP  330

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P+D  +D+R V+FN ESGTSMSCPHV+GVVGLL+TL+P WSP
Sbjct  331   DITAPGVSVIAAWTRANSPTDLAFDRRRVAFNSESGTSMSCPHVSGVVGLLRTLHPEWSP  390

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N G+ I  + + L ++PF YGAGHI+P  A +PGLVYDL   DY+
Sbjct  391   AAIKSAIMTTAAEMDNKGELIL-NASSLPSSPFGYGAGHISPARAMNPGLVYDLGDADYL  449

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLKGT-ATVTRTLKNVGS  315
             +F+CA  YN T +    G PY CP      ++  NYPSITV ++    AT  R +KNVG 
Sbjct  450   DFLCALKYNATVMAMFKGAPYTCPSEAPRRIADLNYPSITVVNVTAAGATALRKVKNVGK  509

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TYTA V  P G +V V P +LKF   GEE+ F+V  K        DY+FG L W++ +
Sbjct  510   PGTYTAFVAEPAGVAVLVTPSVLKFSAKGEEKGFEVHFKVVNATLARDYSFGALVWTNGR  569

Query  134   HRVRSPIVVKAA  99
               VRSP+VVKAA
Sbjct  570   QFVRSPLVVKAA  581



>ref|XP_002885743.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62002.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   421 bits (1083),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 210/369 (57%), Positives = 262/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  405   LCKLGSLDPIKAKGKILVCLRGQNPRVEKGRVVALAGGVGMVLENTNVTGNDLTADPHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  DG A+  YI++T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  465   PATQLTSKDGFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSTVAPQILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P+D  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  525   DITAPGVSVIAAYTAAVSPTDQQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGL+YDL + DY+
Sbjct  585   AAIRSAIMTTATTMDDIPGPI-QNATSMKATPFSFGAGHVQPNLAVNPGLIYDLGIKDYL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+  YN ++I+   G  + C  H  SL   NYPSITVP+L     TV+RT+KNVG P
Sbjct  644   NFLCSLRYNASQISVFSGNNFTCSSHKTSLVNLNYPSITVPNLSSNKVTVSRTVKNVGRP  703

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT  V +P G  VTV P  L F KVGE+++FKV L     N    Y FG L WSDKKH
Sbjct  704   STYTVRVANPQGVYVTVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGELVWSDKKH  763

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  764   RVRSPIVVK  772



>ref|XP_008464289.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=774

 Score =   421 bits (1082),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 207/373 (55%), Positives = 260/373 (70%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL ND+ SG+ I+ D H
Sbjct  402   AMLCKPETLDHSKVKGKILVCLRGETARLDKGKQAALAGAVGMILCNDKLSGSSIVPDFH  461

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y DG  +  YIN  RNP+ ++  P   +  KPAP +A FSSRGPN I+P+I+
Sbjct  462   LLPASHINYQDGQVLLSYINSARNPMGYLIPPLAKVNTKPAPTMAVFSSRGPNTISPEII  521

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGVN+IAAF+EA  P+ +  D R   F   SGTSMSCPHVAG+VGLL+ L+P W
Sbjct  522   KPDVTAPGVNIIAAFSEAISPTRDASDNRTTPFITMSGTSMSCPHVAGLVGLLRNLHPDW  581

Query  671   SPAEIRSAIMTTATVRANSGKAITDDET--RLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             SP+ I+SAIMT++ VR N+   + D  +     ATPFAYG+GHINP GA DPGLVYDL  
Sbjct  582   SPSAIKSAIMTSSQVRDNTLNPMIDGGSLDLAPATPFAYGSGHINPTGAIDPGLVYDLSP  641

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
              DY+ F+CA GY++  I A    P+KCP   S+   NYPSI V +LKG+ +VTR LKNVG
Sbjct  642   NDYLEFLCASGYDEKTIRAFSDEPFKCPPASSVLNLNYPSIGVQNLKGSVSVTRKLKNVG  701

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             SP  Y A +  P G  V+V P+ LKFE+VGEE+SF++TL   G        +G L WSD 
Sbjct  702   SPGVYRAQILHPNGVVVSVKPRFLKFERVGEEKSFELTL--AGVVPKDRVGYGALIWSDG  759

Query  137   KHRVRSPIVVKAA  99
             +H VRSPIVV + 
Sbjct  760   RHVVRSPIVVSSG  772



>emb|CDY15084.1| BnaC03g44450D [Brassica napus]
Length=775

 Score =   421 bits (1082),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 206/369 (56%), Positives = 266/369 (72%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KA+GK+LVCLRG+  R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  407   LCKIGSLDPQKARGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVL  466

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +++ D LA+  YI++T+ P+AHIT   T+LG K APV+AAFSS+GP+++ P+ILKP
Sbjct  467   PATQISFKDSLALSRYISQTKKPIAHITPSRTVLGTKQAPVMAAFSSKGPSSVAPEILKP  526

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPHV+G+ GLLKT YPSWSP
Sbjct  527   DITAPGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSP  586

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  587   AAIRSAIMTTATTMDDIPGPIL-NSTYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  645

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  646   NFLCSLGYNASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP  705

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT  V +P G  V V P  L F KVGE+++FKVT+  +       Y FG L WSDKKH
Sbjct  706   STYTVRVNNPEGVYVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKH  765

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  766   RVRSPIVVK  774



>ref|XP_010514315.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=772

 Score =   421 bits (1081),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/369 (57%), Positives = 265/369 (72%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  404   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  463

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  464   PATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKP  523

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  584   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYL  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT  V +P G  V VNP  L F KVGE+++FKVTL     N    Y FG L WSDKKH
Sbjct  703   STYTVRVTNPRGVYVAVNPTSLNFTKVGEKKTFKVTLVKDKGNKAKGYVFGELVWSDKKH  762

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  763   RVRSPIVVK  771



>ref|XP_006418604.1| hypothetical protein EUTSA_v10002408mg [Eutrema salsugineum]
 gb|ESQ37040.1| hypothetical protein EUTSA_v10002408mg [Eutrema salsugineum]
Length=773

 Score =   421 bits (1081),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 263/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  405   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +++ D LA+  YI++T  P+AHIT   T+LG KPAPV+AAFSS+GP+++ P+ILKP
Sbjct  465   PATQLSFKDSLALSRYISQTNKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  525   DITAPGVSVIAAYTGAVSPTNEQFDARRLLFNAVSGTSMSCPHISGIAGLLKTRYPSWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  585   AAIRSAIMTTATTMDDIPGPI-QNSTNMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKG-TATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L     TV+RT+KNVG P
Sbjct  644   NFLCSLGYNASQISVFSGKNFACKSRKTSLYNLNYPSITVPNLSSRKVTVSRTVKNVGRP  703

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT    +P G  V V P  L F KVGE+++FKVTL  +       Y FG L WSDKKH
Sbjct  704   STYTVQANNPHGVYVAVKPTSLNFTKVGEQKTFKVTLVKRKGKVAKGYVFGELVWSDKKH  763

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  764   RVRSPIVVK  772



>ref|XP_010488664.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Camelina 
sativa]
Length=772

 Score =   420 bits (1080),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/369 (56%), Positives = 264/369 (72%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  404   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  463

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  464   PATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKP  523

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  584   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYL  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             ++YT  V  P G  V VNP  L F KVGE+++FKVTL     N    Y FG L WSDKKH
Sbjct  703   SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKH  762

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  763   RVRSPIVVK  771



>ref|XP_006398487.1| hypothetical protein EUTSA_v10001201mg [Eutrema salsugineum]
 gb|ESQ39940.1| hypothetical protein EUTSA_v10001201mg [Eutrema salsugineum]
Length=763

 Score =   420 bits (1079),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 214/370 (58%), Positives = 261/370 (71%), Gaps = 5/370 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCK GTLDP KAKGK++VCLRG T+R  K  QAALAGAV MIL ND+  G++I AD H
Sbjct  394   AMLCKEGTLDPHKAKGKIMVCLRGDTSRVGKGRQAALAGAVAMILCNDKAFGDDITADHH  453

Query  1031  FLPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  855
             FLPAT + + DG A+F Y+N T  +P+  +T P    G+KPAP +A FSS+GPN+I P I
Sbjct  454   FLPATQINFLDGQAVFSYVNTTYLDPMGSLTAPGAAFGIKPAPYMADFSSQGPNSITPGI  513

Query  854   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             LKPD++APGVN+IAA+T     S  + D R   F   SGTSMSCPHVAG+VGLLKT++PS
Sbjct  514   LKPDVTAPGVNIIAAYTRKQSLSGLESDPRTTPFITLSGTSMSCPHVAGLVGLLKTMHPS  573

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WSPA IRSAIMTTA  R N    + +  + +KA  F YG+GHI PN A DPGLVYDL + 
Sbjct  574   WSPAAIRSAIMTTARTRDNRMSPMLNG-SYVKANSFNYGSGHIRPNRAGDPGLVYDLTVH  632

Query  494   DYVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             D+++F+CA GYN+T I     +P YKCP   S+   NYPSITVP+L G  TVTR LKNVG
Sbjct  633   DHLDFLCAVGYNQTMIKLFSESPSYKCPKEASVLDLNYPSITVPNLSGAVTVTRKLKNVG  692

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             S  TY A VR P G SV V P  L+FE+VG+ +SFK+TLK K     +   FG LTWSD 
Sbjct  693   SAGTYMARVREPYGVSVRVEPSALEFERVGQVKSFKMTLKPKWSAKGS--VFGGLTWSDG  750

Query  137   KHRVRSPIVV  108
             KH VRSPIVV
Sbjct  751   KHYVRSPIVV  760



>emb|CDY37334.1| BnaC02g33520D [Brassica napus]
Length=769

 Score =   419 bits (1078),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 218/374 (58%), Positives = 270/374 (72%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCK GTLDP KAKGK++VCLRG ++R +K  QAA AGA GMIL ND+ SGN+I AD H
Sbjct  399   AMLCKEGTLDPHKAKGKIMVCLRGNSSRVEKGRQAAQAGAAGMILCNDKASGNDITADPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  855
             FLPATH+ + D  A+F Y+N T   P+  +T P    G+KPAP +A FSS+GPN + P I
Sbjct  459   FLPATHINFFDSQALFSYVNSTYLEPMGTLTAPAAAFGIKPAPYMANFSSQGPNTVTPGI  518

Query  854   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             LKPD++APGV++IAA+T     S  ++D R  +F +ESGTSMSCPHVAGV GLL+T++PS
Sbjct  519   LKPDVTAPGVDIIAAYTREQSLSGLEFDHRTTAFYIESGTSMSCPHVAGVAGLLRTMHPS  578

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WS A IRSAIMTTA  R N    + +  + +KA  F YG+GHI PN A DPGLVYDL L 
Sbjct  579   WSSAAIRSAIMTTARTRDNRVSPMLNG-SYVKANSFNYGSGHIRPNRAGDPGLVYDLTLN  637

Query  494   DYVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTA-TVTRTLKNV  321
             DY++F+CA GYN+T IT    +P YKCP   S+   NYPSITVP+L G++ TVTR LKNV
Sbjct  638   DYLDFLCAVGYNQTMITLFSESPSYKCPKEASVVDLNYPSITVPNLTGSSVTVTRKLKNV  697

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
             GS  TY A+VR P G SV V P +LKF++VG+ +SFK+TLK K      DYAFG LTWSD
Sbjct  698   GSVGTYAANVREPHGVSVNVEPSVLKFDRVGQVKSFKMTLKPKW--VAKDYAFGGLTWSD  755

Query  140   KKHRVRSPIVVKAA  99
              KH VRSPIVV  A
Sbjct  756   GKHYVRSPIVVSTA  769



>ref|XP_003608829.1| Subtilisin-like serine protease [Medicago truncatula]
Length=783

 Score =   420 bits (1079),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 268/373 (72%), Gaps = 5/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC  G+LD  KAKGK+LVCL G  +R DK  +A+  GAVGMILAND+ SG EII DAH
Sbjct  409   ALLCINGSLDSHKAKGKILVCLLGNNSRVDKGVEASRVGAVGMILANDDFSGGEIIPDAH  468

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+HV + DG  I  Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN + P IL
Sbjct  469   VLPASHVNFKDGNVILKYVNYTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNILAPSIL  528

Query  851   K-PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             K PDI+APG+ +IAA++EA  PS ++ DKR   FN+ SGTSM+CPHVAG+VGLLK+++P 
Sbjct  529   KVPDITAPGIKIIAAYSEAIPPSPSESDKRRTHFNIMSGTSMACPHVAGLVGLLKSIHPD  588

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WSPA I+SAIMTTAT + N G  +  D ++ +ATP AYGAGH+ PN AADPGLVYDL +T
Sbjct  589   WSPAAIKSAIMTTATTKDNIGGHVL-DSSQEEATPHAYGAGHVRPNLAADPGLVYDLNIT  647

Query  494   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNV  321
             DY+NF+C +GYN +++    G PY CP   +L  FNYP+IT+P  K      VTRT+ NV
Sbjct  648   DYLNFLCGRGYNSSQLKLFYGRPYTCPKSFNLIDFNYPAITIPDFKIGQPLNVTRTVTNV  707

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWS  144
             GSP+ Y   +++P  F V+V P+ L F+K GE++ FKVTL   KG     DY FG L W+
Sbjct  708   GSPSKYRVHIQAPAEFLVSVEPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKLVWT  767

Query  143   DKKHRVRSPIVVK  105
             D KH+V +PI +K
Sbjct  768   DGKHQVGTPIAIK  780



>emb|CDY40408.1| BnaA02g27220D [Brassica napus]
Length=768

 Score =   419 bits (1078),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 266/373 (71%), Gaps = 5/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCK GTLDP KAKGK++VCLRG ++R +K  QAA AGA  MIL ND+ SGN+I AD H
Sbjct  399   AMLCKEGTLDPHKAKGKIMVCLRGNSSRVEKGRQAAQAGAAAMILCNDKASGNDITADPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  855
             FLPATH+ + D  A+F Y+N T   P+  +T P    G+KPAP +A FSS+GPN + P I
Sbjct  459   FLPATHINFFDSQALFSYVNSTYLEPMGTLTAPAAAFGIKPAPYMANFSSQGPNTVTPGI  518

Query  854   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             LKPD++APGV++IAA+T     S  ++D R  +F +ESGTSMSCPHVAGV GLL+T++PS
Sbjct  519   LKPDVTAPGVDIIAAYTREQSLSGLEFDHRTTAFYIESGTSMSCPHVAGVAGLLRTMHPS  578

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WS A IRSAIMTTA  R N    + +  + +KA  F YG+GHI PN A DPGLVYDL + 
Sbjct  579   WSSAAIRSAIMTTARTRDNRVSPMLNG-SYVKANSFNYGSGHIRPNRAGDPGLVYDLTVN  637

Query  494   DYVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             DY++F+CA GYN+T I     +P YKCP   S+   NYPSITVP L G+ TVTR LKNVG
Sbjct  638   DYLDFLCAVGYNQTMIKLFSESPSYKCPKEASIVDLNYPSITVPKLTGSVTVTRKLKNVG  697

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             S  TY A+VR P G SV V P +LKF++VG+ +SFK+TLK K      DYAFG LTWSD 
Sbjct  698   SVGTYAANVREPHGVSVKVEPSVLKFDRVGQVKSFKMTLKPKW--VAKDYAFGGLTWSDG  755

Query  137   KHRVRSPIVVKAA  99
             KH VRSPIVV  A
Sbjct  756   KHYVRSPIVVSIA  768



>gb|KFK31799.1| hypothetical protein AALP_AA6G160400 [Arabis alpina]
Length=774

 Score =   419 bits (1077),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 208/369 (56%), Positives = 262/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K     LAG VGM+L N   +GN++ AD H L
Sbjct  406   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVVLAGGVGMVLDNSNLNGNDLTADPHVL  465

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D LA+  YI +T+ P+AHIT   T+LG KPAPV+A+FSS+GP+ + P ILKP
Sbjct  466   PATQLTLKDSLALARYITQTKKPIAHITPARTVLGTKPAPVMASFSSKGPSKLAPQILKP  525

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  526   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAVSGTSMSCPHISGIAGLLKTRYPSWSP  585

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ P+ A +PGLVYDL + DY+
Sbjct  586   AAIRSAIMTTATTMDDIPGPI-QNSTNMKATPFSFGAGHVRPSLAVNPGLVYDLGIRDYL  644

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTA-TVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C     SL   NYPSITVP+L     TV+RT+KNVG P
Sbjct  645   NFLCSLGYNASQISVFSGKHFTCSSPKTSLFNLNYPSITVPNLSSRKFTVSRTVKNVGRP  704

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT  V +P G  V V P  LKF KVGE+++F+VTL     N    Y FG L WSDKKH
Sbjct  705   STYTVQVDNPEGVVVAVKPTSLKFTKVGEQKTFRVTLVKHNGNVAKGYVFGKLVWSDKKH  764

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  765   RVRSPIVVK  773



>ref|XP_010488663.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Camelina 
sativa]
Length=772

 Score =   418 bits (1075),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 263/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  404   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  463

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  464   PATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKP  523

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  584   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYL  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             ++YT  V  P G  V VNP  L F KVGE+++FKVTL     N    Y FG L WSDKKH
Sbjct  703   SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKH  762

Query  131   RVRSPIVVK  105
             RVRSPIV K
Sbjct  763   RVRSPIVAK  771



>gb|KCW70438.1| hypothetical protein EUGRSUZ_F03663 [Eucalyptus grandis]
Length=752

 Score =   416 bits (1069),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 275/386 (71%), Gaps = 3/386 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     +T +  + +L C  GTLD +K KGK+L CLR      D+ HQAALAGAVGM+
Sbjct  367   LISGADAKITNVSAAKALRCLAGTLDHKKVKGKILACLREY-GTVDEGHQAALAGAVGMV  425

Query  1079  LANDEDSGNEI-IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPV  903
             LANDE SGN+I +A A+ LPA H+++ DG  +F YIN T+ PVAHIT   T+L   PAP+
Sbjct  426   LANDEASGNDIFVAQAYVLPAAHISFLDGKVLFTYINSTKFPVAHITRVKTMLNTTPAPI  485

Query  902   IAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSC  723
             +A+FSSRGPN + P ILKPDI+APGVN+IAA T A GP+  ++DKR   F   SGTSMSC
Sbjct  486   MASFSSRGPNTVEPAILKPDITAPGVNIIAANTLAVGPTGEEFDKRRTPFKAASGTSMSC  545

Query  722   PHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHIN  543
             PHV+G+VGLLKTLYP WSPA I+SAIMTTA+ R N  + +  D + +KATPF+YGAGHI 
Sbjct  546   PHVSGIVGLLKTLYPGWSPAAIQSAIMTTASTRDNKVEPV-HDSSLVKATPFSYGAGHIQ  604

Query  542   PNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH  363
             P+ A DPGLVYDL + DY++F+CA+GY+++++ +     + CP H +++  NYPSITVP+
Sbjct  605   PSRAMDPGLVYDLTVNDYLDFLCARGYDESQLRSFTNEIHACPKHFNVADMNYPSITVPN  664

Query  362   LKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  183
             L GT  VTR ++NVG+P TY   +++P G  V+V P+ L FE+  EE+ FKV LK K   
Sbjct  665   LNGTVVVTRRVRNVGTPGTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAG  724

Query  182   ATADYAFGVLTWSDKKHRVRSPIVVK  105
                DY FG L WSD  H VRSP+VVK
Sbjct  725   KPVDYVFGRLIWSDGVHYVRSPLVVK  750



>ref|XP_010063227.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=769

 Score =   416 bits (1069),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 275/386 (71%), Gaps = 3/386 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     +T +  + +L C  GTLD +K KGK+L CLR      D+ HQAALAGAVGM+
Sbjct  384   LISGADAKITNVSAAKALRCLAGTLDHKKVKGKILACLREY-GTVDEGHQAALAGAVGMV  442

Query  1079  LANDEDSGNEI-IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPV  903
             LANDE SGN+I +A A+ LPA H+++ DG  +F YIN T+ PVAHIT   T+L   PAP+
Sbjct  443   LANDEASGNDIFVAQAYVLPAAHISFLDGKVLFTYINSTKFPVAHITRVKTMLNTTPAPI  502

Query  902   IAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSC  723
             +A+FSSRGPN + P ILKPDI+APGVN+IAA T A GP+  ++DKR   F   SGTSMSC
Sbjct  503   MASFSSRGPNTVEPAILKPDITAPGVNIIAANTLAVGPTGEEFDKRRTPFKAASGTSMSC  562

Query  722   PHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHIN  543
             PHV+G+VGLLKTLYP WSPA I+SAIMTTA+ R N  + +  D + +KATPF+YGAGHI 
Sbjct  563   PHVSGIVGLLKTLYPGWSPAAIQSAIMTTASTRDNKVEPV-HDSSLVKATPFSYGAGHIQ  621

Query  542   PNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH  363
             P+ A DPGLVYDL + DY++F+CA+GY+++++ +     + CP H +++  NYPSITVP+
Sbjct  622   PSRAMDPGLVYDLTVNDYLDFLCARGYDESQLRSFTNEIHACPKHFNVADMNYPSITVPN  681

Query  362   LKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  183
             L GT  VTR ++NVG+P TY   +++P G  V+V P+ L FE+  EE+ FKV LK K   
Sbjct  682   LNGTVVVTRRVRNVGTPGTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAG  741

Query  182   ATADYAFGVLTWSDKKHRVRSPIVVK  105
                DY FG L WSD  H VRSP+VVK
Sbjct  742   KPVDYVFGRLIWSDGVHYVRSPLVVK  767



>ref|XP_010466978.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=773

 Score =   416 bits (1069),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 264/369 (72%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP+KAKGK+LVCLRG   R +K    ALAG VGM+L N   +GN++ AD H L
Sbjct  405   LCKLGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVL  464

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D LA+  Y+++T+NP+AHIT   T LG+KPAPV+A+FSS+GP+ + P+ILKP
Sbjct  465   PATQLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKP  524

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + +N  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  525   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSP  584

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYD  + DY+
Sbjct  585   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYL  643

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GY+ ++I    G  + C     SL   NYPSITVP+L  +  TV+RT+K V  P
Sbjct  644   NFLCSLGYHASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKTVERP  703

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             +TYT  V +P G  VTVNP  L F KVGE+++FKVTL     N    Y FG L WSDKKH
Sbjct  704   STYTVRVTNPRGVYVTVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKH  763

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  764   RVRSPIVVK  772



>ref|NP_565309.2| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 sp|Q9ZSP5.1|AIR3_ARATH RecName: Full=Subtilisin-like protease SBT5.3; AltName: Full=Auxin-induced 
in root cultures protein 3; AltName: Full=Subtilase 
subfamily 5 member 3; Short=AtSBT5.3; AltName: Full=Subtilisin-like 
protease AIR3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD12260.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEC05801.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=772

 Score =   416 bits (1069),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 261/369 (71%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP K KGK+LVCLRG   R +K    AL G +GM+L N   +GN+++AD H L
Sbjct  404   LCKLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVL  463

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT +T  D  A+  YI++T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  464   PATQLTSKDSFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKP  523

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  524   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT+  +    I  + T +KATPF++GAGH+ PN A +PGLVYDL + DY+
Sbjct  584   AAIRSAIMTTATIMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYL  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C    ISL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  643   NFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             + YT  V +P G  V V P  L F KVGE+++FKV L     N    Y FG L WSDKKH
Sbjct  703   SMYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGELVWSDKKH  762

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  763   RVRSPIVVK  771



>ref|XP_009107091.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=764

 Score =   415 bits (1067),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 214/373 (57%), Positives = 266/373 (71%), Gaps = 5/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCK GTLDP KAKGK++VCLRG ++R +K  QAA AGA  MIL NDE SGN+I AD H
Sbjct  395   AMLCKEGTLDPHKAKGKIMVCLRGNSSRVEKGRQAAQAGAAAMILCNDEASGNDITADPH  454

Query  1031  FLPATHVTYSDGLAIFDYINKTR-NPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  855
             FLPATH+ + D  A+F Y+N T   P+  +T P    G+KPAP +A FSS+GPN + P I
Sbjct  455   FLPATHINFFDSEALFSYVNSTYLEPMGTLTAPAAAFGIKPAPYMANFSSQGPNTVTPGI  514

Query  854   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             LKPD++APGV++IAA+T     S  ++D R  +F +ESGTSMSCPHVAGV GLL+T++PS
Sbjct  515   LKPDVTAPGVDIIAAYTREQSLSGLEFDHRTTAFYIESGTSMSCPHVAGVAGLLRTMHPS  574

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WS A IRSAIMTTA  R N    + +  + +KA  F YG+GHI PN A DPGLVYDL + 
Sbjct  575   WSSAAIRSAIMTTARTRDNRVSPMLNG-SYVKANSFNYGSGHIRPNRAGDPGLVYDLTVN  633

Query  494   DYVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             DY++F+CA GYN+T I     +P YKCP   S+   NYPSITV +L G+ TVTR LKNVG
Sbjct  634   DYLDFLCAVGYNQTMIKLFSESPSYKCPKEASVVDLNYPSITVSNLTGSVTVTRKLKNVG  693

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             S  TY A+VR P G SV V P +LKF++VG+ +SFK+TLK K      D+AFG LTWSD 
Sbjct  694   SVGTYAANVREPHGVSVKVEPSVLKFDRVGQVKSFKMTLKPKW--VGKDHAFGGLTWSDG  751

Query  137   KHRVRSPIVVKAA  99
             KH VRSPIVV  A
Sbjct  752   KHYVRSPIVVSTA  764



>ref|XP_010251263.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=771

 Score =   416 bits (1068),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/365 (55%), Positives = 259/365 (71%), Gaps = 1/365 (0%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             C  G+LDP+ AKGK+LVCLRG   R +K      AG +GM+L ND  SG E I DAH LP
Sbjct  404   CVIGSLDPKMAKGKILVCLRGTNPRVEKGKAVMDAGGIGMVLVNDITSGYETIPDAHILP  463

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
              +H++ +DGL++F YIN T++PVA+I+   T L VKPAP +A+FSS+GPN++ P+ILKPD
Sbjct  464   TSHISAADGLSLFSYINSTQSPVAYISPATTELDVKPAPTVASFSSQGPNSVTPEILKPD  523

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             + APGV++IAAFT+ATGPSD  +D R V FN  SGTSM+CPHV+G+VGLLKTL+P WSPA
Sbjct  524   VIAPGVSIIAAFTQATGPSDLPFDSRRVLFNSLSGTSMACPHVSGIVGLLKTLHPDWSPA  583

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SA+MTTA  R N  + I    ++   TPF+ GAGH+ PN A DPGLVYD+ + DY+ 
Sbjct  584   AIKSALMTTARNRDNMREHI-HGSSQDSGTPFSNGAGHVRPNRAMDPGLVYDVTIQDYLY  642

Query  482   FICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPATY  303
             F+CA GY++  I       Y CP   SL  FNYP+I+VP L G+ ++TR +KNVGSP  Y
Sbjct  643   FLCALGYSEDLIAKFANEHYNCPKSTSLLEFNYPAISVPSLYGSVSLTRRVKNVGSPGIY  702

Query  302   TASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRVR  123
                +R P G SV V PK L F ++GEE+ ++VTLK K   +T +Y FG LTWSD  H VR
Sbjct  703   NVRIREPAGISVMVEPKRLIFNQMGEEKKYRVTLKIKEGGSTQNYVFGGLTWSDGVHYVR  762

Query  122   SPIVV  108
             SPIVV
Sbjct  763   SPIVV  767



>ref|XP_003608830.1| Subtilisin-like serine protease [Medicago truncatula]
Length=1572

 Score =   432 bits (1111),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 213/372 (57%), Positives = 270/372 (73%), Gaps = 5/372 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHF  1029
             L C  G LDP KAKGK+LVCLRG + R DK  +A+  GA+GMILAND+ SG EII DAH 
Sbjct  1199  LFCNHGALDPHKAKGKILVCLRGDSNRVDKGVEASRVGAIGMILANDKGSGGEIIDDAHV  1258

Query  1028  LPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILK  849
             LPA+HV++ DG  IF Y+N T++PVA+IT   T LGVK +P IAAFSSRGPN ++P ILK
Sbjct  1259  LPASHVSFKDGDLIFKYVNNTKSPVAYITRVKTQLGVKASPSIAAFSSRGPNRLDPSILK  1318

Query  848   -PDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
              PDI+APGVN+IAA++EA  P++N YDKR   F   SGTSMSCPHVAG+VGLLK+++P W
Sbjct  1319  VPDITAPGVNIIAAYSEAISPTENSYDKRRTPFITMSGTSMSCPHVAGLVGLLKSIHPDW  1378

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + N G  +  D ++ +ATP AYGAGH+ PN AADPGLVYDL +TD
Sbjct  1379  SPAAIKSAIMTTATTKNNIGGHVL-DSSQEEATPNAYGAGHVRPNLAADPGLVYDLNITD  1437

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  318
             Y+NF+C +GYN +++    G  Y CP   +L  FNYP+ITVP +K      VTRT+ NVG
Sbjct  1438  YLNFLCGRGYNSSQLKLFYGRSYTCPKSFNLIDFNYPAITVPDIKIGQPLNVTRTVTNVG  1497

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK-AKGENATADYAFGVLTWSD  141
             SP+ Y   +++P    V+VNP+ L F+K GE++ FKVTL   KG     DY FG L W+D
Sbjct  1498  SPSKYRVLIQAPAELLVSVNPRRLNFKKKGEKREFKVTLTLKKGTTYKTDYVFGKLVWND  1557

Query  140   KKHRVRSPIVVK  105
              KH+V +PI +K
Sbjct  1558  GKHQVGTPIAIK  1569


 Score =   424 bits (1090),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/381 (54%), Positives = 271/381 (71%), Gaps = 4/381 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK GTLD +KAKGK++VCLRG   RTDK  QAA AGAVGMILAN+ +SGN++++D H
Sbjct  403   ALLCKKGTLDSKKAKGKIVVCLRGDNDRTDKGVQAARAGAVGMILANNIESGNDVLSDPH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y DG  IF Y+N T++P A I+   T LG  P+P++A+FSSRGPN I+P IL
Sbjct  463   VLPASHLGYDDGSYIFSYLNNTKSPKASISKVETKLGQSPSPIMASFSSRGPNIIDPSIL  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+ PGV+++AA++EA  PS    DKR   F   SGTSMS PHV+G+VG++K+L+P W
Sbjct  523   KPDITGPGVDIVAAYSEAASPSQQKSDKRRSPFITLSGTSMSTPHVSGIVGIIKSLHPDW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA ++ N+GK I  D TR+ A PFAYGAG + PN A DPGLVYDL +TD
Sbjct  583   SPAAIKSAIMTTARIKDNTGKPIL-DSTRINANPFAYGAGQVQPNHAVDPGLVYDLNITD  641

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNVG  318
             Y N++C +GY  + +T   G  Y CP   +L  FNYPSI++P+LK      VTRTL NVG
Sbjct  642   YTNYLCNRGYKGSRLTIFYGKRYICPKSFNLLDFNYPSISIPNLKIRDFLNVTRTLTNVG  701

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKG-ENATADYAFGVLTWSD  141
             SP+TY   +++P    V+V PK+L F++ GE++ F+VT   K   N + DY FG L WSD
Sbjct  702   SPSTYKVHIQAPHEVLVSVEPKVLNFKEKGEKKEFRVTFSLKTLTNNSTDYLFGSLDWSD  761

Query  140   KKHRVRSPIVVKAAA*MTIIM  78
              KH VRS IV+  A    ++M
Sbjct  762   CKHHVRSSIVINGAQMWLMVM  782



>ref|XP_004951554.1| PREDICTED: subtilisin-like protease-like isoform X2 [Setaria 
italica]
Length=780

 Score =   415 bits (1067),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/373 (55%), Positives = 260/373 (70%), Gaps = 4/373 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G LDP+K KGK++VCLRG+ AR  K      AG VGM+LAND  +GNEIIADAH L
Sbjct  409   LCMIGALDPKKVKGKIVVCLRGINARVAKGEAVKQAGGVGMVLANDASTGNEIIADAHVL  468

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT + YSDGL ++ Y+N T+NP   IT P T+LG KPAP +AAFSS+GPN I P+ILKP
Sbjct  469   PATQIKYSDGLLLYSYLNSTKNPTGFITKPATVLGTKPAPFMAAFSSQGPNTITPEILKP  528

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T +  P+D  +D R V+FN ESGTSMSCPHV+G+VGLL+TL+P WSP
Sbjct  529   DITAPGVSVIAAWTRSNSPTDLAFDLRRVAFNSESGTSMSCPHVSGIVGLLRTLHPEWSP  588

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N G+ I  + + L ++PF YGAGH++P  A +PGLVYDL   DY+
Sbjct  589   AAIKSAIMTTAMEMDNKGELIL-NASSLPSSPFGYGAGHVSPARAMNPGLVYDLGDADYL  647

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLKGT-ATVTRTLKNVGS  315
             +F+CA  YN T +    G PY CP      ++  NYPSITV ++    AT  R +KNVG 
Sbjct  648   DFLCALKYNATVMAMFNGAPYTCPGEAPRRVADLNYPSITVVNVTAAGATARRRVKNVGR  707

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A V  P G +V+V P +L+F   GEE+ F+V+ + K      DY+FG L W++ K
Sbjct  708   PGTYWAFVVEPAGVAVSVTPNVLEFRAKGEEKGFEVSFQVKNAALAKDYSFGALVWTNGK  767

Query  134   HRVRSPIVVKAAA  96
               VRSP+VVKA A
Sbjct  768   QFVRSPLVVKALA  780



>ref|XP_006648425.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=748

 Score =   414 bits (1064),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/374 (56%), Positives = 258/374 (69%), Gaps = 3/374 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S LC  G+LDP K KGK++VCLRGV  R +K      AG  GM+LAND  +GNEIIADAH
Sbjct  376   SRLCMLGSLDPAKVKGKIVVCLRGVNPRVEKGEAVREAGGAGMVLANDATTGNEIIADAH  435

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPATHV +SDG  IF Y+ KT+NP   IT P T LG KPAP +A+FSS+GPN + P IL
Sbjct  436   VLPATHVKFSDGQRIFSYLKKTKNPSGTITRPETRLGAKPAPFMASFSSKGPNTVTPGIL  495

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+V+AA+T A  P+D  +DKR V+FN ESGTSMSCPHVAG+VGLL+TL P W
Sbjct  496   KPDITAPGVSVVAAWTRANSPTDLAFDKRRVAFNSESGTSMSCPHVAGIVGLLRTLRPDW  555

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSA+MTTAT   N    I +  + + A+PF Y AGH++P+ A +PGLVYDL   D
Sbjct  556   SPAAIRSALMTTATDVDNDRHPILNSSS-VAASPFNYDAGHVSPSRAMNPGLVYDLAAAD  614

Query  491   YVNFICAQGYNKTEI-TAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             Y+NF+C+  YN T + T   G PYKCP         NYPSITV +L  +ATV RT+KNVG
Sbjct  615   YLNFLCSLRYNATVMATFNDGKPYKCPASPPKAQDLNYPSITVVNLTSSATVKRTVKNVG  674

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             +P TY A V SP G  V V+P  L F   GEE++F+V+ +        DYAFG L W++ 
Sbjct  675   TPGTYKAYVNSPAGVRVAVSPDTLAFATKGEEKTFRVSFQVTNAALAMDYAFGALVWTNG  734

Query  137   KHRVRSPIVVKAAA  96
             K  VRSP+VVK  A
Sbjct  735   KQFVRSPLVVKTTA  748



>gb|KGN55992.1| hypothetical protein Csa_3G045060 [Cucumis sativus]
Length=746

 Score =   414 bits (1063),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 255/368 (69%), Gaps = 3/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KAKGK++VCLRG  AR +K      AG VGMIL N ++ G+   ADAH L
Sbjct  377   LCHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMILVNGKNGGSGTTADAHIL  436

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH++Y+DGLA+  YIN T+ PVAHIT   T LG+KP+PV+A FSSRGPN I   +LKP
Sbjct  437   PATHLSYTDGLAVAQYINSTKTPVAHITPVQTQLGIKPSPVMADFSSRGPNPITEAMLKP  496

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+ PG++++A+ T     +   +D R V FNVESGTSMSCPH++GVVGLLKTLYP+WSP
Sbjct  497   DITGPGMSILASVTTDVTATTFPFDTRRVPFNVESGTSMSCPHISGVVGLLKTLYPTWSP  556

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I+D+  + KATPF YGAGH++PN A DPGLVYD  + DY+
Sbjct  557   AAIKSAIMTTAKTRDNTMRTISDN-VKPKATPFDYGAGHVHPNSAMDPGLVYDTTIDDYL  615

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GYN          P+ C    +L+  NYPSI++P L+  A  TV R +KNVG+P
Sbjct  616   NFLCARGYNSLTFKNFYNKPFVCAKSFTLTDLNYPSISIPKLQFGAPVTVNRRVKNVGTP  675

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V +     VTV P  L+F  VGEE++FKV  + KG      Y FG L WSD KH
Sbjct  676   GTYVARVNASSKILVTVEPSTLQFNSVGEEKAFKVVFEYKGNEQDKGYVFGTLIWSDGKH  735

Query  131   RVRSPIVV  108
              VRSPIVV
Sbjct  736   NVRSPIVV  743



>ref|XP_006857645.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
 gb|ERN19112.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
Length=774

 Score =   414 bits (1065),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 214/366 (58%), Positives = 262/366 (72%), Gaps = 3/366 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             C  G+LDP KAKGK++ CLRG  AR +K     LAG VGMIL ND +SGNE+IADAH LP
Sbjct  408   CLLGSLDPTKAKGKIVACLRGDNARVEKGEAVKLAGGVGMILCNDPNSGNEVIADAHVLP  467

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             A H+T SDG  +F YI  T+NP+A+IT PNT LG  PAPV+AAFSS+GPN I P ILKPD
Sbjct  468   AAHLTLSDGAQVFSYIKSTKNPMAYITRPNTNLGSTPAPVMAAFSSQGPNTITPQILKPD  527

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             I+ PGV+++AA+TEAT P+D +YDKR VSFNV SGTSMSCPH++GVV L+K  +P+WS A
Sbjct  528   ITGPGVSILAAYTEATSPTDMEYDKRRVSFNVVSGTSMSCPHLSGVVALIKARHPNWSEA  587

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SAIMTTA  R N   A+ D     KATPF YGAGH+ PN AADPGLVYDL  TDY+N
Sbjct  588   AIKSAIMTTAHRRDNVESAVKDASLE-KATPFNYGAGHVRPNAAADPGLVYDLTPTDYLN  646

Query  482   FICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             F+C+  YN++ I+A+    Y CP     L  FNYPS ++ +L  T TVTR +K VG PAT
Sbjct  647   FLCSLDYNQSSISAITDQNYTCPTPKPKLLDFNYPSFSITNLTSTVTVTRVVKLVGPPAT  706

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YT  V+SP G S+ V+ K L FEK GEE+S+ V    K +N   +Y+FG L WSD  H V
Sbjct  707   YTVRVQSPTGVSIEVSTKSLSFEKEGEEKSYTVKFTLKSKN-FGNYSFGRLIWSDGTHYV  765

Query  125   RSPIVV  108
             RS IV+
Sbjct  766   RSAIVI  771



>ref|XP_010064971.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=754

 Score =   414 bits (1063),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 273/386 (71%), Gaps = 2/386 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     +T +  + +L C  GTLD +K KGK+L CL G     +K HQAALAGAVGM+
Sbjct  368   LISGADAKITNVSAAEALRCLAGTLDHKKVKGKILTCLSGAYEAVNKGHQAALAGAVGMV  427

Query  1079  LANDEDSGNEI-IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPV  903
             LANDE +G +I +A+AH LP  H+++ DG  +F YIN T+ PVAHIT   T+L   PAP+
Sbjct  428   LANDEANGKDIFVAEAHVLPTAHISFLDGKVLFTYINSTKFPVAHITRAKTMLNTTPAPI  487

Query  902   IAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSC  723
             + +FSSRGPN + P ILKPDI+APGVN+IAA++   GP+  ++DKR   F  ++GTSM+C
Sbjct  488   MTSFSSRGPNTVEPAILKPDIAAPGVNIIAAYSLVVGPTGQEFDKRRTPFKADTGTSMAC  547

Query  722   PHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHIN  543
             PHV+G+ GLLKTLYPSWSPA I+SAIMTTA+ R N  + +  + + +KATPF+YGAGHI 
Sbjct  548   PHVSGIAGLLKTLYPSWSPAAIQSAIMTTASTRDNKVEPVL-NSSFVKATPFSYGAGHIR  606

Query  542   PNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH  363
             PN A DPGLVYDL + DY++FICA+GY+++++       + CP H +++  NYPSITVP+
Sbjct  607   PNRAMDPGLVYDLTVHDYLDFICARGYDESQLRLFTNEIHTCPKHFNVADMNYPSITVPN  666

Query  362   LKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  183
             L GT  VTR ++NVG+P TY   +++P G  V+V P+ L FE+  EE+ FKV LK K   
Sbjct  667   LNGTVVVTRRVRNVGTPGTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAG  726

Query  182   ATADYAFGVLTWSDKKHRVRSPIVVK  105
                DY FG L WSD  H VRSP+VVK
Sbjct  727   KPVDYVFGRLIWSDGVHYVRSPLVVK  752



>ref|XP_004951553.1| PREDICTED: subtilisin-like protease-like isoform X1 [Setaria 
italica]
Length=801

 Score =   415 bits (1067),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 204/373 (55%), Positives = 260/373 (70%), Gaps = 4/373 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G LDP+K KGK++VCLRG+ AR  K      AG VGM+LAND  +GNEIIADAH L
Sbjct  430   LCMIGALDPKKVKGKIVVCLRGINARVAKGEAVKQAGGVGMVLANDASTGNEIIADAHVL  489

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT + YSDGL ++ Y+N T+NP   IT P T+LG KPAP +AAFSS+GPN I P+ILKP
Sbjct  490   PATQIKYSDGLLLYSYLNSTKNPTGFITKPATVLGTKPAPFMAAFSSQGPNTITPEILKP  549

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T +  P+D  +D R V+FN ESGTSMSCPHV+G+VGLL+TL+P WSP
Sbjct  550   DITAPGVSVIAAWTRSNSPTDLAFDLRRVAFNSESGTSMSCPHVSGIVGLLRTLHPEWSP  609

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N G+ I  + + L ++PF YGAGH++P  A +PGLVYDL   DY+
Sbjct  610   AAIKSAIMTTAMEMDNKGELIL-NASSLPSSPFGYGAGHVSPARAMNPGLVYDLGDADYL  668

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLKGT-ATVTRTLKNVGS  315
             +F+CA  YN T +    G PY CP      ++  NYPSITV ++    AT  R +KNVG 
Sbjct  669   DFLCALKYNATVMAMFNGAPYTCPGEAPRRVADLNYPSITVVNVTAAGATARRRVKNVGR  728

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TY A V  P G +V+V P +L+F   GEE+ F+V+ + K      DY+FG L W++ K
Sbjct  729   PGTYWAFVVEPAGVAVSVTPNVLEFRAKGEEKGFEVSFQVKNAALAKDYSFGALVWTNGK  788

Query  134   HRVRSPIVVKAAA  96
               VRSP+VVKA A
Sbjct  789   QFVRSPLVVKALA  801



>gb|KCW70439.1| hypothetical protein EUGRSUZ_F03664 [Eucalyptus grandis]
Length=767

 Score =   414 bits (1064),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 273/386 (71%), Gaps = 2/386 (1%)
 Frame = -3

Query  1259  LISYKLMILTAIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMI  1080
             LIS     +T +  + +L C  GTLD +K KGK+L CL G     +K HQAALAGAVGM+
Sbjct  381   LISGADAKITNVSAAEALRCLAGTLDHKKVKGKILTCLSGAYEAVNKGHQAALAGAVGMV  440

Query  1079  LANDEDSGNEI-IADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPV  903
             LANDE +G +I +A+AH LP  H+++ DG  +F YIN T+ PVAHIT   T+L   PAP+
Sbjct  441   LANDEANGKDIFVAEAHVLPTAHISFLDGKVLFTYINSTKFPVAHITRAKTMLNTTPAPI  500

Query  902   IAAFSSRGPNAINPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSC  723
             + +FSSRGPN + P ILKPDI+APGVN+IAA++   GP+  ++DKR   F  ++GTSM+C
Sbjct  501   MTSFSSRGPNTVEPAILKPDIAAPGVNIIAAYSLVVGPTGQEFDKRRTPFKADTGTSMAC  560

Query  722   PHVAGVVGLLKTLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHIN  543
             PHV+G+ GLLKTLYPSWSPA I+SAIMTTA+ R N  + +  + + +KATPF+YGAGHI 
Sbjct  561   PHVSGIAGLLKTLYPSWSPAAIQSAIMTTASTRDNKVEPVL-NSSFVKATPFSYGAGHIR  619

Query  542   PNGAADPGLVYDLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPH  363
             PN A DPGLVYDL + DY++FICA+GY+++++       + CP H +++  NYPSITVP+
Sbjct  620   PNRAMDPGLVYDLTVHDYLDFICARGYDESQLRLFTNEIHTCPKHFNVADMNYPSITVPN  679

Query  362   LKGTATVTRTLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN  183
             L GT  VTR ++NVG+P TY   +++P G  V+V P+ L FE+  EE+ FKV LK K   
Sbjct  680   LNGTVVVTRRVRNVGTPGTYYVRIKAPAGVLVSVQPQSLVFERFDEEKEFKVVLKPKVAG  739

Query  182   ATADYAFGVLTWSDKKHRVRSPIVVK  105
                DY FG L WSD  H VRSP+VVK
Sbjct  740   KPVDYVFGRLIWSDGVHYVRSPLVVK  765



>ref|XP_008645399.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 gb|AFW70717.1| putative subtilase family protein [Zea mays]
Length=805

 Score =   415 bits (1066),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 256/372 (69%), Gaps = 4/372 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KAKGK++VCLRG+  R  K      AG VGM+LAND  +GNEIIADAH L
Sbjct  431   LCMIGSLDPAKAKGKIVVCLRGINPRVAKGEAVKQAGGVGMVLANDASTGNEIIADAHVL  490

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT + Y DGL ++ Y+N T+ P   IT P T+LG KPAP +AAFSS+GPN I P ILKP
Sbjct  491   PATQIKYRDGLLLYSYVNSTKKPTGFITRPATVLGTKPAPFMAAFSSQGPNIITPGILKP  550

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P+D  +D+R V+FN ESGTSMSCPHV+GVVGLL+TL+P WSP
Sbjct  551   DITAPGVSVIAAWTRANSPTDLAFDRRRVAFNSESGTSMSCPHVSGVVGLLRTLHPEWSP  610

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N G+ I  + + L ++PF YGAGHI+P  A +PGLVYDL   DY+
Sbjct  611   AAIKSAIMTTAAEMDNKGELIL-NASSLPSSPFGYGAGHISPARAMNPGLVYDLGDADYL  669

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLKGT-ATVTRTLKNVGS  315
             +F+CA  YN T +    G PY CP      ++  NYPSITV ++    AT  R +KNVG 
Sbjct  670   DFLCALKYNATVMAMFKGAPYTCPSEAPRRIADLNYPSITVVNVTAAGATALRKVKNVGK  729

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TYTA V  P G +V V P +LKF   GEE+ F+V  K        DY+FG L W++ +
Sbjct  730   PGTYTAFVAEPAGVAVLVTPSVLKFSAKGEEKGFEVHFKVVNATLARDYSFGALVWTNGR  789

Query  134   HRVRSPIVVKAA  99
               VRSP+VVKAA
Sbjct  790   QFVRSPLVVKAA  801



>ref|XP_006469402.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=771

 Score =   413 bits (1062),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 217/373 (58%), Positives = 268/373 (72%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +L+CK GTLDP+K KGK+LVCL   T   DK  QAALAGA G++L N  + GN+ + D H
Sbjct  399   ALICKKGTLDPKKVKGKILVCLDVNTRSVDKGLQAALAGAAGIVLVNLPEYGNDRMTDPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + ++D +++F YI   ++PV +IT P T  G KPAP +AAFSS+GPN I P+IL
Sbjct  459   VLPASDINFNDSVSLFSYITSIKHPVGYITRPTTEFGTKPAPFMAAFSSKGPNIITPEIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG N+IAA+TEA  P+  +YDKR   FN  SGTSMSCPH++G+  LLK L+P W
Sbjct  519   KPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSMSCPHISGIASLLKILHPDW  578

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA+   N+ + I  + +  +ATPF+YGAGH+ PN A DPGLVYDL   D
Sbjct  579   SPAAIQSAIMTTASTHDNNKQQIL-NASFAEATPFSYGAGHVQPNLAMDPGLVYDLTAND  637

Query  491   YVNFICAQGYNKTEITAV-LGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             Y+NF+C  GYNK EI        Y CP H ISL  FNYPSITVP L G+ TVTR +KNVG
Sbjct  638   YLNFLCTLGYNKKEIFWFSKNYTYTCPKHTISLVDFNYPSITVPKLSGSITVTRKVKNVG  697

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS-D  141
             SP TY A ++SP G SVT+ PK LKF  VGEE+SFKV  KA+  + T DYAFG L WS D
Sbjct  698   SPGTYQALLKSPKGVSVTIAPKSLKFINVGEEKSFKVIFKAQNASVTKDYAFGELIWSDD  757

Query  140   KKHRVRSPIVVKA  102
             K H+VRSPIVVKA
Sbjct  758   KHHQVRSPIVVKA  770



>ref|XP_008645398.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=826

 Score =   414 bits (1064),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 256/372 (69%), Gaps = 4/372 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KAKGK++VCLRG+  R  K      AG VGM+LAND  +GNEIIADAH L
Sbjct  452   LCMIGSLDPAKAKGKIVVCLRGINPRVAKGEAVKQAGGVGMVLANDASTGNEIIADAHVL  511

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT + Y DGL ++ Y+N T+ P   IT P T+LG KPAP +AAFSS+GPN I P ILKP
Sbjct  512   PATQIKYRDGLLLYSYVNSTKKPTGFITRPATVLGTKPAPFMAAFSSQGPNIITPGILKP  571

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P+D  +D+R V+FN ESGTSMSCPHV+GVVGLL+TL+P WSP
Sbjct  572   DITAPGVSVIAAWTRANSPTDLAFDRRRVAFNSESGTSMSCPHVSGVVGLLRTLHPEWSP  631

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N G+ I  + + L ++PF YGAGHI+P  A +PGLVYDL   DY+
Sbjct  632   AAIKSAIMTTAAEMDNKGELIL-NASSLPSSPFGYGAGHISPARAMNPGLVYDLGDADYL  690

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHI--SLSTFNYPSITVPHLKGT-ATVTRTLKNVGS  315
             +F+CA  YN T +    G PY CP      ++  NYPSITV ++    AT  R +KNVG 
Sbjct  691   DFLCALKYNATVMAMFKGAPYTCPSEAPRRIADLNYPSITVVNVTAAGATALRKVKNVGK  750

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKK  135
             P TYTA V  P G +V V P +LKF   GEE+ F+V  K        DY+FG L W++ +
Sbjct  751   PGTYTAFVAEPAGVAVLVTPSVLKFSAKGEEKGFEVHFKVVNATLARDYSFGALVWTNGR  810

Query  134   HRVRSPIVVKAA  99
               VRSP+VVKAA
Sbjct  811   QFVRSPLVVKAA  822



>ref|XP_003608826.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES91023.1| subtilisin-like serine protease [Medicago truncatula]
Length=775

 Score =   412 bits (1060),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 266/372 (72%), Gaps = 6/372 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC  G LDP KA GK+LVCL G  ++ +K  +A+  GA+GMIL  + +SG E+IADAH
Sbjct  399   ALLCLNGALDPHKAHGKILVCLEGENSKLEKGIEASRVGAIGMILVIERESGGEVIADAH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA++V  +DG  IF+Y NKT+ PVA+IT   T LG+KP P +A+FSSRGP+++ P IL
Sbjct  459   VLPASNVNVTDGSYIFNYANKTKFPVAYITGVKTQLGIKPTPSMASFSSRGPSSLEPSIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAA++E+T PS +  DKRI+ F   SGTSMSCPHVAG+VGLLK+++P W
Sbjct  519   KPDITAPGVNIIAAYSESTSPSQSASDKRIIPFMTMSGTSMSCPHVAGLVGLLKSIHPDW  578

Query  671   SPAEIRSAIMTTATVRAN-SGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             SPA I+SAIMTTAT + N  G A+  + +  +ATPFAYGAGHI PN  ADPGLVYDL + 
Sbjct  579   SPAAIKSAIMTTATTKDNVRGSAL--ESSLAEATPFAYGAGHIRPNHVADPGLVYDLNVI  636

Query  494   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTRTLKNV  321
             DY+NF+CA+GYN  ++    G PY CP   ++  FNYP+IT+P  K   +  VTRT+ NV
Sbjct  637   DYLNFLCARGYNNKQLKLFYGRPYTCPKSFNIIDFNYPAITIPDFKIGHSLNVTRTVTNV  696

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFGVLTWS  144
             GSP+TY   V++P  F ++V P+ LKF + GE+  FKVT   + +     DY FG L W+
Sbjct  697   GSPSTYRVRVQAPPEFLISVEPRRLKFRQKGEKIEFKVTFTLRPQTKYIEDYVFGRLVWT  756

Query  143   DKKHRVRSPIVV  108
             D KH V +PI +
Sbjct  757   DGKHSVETPIAI  768



>ref|XP_002453487.1| hypothetical protein SORBIDRAFT_04g006740 [Sorghum bicolor]
 gb|EES06463.1| hypothetical protein SORBIDRAFT_04g006740 [Sorghum bicolor]
Length=590

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 255/373 (68%), Gaps = 5/373 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G LDP K KGK++VCLRG+  R  K      AG VGM+LAND  +GNEIIADAH L
Sbjct  219   LCMIGALDPAKVKGKIVVCLRGINPRVAKGEAVKQAGGVGMVLANDVTTGNEIIADAHVL  278

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PAT + YSDGL ++ Y+N T+NP   IT P T+LG KPAP +AAFSS+GPN I P+ILKP
Sbjct  279   PATQIKYSDGLHLYSYLNSTKNPAGFITKPATVLGTKPAPFMAAFSSQGPNTITPEILKP  338

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P+D  +D R V+FN +SGTSMSCPHV+GVVGLL+T++P WSP
Sbjct  339   DITAPGVSVIAAWTRANSPTDLAFDPRRVAFNSQSGTSMSCPHVSGVVGLLRTVHPQWSP  398

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N G+ I  + +   ++PF YGAGHI P  A +PGLVYDL   DY+
Sbjct  399   AAIKSAIMTTAIEMDNKGELIL-NSSSRSSSPFGYGAGHIYPTRALNPGLVYDLGDKDYL  457

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHIS---LSTFNYPSITVPHLKGT-ATVTRTLKNVG  318
             +F+CA  YN T +    G PY CP   +   +S  NYPSITV ++    AT  R +KNV 
Sbjct  458   DFLCALKYNATVMAMFNGAPYTCPTGEAPHRISDLNYPSITVVNVTSAGATARRRVKNVA  517

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
              P+TY A V  P G SV VNP +LKF   GEE+ F+V  K K       Y+FG L W++ 
Sbjct  518   KPSTYRAFVVEPAGVSVVVNPSVLKFSAKGEEKGFEVQFKVKDAALAKGYSFGALAWTNG  577

Query  137   KHRVRSPIVVKAA  99
              H VRSP+VVKAA
Sbjct  578   VHFVRSPLVVKAA  590



>ref|XP_004169297.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=833

 Score =   414 bits (1063),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 255/368 (69%), Gaps = 3/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KAKGK++VCLRG  AR +K      AG VGMIL N ++ G+   ADAH L
Sbjct  464   LCHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMILVNGKNGGSGTTADAHIL  523

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH++Y+DGLA+  YIN T+ PVAHIT   T LG+KP+PV+A FSSRGPN I   +LKP
Sbjct  524   PATHLSYTDGLAVAQYINSTKTPVAHITPVQTQLGIKPSPVMADFSSRGPNPITEAMLKP  583

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+ PG++++A+ T     +   +D R V FNVESGTSMSCPH++GVVGLLKTLYP+WSP
Sbjct  584   DITGPGMSILASVTTDVTATTFPFDTRRVPFNVESGTSMSCPHISGVVGLLKTLYPTWSP  643

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I+D+  + KATPF YGAGH++PN A DPGLVYD  + DY+
Sbjct  644   AAIKSAIMTTAKTRDNTMRTISDN-VKPKATPFDYGAGHVHPNSAMDPGLVYDTTIDDYL  702

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GYN          P+ C    +L+  NYPSI++P L+  A  TV R +KNVG+P
Sbjct  703   NFLCARGYNSLTFKNFYNKPFVCAKSFTLTDLNYPSISIPKLQFGAPITVNRRVKNVGTP  762

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V +     VTV P  L+F  VGEE++FKV  + KG      Y FG L WSD KH
Sbjct  763   GTYVARVNASSKILVTVEPSTLQFNSVGEEKAFKVVFEYKGNEQDKGYVFGTLIWSDGKH  822

Query  131   RVRSPIVV  108
              VRSPIVV
Sbjct  823   NVRSPIVV  830



>ref|XP_010942695.1| PREDICTED: subtilisin-like protease SBT5.3 [Elaeis guineensis]
Length=765

 Score =   412 bits (1058),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 209/371 (56%), Positives = 264/371 (71%), Gaps = 3/371 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC P +LDP K KG ++ C+RG  AR DK  +  +AG  GMIL ND+ +GN ++AD H L
Sbjct  397   LCYPDSLDPNKVKGNIVACIRGDVARLDKGAEVLMAGGAGMILINDKTNGNSLLADPHLL  456

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA  +TY DG A+  Y+N T++PVA+I+ P T LGVKPAP++AAFSS+GPN ++P ILKP
Sbjct  457   PAIMITYEDGFALRKYMNSTKSPVAYISAPKTELGVKPAPMMAAFSSQGPNLVSPQILKP  516

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGV+++AAFT AT  +    D R V FN+ SGTSMSCPHV+GV GLLKTL+P WSP
Sbjct  517   DVTAPGVSILAAFTGATSATGLTLDNRYVPFNLMSGTSMSCPHVSGVAGLLKTLHPDWSP  576

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTA  R N+G  +  D    KATP  YG+GHI PN A DPGLV+DL  TDY+
Sbjct  577   AAIRSAIMTTARSRDNTGSPM-KDYGLAKATPLEYGSGHIRPNRAMDPGLVFDLNFTDYL  635

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             +F+CA GYN T++ A     Y+CP   ++L   NYPSI  P++  T TVTRT+KNVGSP 
Sbjct  636   SFLCAFGYNSTQL-AQFKKGYQCPTTPMNLEDLNYPSIAAPNVTRTLTVTRTMKNVGSPG  694

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY   V  P G +VTV P+ILKF+KVGEE+ F+VTLK++  +    Y FG L WSD KH 
Sbjct  695   TYKVRVEPPYGITVTVKPEILKFDKVGEEKVFEVTLKSQEGSIGRGYQFGRLIWSDGKHY  754

Query  128   VRSPIVVKAAA  96
             VR P+VV A A
Sbjct  755   VRIPLVVNAFA  765



>ref|XP_006447860.1| hypothetical protein CICLE_v10014355mg [Citrus clementina]
 gb|ESR61100.1| hypothetical protein CICLE_v10014355mg [Citrus clementina]
Length=771

 Score =   411 bits (1056),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 267/373 (72%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +L+CK GTLDP+K KGK+LVCL   T   DK  QAALAGA G++L N  + GN+ + D H
Sbjct  399   ALICKKGTLDPKKVKGKILVCLDVNTRSVDKGLQAALAGAAGIVLVNLPEYGNDRMTDPH  458

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + ++D +++F YI   ++PV +IT P T  G KPAP +AAFSS+GPN I P+IL
Sbjct  459   VLPASDINFNDSVSLFSYITSIKHPVGYITRPTTEFGTKPAPFMAAFSSKGPNIITPEIL  518

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APG N+IAA+TEA  P+  +YDKR   FN  SGTSMSCPH++G+  LLK L+P W
Sbjct  519   KPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSMSCPHISGIASLLKILHPDW  578

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTA+   N+ + I  + +  +ATPF+YGAGH+ PN A DPGLVYDL   D
Sbjct  579   SPAAIQSAIMTTASTHDNNKQQIL-NASFAEATPFSYGAGHVQPNLAMDPGLVYDLTAND  637

Query  491   YVNFICAQGYNKTEITAV-LGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
             Y+NF+C  GYNK EI        Y CP H ISL  FNYPSITVP L G+ TVTR +KNVG
Sbjct  638   YLNFLCTLGYNKKEIFWFSKNYTYTCPKHTISLVDFNYPSITVPKLSGSITVTRKVKNVG  697

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS-D  141
             SP TY A ++SP G SVT+ PK L F  VGEE+SFKV  KA+  + T DYAFG L WS D
Sbjct  698   SPGTYQALLKSPKGVSVTIAPKSLTFINVGEEKSFKVIFKAQNASVTKDYAFGELIWSDD  757

Query  140   KKHRVRSPIVVKA  102
             K H+VRSPIVVKA
Sbjct  758   KHHQVRSPIVVKA  770



>gb|EAZ22112.1| hypothetical protein OsJ_05774 [Oryza sativa Japonica Group]
Length=527

 Score =   402 bits (1032),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 253/374 (68%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S LC  G+LDPEK KGK++VCLRGV  R +K      AG  GM+LAND  +GNEIIADAH
Sbjct  148   SQLCFLGSLDPEKVKGKIVVCLRGVNPRVEKGEAVLEAGGAGMVLANDVTTGNEIIADAH  207

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPATH+ +SDG  +F Y+  T++P   IT P T LG KPAP +AAFSS+GPN + P IL
Sbjct  208   VLPATHIKFSDGQILFSYLKNTKSPAGTITRPETRLGTKPAPFMAAFSSQGPNTVTPGIL  267

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+V+AA+T A+ P+D  +DKR V+FN ESGTSMSCPHVAGVVGLL+TL P W
Sbjct  268   KPDITAPGVSVVAAWTRASAPTDLAFDKRRVAFNSESGTSMSCPHVAGVVGLLRTLRPDW  327

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSA+MTTA    N   AI  + +   A PF +GAGH++P  A +PGLVYDL   D
Sbjct  328   SPAAIRSALMTTAVEVDNERHAIL-NSSFAAANPFGFGAGHVSPARAMNPGLVYDLGAVD  386

Query  491   YVNFICAQGYNKT----EITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLK  327
             Y+NF+C+  YN T            P++CP     +   NYPSITV +L  +ATV RT+K
Sbjct  387   YLNFLCSLSYNATVMAMFAGGGGAAPFRCPASPPKVQDLNYPSITVVNLTSSATVRRTVK  446

Query  326   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             NVG P  Y A V SP G  VTV+P  L F   GE+++F+V  +    +   DY+FG L W
Sbjct  447   NVGKPGVYKAYVTSPAGVRVTVSPDTLPFLLKGEKKTFQVRFEVTNASLAMDYSFGALVW  506

Query  146   SDKKHRVRSPIVVK  105
             ++ K  VRSP+VVK
Sbjct  507   TNGKQFVRSPLVVK  520



>ref|XP_004296127.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=774

 Score =   408 bits (1049),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 206/371 (56%), Positives = 262/371 (71%), Gaps = 4/371 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVT--ARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +C  G LDP K  GK+LVCLR      RT+KS QA +AGA+GMIL NDE SGN+++AD H
Sbjct  402   VCNVGALDPRKVNGKILVCLREYNNNERTEKSQQADIAGALGMILVNDEQSGNDVVADPH  461

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              L  +H+ YSDG  +FDYI  T+ PVA++T     LGV+PAP +A FSSRGPN +   IL
Sbjct  462   VLLVSHLNYSDGKHVFDYIKSTKLPVAYLTPVKAELGVRPAPTVAPFSSRGPNLLEQAIL  521

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI APGV++IAA+TEATGP+    D R VSFNV++GTSM+CPHV+GV GLL+TL+P W
Sbjct  522   KPDIIAPGVSIIAAYTEATGPTYQSSDTRRVSFNVQTGTSMACPHVSGVAGLLRTLHPDW  581

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT + +S + + D    LKATPFAYGAGHI PN A DPGL+Y+L   D
Sbjct  582   SPAVIKSAIMTTATTQDDSNEQMFDSSAYLKATPFAYGAGHIQPNKAMDPGLIYNLTTLD  641

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGT-ATVT-RTLKNVG  318
             Y++ +CA+GYN+T I +   +P+KCP   SL  FNYP+I VP+L  T  T+T R + NVG
Sbjct  642   YLDLLCARGYNETMIKSFSDSPFKCPKSFSLGDFNYPAIVVPNLGATLVTITRRRVTNVG  701

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             SP TY   V++P    V V P+ LKFE +GE + F+V  KAK +     YAFG L WSD 
Sbjct  702   SPGTYKVRVKAPPEVEVLVKPRSLKFESIGEVKKFEVIFKAKVKGKPRGYAFGELMWSDG  761

Query  137   KHRVRSPIVVK  105
              H V++P+ VK
Sbjct  762   NHHVKTPLAVK  772



>ref|XP_004159122.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=775

 Score =   406 bits (1043),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 255/373 (68%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL ND+ SG  I  D H
Sbjct  403   AMLCKPETLDHSKVKGKILVCLRGETARLDKGKQAALAGAVGMILCNDKLSGTSINPDFH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y DG  +  Y N  R P+  +  P   +  KPAP +A FSSRGPN I+P+I+
Sbjct  463   VLPASHINYHDGQVLLSYTNSARYPMGCLIPPLARVNTKPAPTMAVFSSRGPNTISPEII  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV++IAAF+EA  P+ +  D R   F   SGTSMSCPHVAG+VGLL+ L+P W
Sbjct  523   KPDVTAPGVDIIAAFSEAISPTRDPSDNRTTPFITMSGTSMSCPHVAGLVGLLRNLHPDW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDET--RLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             +P+ I+SAIMT+A VR N+   + D  +     ATPFAYG+GHINP GA DPGLVYDL  
Sbjct  583   TPSAIKSAIMTSAQVRDNTLNPMLDGGSLDLDPATPFAYGSGHINPTGAVDPGLVYDLSP  642

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
              DY+ F+CA GY++  I A    P+KCP   S+   NYPSI V +LK + T+TR LKNVG
Sbjct  643   NDYLEFLCASGYDERTIRAFSDEPFKCPASASVLNLNYPSIGVQNLKDSVTITRKLKNVG  702

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             +P  Y A +  P    V+V P+ LKFE+VGEE+SF++TL   G      +A+G L WSD 
Sbjct  703   TPGVYKAQILHPNVVQVSVKPRFLKFERVGEEKSFELTL--SGVVPKNRFAYGALIWSDG  760

Query  137   KHRVRSPIVVKAA  99
             +H VRSPIVV + 
Sbjct  761   RHFVRSPIVVSSG  773



>dbj|BAC42673.1| putative subtilisin-like protease [Arabidopsis thaliana]
Length=756

 Score =   405 bits (1041),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 205/339 (60%), Positives = 247/339 (73%), Gaps = 2/339 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLCK G+LDP+K KGK+LVCLRG  AR DK  QAA AGA GM+L ND+ SGNEII+DAH
Sbjct  408   ALLCKKGSLDPKKVKGKILVCLRGDNARVDKGMQAAAAGAAGMVLCNDKASGNEIISDAH  467

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+ + Y DG  +F Y++ T++P  +I  P   L  KPAP +A+FSSRGPN I P IL
Sbjct  468   VLPASQIDYKDGETLFSYLSSTKDPKGYIKAPTATLNTKPAPFMASFSSRGPNTITPGIL  527

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGVN+IAAFTEATGP+D D D R   FN ESGTSMSCPH++GVVGLLKTL+P W
Sbjct  528   KPDITAPGVNIIAAFTEATGPTDLDSDNRRTPFNTESGTSMSCPHISGVVGLLKTLHPHW  587

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSAIMTT+  R N  K +  DE+  KA PF+YG+GH+ PN AA PGLVYDL   D
Sbjct  588   SPAAIRSAIMTTSRTRNNRRKPMV-DESFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGD  646

Query  491   YVNFICAQGYNKTEITAVLGTP-YKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             Y++F+CA GYN T +      P Y C    +L  FNYPSITVP+L G+ TVTR LKNVG 
Sbjct  647   YLDFLCAVGYNNTVVQLFAEDPQYTCRQGANLLDFNYPSITVPNLTGSITVTRKLKNVGP  706

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLK  198
             PATY A  R P+G  V+V PK L F K GE + F++TL+
Sbjct  707   PATYNARFREPLGVRVSVEPKQLTFNKTGEVKIFQMTLR  745



>ref|XP_010675634.1| PREDICTED: subtilisin-like protease SBT5.4 [Beta vulgaris subsp. 
vulgaris]
Length=774

 Score =   405 bits (1041),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/368 (53%), Positives = 256/368 (70%), Gaps = 5/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GT+DPEKAKGK+LVCLRG+ AR  K ++AA  GAVG+I+AN ++ G +I+A+ + L
Sbjct  408   FCFNGTMDPEKAKGKILVCLRGLGARKHKGYEAARVGAVGLIIANAKEHGMQIMAENYPL  467

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+H+ +SD  A+F YIN T +PVA IT   T  GVKPAP +A FSS GPN + P ILKP
Sbjct  468   PASHLAFSDAQALFAYINSTNSPVATITAARTEFGVKPAPFVAGFSSTGPNIVTPGILKP  527

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D+ APGVN+IAA +EA   S  +       + +  GTSMSCPH+ G++GLLKT+YP WSP
Sbjct  528   DVIAPGVNIIAAISEAKAKSTQEN----TPYGLMDGTSMSCPHITGIIGLLKTMYPHWSP  583

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SAIMTT++ R N  K + D  T + ATPF YGAGH+ PN A  PGLVYD+   DY+
Sbjct  584   SAIKSAIMTTSSTRDNRRKPLVD-FTNMTATPFHYGAGHVRPNKAMYPGLVYDMNHHDYL  642

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             NF+CA GYNK  I  +    Y CPD ++++  NYP+I VP   G AT+ R LKNVG P+T
Sbjct  643   NFLCAIGYNKKMIKKLSDNSYCCPDLVAVADLNYPTIVVPSFSGNATIVRRLKNVGHPST  702

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y AS+R+P G S+TV PK L F + G+E  +K+   A+  +   D++FG L WSD+K+RV
Sbjct  703   YLASIRAPSGISITVEPKTLTFTEKGQELHYKLIFTAEQSHLLKDHSFGYLLWSDRKYRV  762

Query  125   RSPIVVKA  102
             RS IVVKA
Sbjct  763   RSSIVVKA  770



>gb|AAC62611.1| subtilisin-like protease, partial [Arabidopsis thaliana]
Length=758

 Score =   404 bits (1039),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 257/369 (70%), Gaps = 3/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LCK G+LDP K KGK+LVCLRG   R +K    AL G +GM+L N   +GN+++AD H L
Sbjct  390   LCKLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVL  449

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             P+T +T  D  A+  Y+ +T+ P+AHIT   T LG+KPAPV+A+FSS+GP+ + P ILKP
Sbjct  450   PSTQLTSKDSFAVSRYMTQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKP  509

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+VIAA+T A  P++  +D R + FN  SGTSMSCPH++G+ GLLKT YPSWSP
Sbjct  510   DITAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSP  569

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTAT   +    I  + T +KATPF++GAGH+ PN A +PGLVYDL + DY+
Sbjct  570   AAIRSAIMTTATTMDDIPGPI-QNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYL  628

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             NF+C+ GYN ++I+   G  + C    ISL   NYPSITVP+L  +  TV+RT+KNVG P
Sbjct  629   NFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP  688

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
             + YT  V +P G  V + P  L F KVGE ++FKV L     N    Y FG L WS KKH
Sbjct  689   SMYTVKVNNPHGVYVALKPTSLNFTKVGELKTFKVILVKSKGNVAKGYMFGELVWSAKKH  748

Query  131   RVRSPIVVK  105
             RVRSPIVVK
Sbjct  749   RVRSPIVVK  757



>ref|XP_004139596.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=773

 Score =   405 bits (1040),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 255/373 (68%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL ND+ SG  I  D H
Sbjct  401   AMLCKPETLDHSKVKGKILVCLRGETARLDKGKQAALAGAVGMILCNDKLSGTSINPDFH  460

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y DG  +  Y N  R P+  +  P   +  KPAP +A FSSRGPN I+P+I+
Sbjct  461   VLPASHINYHDGQVLLSYTNSARYPMGCLIPPLARVNTKPAPTMAVFSSRGPNTISPEII  520

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV++IAAF+EA  P+ +  D R   F   SGTSMSCPHVAG+VGLL+ L+P W
Sbjct  521   KPDVTAPGVDIIAAFSEAISPTRDPSDNRTTPFITMSGTSMSCPHVAGLVGLLRNLHPDW  580

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRL--KATPFAYGAGHINPNGAADPGLVYDLKL  498
             +P+ I+SAIMT+A VR N+   + D  +     ATPFAYG+GHINP GA DPGLVYDL  
Sbjct  581   TPSAIKSAIMTSAQVRDNTLNPMLDGGSLGLDPATPFAYGSGHINPTGAVDPGLVYDLSP  640

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
              DY+ F+CA GY++  I A    P+KCP   S+   NYPSI V +LK + T+TR LKNVG
Sbjct  641   NDYLEFLCASGYDERTIRAFSDEPFKCPASASVLNLNYPSIGVQNLKDSVTITRKLKNVG  700

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             +P  Y A +  P    V+V P+ LKFE+VGEE+SF++T+   G      +A+G L WSD 
Sbjct  701   TPGVYKAQILHPNVVQVSVKPRFLKFERVGEEKSFELTV--SGVVPKNRFAYGALIWSDG  758

Query  137   KHRVRSPIVVKAA  99
             +H VRSPIVV + 
Sbjct  759   RHFVRSPIVVSSG  771



>gb|KGN64981.1| hypothetical protein Csa_1G171030 [Cucumis sativus]
Length=775

 Score =   405 bits (1040),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 255/373 (68%), Gaps = 4/373 (1%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             ++LCKP TLD  K KGK+LVCLRG TAR DK  QAALAGAVGMIL ND+ SG  I  D H
Sbjct  403   AMLCKPETLDHSKVKGKILVCLRGETARLDKGKQAALAGAVGMILCNDKLSGTSINPDFH  462

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA+H+ Y DG  +  Y N  R P+  +  P   +  KPAP +A FSSRGPN I+P+I+
Sbjct  463   VLPASHINYHDGQVLLSYTNSARYPMGCLIPPLARVNTKPAPTMAVFSSRGPNTISPEII  522

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV++IAAF+EA  P+ +  D R   F   SGTSMSCPHVAG+VGLL+ L+P W
Sbjct  523   KPDVTAPGVDIIAAFSEAISPTRDPSDNRTTPFITMSGTSMSCPHVAGLVGLLRNLHPDW  582

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRL--KATPFAYGAGHINPNGAADPGLVYDLKL  498
             +P+ I+SAIMT+A VR N+   + D  +     ATPFAYG+GHINP GA DPGLVYDL  
Sbjct  583   TPSAIKSAIMTSAQVRDNTLNPMLDGGSLGLDPATPFAYGSGHINPTGAVDPGLVYDLSP  642

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVG  318
              DY+ F+CA GY++  I A    P+KCP   S+   NYPSI V +LK + T+TR LKNVG
Sbjct  643   NDYLEFLCASGYDERTIRAFSDEPFKCPASASVLNLNYPSIGVQNLKDSVTITRKLKNVG  702

Query  317   SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDK  138
             +P  Y A +  P    V+V P+ LKFE+VGEE+SF++T+   G      +A+G L WSD 
Sbjct  703   TPGVYKAQILHPNVVQVSVKPRFLKFERVGEEKSFELTV--SGVVPKNRFAYGALIWSDG  760

Query  137   KHRVRSPIVVKAA  99
             +H VRSPIVV + 
Sbjct  761   RHFVRSPIVVSSG  773



>ref|XP_006447865.1| hypothetical protein CICLE_v10018333mg [Citrus clementina]
 gb|ESR61105.1| hypothetical protein CICLE_v10018333mg [Citrus clementina]
Length=671

 Score =   401 bits (1031),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/375 (57%), Positives = 265/375 (71%), Gaps = 12/375 (3%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLR--GVTARTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             +L  + G LDP+K KGK++V     GV        QAALAGAVG+IL N +  G + +AD
Sbjct  303   NLALEKGILDPKKVKGKIVVWSNELGVAG----GQQAALAGAVGVILINIQGFGYDRMAD  358

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
              H LPA+ + ++DG+++  YIN        IT PNT  G KPAP +AAFSS+GPN+I  D
Sbjct  359   PHVLPASVINFNDGVSLLRYINSAS--CGFITRPNTEFGTKPAPFMAAFSSKGPNSIISD  416

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI+APG N+IAA+TEA  P++ +YD+R + FN  SGTSMSCPH++G+ GLLKTL+P
Sbjct  417   ILKPDITAPGENIIAAYTEAESPTNLNYDQRRIPFNSMSGTSMSCPHISGIAGLLKTLHP  476

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
              WSPA I+SAIMTTAT   N  + I  D +  +ATPF+YGAGH  PN A DPGLVYDL +
Sbjct  477   DWSPAAIQSAIMTTATTLDNKKQQIL-DASFTEATPFSYGAGHAQPNLAMDPGLVYDLTV  535

Query  497   TDYVNFICAQGYNKTEITAV-LGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKN  324
              +Y+NF+CA GYNK  I      + Y CP++ ISL  FNYPSITVP L G+ TVTR +KN
Sbjct  536   NEYLNFLCALGYNKNVILLFSTNSSYTCPENAISLVNFNYPSITVPKLSGSITVTRRVKN  595

Query  323   VGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWS  144
             VGSP TY A V++P G SVT+ PK LKF  VGEE+SFKV +KAK  + T DY FG L WS
Sbjct  596   VGSPRTYQARVKTPQGVSVTIAPKSLKFINVGEEKSFKVIIKAKNASVTKDYVFGELIWS  655

Query  143   D-KKHRVRSPIVVKA  102
             D K+H+VRSP VVKA
Sbjct  656   DEKQHQVRSPTVVKA  670



>gb|EEE69917.1| hypothetical protein OsJ_29768 [Oryza sativa Japonica Group]
Length=805

 Score =   404 bits (1038),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 207/386 (54%), Positives = 261/386 (68%), Gaps = 16/386 (4%)
 Frame = -3

Query  1217  SCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             S + LC  G+L+  K +G+++VC+RG  AR +K      AG  G++LANDE +GNE+IAD
Sbjct  408   SQARLCMEGSLERGKVEGRIVVCMRGKNARVEKGEAVRRAGGAGLVLANDEATGNEMIAD  467

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
             AH LPATHVTYSDG+A+  Y+N TR+P   IT P+T L  KPAP +AAFSS+GPN +   
Sbjct  468   AHVLPATHVTYSDGVALLAYLNSTRSPSGFITVPDTALDTKPAPFMAAFSSQGPNTVTTQ  527

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI+APGV+++AAFT   GP+   +D R V FN ESGTSMSCPHVAGV GLLK L+P
Sbjct  528   ILKPDITAPGVSILAAFTGQAGPTGLAFDSRRVLFNAESGTSMSCPHVAGVAGLLKALHP  587

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
              WSPA I+SAIMTTA V+ N  + +++  + L+ATPF+YGAGH+ P  AADPGLVYD+  
Sbjct  588   DWSPAAIKSAIMTTARVKDNMRRPMSNS-SFLRATPFSYGAGHVQPGRAADPGLVYDMND  646

Query  497   TDYVNFICAQGYNKTEITAVLGT------PYKCPDHISLSTFNYPSITVPHL--KGTA-T  345
             TDY+ F+CA GYN + I   + +      PY CP        NYPS  +PHL   G A T
Sbjct  647   TDYLGFLCALGYNSSVIATFMASGSGAQPPYACPPARRPEDLNYPSFALPHLSPSGAART  706

Query  344   VTRTLKNVG-SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKA-KGENATAD  171
             VTR ++NVG +PA Y ASV  P G SV V P  L+F   GEE  F VT +A KG     +
Sbjct  707   VTRRVRNVGAAPAAYVASVAEPRGVSVAVRPSRLEFTAAGEELEFAVTFRAKKGSFLAGE  766

Query  170   YAFGVLTWSDK----KHRVRSPIVVK  105
             Y FG L WSD     +HRVRSP+VV+
Sbjct  767   YEFGRLVWSDAAAGGRHRVRSPLVVR  792



>ref|XP_006857622.1| hypothetical protein AMTR_s00061p00122710 [Amborella trichopoda]
 gb|ERN19089.1| hypothetical protein AMTR_s00061p00122710 [Amborella trichopoda]
Length=775

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 208/366 (57%), Positives = 255/366 (70%), Gaps = 3/366 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             C  G+LDP K KGK++ CLRGV  R +K      AG VGMIL ND +SGNE+IAD H LP
Sbjct  409   CLIGSLDPTKTKGKIVACLRGVNDRVEKGEAVKQAGGVGMILCNDPNSGNEVIADPHVLP  468

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
             A H+T SDG  +F YI  T+NP+A+IT P T LG  PAPV+AAFSS+GPN I P+ILKPD
Sbjct  469   AAHLTLSDGAEVFSYIKSTKNPMAYITRPKTFLGSTPAPVMAAFSSQGPNVITPEILKPD  528

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             I+ PGV+++AA+TE   PS  ++DKR VSFN +SGTSMSCPH+AGVV L+K  Y  WS A
Sbjct  529   ITGPGVDILAAYTEVRPPSHMEFDKRRVSFNTDSGTSMSCPHLAGVVALIKARYTHWSEA  588

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SAIMTTA    N   AI D     +ATPF+YGAGH+ PN AADPGLVYDL  TDY+N
Sbjct  589   AIKSAIMTTARRHDNMELAIKDASLE-RATPFSYGAGHVRPNAAADPGLVYDLTPTDYLN  647

Query  482   FICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
             F+CA  YN++ I+A+    Y CP     L  FNYPS ++ +L  T TVTR +K VG PAT
Sbjct  648   FLCALDYNQSSISAITEQNYTCPTPKPKLLDFNYPSFSITNLTSTVTVTRVVKLVGPPAT  707

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             YT  V+SP G SV V+PK L FEK GEE+S+ +    K +N   +Y+FG L WSD  H V
Sbjct  708   YTVRVQSPPGVSVEVSPKSLSFEKEGEEKSYALKFTLKSQN-FGNYSFGRLIWSDGTHHV  766

Query  125   RSPIVV  108
             RS IV+
Sbjct  767   RSSIVI  772



>ref|XP_007026418.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY29040.1| Subtilase family protein, putative [Theobroma cacao]
Length=796

 Score =   403 bits (1036),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/374 (55%), Positives = 255/374 (68%), Gaps = 4/374 (1%)
 Frame = -3

Query  1208  LLCKPGTLDPEKAKGKVLVCLRG-VTARTDKSHQAALAGAVGMILANDEDSGNEI-IADA  1035
             LLC    LDP K KGK++VCL G       K    A AGA GMI+ N E S NE    + 
Sbjct  422   LLCLE-DLDPNKVKGKIVVCLEGGYVFPVMKGLLVAEAGAAGMIMCNHERSPNETSFEEL  480

Query  1034  HFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDI  855
             HFLP +H+ Y D  +++ YIN + NP+A+ T P T L  KPAP++A  SSRGPN   P+I
Sbjct  481   HFLPVSHLNYEDCRSLYAYINSSDNPMAYFTPPTTQLYTKPAPLMAVSSSRGPNPFTPEI  540

Query  854   LKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPS  675
             LKPDI+APGV++IAA TEA  P+    D R  +F  +SGTSMSCPHVAGV GLLKTL P 
Sbjct  541   LKPDITAPGVDIIAANTEAVSPTGFPEDTRRSAFLFKSGTSMSCPHVAGVAGLLKTLKPD  600

Query  674   WSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLT  495
             WSPA IRSAIMTTA  R N+G A+ DD +  K+TPF YG+GHI PN A +PGLVYDL++ 
Sbjct  601   WSPAAIRSAIMTTAETRDNTGNALRDDLSLNKSTPFGYGSGHIKPNRAMNPGLVYDLRVE  660

Query  494   DYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGS  315
             DY++F+CA GYN++ +      PY CP+  +    NYPSI VP L G+ T++R LKNVG+
Sbjct  661   DYLDFLCAIGYNQSMVERFSEGPYTCPESGNPLDLNYPSIAVPKLSGSVTISRKLKNVGT  720

Query  314   PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGEN-ATADYAFGVLTWSDK  138
             P  YTA V  P G SV+V P  L+FE +GEE+ FK+TLKAKG+  A  DY FG LTW+D 
Sbjct  721   PGNYTARVCEPFGISVSVEPSSLQFENIGEEKGFKLTLKAKGDGAANKDYVFGALTWTDG  780

Query  137   KHRVRSPIVVKAAA  96
             KH VRSPI V AAA
Sbjct  781   KHYVRSPIAVAAAA  794



>emb|CAJ75644.1| subtilisin-like protease [Triticum aestivum]
Length=722

 Score =   400 bits (1029),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 252/361 (70%), Gaps = 7/361 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LD +KA+GK++VC+RG  AR +K      AG VG++LANDE +GNE+IADAH L
Sbjct  333   LCMEGSLDKKKARGKIVVCMRGKNARVEKGEAVHRAGGVGLVLANDEATGNEMIADAHVL  392

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TYSDG+A+  Y+N TR    +IT PNT L  KPAP +AAFSS+GPN + P ILKP
Sbjct  393   PATHITYSDGVALLAYMNSTRLASGYITLPNTALETKPAPFMAAFSSQGPNTVTPQILKP  452

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+++AAFT   GP+   +D R V FN ESGTSMSCPHVAG+ GLLK L+P WSP
Sbjct  453   DITAPGVSILAAFTGLAGPTGLTFDSRRVLFNSESGTSMSCPHVAGIAGLLKALHPDWSP  512

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTT  V+ N+ + ++ + + L+ATPFAYGAGH+ PN AADPGLVYD   TDY+
Sbjct  513   AAIKSAIMTTTRVQDNTRRPMS-NSSFLRATPFAYGAGHVQPNRAADPGLVYDTNATDYL  571

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISL-STFNYPSITVPHLKGTA---TVTRTLKNVG  318
             +F+CA GYN T I   +  P  CP         NYPS+TVPHL  +    TVTR ++NVG
Sbjct  572   HFLCALGYNSTVIGTFMDGPNACPARPRKPEDLNYPSVTVPHLSASGEPRTVTRRVRNVG  631

Query  317   S-PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAFGVLTWS  144
             + PA Y   VR P G SV+V P  L+F   GEE+ F VT +A+ G     +Y FG + WS
Sbjct  632   AEPAAYDVRVREPRGVSVSVRPSRLEFAAAGEEKEFAVTFRARAGRFLPGEYVFGQMVWS  691

Query  143   D  141
             D
Sbjct  692   D  692



>ref|XP_003608824.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES91021.1| subtilisin-like serine protease [Medicago truncatula]
Length=780

 Score =   402 bits (1033),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 201/371 (54%), Positives = 265/371 (71%), Gaps = 10/371 (3%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLR-----GVTARTDKSHQAALAGAVGMILAN-DEDSGNE  1050
             +L C+ GTLDP+KAKGK+LVC +         RT K  +AA  GAVG+ILAN D+DSG+ 
Sbjct  400   ALNCEGGTLDPQKAKGKILVCFQVPDDCHFLCRTHKGVEAARVGAVGIILANSDKDSGSG  459

Query  1049  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  870
             I AD H LP+++V + DG  IF+YIN T++PVA+I+   T L  KPAP IA+FS+RGPN 
Sbjct  460   IQADPHVLPSSYVNFIDGSYIFNYINHTKSPVAYISKVTTQLATKPAPFIASFSARGPNL  519

Query  869   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  690
             + P ILKPDI+APGV++IAA++E   PS+ +YDKR   FN+ SGTSMSCPHVAG+VGL+K
Sbjct  520   VEPTILKPDITAPGVDIIAAYSENISPSEQEYDKRRTLFNIMSGTSMSCPHVAGLVGLVK  579

Query  689   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVY  510
             +L+P+WSPA ++SAIMTTAT   N+G  I  D  + KATPF YGAGHI PN   DPGLVY
Sbjct  580   SLHPNWSPAAVKSAIMTTATTEDNTGGPIL-DSFKEKATPFDYGAGHIQPNRVVDPGLVY  638

Query  509   DLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK--GTATVTR  336
             DL +TDY+NF+CA+GYN + +    G PY CP   +L  FNYP+IT+   K   +  VTR
Sbjct  639   DLNITDYMNFLCARGYNSSMLRFFYGKPYTCPKSFNLKDFNYPAITILDFKVGQSINVTR  698

Query  335   TLKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENA-TADYAFG  159
             TL NVGSP+TYTA +++P  + + V PK L F + GE++ F+VTL  K ++   +DY FG
Sbjct  699   TLTNVGSPSTYTAQIQAPPEYVIYVEPKTLSFNQKGEKKEFRVTLTFKLQSKDKSDYVFG  758

Query  158   VLTWSDKKHRV  126
              L W++ K+ V
Sbjct  759   KLIWTNGKNYV  769



>dbj|BAK01624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=792

 Score =   402 bits (1033),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 260/372 (70%), Gaps = 3/372 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             +C  G+LDPEK KGK++VCLRG +AR  K      AG   M+LAND  SGNE+IADAH L
Sbjct  422   ICLQGSLDPEKVKGKIVVCLRGTSARVAKGLTVLQAGGAAMVLANDAASGNEVIADAHLL  481

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+ + DGL ++ Y+  T++PV ++  P T L  KPAP +AAFSS+GPN +NP+ILKP
Sbjct  482   PATHIRHHDGLTLYSYLKSTKSPVGYVEKPETSLETKPAPYMAAFSSQGPNPVNPEILKP  541

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV VIAAFT A  P++  +D+R V+F   SGTSMSCPHV+G+VGLLK L+P WSP
Sbjct  542   DITAPGVGVIAAFTRAMAPTELAFDERRVAFTTMSGTSMSCPHVSGLVGLLKALHPDWSP  601

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             + I+SA+MTTAT   N G++I  + +   A PFAYGAGH+ P+ A +PGLVYDL    Y+
Sbjct  602   SAIKSAMMTTATDVDNKGESIL-NASLTPAGPFAYGAGHVWPSRAMNPGLVYDLGPDHYL  660

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHI-SLSTFNYPSITVPHLKGT-ATVTRTLKNVGSP  312
             +F+CA  YN T ++   G PYKCP+    +   NYPSITV +L  + ATV RT+KNVG P
Sbjct  661   DFLCALKYNATVLSMFNGEPYKCPEKAPKIQDLNYPSITVVNLTASGATVKRTVKNVGFP  720

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
               Y A VR P G  V V+P++++F K GEE++F+V  + K      +YAFG L WS+   
Sbjct  721   GKYKAVVRQPAGVHVAVSPEVMEFGKKGEEKTFEVKFEIKDAKLAKNYAFGTLMWSNGVQ  780

Query  131   RVRSPIVVKAAA  96
              V+SPIVVK AA
Sbjct  781   FVKSPIVVKTAA  792



>ref|XP_004957134.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=808

 Score =   402 bits (1034),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 208/381 (55%), Positives = 257/381 (67%), Gaps = 15/381 (4%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LD  K KGK++VC+RG  AR +K      AG VG++LANDE SGNE+IADAH L
Sbjct  415   LCIEGSLDKAKVKGKIVVCIRGKNARVEKGEAVRRAGGVGLVLANDEASGNEVIADAHVL  474

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TY+DG+A+  Y+N TR+   +IT P T L  KPAP +AAFSS+GPN + P ILKP
Sbjct  475   PATHITYTDGVALLAYLNSTRSASGYITVPYTALDTKPAPFMAAFSSQGPNTVTPQILKP  534

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+++AAFT   GP+   +D+R V FN ESGTSMSCPHVAGV GLLK L+P WSP
Sbjct  535   DITAPGVSILAAFTGLAGPTGLPFDERRVLFNAESGTSMSCPHVAGVAGLLKALHPDWSP  594

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA V+ N  K ++ + + L+ATPF YGAGH+ PN AADPGLVYD   TDY+
Sbjct  595   AAIKSAIMTTARVQDNMRKPMS-NSSFLRATPFGYGAGHVQPNRAADPGLVYDADATDYL  653

Query  485   NFICAQGYNKTEITAVLG------TPYKCPDHISL-STFNYPSITVPHLKGTA---TVTR  336
              F+CA GYN + I A         T Y CP         NYPS+ VPHL  T    TVTR
Sbjct  654   GFLCALGYNSSAIAAFTAGDGDGHTHYSCPARAPRPEDLNYPSVAVPHLSPTGAAHTVTR  713

Query  335   TLKNVGS-PATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAF  162
              ++NVG+  A Y A V  P G  V V P+ L+F   GEE+ F VT +A+ G     +Y F
Sbjct  714   RVRNVGAGAAAYDARVHEPRGVEVDVRPRRLEFAAAGEEKQFTVTFRAREGSFWPGEYVF  773

Query  161   GVLTWSDKK--HRVRSPIVVK  105
             G L WSD    HRVRSP+VV+
Sbjct  774   GRLVWSDGAGGHRVRSPLVVR  794



>ref|NP_001046210.1| Os02g0198700 [Oryza sativa Japonica Group]
 dbj|BAD25466.1| putative subtilisin-like proteinase AIR3 [Oryza sativa Japonica 
Group]
 dbj|BAF08124.1| Os02g0198700 [Oryza sativa Japonica Group]
Length=799

 Score =   401 bits (1031),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 253/374 (68%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S LC  G+LDPEK KGK++VCLRGV  R +K      AG  GM+LAND  +GNEIIADAH
Sbjct  420   SQLCFLGSLDPEKVKGKIVVCLRGVNPRVEKGEAVLEAGGAGMVLANDVTTGNEIIADAH  479

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPATH+ +SDG  +F Y+  T++P   IT P T LG KPAP +AAFSS+GPN + P IL
Sbjct  480   VLPATHIKFSDGQILFSYLKNTKSPAGTITRPETRLGTKPAPFMAAFSSQGPNTVTPGIL  539

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+V+AA+T A+ P+D  +DKR V+FN ESGTSMSCPHVAGVVGLL+TL P W
Sbjct  540   KPDITAPGVSVVAAWTRASAPTDLAFDKRRVAFNSESGTSMSCPHVAGVVGLLRTLRPDW  599

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSA+MTTA    N   AI  + +   A PF +GAGH++P  A +PGLVYDL   D
Sbjct  600   SPAAIRSALMTTAVEVDNERHAIL-NSSFAAANPFGFGAGHVSPARAMNPGLVYDLAAVD  658

Query  491   YVNFICAQGYNKT----EITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLK  327
             Y+NF+C+  YN T            P++CP     +   NYPSITV +L  +ATV RT+K
Sbjct  659   YLNFLCSLSYNATVMAMFAGGGGAAPFRCPASPPKVQDLNYPSITVVNLTSSATVRRTVK  718

Query  326   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             NVG P  Y A V SP G  VTV+P  L F   GE+++F+V  +    +   DY+FG L W
Sbjct  719   NVGKPGVYKAYVTSPAGVRVTVSPDTLPFLLKGEKKTFQVRFEVTNASLAMDYSFGALVW  778

Query  146   SDKKHRVRSPIVVK  105
             ++ K  VRSP+VVK
Sbjct  779   TNGKQFVRSPLVVK  792



>gb|KGN56002.1| hypothetical protein Csa_3G045160 [Cucumis sativus]
Length=671

 Score =   397 bits (1021),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 251/367 (68%), Gaps = 2/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             +C  G+LDPEK  GK++VCLRG   R  K + AA AGAVGM++ NDE+SGN I+ D+H L
Sbjct  302   VCDEGSLDPEKLAGKIVVCLRGGLPRVSKGYVAAKAGAVGMLVVNDEESGNAILTDSHVL  361

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HVTY D ++IF YIN T+ P+A+I+   T L + P+PV+A FSSRGPN I   ILKP
Sbjct  362   PASHVTYDDSISIFQYINSTKTPMAYISSVMTELEITPSPVVADFSSRGPNTIEESILKP  421

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI APGVN++AA+ +    ++   D R   F V+SGTSM+CPH+AG+VGLLKTL P WSP
Sbjct  422   DIIAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHIAGIVGLLKTLNPKWSP  481

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N+   I  D   L+A P AYGAGH+NPN A DPGLVYD+ + DY+
Sbjct  482   AAIKSAIMTTAKTTDNNFNPIV-DYGGLEANPLAYGAGHVNPNSAMDPGLVYDITIDDYL  540

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSPA  309
             NF+CA+GYN T+I  +    + C     ++  NYPSI+V +LK G   + R LKNVGSP 
Sbjct  541   NFLCARGYNTTQIKRISKKNFVCDKSFKVTDLNYPSISVTNLKMGPVAINRKLKNVGSPG  600

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A V++P+  S+ V P+IL F  + EE+SFKV L   G+     Y FG L W+D    
Sbjct  601   TYVARVKTPLEVSIIVEPRILDFTAMDEEKSFKVLLNRSGKGKQEGYVFGELVWTDVNRH  660

Query  128   VRSPIVV  108
             VR+PIVV
Sbjct  661   VRTPIVV  667



>gb|EAY84890.1| hypothetical protein OsI_06255 [Oryza sativa Indica Group]
Length=791

 Score =   400 bits (1029),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 253/374 (68%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             S LC  G+LDPEK KGK++VCLRGV  R +K      AG  GM+LAND  +GNEIIADAH
Sbjct  412   SQLCFLGSLDPEKVKGKIVVCLRGVNPRVEKGEAVLEAGGAGMVLANDVTTGNEIIADAH  471

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPATH+ +SDG  +F Y+  T++P   IT P T LG KPAP +AAFSS+GPN + P IL
Sbjct  472   VLPATHIKFSDGQILFSYLKNTKSPAGTITRPETRLGTKPAPFMAAFSSQGPNTVTPGIL  531

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPDI+APGV+V+AA+T A+ P+D  +DKR V+FN ESGTSMSCPHVAGVVGLL+TL P W
Sbjct  532   KPDITAPGVSVVAAWTRASAPTDLAFDKRRVAFNSESGTSMSCPHVAGVVGLLRTLRPDW  591

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA IRSA+MTTA    N   AI  + +   A PF +GAGH++P  A +PGLVYDL   D
Sbjct  592   SPAAIRSALMTTAVEVDNERHAIL-NSSFAAANPFGFGAGHVSPARAMNPGLVYDLAAVD  650

Query  491   YVNFICAQGYNKT----EITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLK  327
             Y+NF+C+  YN T            P++CP     +   NYPSITV +L  +ATV RT+K
Sbjct  651   YLNFLCSLRYNATVMAMFAGGGGAAPFRCPASPPKVQDLNYPSITVVNLTSSATVRRTVK  710

Query  326   NVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             NVG P  Y A V SP G  VTV+P  L F   GE+++F+V  +    +   DY+FG L W
Sbjct  711   NVGKPGVYKAYVTSPAGVRVTVSPDTLPFLLKGEKKTFQVRFEVTNASLAMDYSFGALVW  770

Query  146   SDKKHRVRSPIVVK  105
             ++ K  VRSP+VVK
Sbjct  771   TNGKQFVRSPLVVK  784



>ref|XP_008449005.1| PREDICTED: subtilisin-like protease isoform X2 [Cucumis melo]
Length=681

 Score =   397 bits (1020),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/367 (53%), Positives = 251/367 (68%), Gaps = 2/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             +C  G+LDP+K  GK++VCLRG  +R  K + AA AGAVGMI+ NDEDSGN II D+H L
Sbjct  312   VCDEGSLDPKKLAGKIVVCLRGGLSRVSKGYVAAKAGAVGMIVENDEDSGNAIITDSHVL  371

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HVTY D ++IF YIN T+ P A+I+   T L + P+ V+A FSSRGPN I   ILKP
Sbjct  372   PASHVTYDDSISIFQYINSTKRPKAYISSVMTELEITPSAVVADFSSRGPNTIEESILKP  431

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN++AA+ +    ++   D R   F V+SGTSM+CPHVAG+VGLLKTL P WSP
Sbjct  432   DITAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHVAGIVGLLKTLNPKWSP  491

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N+   I D    L+A P AYGAGH+NPN A DPGLVYD+ + DY+
Sbjct  492   AAIKSAIMTTAKTTDNNFNPIVDHRG-LEANPLAYGAGHVNPNSAMDPGLVYDITIDDYL  550

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSPA  309
             NF+CA+GYN  +I  +    + C     ++  NYPSI+V +LK G   + R LKNVGSP 
Sbjct  551   NFLCARGYNTKQIKRISKKNFICDKSFKVTDLNYPSISVTNLKMGPVAINRKLKNVGSPG  610

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
              Y A V++P+  S+ V P+IL+F  + EE+SFKV LK  G+     Y FG L W+D  H 
Sbjct  611   RYVARVKTPLEVSIIVEPRILEFTAMDEEKSFKVLLKRSGKGKQEGYVFGELVWTDFNHH  670

Query  128   VRSPIVV  108
             VRS IVV
Sbjct  671   VRSSIVV  677



>ref|XP_006475104.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score =   399 bits (1026),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/368 (53%), Positives = 253/368 (69%), Gaps = 3/368 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             CK G++DP K +GK+L+C  G     +K   AA AGAVGMIL + ++SGN+++   H LP
Sbjct  410   CKKGSIDPAKVQGKILICY-GARYGDEKGRWAAQAGAVGMILVSSKESGNKVLNMVHHLP  468

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
               H+ Y+DG +++ YIN T+NP A +T+  T    +P+ ++A F+SRGPN I+P I KPD
Sbjct  469   TAHLNYTDGESVYAYINSTQNPTASMTNSKTEFNTRPSRMMAFFTSRGPNMIDPAIFKPD  528

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             ++APGV++IAAFTEA+GPS ++ DKR + + + SGTSMSCPHVAG+VGL+KTL+P WSPA
Sbjct  529   VTAPGVDIIAAFTEASGPSPDETDKRRIPYIMMSGTSMSCPHVAGIVGLVKTLHPDWSPA  588

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SAIMTTA    +S + I D  T  KATPFAYGAGH+NPN A DPGLVYDL   DY+ 
Sbjct  589   AIKSAIMTTARAEDSSNRPILDQNTGEKATPFAYGAGHVNPNSALDPGLVYDLTFEDYLG  648

Query  482   FICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP-A  309
             +IC +GYN++ I        + CP   +L+ FNYPSI VP L GT T TR +KNVG+  +
Sbjct  649   YICDRGYNQSTIDLFTAPKKFTCPKSFNLADFNYPSIAVPKLNGTITFTRKVKNVGAANS  708

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A      G S  V P IL F K GEE++FKVT   KG++   DY FG L WSD  H 
Sbjct  709   TYKARTSEITGVSTIVEPSILNFTKYGEEKTFKVTFSVKGDDKPKDYVFGELVWSDGFHD  768

Query  128   VRSPIVVK  105
             VRSPI VK
Sbjct  769   VRSPIAVK  776



>ref|XP_008449002.1| PREDICTED: subtilisin-like protease isoform X1 [Cucumis melo]
 ref|XP_008449003.1| PREDICTED: subtilisin-like protease isoform X1 [Cucumis melo]
Length=710

 Score =   397 bits (1020),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/367 (53%), Positives = 251/367 (68%), Gaps = 2/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             +C  G+LDP+K  GK++VCLRG  +R  K + AA AGAVGMI+ NDEDSGN II D+H L
Sbjct  341   VCDEGSLDPKKLAGKIVVCLRGGLSRVSKGYVAAKAGAVGMIVENDEDSGNAIITDSHVL  400

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HVTY D ++IF YIN T+ P A+I+   T L + P+ V+A FSSRGPN I   ILKP
Sbjct  401   PASHVTYDDSISIFQYINSTKRPKAYISSVMTELEITPSAVVADFSSRGPNTIEESILKP  460

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGVN++AA+ +    ++   D R   F V+SGTSM+CPHVAG+VGLLKTL P WSP
Sbjct  461   DITAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHVAGIVGLLKTLNPKWSP  520

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N+   I D    L+A P AYGAGH+NPN A DPGLVYD+ + DY+
Sbjct  521   AAIKSAIMTTAKTTDNNFNPIVDHRG-LEANPLAYGAGHVNPNSAMDPGLVYDITIDDYL  579

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSPA  309
             NF+CA+GYN  +I  +    + C     ++  NYPSI+V +LK G   + R LKNVGSP 
Sbjct  580   NFLCARGYNTKQIKRISKKNFICDKSFKVTDLNYPSISVTNLKMGPVAINRKLKNVGSPG  639

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
              Y A V++P+  S+ V P+IL+F  + EE+SFKV LK  G+     Y FG L W+D  H 
Sbjct  640   RYVARVKTPLEVSIIVEPRILEFTAMDEEKSFKVLLKRSGKGKQEGYVFGELVWTDFNHH  699

Query  128   VRSPIVV  108
             VRS IVV
Sbjct  700   VRSSIVV  706



>ref|XP_008794758.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=758

 Score =   397 bits (1021),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 204/369 (55%), Positives = 260/369 (70%), Gaps = 2/369 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC   +LDP K KGK++ CLRG+ AR +K      AG  GM+L ND+  GN +++D + L
Sbjct  389   LCFMDSLDPNKVKGKIVACLRGIIARMEKGAAVLRAGGAGMVLINDKQDGNSLLSDPYIL  448

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA  VT+ DG+A+  Y++ T++PVA I+ P T LGVKPAP +AAFSS+GPN I+P ILKP
Sbjct  449   PALMVTHRDGVALRKYMDSTKSPVASISAPATKLGVKPAPTMAAFSSQGPNLISPHILKP  508

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV ++AAFT A   +    D R V FN+ SGTSMSCPHV+GV GLLKTL+P W+P
Sbjct  509   DITAPGVGILAAFTGARSATGLPMDNRHVPFNLLSGTSMSCPHVSGVAGLLKTLHPHWTP  568

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTA  R N+G  +       KATPFA+G+GHI PN A DPGLV+DL LTDY+
Sbjct  569   AAIRSAIMTTARSRDNTGSPMKGYNLLEKATPFAHGSGHIRPNRAMDPGLVFDLTLTDYL  628

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             N++CA GYN T++ A     Y+CP   I +  FNYPSI VP +  T T+TRT+KNVGSP 
Sbjct  629   NYLCAFGYNSTQL-AQFSKRYRCPATPIKMEDFNYPSIAVPTVTRTLTLTRTVKNVGSPG  687

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A V  P G ++TV P+ILKF+KVGEE++F+VTLK   ++    Y FG L WSD +H 
Sbjct  688   TYKARVEPPYGITMTVKPEILKFDKVGEEKAFEVTLKPHEKSIGRGYLFGRLIWSDGRHY  747

Query  128   VRSPIVVKA  102
             VR P+ V A
Sbjct  748   VRIPVAVNA  756



>ref|XP_004148289.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=768

 Score =   396 bits (1018),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 251/367 (68%), Gaps = 2/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             +C  G+LDPEK  GK++VCLRG   R  K + AA AGAVGM++ NDE+SGN I+ D+H L
Sbjct  399   VCDEGSLDPEKLAGKIVVCLRGGLPRVSKGYVAAKAGAVGMLVVNDEESGNAILTDSHVL  458

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HVTY D ++IF YIN T+ P+A+I+   T L + P+PV+A FSSRGPN I   ILKP
Sbjct  459   PASHVTYDDSISIFQYINSTKTPMAYISSVMTELEITPSPVVADFSSRGPNTIEESILKP  518

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI APGVN++AA+ +    ++   D R   F V+SGTSM+CPH+AG+VGLLKTL P WSP
Sbjct  519   DIIAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHIAGIVGLLKTLNPKWSP  578

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N+   I  D   L+A P AYGAGH+NPN A DPGLVYD+ + DY+
Sbjct  579   AAIKSAIMTTAKTTDNNFNPIV-DYGGLEANPLAYGAGHVNPNSAMDPGLVYDITIDDYL  637

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSPA  309
             NF+CA+GYN T+I  +    + C     ++  NYPSI+V +LK G   + R LKNVGSP 
Sbjct  638   NFLCARGYNTTQIKRISKKNFVCDKSFKVTDLNYPSISVTNLKMGPVAINRKLKNVGSPG  697

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A V++P+  S+ V P+IL F  + EE+SFKV L   G+     Y FG L W+D    
Sbjct  698   TYVARVKTPLEVSIIVEPRILDFTAMDEEKSFKVLLNRSGKGKQEGYVFGELVWTDVNRH  757

Query  128   VRSPIVV  108
             VR+PIVV
Sbjct  758   VRTPIVV  764



>ref|XP_004162792.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=768

 Score =   396 bits (1018),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 251/367 (68%), Gaps = 2/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             +C  G+LDPEK  GK++VCLRG   R  K + AA AGAVGM++ NDE+SGN I+ D+H L
Sbjct  399   VCDEGSLDPEKLAGKIVVCLRGGLPRVSKGYVAAKAGAVGMLVVNDEESGNAILTDSHVL  458

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+HVTY D ++IF YIN T+ P+A+I+   T L + P+PV+A FSSRGPN I   ILKP
Sbjct  459   PASHVTYDDSISIFQYINSTKTPMAYISSVMTELEITPSPVVADFSSRGPNTIEESILKP  518

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI APGVN++AA+ +    ++   D R   F V+SGTSM+CPH+AG+VGLLKTL P WSP
Sbjct  519   DIIAPGVNILAAYPDGIPLTEAPLDDRQSPFKVDSGTSMACPHIAGIVGLLKTLNPKWSP  578

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA    N+   I  D   L+A P AYGAGH+NPN A DPGLVYD+ + DY+
Sbjct  579   AAIKSAIMTTAKTTDNNFNPIV-DYGGLEANPLAYGAGHVNPNSAMDPGLVYDITIDDYL  637

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLK-GTATVTRTLKNVGSPA  309
             NF+CA+GYN T+I  +    + C     ++  NYPSI+V +LK G   + R LKNVGSP 
Sbjct  638   NFLCARGYNTTQIKRISKKNFVCDKSFKVTDLNYPSISVTNLKMGPVAINRKLKNVGSPG  697

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A V++P+  S+ V P+IL F  + EE+SFKV L   G+     Y FG L W+D    
Sbjct  698   TYVARVKTPLEVSIIVEPRILDFTAMDEEKSFKVLLNRSGKGKQEGYVFGELVWTDVNRH  757

Query  128   VRSPIVV  108
             VR+PIVV
Sbjct  758   VRTPIVV  764



>ref|XP_006452710.1| hypothetical protein CICLE_v10010380mg, partial [Citrus clementina]
 gb|ESR65950.1| hypothetical protein CICLE_v10010380mg, partial [Citrus clementina]
Length=750

 Score =   395 bits (1016),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 251/368 (68%), Gaps = 3/368 (1%)
 Frame = -3

Query  1202  CKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFLP  1023
             CK G++DP K +GK+L+C  G     +K   AA AGAVGMIL + ++SGN+++   H LP
Sbjct  382   CKKGSIDPAKVQGKILICY-GARYGDEKGQWAAQAGAVGMILVSSKESGNKVLNMVHHLP  440

Query  1022  ATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKPD  843
               H+ Y+DG +++ YIN T+NP A +T+  T    +P+ ++A F+SRGPN I+P I KPD
Sbjct  441   TAHLNYTDGESVYAYINSTQNPTASMTNSKTEFNTRPSRMMAFFTSRGPNMIDPAIFKPD  500

Query  842   ISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSPA  663
             ++APGV++IAAFTEA+GPS ++  KR + + + SGTSMSCPHVAG+VGL+KTL+P WSPA
Sbjct  501   VTAPGVDIIAAFTEASGPSPDETHKRRIPYIMMSGTSMSCPHVAGIVGLVKTLHPDWSPA  560

Query  662   EIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYVN  483
              I+SAIMTTA    +S + I D  T  KATPFAYGAGH+NPN A DPGLVYDL   DY+ 
Sbjct  561   AIKSAIMTTARAEDSSNRPILDQNTGEKATPFAYGAGHVNPNSALDPGLVYDLTFEDYLG  620

Query  482   FICAQGYNKTEITAVLG-TPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSP-A  309
             +IC +GYN++ I        + CP   +L+ FNYPSI VP L GT T TR +KNVG+  +
Sbjct  621   YICDRGYNQSTIDLFTAPKKFTCPKSFNLADFNYPSIAVPKLNGTITFTRKVKNVGAANS  680

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
             TY A      G S  V P IL F K GEE++FKV    KG++   DY FG L WSD  H 
Sbjct  681   TYKARTSEITGVSTIVEPSILNFTKYGEEKTFKVAFSVKGDDKPTDYGFGELVWSDGFHD  740

Query  128   VRSPIVVK  105
             VRSPI VK
Sbjct  741   VRSPIAVK  748



>ref|XP_004148290.1| PREDICTED: uncharacterized protein LOC101212014 [Cucumis sativus]
Length=1696

 Score =   412 bits (1058),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 201/367 (55%), Positives = 254/367 (69%), Gaps = 3/367 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LDP KAKGK++VCLRG  AR +K      AG VGMIL N ++ G+   ADAH L
Sbjct  464   LCHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMILVNGKNGGSGTTADAHIL  523

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH++Y+DGLA+  YIN T+ PVAHIT   T LG+KP+PV+A FSSRGPN I   +LKP
Sbjct  524   PATHLSYTDGLAVAQYINSTKTPVAHITPVQTQLGIKPSPVMADFSSRGPNPITEAMLKP  583

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+ PG++++A+ T     +   +D R V FNVESGTSMSCPH++GVVGLLKTLYP+WSP
Sbjct  584   DITGPGMSILASVTTDVTATTFPFDTRRVPFNVESGTSMSCPHISGVVGLLKTLYPTWSP  643

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I+D+  + KATPF YGAGH++PN A DPGLVYD  + DY+
Sbjct  644   AAIKSAIMTTAKTRDNTMRTISDN-VKPKATPFDYGAGHVHPNSAMDPGLVYDTTIDDYL  702

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GYN          P+ C    +L+  NYPSI++P L+  A  TV R +KNVG+P
Sbjct  703   NFLCARGYNSLTFKNFYNKPFVCAKSFTLTDLNYPSISIPKLQFGAPVTVNRRVKNVGTP  762

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V +     VTV P  L+F  VGEE++FKV  + KG      Y FG L WSD KH
Sbjct  763   GTYVARVNASSKILVTVEPSTLQFNSVGEEKAFKVVFEYKGNEQDKGYVFGTLIWSDGKH  822

Query  131   RVRSPIV  111
              VRSPI+
Sbjct  823   NVRSPIL  829


 Score =   395 bits (1014),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 191/368 (52%), Positives = 254/368 (69%), Gaps = 3/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GTLDP K KGK+++C  G T   DK  QA+ AGAVG+I+AND + G+EI  + HF+
Sbjct  1322  FCGKGTLDPMKVKGKIVICQVGETDGVDKGFQASRAGAVGVIIANDLEKGDEIFPELHFI  1381

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ +T +D   + +Y+  TR P+AH+T   TLL VKPAP IA FS+RGPN I+  ILKP
Sbjct  1382  PASDITNTDAQIVQNYLKSTRTPMAHLTSVKTLLSVKPAPTIATFSARGPNPIDSTILKP  1441

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSP
Sbjct  1442  DVTAPGVNILASYPTGIAPTFSPVDRRRIPFNVISGTSMSCPHVAGIAGLIKSIHPNWSP  1501

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I  D T+LKATP+AYGAG +NPN AADPGLVYD+ + DY+
Sbjct  1502  AAIKSAIMTTAKTRGNNNQTIL-DSTKLKATPYAYGAGQVNPNDAADPGLVYDITVNDYL  1560

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GYN  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP
Sbjct  1561  NFLCARGYNAMQIKKFYAKPFSCVRSFKVTDLNYPSISVGELKIGAPLTMNRRVKNVGSP  1620

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++  G +V++ P  L F +VGEE+ FKV L+  G+       FG L WSD KH
Sbjct  1621  GTYVARVKASPGVAVSIEPSTLVFSRVGEEKGFKVVLQNTGKVKNGSDVFGTLIWSDGKH  1680

Query  131   RVRSPIVV  108
              VRS I V
Sbjct  1681  FVRSSIAV  1688



>ref|XP_004164572.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=771

 Score =   395 bits (1015),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 191/368 (52%), Positives = 255/368 (69%), Gaps = 3/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GTLDP K KGK+++C  G T   DK  QA+ AGAVG+I+AND + G+EI  + HF+
Sbjct  397   FCGKGTLDPMKVKGKIVICQVGETDGVDKGFQASRAGAVGVIIANDLEKGDEIFPELHFI  456

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ +T +D   + +Y+  TR P+AH+T   TLL VKPAP IA FS+RGPN I+  ILKP
Sbjct  457   PASDITNTDAQIVQNYLKSTRTPMAHLTSVKTLLSVKPAPTIATFSARGPNPIDSTILKP  516

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSP
Sbjct  517   DVTAPGVNILASYPTGIAPTFSPVDRRRIPFNVISGTSMSCPHVAGIAGLIKSIHPNWSP  576

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I  D T+LKATP+AYGAG +NPN AADPGLVYD+ + DY+
Sbjct  577   AAIKSAIMTTAKTRGNNNQTIL-DSTKLKATPYAYGAGQVNPNDAADPGLVYDITVNDYL  635

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GYN  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP
Sbjct  636   NFLCARGYNAMQIKKFYAKPFSCVRSFKVTDLNYPSISVGELKIGAPLTMNRRVKNVGSP  695

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++  G +V++ P  L F +VGEE+ FKV L+  G+  +    FG L WSD KH
Sbjct  696   GTYVARVKASPGVAVSIEPSTLVFSRVGEEKGFKVVLQNTGKVKSGSDVFGTLIWSDGKH  755

Query  131   RVRSPIVV  108
              VRS I V
Sbjct  756   FVRSSIAV  763



>ref|XP_008650860.1| PREDICTED: uncharacterized protein LOC100192953 isoform X1 [Zea 
mays]
 tpg|DAA61960.1| TPA: putative subtilase family protein [Zea mays]
Length=808

 Score =   396 bits (1017),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 255/380 (67%), Gaps = 14/380 (4%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC  G+LD  K KGK++VC+RG  AR +K      AG  GM+LANDE SGNE+IADAH L
Sbjct  418   LCIGGSLDKAKVKGKIVVCVRGKNARVEKGEAVHRAGGAGMVLANDEASGNEVIADAHVL  477

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PATH+TY+DG+ +  Y+  TR    +IT P T L  KPAP +AAFSS+GPN + P+ILKP
Sbjct  478   PATHITYADGVTLLAYLKATRLASGYITVPYTALDAKPAPFMAAFSSQGPNTVTPEILKP  537

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+++AAFT   GP+   +D R V FN ESGTSMSCPHVAG+ GLLK ++P WSP
Sbjct  538   DITAPGVSILAAFTGEAGPTGLAFDDRRVLFNAESGTSMSCPHVAGIAGLLKAVHPDWSP  597

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA V+ N  K ++ + + L+ATPF YGAGH+ PN AADPGLVYD   TDY+
Sbjct  598   AAIKSAIMTTARVQDNMRKPMS-NSSFLRATPFGYGAGHVQPNRAADPGLVYDANTTDYL  656

Query  485   NFICAQGYNKTEITAVLGTP------YKCPDHISLSTFNYPSITVPHLK---GTATVTRT  333
             +F+CA GYN + I   +         + CP  +     NYPS+ VPHL    G  TVTR 
Sbjct  657   SFLCALGYNSSVIATFMAGAGDGHEVHACPARLRPEDLNYPSVAVPHLSPTGGAHTVTRR  716

Query  332   LKNVG-SPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAK-GENATADYAFG  159
             ++NVG   ATY A V  P G +V V P+ L+F   GEE+ F VT +A+ G     +Y FG
Sbjct  717   VRNVGPGGATYDAKVHEPRGVAVDVRPRRLEFAAAGEEKQFTVTFRAREGFFLPGEYVFG  776

Query  158   VLTWSD--KKHRVRSPIVVK  105
              L WSD   +HRVRSP+V +
Sbjct  777   RLVWSDGRGRHRVRSPLVAR  796



>gb|KGN55995.1| hypothetical protein Csa_3G045090 [Cucumis sativus]
Length=751

 Score =   394 bits (1013),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/368 (52%), Positives = 254/368 (69%), Gaps = 3/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GTLDP K KGK+++C  G T   DK  QA+ AGAVG+I+AND + G+EI  + HF+
Sbjct  377   FCGKGTLDPMKVKGKIVICQVGETDGVDKGFQASRAGAVGVIIANDLEKGDEIFPELHFI  436

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ +T +D   + +Y+  TR P+AH+T   TLL VKPAP IA FS+RGPN I+  ILKP
Sbjct  437   PASDITNTDAQIVQNYLKSTRTPMAHLTSVKTLLSVKPAPTIATFSARGPNPIDSTILKP  496

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSP
Sbjct  497   DVTAPGVNILASYPTGIAPTFSPVDRRRIPFNVISGTSMSCPHVAGIAGLIKSIHPNWSP  556

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I  D T+LKATP+AYGAG +NPN AADPGLVYD+ + DY+
Sbjct  557   AAIKSAIMTTAKTRGNNNQTIL-DSTKLKATPYAYGAGQVNPNDAADPGLVYDITVNDYL  615

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GYN  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP
Sbjct  616   NFLCARGYNAMQIKKFYAKPFSCVRSFKVTDLNYPSISVGELKIGAPLTMNRRVKNVGSP  675

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++  G +V++ P  L F +VGEE+ FKV L+  G+       FG L WSD KH
Sbjct  676   GTYVARVKASPGVAVSIEPSTLVFSRVGEEKGFKVVLQNTGKVKNGSDVFGTLIWSDGKH  735

Query  131   RVRSPIVV  108
              VRS I V
Sbjct  736   FVRSSIAV  743



>ref|XP_008448997.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=776

 Score =   395 bits (1014),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 256/368 (70%), Gaps = 4/368 (1%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C  GTLDP K KGK+++C  G T   DK +QA+LAGA G+I+AND + G+EI  + HF+
Sbjct  403   FCGKGTLDPMKVKGKIVICQVGETEGVDKGYQASLAGAAGVIVANDIEKGDEIYPELHFI  462

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA+ +T +D   +  Y+  T+ P+AH+T   TLL VKPAP+IA FSSRGPN I+  ILKP
Sbjct  463   PASDITNTDAQIVQKYLKSTKTPIAHLTSVKTLLSVKPAPIIATFSSRGPNPIDSTILKP  522

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGVN++A++     P+ +  D+R + FNV SGTSMSCPHVAG+ GL+K+++P+WSP
Sbjct  523   DVTAPGVNILASYPTGIAPTFSAADRRRIPFNVISGTSMSCPHVAGIAGLVKSIHPNWSP  582

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMTTA  R N+ + I  D T+LKATP+AYGAG + PN AADPGLVYD+ + DY+
Sbjct  583   AAIKSAIMTTAKTRGNNNQTIL-DSTKLKATPYAYGAGQVYPNDAADPGLVYDITINDYL  641

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTA--TVTRTLKNVGSP  312
             NF+CA+GY+  +I      P+ C     ++  NYPSI+V  LK  A  T+ R +KNVGSP
Sbjct  642   NFLCARGYDAMKIKKFYAKPFNCVRSFKVTDLNYPSISVGELKIGAPLTINRRVKNVGSP  701

Query  311   ATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKH  132
              TY A V++  G +VT+ P  L F  VGEE+ FKV L+  G+  + D  FG L WSD KH
Sbjct  702   GTYVARVKASPGVAVTIEPSTLVFRSVGEEKGFKVVLQNTGKVKSGD-VFGTLIWSDGKH  760

Query  131   RVRSPIVV  108
              VRSPI V
Sbjct  761   FVRSPIAV  768



>ref|XP_010647520.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=698

 Score =   392 bits (1006),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 264/373 (71%), Gaps = 8/373 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCL---RGVTA-RTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             +C  G+LDP+K KGK++ CL    G+ A   +KS   A AG +GMILAN   +   +I  
Sbjct  324   ICSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTT-TTLIPQ  382

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
             AHF+P + V+ +DGLAI  YI+ T+ PVA+I+   T +G   AP++A+FSS+GPN I P+
Sbjct  383   AHFVPTSRVSAADGLAILLYIHTTKYPVAYISGA-TEVGTVTAPIMASFSSQGPNTITPE  441

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI+APGV +IAA+TEA GP+    D R V FN+ SGTSMSCPHV+G VGLLK ++P
Sbjct  442   ILKPDITAPGVQIIAAYTEARGPTFLQSDDRRVLFNIVSGTSMSCPHVSGAVGLLKKIHP  501

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             +WSP+ IRSAIMT AT R+N  + I +D T  +  PF YGAGH++PN A DPGLVYDL +
Sbjct  502   NWSPSAIRSAIMTLATTRSNLRQPIAND-TLAEGNPFNYGAGHLSPNRAMDPGLVYDLTI  560

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISL-STFNYPSITVPHLKGTATVTRTLKNV  321
             TDY+NF+C+ GYN T+++  +   Y+CP   +     NYPSITVP L G  TVTRTLKNV
Sbjct  561   TDYLNFLCSIGYNATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNV  620

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
             G+P+TYT  +++P G SV V PK L+FEK  EE+ FKVT++AK ++   +Y FG L WSD
Sbjct  621   GTPSTYTVRIKAPSGISVKVEPKRLRFEKKNEEKMFKVTIEAKRDDGGGEYVFGRLIWSD  680

Query  140   KKHRVRSPIVVKA  102
              KH V SPIVV A
Sbjct  681   GKHFVGSPIVVNA  693



>gb|ACN85198.1| subtilisin-like protease precursor [Oryza glaberrima]
Length=791

 Score =   393 bits (1010),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 257/374 (69%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC+ G LD +K  GK++VC+RG   R +K  + + AG   MIL NDE SGN++IADAH
Sbjct  415   ALLCELGALDGKKVMGKIVVCMRGGNPRVEKGEEVSRAGGAAMILVNDEASGNDVIADAH  474

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA H+ ++DG A+  YIN T+   A IT   T++GVKPAPV+AAFSS+GPN +NP+IL
Sbjct  475   VLPAVHINHADGHALLAYINSTKGAKAFITRAKTVVGVKPAPVMAAFSSQGPNTVNPEIL  534

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV+VIAA++ A GP+   YD+R V+FN +SGTSMSCP V+GV GL+KTL+P W
Sbjct  535   KPDVTAPGVSVIAAWSGAAGPTGLPYDQRRVAFNAQSGTSMSCPQVSGVAGLIKTLHPDW  594

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT   N  + I +      ATPF+ GAGH+ P+ A DPGLVYDL + D
Sbjct  595   SPAAIKSAIMTTATELGNDMRPIMNSSMS-PATPFSCGAGHVFPHRAMDPGLVYDLTVDD  653

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT---ATVTRTLKN  324
             +++F+C  GYN T +    G P++CPD  +    FNYPSIT   L      AT  R ++N
Sbjct  654   HLSFLCTIGYNATALALFNGAPFRCPDDPLDPLDFNYPSITAFDLAPAGPPATARRRVRN  713

Query  323   VGSPATYTAS-VRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             VG PATYTA+ VR P G  VTV P  L FE  GE ++F V    +     A+YAFG + W
Sbjct  714   VGPPATYTAAVVREPEGVQVTVTPTTLTFESTGEVRTFWVKFAVRDPAPAANYAFGAIVW  773

Query  146   SDKKHRVRSPIVVK  105
             SD  H+VRSPIVVK
Sbjct  774   SDGNHQVRSPIVVK  787



>dbj|BAD35630.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAD35473.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
Length=790

 Score =   393 bits (1010),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 257/374 (69%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC+ G LD +K  GK++VC+RG   R +K  + + AG   MIL NDE SGN++IADAH
Sbjct  414   ALLCELGALDGKKVMGKIVVCMRGGNPRVEKGEEVSRAGGAAMILVNDEASGNDVIADAH  473

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA H+ ++DG A+  YIN T+   A IT   T++GVKPAPV+AAFSS+GPN +NP+IL
Sbjct  474   VLPAVHINHADGHALLAYINSTKGAKAFITRAKTVVGVKPAPVMAAFSSQGPNTVNPEIL  533

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV+VIAA++ A GP+   YD+R V+FN +SGTSMSCP V+GV GL+KTL+P W
Sbjct  534   KPDVTAPGVSVIAAWSGAAGPTGLPYDQRRVAFNAQSGTSMSCPQVSGVAGLIKTLHPDW  593

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT   N  + I +      ATPF+ GAGH+ P+ A DPGLVYDL + D
Sbjct  594   SPAAIKSAIMTTATELGNDMRPIMNSSMS-PATPFSCGAGHVFPHRAMDPGLVYDLTVDD  652

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT---ATVTRTLKN  324
             +++F+C  GYN T +    G P++CPD  +    FNYPSIT   L      AT  R ++N
Sbjct  653   HLSFLCTIGYNATALALFNGAPFRCPDDPLDPLDFNYPSITAFDLAPAGPPATARRRVRN  712

Query  323   VGSPATYTAS-VRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             VG PATYTA+ VR P G  VTV P  L FE  GE ++F V    +     A+YAFG + W
Sbjct  713   VGPPATYTAAVVREPEGVQVTVTPTTLTFESTGEVRTFWVKFAVRDPAPAANYAFGAIVW  772

Query  146   SDKKHRVRSPIVVK  105
             SD  H+VRSPIVVK
Sbjct  773   SDGNHQVRSPIVVK  786



>gb|ACN85165.1| subtilisin-like protease precursor [Oryza nivara]
 gb|ACN85182.1| subtilisin-like protease precursor [Oryza rufipogon]
Length=790

 Score =   393 bits (1010),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 256/374 (68%), Gaps = 6/374 (2%)
 Frame = -3

Query  1211  SLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAH  1032
             +LLC+ G LD +K  GK++VC+RG   R +K  + + AG   MIL NDE SGN++IADAH
Sbjct  414   ALLCELGALDGKKVMGKIVVCMRGGNPRVEKGEEVSRAGGAAMILVNDEASGNDVIADAH  473

Query  1031  FLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDIL  852
              LPA H+ ++DG A+  YIN T+   A IT   T++GVKPAPV+AAFSS+GPN +NP+IL
Sbjct  474   VLPAVHINHADGHALLAYINSTKGAKAFITRAKTVVGVKPAPVMAAFSSQGPNTVNPEIL  533

Query  851   KPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSW  672
             KPD++APGV+VIAA++ A GP+   YD+R V+FN +SGTSMSCP V+GV GL+KTL+P W
Sbjct  534   KPDVTAPGVSVIAAWSGAAGPTGLPYDQRRVAFNAQSGTSMSCPQVSGVAGLIKTLHPDW  593

Query  671   SPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTD  492
             SPA I+SAIMTTAT   N  + I +      ATPF+ GAGH+ P+ A DPGLVYDL + D
Sbjct  594   SPAAIKSAIMTTATELGNDMRPIMNSSMS-PATPFSCGAGHVFPHRAMDPGLVYDLTVDD  652

Query  491   YVNFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHLKGT---ATVTRTLKN  324
             ++ F+C  GYN T +    G P++CPD  +    FNYPSIT   L      AT  R ++N
Sbjct  653   HLGFLCTIGYNATALALFNGAPFRCPDDPLDPLDFNYPSITAFDLAPAGPPATARRRVRN  712

Query  323   VGSPATYTAS-VRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTW  147
             VG PATYTA+ VR P G  VTV P  L FE  GE ++F V    +     A+YAFG + W
Sbjct  713   VGPPATYTAAVVREPEGVQVTVTPTTLTFESTGEVRTFWVKFAVRDPAPAANYAFGAIVW  772

Query  146   SDKKHRVRSPIVVK  105
             SD  H+VRSPIVVK
Sbjct  773   SDGNHQVRSPIVVK  786



>ref|XP_010647021.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=725

 Score =   390 bits (1003),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 263/373 (71%), Gaps = 8/373 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCL---RGVTA-RTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             LC  G+LDP+K KGK++ CL    G+ A   +KS   A AG +GMILAN   +   +I  
Sbjct  351   LCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTAT-LIPQ  409

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
             AHF+P + V+ +DGLAI  YI+ T+ PVA+I+   T +G   AP++A+FSS+GPN I P+
Sbjct  410   AHFVPTSRVSAADGLAILLYIHTTKYPVAYISGA-TEVGTVTAPIMASFSSQGPNTITPE  468

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI+APGV +IAA+TEA GP+    D R V FN+ SGTSMSCPHV+G VGLLK ++P
Sbjct  469   ILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHP  528

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             +WSP+ IRSAIMT+A  R+N  + I +  T     PF YGAGH++PN A DPGLVYDL +
Sbjct  529   NWSPSAIRSAIMTSARTRSNLRQPIANG-TLAGGNPFNYGAGHLSPNRAMDPGLVYDLTI  587

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISL-STFNYPSITVPHLKGTATVTRTLKNV  321
             TDY+NF+C+ GYN T+++  +   Y+CP   +     NYPSITVP L G  TVTRTLKNV
Sbjct  588   TDYLNFLCSIGYNATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNV  647

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
             G+PATYT  +++P G SV V PK L+FEK+ EE+ FKVT++AK ++   +Y FG L WSD
Sbjct  648   GTPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSD  707

Query  140   KKHRVRSPIVVKA  102
              KH V SPIVV A
Sbjct  708   GKHFVGSPIVVNA  720



>ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   392 bits (1006),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 256/370 (69%), Gaps = 8/370 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
              C PG+L+P K KGK++ C+ G     +KS   A AG VGMIL++   S  E    AHFL
Sbjct  398   FCTPGSLEPSKIKGKIVYCVSGFNQDVEKSWVVAQAGGVGMILSSFHTSTPE----AHFL  453

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             P + V+  DG ++  YIN T+ PVA+I+   T  G   APV+A FSS GPNAI P+ILKP
Sbjct  454   PTSVVSEHDGSSVLAYINSTKLPVAYISGA-TEFGKTVAPVMALFSSPGPNAITPEILKP  512

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             DI+APGV+++AA TEA GP+    D R + F + SGTSMSCPHV+G+  LLK+L P WSP
Sbjct  513   DITAPGVDILAANTEAKGPTSVRMDHRHLPFTILSGTSMSCPHVSGIAALLKSLRPDWSP  572

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSAIMTTA  ++N+G +I  +E   +ATPF YG+GHI P+   DPGLVYDL   DY+
Sbjct  573   AAIRSAIMTTARTKSNTGGSIL-NENLEEATPFDYGSGHIRPSHIVDPGLVYDLSSKDYL  631

Query  485   NFICAQGYNKTEITAVLGTPYKCPD-HISLSTFNYPSITVPHLKGTATVTRTLKNVGSPA  309
             NF+C+ GYN T+++  +   Y CP   ISL  FNYPSITVP+LKG  T+TRTLKNVG+P 
Sbjct  632   NFLCSIGYNNTQMSNFVDKSYNCPSAKISLLDFNYPSITVPNLKGNVTLTRTLKNVGTPG  691

Query  308   TYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHR  129
              YT  +R+P G S+ ++P  LKF KV EE+SFKVTLKAK +N +  Y FG L WSD  H 
Sbjct  692   IYTVRIRAPKGISIKIDPMSLKFNKVNEERSFKVTLKAK-KNQSQGYVFGKLVWSDGMHN  750

Query  128   VRSPIVVKAA  99
             VRSPIVVK A
Sbjct  751   VRSPIVVKKA  760



>gb|ACN85269.1| subtilisin-like protease precursor [Oryza alta]
Length=783

 Score =   392 bits (1007),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 256/372 (69%), Gaps = 6/372 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC+ G LD  K  GK++VC+RG + R +K    + AG  GMIL NDE SG+++IAD H +
Sbjct  409   LCELGALDAAKVTGKIVVCMRGGSPRVEKGEAVSRAGGAGMILVNDEASGHDVIADPHII  468

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA H+ ++DGLA+  YIN T+   A IT   T++G+KPAPV+A+FSS+GPN +NP+ILKP
Sbjct  469   PAVHINHADGLALLAYINSTKGAKAFITKAKTVVGIKPAPVMASFSSQGPNTVNPEILKP  528

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGV+VIAA+T A GP+   YD+R V+FN ++GTSMSCPHV+G+ GL+KTL+P WSP
Sbjct  529   DVAAPGVSVIAAWTGAAGPTGLPYDQRRVAFNTQTGTSMSCPHVSGIAGLIKTLHPDWSP  588

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A I+SAIMT+AT  +N  K I +      ATPF+YGAGH+ P+ A DPGLVYDL   DY+
Sbjct  589   AAIKSAIMTSATELSNEVKPILNSSLS-PATPFSYGAGHVFPHRAMDPGLVYDLTADDYL  647

Query  485   NFICAQGYNKTEITAVLGTPYKCPDH-ISLSTFNYPSITVPHL---KGTATVTRTLKNVG  318
             +F+C+ GYN T +    G PY+CPD  +    FNYPSIT   L      A   R +KNVG
Sbjct  648   SFLCSIGYNATSLALFNGAPYRCPDDPLDPLDFNYPSITAYDLAPAGPPAAARRRVKNVG  707

Query  317   SPATYTAS-VRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
              PATYTA+ VR P G  VTV P  L FE  GE ++F V    +      DYAFG + WSD
Sbjct  708   PPATYTAAVVREPEGVQVTVTPPTLTFESTGEVRTFWVKFAVRDPLPAVDYAFGAIVWSD  767

Query  140   KKHRVRSPIVVK  105
               H+VRSPIVVK
Sbjct  768   GTHQVRSPIVVK  779



>ref|XP_002530613.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF31756.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=726

 Score =   390 bits (1002),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 201/367 (55%), Positives = 240/367 (65%), Gaps = 41/367 (11%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNEIIADAHFL  1026
             LC PG+LDP+K KGK++VCLRG   R DK  QA LAGAVGMILANDE SGNEIIAD H L
Sbjct  399   LCMPGSLDPKKVKGKIVVCLRGENGRVDKGEQAFLAGAVGMILANDEKSGNEIIADPHVL  458

Query  1025  PATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPDILKP  846
             PA HV Y+DG A+F Y+N TR PVA +T   T L  KPAP +AAFSSRGPN I   ILKP
Sbjct  459   PAAHVNYTDGEAVFAYVNSTRVPVAFMTRVRTQLESKPAPFMAAFSSRGPNGIERSILKP  518

Query  845   DISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYPSWSP  666
             D++APGV++IA FT A GP++  +DKR +SFN +SGTSMSCPHV+G+ GLLKTL+P WSP
Sbjct  519   DVTAPGVSIIAGFTLAVGPTEEVFDKRRISFNSQSGTSMSCPHVSGISGLLKTLHPDWSP  578

Query  665   AEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKLTDYV  486
             A IRSA+MT+A  R N+ + + D   R KATPF YGAGH+ P+ A DPGL          
Sbjct  579   AAIRSALMTSARTRDNNMEPMLDSSNR-KATPFDYGAGHVRPDQAMDPGL----------  627

Query  485   NFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKGTATVTRTLKNVGSPAT  306
                                           T    S  V  +  T T+TR +KNVGSP  
Sbjct  628   ------------------------------TSTTLSFVVADINTTVTLTRKVKNVGSPGK  657

Query  305   YTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSDKKHRV  126
             Y A V+ PVG SV+V PK L+F+K+GEE+ FKVT K K  +   DY FG L WSD KH V
Sbjct  658   YYAHVKEPVGVSVSVKPKSLEFKKIGEEKEFKVTFKTKKASEPVDYVFGRLIWSDGKHYV  717

Query  125   RSPIVVK  105
             RSP+VVK
Sbjct  718   RSPLVVK  724



>gb|EPS60041.1| subtilase family protein, partial [Genlisea aurea]
Length=709

 Score =   389 bits (1000),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 198/343 (58%), Positives = 239/343 (70%), Gaps = 1/343 (0%)
 Frame = -3

Query  1229  AIYNSCSLLCKPGTLDPEKAKGKVLVCLRGVTARTDKSHQAALAGAVGMILANDEDSGNE  1050
              I ++ SLLCK  TLDP K KGK++VCLRG  AR +K    A AG  GMIL ND+  G+E
Sbjct  367   GINSTDSLLCKNNTLDPRKVKGKIVVCLRGDNARLEKGAVVARAGGAGMILCNDKADGSE  426

Query  1049  IIADAHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNA  870
             IIAD H LPATH+ Y+DGL +F Y+N+ R P   I+ P  ++GVKPAP +AAFSSRGPN 
Sbjct  427   IIADPHLLPATHINYTDGLKLFSYLNENRKPRGVISSPTAVVGVKPAPFMAAFSSRGPNT  486

Query  869   INPDILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLK  690
             I P ILKPDI+APGVN+IAA+TE   PS  ++D R   F  ESGTSMSCPHVAGV  LL+
Sbjct  487   ITPSILKPDITAPGVNIIAAYTENASPSGMEFDHRKTPFITESGTSMSCPHVAGVTALLR  546

Query  689   TLYPSWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVY  510
              L+P WSPA I+SAIMTTA  R N+G+A+ D  T   ATP AYGAGHI PN A DPGLVY
Sbjct  547   RLHPDWSPAAIKSAIMTTARTRDNNGRAMIDGATETGATPLAYGAGHIRPNRAMDPGLVY  606

Query  509   DLKLTDYVNFICAQGYNKTEITAVLGTPYKCPDHISLSTFNYPSITVPHLKG-TATVTRT  333
             DL   DY++F+C  GYN+T I     T Y CP   ++  FNYPSIT+P + G + TV R 
Sbjct  607   DLDSDDYLDFLCGSGYNETMIKRFSRTHYACPKEYNMLNFNYPSITIPAISGESVTVVRK  666

Query  332   LKNVGSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVT  204
             LKNVG P  Y A +R P G++  V P  L F K+GEE+SFKVT
Sbjct  667   LKNVGKPGKYGAVIRPPPGYTAKVEPDNLSFGKIGEEKSFKVT  709



>emb|CBI38460.3| unnamed protein product [Vitis vinifera]
Length=783

 Score =   391 bits (1005),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 263/373 (71%), Gaps = 8/373 (2%)
 Frame = -3

Query  1205  LCKPGTLDPEKAKGKVLVCL---RGVTA-RTDKSHQAALAGAVGMILANDEDSGNEIIAD  1038
             LC  G+LDP+K KGK++ CL    G+ A   +KS   A AG +GMILAN   +   +I  
Sbjct  409   LCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTAT-LIPQ  467

Query  1037  AHFLPATHVTYSDGLAIFDYINKTRNPVAHITHPNTLLGVKPAPVIAAFSSRGPNAINPD  858
             AHF+P + V+ +DGLAI  YI+ T+ PVA+I+   T +G   AP++A+FSS+GPN I P+
Sbjct  468   AHFVPTSRVSAADGLAILLYIHTTKYPVAYISGA-TEVGTVTAPIMASFSSQGPNTITPE  526

Query  857   ILKPDISAPGVNVIAAFTEATGPSDNDYDKRIVSFNVESGTSMSCPHVAGVVGLLKTLYP  678
             ILKPDI+APGV +IAA+TEA GP+    D R V FN+ SGTSMSCPHV+G VGLLK ++P
Sbjct  527   ILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHP  586

Query  677   SWSPAEIRSAIMTTATVRANSGKAITDDETRLKATPFAYGAGHINPNGAADPGLVYDLKL  498
             +WSP+ IRSAIMT+A  R+N  + I +  T     PF YGAGH++PN A DPGLVYDL +
Sbjct  587   NWSPSAIRSAIMTSARTRSNLRQPIANG-TLAGGNPFNYGAGHLSPNRAMDPGLVYDLTI  645

Query  497   TDYVNFICAQGYNKTEITAVLGTPYKCPDHISL-STFNYPSITVPHLKGTATVTRTLKNV  321
             TDY+NF+C+ GYN T+++  +   Y+CP   +     NYPSITVP L G  TVTRTLKNV
Sbjct  646   TDYLNFLCSIGYNATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNV  705

Query  320   GSPATYTASVRSPVGFSVTVNPKILKFEKVGEEQSFKVTLKAKGENATADYAFGVLTWSD  141
             G+PATYT  +++P G SV V PK L+FEK+ EE+ FKVT++AK ++   +Y FG L WSD
Sbjct  706   GTPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSD  765

Query  140   KKHRVRSPIVVKA  102
              KH V SPIVV A
Sbjct  766   GKHFVGSPIVVNA  778



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3607887660968