BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25942_g5_i1 len=1937 path=[2260:0-6 1482:7-30 1506:31-272
1748:273-297 36847:298-300 36850:301-308 14807:309-346 36900:347-368
36922:369-385 14883:386-423 14921:424-427 3656:428-457 36962:458-461
14957:462-481 36971:482-499 36989:500-513 32340:514-514
11246:515-517 37021:518-521 32346:522-553 37071:554-555
32379:556-556 10298:557-583 9903:584-622 9942:623-654 9974:655-683
10003:684-698 37179:699-707 15199:708-710 10030:711-810
15301:811-842 15332:843-844 4395:845-868 15357:869-1406
4471:1407-1408 7556:1409-1454 15939:1455-1481 15966:1482-1936]

Length=1937
                                                                      Score     E

ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...    179   2e-45   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...    177   7e-44   
ref|XP_006347943.1|  PREDICTED: putative late blight resistance p...    170   2e-42   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg                169   1e-40   
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...    167   4e-40   
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...    166   1e-39   
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...    166   1e-39   
emb|CDP16255.1|  unnamed protein product                                164   3e-39   
ref|NP_001234202.1|  NRC1                                               164   4e-39   
ref|XP_009625338.1|  PREDICTED: putative late blight resistance p...    156   7e-39   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...    162   1e-38   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...    161   1e-38   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2                162   3e-38   
ref|XP_009618247.1|  PREDICTED: probable disease resistance prote...    152   3e-38   
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...    160   6e-38   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...    159   1e-37   
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...    159   1e-37   
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...    159   1e-37   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...    157   6e-37   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...    156   1e-36   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...    156   2e-36   
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...    154   2e-36   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...    153   1e-35   
ref|XP_009793189.1|  PREDICTED: putative late blight resistance p...    151   6e-35   
ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...    151   9e-35   
ref|XP_009798711.1|  PREDICTED: putative late blight resistance p...    149   1e-34   
emb|CDP00590.1|  unnamed protein product                                150   2e-34   
ref|XP_009591232.1|  PREDICTED: putative late blight resistance p...    149   2e-34   
emb|CDP11831.1|  unnamed protein product                                149   2e-34   
emb|CDP11611.1|  unnamed protein product                                149   3e-34   
ref|XP_009803469.1|  PREDICTED: putative late blight resistance p...    141   4e-34   
emb|CDP16256.1|  unnamed protein product                                146   2e-33   
emb|CDP00592.1|  unnamed protein product                                147   2e-33   
ref|XP_009596917.1|  PREDICTED: disease resistance protein RPP13-...    146   2e-33   
ref|XP_009594795.1|  PREDICTED: putative late blight resistance p...    146   3e-33   
emb|CDP16841.1|  unnamed protein product                                145   5e-33   
ref|XP_004236957.1|  PREDICTED: putative late blight resistance p...    145   5e-33   
emb|CDP08032.1|  unnamed protein product                                141   6e-33   
gb|EYU24144.1|  hypothetical protein MIMGU_mgv1a001094mg                145   7e-33   
emb|CDP05558.1|  unnamed protein product                                144   1e-32   
ref|XP_009793040.1|  PREDICTED: putative late blight resistance p...    144   2e-32   
ref|XP_009604446.1|  PREDICTED: putative late blight resistance p...    142   2e-32   
emb|CDP18959.1|  unnamed protein product                                144   2e-32   
emb|CDP20211.1|  unnamed protein product                                143   2e-32   
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...    142   4e-32   
ref|XP_009792813.1|  PREDICTED: putative late blight resistance p...    138   4e-32   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...    142   5e-32   
gb|EYU22232.1|  hypothetical protein MIMGU_mgv1a002671mg                141   6e-32   
ref|XP_009757879.1|  PREDICTED: putative late blight resistance p...    141   9e-32   
ref|XP_009620237.1|  PREDICTED: putative late blight resistance p...    141   1e-31   
ref|XP_009761103.1|  PREDICTED: putative late blight resistance p...    141   1e-31   
dbj|BAD15107.1|  hypothetical protein                                   135   2e-31   Nicotiana tabacum [American tobacco]
ref|XP_009803158.1|  PREDICTED: putative late blight resistance p...    140   2e-31   
ref|XP_009778215.1|  PREDICTED: putative late blight resistance p...    139   4e-31   
ref|XP_009630452.1|  PREDICTED: putative late blight resistance p...    139   8e-31   
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...    139   9e-31   
ref|XP_004234046.1|  PREDICTED: putative late blight resistance p...    138   1e-30   
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg                137   2e-30   
ref|XP_006367931.1|  PREDICTED: putative late blight resistance p...    137   2e-30   
ref|XP_006367930.1|  PREDICTED: putative late blight resistance p...    137   3e-30   
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg                136   3e-30   
ref|XP_009596888.1|  PREDICTED: uncharacterized protein LOC104092904    130   3e-30   
ref|XP_009788462.1|  PREDICTED: putative late blight resistance p...    136   4e-30   
ref|XP_004236959.1|  PREDICTED: putative late blight resistance p...    136   5e-30   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...    136   5e-30   
ref|XP_009630520.1|  PREDICTED: putative late blight resistance p...    136   6e-30   
ref|XP_009626721.1|  PREDICTED: putative late blight resistance p...    135   7e-30   
emb|CDP00589.1|  unnamed protein product                                134   2e-29   
emb|CDP16498.1|  unnamed protein product                                133   4e-29   
ref|XP_011072177.1|  PREDICTED: disease resistance RPP8-like prot...    132   8e-29   
gb|EYU40383.1|  hypothetical protein MIMGU_mgv1a001106mg                132   1e-28   
ref|XP_009622940.1|  PREDICTED: putative late blight resistance p...    131   2e-28   
ref|XP_004236958.1|  PREDICTED: putative late blight resistance p...    130   3e-28   
emb|CDP16500.1|  unnamed protein product                                128   1e-27   
ref|XP_011071970.1|  PREDICTED: putative late blight resistance p...    127   3e-27   
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...    121   3e-27   
ref|XP_011072180.1|  PREDICTED: putative late blight resistance p...    127   3e-27   
emb|CDP08033.1|  unnamed protein product                                127   6e-27   
gb|EYU17742.1|  hypothetical protein MIMGU_mgv1a023281mg                126   6e-27   
ref|XP_009796670.1|  PREDICTED: putative late blight resistance p...    125   1e-26   
ref|XP_009796668.1|  PREDICTED: putative late blight resistance p...    125   1e-26   
ref|XP_009796671.1|  PREDICTED: putative late blight resistance p...    125   1e-26   
ref|XP_009796664.1|  PREDICTED: putative late blight resistance p...    125   1e-26   
ref|XP_009796665.1|  PREDICTED: putative late blight resistance p...    125   2e-26   
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...    125   2e-26   
emb|CDP05499.1|  unnamed protein product                                125   2e-26   
gb|EYU17689.1|  hypothetical protein MIMGU_mgv1a024130mg                124   4e-26   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...    123   8e-26   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...    123   8e-26   
ref|XP_009797674.1|  PREDICTED: putative late blight resistance p...    122   9e-26   
ref|XP_009591235.1|  PREDICTED: putative late blight resistance p...    122   1e-25   
gb|ABJ99598.1|  NBS-LRR type resistance protein                         122   1e-25   Beta vulgaris [beet]
ref|XP_009763000.1|  PREDICTED: probable disease resistance RPP8-...    122   1e-25   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...    122   2e-25   
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...    122   2e-25   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...    122   2e-25   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...    122   2e-25   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...    122   2e-25   
ref|XP_009603760.1|  PREDICTED: putative late blight resistance p...    122   2e-25   
ref|XP_009603761.1|  PREDICTED: putative late blight resistance p...    122   2e-25   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...    121   3e-25   
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...    121   4e-25   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...    121   4e-25   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...    121   4e-25   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...    120   5e-25   
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...    117   8e-25   
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...    117   9e-25   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...    120   1e-24   
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...    119   1e-24   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...    119   2e-24   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...    119   2e-24   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...    118   3e-24   
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...    118   3e-24   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...    118   4e-24   
gb|AAV31175.1|  Putative disease resistance protein, identical          118   4e-24   Solanum tuberosum [potatoes]
ref|XP_009614325.1|  PREDICTED: putative late blight resistance p...    118   4e-24   
gb|EYU23536.1|  hypothetical protein MIMGU_mgv1a001875mg                117   7e-24   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...    117   7e-24   
ref|XP_006355046.1|  PREDICTED: putative late blight resistance p...    117   8e-24   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...    117   9e-24   
gb|EYU17763.1|  hypothetical protein MIMGU_mgv1a002610mg                116   1e-23   
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...    116   1e-23   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...    117   1e-23   
ref|XP_004237189.1|  PREDICTED: putative late blight resistance p...    116   1e-23   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...    116   1e-23   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...    116   2e-23   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...    115   3e-23   
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...    115   3e-23   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...    115   4e-23   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...    115   4e-23   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...    115   4e-23   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...    114   4e-23   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...    114   5e-23   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...    115   5e-23   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...    114   5e-23   
ref|XP_011086979.1|  PREDICTED: putative late blight resistance p...    114   5e-23   
ref|XP_009601833.1|  PREDICTED: putative late blight resistance p...    114   6e-23   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...    114   6e-23   
ref|XP_009796673.1|  PREDICTED: uncharacterized protein LOC104243211    109   6e-23   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...    114   7e-23   
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...    114   9e-23   
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...    114   9e-23   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...    113   1e-22   
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...    110   2e-22   
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...    112   2e-22   
gb|EYU17764.1|  hypothetical protein MIMGU_mgv1a026345mg                112   2e-22   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...    112   3e-22   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...    112   3e-22   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...    112   3e-22   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg                112   3e-22   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...    112   3e-22   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...    111   6e-22   
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...    110   6e-22   
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...    105   6e-22   
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...    110   7e-22   
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...    110   7e-22   
gb|EYU40385.1|  hypothetical protein MIMGU_mgv1a007613mg                107   9e-22   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...    110   1e-21   
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...    110   1e-21   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...    110   1e-21   
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...    110   1e-21   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...    109   2e-21   
emb|CDP00692.1|  unnamed protein product                                109   2e-21   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...    109   2e-21   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...    108   3e-21   
gb|EYU17692.1|  hypothetical protein MIMGU_mgv1a019705mg                108   3e-21   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...    108   5e-21   
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...    107   5e-21   
emb|CDP10671.1|  unnamed protein product                                107   6e-21   
ref|XP_004243045.1|  PREDICTED: putative late blight resistance p...    106   6e-21   
emb|CDP05521.1|  unnamed protein product                                108   6e-21   
gb|EYU24408.1|  hypothetical protein MIMGU_mgv1a022062mg                107   7e-21   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...    107   9e-21   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...    107   9e-21   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...    107   9e-21   
emb|CDP00687.1|  unnamed protein product                                104   1e-20   
emb|CDP00737.1|  unnamed protein product                                107   1e-20   
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...    106   2e-20   
gb|EYU24406.1|  hypothetical protein MIMGU_mgv1a002161mg                106   2e-20   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...    106   2e-20   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...    106   2e-20   
emb|CDP00736.1|  unnamed protein product                                106   2e-20   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...    106   3e-20   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...    105   3e-20   
ref|XP_011087137.1|  PREDICTED: putative late blight resistance p...    105   3e-20   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...    105   4e-20   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...    105   4e-20   
gb|AAT40487.1|  putative disease resistance protein                     105   6e-20   Solanum demissum
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    104   8e-20   
emb|CDP21314.1|  unnamed protein product                              99.8    8e-20   
ref|XP_011087136.1|  PREDICTED: putative late blight resistance p...    103   2e-19   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...    103   2e-19   
ref|XP_009784114.1|  PREDICTED: uncharacterized protein LOC104232578  97.8    2e-19   
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  98.2    2e-19   
ref|XP_011087139.1|  PREDICTED: putative late blight resistance p...    103   3e-19   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...    102   3e-19   
emb|CDP05514.1|  unnamed protein product                                102   3e-19   
gb|EYU17740.1|  hypothetical protein MIMGU_mgv1a018663mg                102   3e-19   
gb|ABJ99601.1|  NBS-LRR type resistance protein                         102   4e-19   Beta vulgaris [beet]
emb|CDP00690.1|  unnamed protein product                                101   4e-19   
gb|AAT39951.2|  Disease resistance protein, putative                    102   4e-19   Solanum demissum
gb|EYU22216.1|  hypothetical protein MIMGU_mgv1a019937mg                102   4e-19   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  96.7    4e-19   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg                102   5e-19   
emb|CDP10323.1|  unnamed protein product                                101   5e-19   
ref|XP_011076796.1|  PREDICTED: putative late blight resistance p...    101   5e-19   
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...    101   6e-19   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...    101   6e-19   
ref|XP_009601897.1|  PREDICTED: putative late blight resistance p...    101   6e-19   
gb|EYU23555.1|  hypothetical protein MIMGU_mgv1a020380mg                101   6e-19   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...    101   7e-19   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...    100   1e-18   
gb|EYU17690.1|  hypothetical protein MIMGU_mgv1a023002mg                100   1e-18   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...    100   1e-18   
gb|EYU19283.1|  hypothetical protein MIMGU_mgv1a026559mg                100   1e-18   
gb|EYU17782.1|  hypothetical protein MIMGU_mgv1a0218242mg               100   1e-18   
ref|XP_009620169.1|  PREDICTED: disease resistance protein RPP13-...    100   2e-18   
gb|AET22504.1|  hypothetical protein                                    100   2e-18   
ref|XP_009620170.1|  PREDICTED: putative late blight resistance p...  99.4    2e-18   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  99.8    2e-18   
emb|CDP15268.1|  unnamed protein product                                100   3e-18   
ref|XP_009761713.1|  PREDICTED: putative late blight resistance p...  96.3    3e-18   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  99.4    3e-18   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  99.4    3e-18   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  99.4    3e-18   
emb|CDP08019.1|  unnamed protein product                              99.8    4e-18   
ref|XP_006350238.1|  PREDICTED: putative late blight resistance p...  99.0    4e-18   
emb|CDP17920.1|  unnamed protein product                              99.4    4e-18   
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...  98.6    5e-18   
emb|CDP16510.1|  unnamed protein product                              99.0    5e-18   
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...  98.6    5e-18   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...  98.6    6e-18   
emb|CDP11163.1|  unnamed protein product                              99.0    6e-18   
emb|CDP11161.1|  unnamed protein product                              98.6    6e-18   
emb|CDP11825.1|  unnamed protein product                              98.6    7e-18   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...  98.2    8e-18   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  98.2    8e-18   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  98.2    9e-18   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  97.4    1e-17   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  98.2    1e-17   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  97.8    1e-17   
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...  97.4    1e-17   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...  97.4    1e-17   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  97.1    2e-17   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg              97.1    2e-17   
emb|CDP08021.1|  unnamed protein product                              97.1    2e-17   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  97.1    2e-17   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  96.7    2e-17   
gb|EYU23525.1|  hypothetical protein MIMGU_mgv1a018698mg              96.7    2e-17   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  96.7    2e-17   
emb|CDP00691.1|  unnamed protein product                              96.3    2e-17   
gb|EYU17759.1|  hypothetical protein MIMGU_mgv1a001467mg              96.7    2e-17   
gb|EYU22116.1|  hypothetical protein MIMGU_mgv1a009581mg              93.6    2e-17   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...  96.7    3e-17   
ref|XP_009779606.1|  PREDICTED: putative late blight resistance p...  96.7    3e-17   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  96.7    3e-17   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  96.3    3e-17   
ref|XP_009599401.1|  PREDICTED: putative late blight resistance p...  92.4    3e-17   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  96.3    3e-17   
emb|CDP19132.1|  unnamed protein product                              96.3    4e-17   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  95.9    4e-17   
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...  95.9    4e-17   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  95.9    4e-17   
ref|XP_010319429.1|  PREDICTED: putative late blight resistance p...  95.9    4e-17   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  95.9    5e-17   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  95.9    5e-17   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  95.9    5e-17   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  95.9    5e-17   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  95.5    5e-17   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  95.5    5e-17   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  95.5    5e-17   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  95.5    5e-17   
emb|CDP04880.1|  unnamed protein product                              95.5    6e-17   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  95.5    6e-17   
gb|EYU23535.1|  hypothetical protein MIMGU_mgv1a024600mg              95.5    6e-17   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  95.5    6e-17   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  95.5    6e-17   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  95.1    7e-17   
gb|KDO38582.1|  hypothetical protein CISIN_1g036414mg                 91.3    8e-17   
gb|KDO44317.1|  hypothetical protein CISIN_1g044637mg                 92.4    8e-17   
gb|EYU23544.1|  hypothetical protein MIMGU_mgv1a019656mg              94.7    9e-17   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  94.7    1e-16   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2              94.7    1e-16   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...  94.4    1e-16   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  94.4    1e-16   
ref|XP_006471178.1|  PREDICTED: probable disease resistance prote...  90.5    1e-16   
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  94.7    1e-16   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg              94.0    1e-16   
ref|XP_009784309.1|  PREDICTED: putative late blight resistance p...  91.3    1e-16   
emb|CDP20153.1|  unnamed protein product                              94.4    2e-16   
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg              94.0    2e-16   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...  93.6    2e-16   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  94.0    2e-16   
gb|EYU17691.1|  hypothetical protein MIMGU_mgv1a025613mg              93.6    2e-16   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  93.6    2e-16   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  93.6    2e-16   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  93.6    2e-16   
ref|XP_006493837.1|  PREDICTED: disease resistance protein RPH8A-...  89.7    2e-16   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg              93.2    2e-16   
ref|XP_009782925.1|  PREDICTED: putative late blight resistance p...  93.2    2e-16   
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg              93.2    3e-16   
emb|CDP08024.1|  unnamed protein product                              92.8    3e-16   
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg              92.8    3e-16   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  92.8    4e-16   
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...  92.8    4e-16   
gb|KDO38403.1|  hypothetical protein CISIN_1g039403mg                 89.0    4e-16   
gb|EYU17780.1|  hypothetical protein MIMGU_mgv11b023716mg             91.7    4e-16   
ref|XP_009791923.1|  PREDICTED: putative late blight resistance p...  92.4    4e-16   
ref|XP_006365952.1|  PREDICTED: putative late blight resistance p...  88.2    5e-16   
emb|CDP04724.1|  unnamed protein product                              91.7    5e-16   
ref|XP_006495296.1|  PREDICTED: probable disease resistance prote...  92.0    5e-16   
gb|KDO63081.1|  hypothetical protein CISIN_1g037018mg                 91.7    6e-16   
gb|EYU22169.1|  hypothetical protein MIMGU_mgv1a001998mg              92.0    6e-16   
gb|EYU38159.1|  hypothetical protein MIMGU_mgv1a025995mg              92.0    6e-16   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  92.0    6e-16   
emb|CDP13141.1|  unnamed protein product                              91.7    6e-16   
ref|XP_009618258.1|  PREDICTED: late blight resistance protein R1...  92.4    7e-16   
gb|EYU23566.1|  hypothetical protein MIMGU_mgv1a020047mg              91.7    7e-16   
emb|CDP11157.1|  unnamed protein product                              91.7    8e-16   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...  92.0    9e-16   
emb|CDP10810.1|  unnamed protein product                              91.7    1e-15   
emb|CDP11186.1|  unnamed protein product                              91.7    1e-15   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...  92.0    1e-15   
ref|XP_006471228.1|  PREDICTED: probable disease resistance prote...  87.4    1e-15   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg              91.3    1e-15   
gb|AAV31174.1|  Putative disease resistance protein, identical        90.5    1e-15   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  91.3    1e-15   
emb|CDP08023.1|  unnamed protein product                              91.7    1e-15   
ref|XP_006471237.1|  PREDICTED: probable disease resistance prote...  91.3    1e-15   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  91.3    1e-15   
ref|XP_006471232.1|  PREDICTED: disease resistance protein RPP8-like  88.6    1e-15   
gb|KDO40277.1|  hypothetical protein CISIN_1g047959mg                 90.1    1e-15   
gb|EYU17781.1|  hypothetical protein MIMGU_mgv1a023021mg              90.9    1e-15   
gb|KDO59924.1|  hypothetical protein CISIN_1g035853mg                 90.5    1e-15   
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...  91.3    2e-15   
ref|XP_006464900.1|  PREDICTED: probable disease resistance prote...  90.5    2e-15   
ref|XP_006471233.1|  PREDICTED: probable disease resistance prote...  90.9    2e-15   
emb|CDP08038.1|  unnamed protein product                              90.9    2e-15   
emb|CDP08020.1|  unnamed protein product                              90.9    2e-15   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  90.5    2e-15   
ref|XP_006471236.1|  PREDICTED: probable disease resistance prote...  90.5    2e-15   
ref|XP_009616094.1|  PREDICTED: putative late blight resistance p...  90.5    2e-15   
gb|KDO45868.1|  hypothetical protein CISIN_1g003154mg                 90.1    2e-15   
ref|XP_006464846.1|  PREDICTED: disease resistance protein RPP13-...  90.1    2e-15   
ref|XP_009616093.1|  PREDICTED: putative late blight resistance p...  90.5    2e-15   
emb|CDP05441.1|  unnamed protein product                              90.1    2e-15   
emb|CDP10805.1|  unnamed protein product                              90.5    3e-15   
gb|EYU23615.1|  hypothetical protein MIMGU_mgv1a019724mg              89.7    3e-15   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  90.1    3e-15   
emb|CDP11160.1|  unnamed protein product                              90.1    3e-15   
ref|XP_006366075.1|  PREDICTED: putative late blight resistance p...  89.7    3e-15   
emb|CDP04878.1|  unnamed protein product                              90.1    3e-15   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg              89.7    3e-15   
gb|AEW48212.1|  disease resistance protein RGH1                       89.7    3e-15   
gb|AEW48205.1|  disease resistance protein RGH2                       89.7    3e-15   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...  89.7    4e-15   
emb|CDP21728.1|  unnamed protein product                              89.4    4e-15   
ref|XP_011072179.1|  PREDICTED: putative late blight resistance p...  89.4    4e-15   
ref|XP_009616092.1|  PREDICTED: putative late blight resistance p...  89.7    4e-15   
ref|XP_011084823.1|  PREDICTED: putative late blight resistance p...  89.0    4e-15   
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  89.7    4e-15   
emb|CDP15579.1|  unnamed protein product                              89.7    4e-15   
gb|AAF76163.1|AF266747_1  RGC1                                        89.4    5e-15   
ref|XP_009764457.1|  PREDICTED: putative late blight resistance p...  88.2    5e-15   
gb|EYU22054.1|  hypothetical protein MIMGU_mgv1a022312mg              89.4    5e-15   
ref|XP_009785700.1|  PREDICTED: putative late blight resistance p...  87.8    5e-15   
gb|EYU19336.1|  hypothetical protein MIMGU_mgv1a023337mg              89.0    5e-15   
ref|XP_009625968.1|  PREDICTED: putative late blight resistance p...  87.0    5e-15   
ref|XP_006471220.1|  PREDICTED: probable disease resistance prote...  85.5    6e-15   
emb|CDP10797.1|  unnamed protein product                              89.0    6e-15   
gb|ABY61745.1|  resistance protein PSH-RGH6                           89.0    6e-15   
gb|KDP30596.1|  hypothetical protein JCGZ_16249                       89.0    6e-15   
ref|XP_006471227.1|  PREDICTED: disease resistance RPP8-like prot...  88.6    7e-15   
gb|AEW48198.1|  disease resistance protein RGH4                       88.6    7e-15   
ref|XP_006471223.1|  PREDICTED: probable disease resistance RPP8-...  88.6    9e-15   
ref|XP_009778434.1|  PREDICTED: putative late blight resistance p...  88.6    9e-15   
emb|CDP13440.1|  unnamed protein product                              88.2    9e-15   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              88.2    9e-15   
emb|CDP11830.1|  unnamed protein product                              88.2    9e-15   
ref|XP_006471238.1|  PREDICTED: disease resistance protein RPP8-l...  88.2    1e-14   
gb|EYU17693.1|  hypothetical protein MIMGU_mgv1a001245mg              88.2    1e-14   
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...  88.2    1e-14   
ref|XP_006356446.1|  PREDICTED: putative late blight resistance p...  88.6    1e-14   
ref|XP_006471222.1|  PREDICTED: disease resistance RPP8-like prot...  88.2    1e-14   
ref|XP_006365690.1|  PREDICTED: putative late blight resistance p...  87.4    1e-14   
gb|AAV88066.1|  NBS-LRR protein                                       88.2    1e-14   
gb|EYU24323.1|  hypothetical protein MIMGU_mgv1a020732mg              88.2    1e-14   
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...  88.2    1e-14   
ref|XP_009589795.1|  PREDICTED: putative late blight resistance p...  88.2    1e-14   
ref|XP_006346788.1|  PREDICTED: putative late blight resistance p...  87.8    1e-14   
ref|XP_006471226.1|  PREDICTED: probable disease resistance RPP8-...  87.8    1e-14   
emb|CDP10800.1|  unnamed protein product                              88.2    1e-14   
emb|CDP08040.1|  unnamed protein product                              87.0    1e-14   
gb|KDO35880.1|  hypothetical protein CISIN_1g010381mg                 87.0    1e-14   
gb|KDO62564.1|  hypothetical protein CISIN_1g003387mg                 87.8    1e-14   
gb|EPS69440.1|  hypothetical protein M569_05326                       86.3    1e-14   
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  88.2    1e-14   
emb|CDP10807.1|  unnamed protein product                              87.8    1e-14   
emb|CDP21300.1|  unnamed protein product                              87.8    2e-14   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg              87.4    2e-14   
ref|XP_009604649.1|  PREDICTED: putative late blight resistance p...  87.0    2e-14   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg              87.4    2e-14   
emb|CDP11829.1|  unnamed protein product                              87.4    2e-14   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  87.0    2e-14   
ref|XP_009609967.1|  PREDICTED: late blight resistance protein R1...  85.9    2e-14   
ref|XP_009604667.1|  PREDICTED: putative late blight resistance p...  86.7    2e-14   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  87.0    2e-14   
gb|EYU24400.1|  hypothetical protein MIMGU_mgv1a026464mg              86.7    2e-14   
emb|CDP11642.1|  unnamed protein product                              87.4    3e-14   
emb|CDP19728.1|  unnamed protein product                              87.0    3e-14   
gb|KDO41692.1|  hypothetical protein CISIN_1g048418mg                 86.7    3e-14   
ref|XP_009783489.1|  PREDICTED: putative late blight resistance p...  86.3    3e-14   
gb|AEW48197.1|  disease resistance protein RGH3                       86.7    4e-14   
emb|CDP16512.1|  unnamed protein product                              86.3    4e-14   
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...  86.7    4e-14   
gb|EYU22052.1|  hypothetical protein MIMGU_mgv1a023195mg              86.3    4e-14   
gb|KDO41694.1|  hypothetical protein CISIN_1g003401mg                 86.3    4e-14   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  86.3    4e-14   
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...  86.3    5e-14   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...  86.3    5e-14   
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...  85.9    5e-14   
ref|XP_011101277.1|  PREDICTED: putative late blight resistance p...  85.9    5e-14   
gb|KDO62578.1|  hypothetical protein CISIN_1g041317mg                 84.7    5e-14   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  85.9    6e-14   
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...  85.9    6e-14   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  86.3    6e-14   
emb|CDP10799.1|  unnamed protein product                              85.5    6e-14   
emb|CDP21316.1|  unnamed protein product                              81.3    6e-14   
ref|XP_009765786.1|  PREDICTED: putative late blight resistance p...  85.1    8e-14   
emb|CDP10296.1|  unnamed protein product                              85.5    9e-14   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg              85.1    1e-13   
gb|EYU43578.1|  hypothetical protein MIMGU_mgv1a025232mg              84.7    1e-13   
ref|XP_011084836.1|  PREDICTED: putative late blight resistance p...  84.0    1e-13   
emb|CDP11974.1|  unnamed protein product                              85.1    1e-13   
gb|EYU21837.1|  hypothetical protein MIMGU_mgv1a021514mg              84.3    1e-13   
gb|EYU21829.1|  hypothetical protein MIMGU_mgv1a001470mg              84.7    1e-13   
gb|EYU21838.1|  hypothetical protein MIMGU_mgv1a001107mg              84.3    2e-13   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg              84.3    2e-13   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...  84.3    2e-13   
emb|CDP15122.1|  unnamed protein product                              84.3    2e-13   
gb|EYU17739.1|  hypothetical protein MIMGU_mgv1a023631mg              84.0    2e-13   
gb|EYU23607.1|  hypothetical protein MIMGU_mgv1a019784mg              84.0    2e-13   
gb|AEW48216.1|  disease resistance protein RX3                        84.0    2e-13   
emb|CDP15990.1|  unnamed protein product                              84.0    2e-13   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              84.0    2e-13   
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg              84.0    2e-13   
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...  83.6    2e-13   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...  84.0    3e-13   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  83.6    3e-13   
ref|XP_006345615.1|  PREDICTED: putative late blight resistance p...  79.7    3e-13   
emb|CDP04885.1|  unnamed protein product                              83.6    3e-13   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...  84.0    3e-13   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...  84.0    3e-13   
ref|XP_006471229.1|  PREDICTED: disease resistance RPP8-like prot...  83.6    3e-13   
gb|AEW48209.1|  disease resistance protein RGH5                       83.6    3e-13   
ref|XP_011072134.1|  PREDICTED: putative late blight resistance p...  83.6    3e-13   
ref|XP_009614428.1|  PREDICTED: putative late blight resistance p...  83.2    4e-13   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...  82.8    4e-13   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  82.8    5e-13   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...  82.8    5e-13   
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...  83.2    5e-13   
ref|XP_009624584.1|  PREDICTED: putative late blight resistance p...  82.4    5e-13   
ref|XP_009774297.1|  PREDICTED: putative late blight resistance p...  82.4    6e-13   
ref|XP_006355211.1|  PREDICTED: putative late blight resistance p...  81.6    6e-13   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...  82.4    6e-13   
gb|AEW48218.1|  disease resistance protein RX6                        82.4    6e-13   
emb|CDP11649.1|  unnamed protein product                              82.8    6e-13   
gb|EYU22214.1|  hypothetical protein MIMGU_mgv1a001216mg              82.4    7e-13   
ref|XP_004251533.1|  PREDICTED: putative late blight resistance p...  82.4    7e-13   
gb|KDO37194.1|  hypothetical protein CISIN_1g045113mg                 82.4    7e-13   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              82.4    7e-13   
gb|EYU43101.1|  hypothetical protein MIMGU_mgv1a017964mg              82.0    7e-13   
gb|AAF76312.1|AF220603_4  Prf                                         82.8    7e-13   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...  82.0    7e-13   
emb|CAB50786.1|  Rx protein                                           82.4    7e-13   
gb|EYU22057.1|  hypothetical protein MIMGU_mgv1a022563mg              82.0    8e-13   
emb|CDP05538.1|  unnamed protein product                              82.4    8e-13   
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...  82.4    9e-13   
gb|AEW48217.1|  disease resistance protein RX5                        82.0    9e-13   
ref|XP_009603189.1|  PREDICTED: uncharacterized protein LOC104098223  79.3    1e-12   
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...  82.0    1e-12   
ref|XP_009799406.1|  PREDICTED: putative late blight resistance p...  81.3    1e-12   
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...  82.0    1e-12   
ref|XP_009799404.1|  PREDICTED: putative late blight resistance p...  81.6    1e-12   
gb|AEW48190.1|  disease resistance protein RX4                        81.6    1e-12   
gb|AAC49408.1|  PRF                                                   82.0    1e-12   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg              81.6    1e-12   
gb|AAF76308.1|  Prf                                                   82.0    1e-12   
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  81.6    1e-12   
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg              81.6    1e-12   
gb|AEW48215.1|  disease resistance protein RGH7                       81.6    1e-12   
emb|CAB56299.1|  NBS-LRR protein                                      81.3    1e-12   
emb|CDP12797.1|  unnamed protein product                              81.6    1e-12   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...  81.3    1e-12   
ref|XP_009800168.1|  PREDICTED: putative late blight resistance p...  80.9    1e-12   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...  81.3    1e-12   
gb|AEW48201.1|  disease resistance protein RGH9                       81.3    2e-12   
ref|XP_009763120.1|  PREDICTED: putative late blight resistance p...  80.9    2e-12   
ref|XP_009763119.1|  PREDICTED: putative late blight resistance p...  80.9    2e-12   
gb|EYU29512.1|  hypothetical protein MIMGU_mgv1a022452mg              80.9    2e-12   



>ref|XP_009778116.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=490

 Score =   179 bits (453),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 159/263 (60%), Gaps = 14/263 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNI--C--TLCTISPASCTSEIFNKTP  170
            I   IWNM +LRH+HTNTS +LP+     SS+ T++  C  TL TI+P SCT E+F++ P
Sbjct  231  IQADIWNMPRLRHLHTNTSAKLPTPVAPKSSKVTSVNQCLQTLSTIAPESCTEEVFSRAP  290

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL--HGNSEKVELKVTVFDKFLR  344
             L+KLG+RG +  L    K +  L NN++ L+CL+NLKL   G S K +L++     F  
Sbjct  291  NLKKLGIRGKIFMLLEPNKSE--LFNNVKKLQCLENLKLINVGQSGK-QLRLPPTYIFPT  347

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             LRKLTL  T  +WDDM+VLG LE LEVLKL DNAF G+ W+      F+ L  L + + 
Sbjct  348  NLRKLTLLDTWLEWDDMSVLGQLEYLEVLKLKDNAFKGEYWEPKVGG-FRSLLVLWIERS  406

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L +W A  S   FP L+ L+L +C  L+ +P   A++  L+VMEL N  ++ ++ AR+I
Sbjct  407  DLASWNA--SSDHFPRLKRLVLVSCDKLEEVPIGLADICGLQVMELRNSTKQTANSARDI  464

Query  705  CVKRHGKTN--VKINAFNVFITP  767
              K+  +T    K   F + I P
Sbjct  465  QAKKDKQTQEGAKTQRFKLSIFP  487



>ref|XP_006347944.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006347945.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347946.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X3 [Solanum tuberosum]
Length=703

 Score =   177 bits (448),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 162/261 (62%), Gaps = 12/261 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT----NICTLCTISPASCTSEIFNKTP  170
            I   I NM +LRH+HTNTS +LP+     +S+ T    ++ TL TI+P SCT  + ++ P
Sbjct  440  IQADILNMPRLRHLHTNTSAKLPTPANPRTSKTTLVNQSLQTLSTIAPESCTEYVLSRAP  499

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL--HGNSEKVELKVTVFDKFLR  344
            KL+KLG+RG +++L LE    V L NN++ML+CL+NLKL   G +++ +L++     F  
Sbjct  500  KLKKLGIRGKIAKL-LEPSLPV-LFNNVKMLQCLENLKLINVGQTDQTQLRLPPASLFPT  557

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LR+LTLS T  +WDDM+VL  LE L VLKL DNAF G+ W+LN D  F  L+ L + + 
Sbjct  558  KLRRLTLSDTWLEWDDMSVLKQLEYLLVLKLKDNAFKGEHWELN-DGGFPFLEVLCIERA  616

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL++W A  S   FP L+ L + +C  L+ IP   A++ +L+VM+L N  +  +  AREI
Sbjct  617  NLVSWNA--SGDHFPRLKHLHI-SCDKLEKIPIGLADIRSLQVMDLQNSTKSAAKSAREI  673

Query  705  CVKRHGKTNVKINAFNVFITP  767
              K++     K   F + + P
Sbjct  674  QAKKNKLQTAKSQKFELSVFP  694



>ref|XP_006347943.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=491

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/261 (40%), Positives = 161/261 (62%), Gaps = 12/261 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT----NICTLCTISPASCTSEIFNKTP  170
            I   I NM +LRH+HTNTS +LP+     +S+ T    ++ TL TI+P SCT  + ++ P
Sbjct  228  IQADILNMPRLRHLHTNTSAKLPTPANPKTSKTTLVNQSLQTLSTIAPESCTEYVLSRAP  287

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL--HGNSEKVELKVTVFDKFLR  344
             L+KLG+RG +++L +E  + + L NN++ L+ L+NLKL   G +++ +L++     F  
Sbjct  288  NLKKLGIRGKIAKL-MEPSRSI-LFNNVKRLQFLENLKLINVGQTDQTQLRLPPASLFPT  345

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LR+LTLS T  +WDDM+VL  LE L+VLKL DNAF G+ W+LN D  F  L+ L + + 
Sbjct  346  KLRRLTLSDTWLEWDDMSVLKQLEYLQVLKLKDNAFKGEHWELN-DGGFPFLEVLCIERA  404

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL++W A  S   FP L+ L + +C  L+ IP   A++ +L+VM+L N  +  +  AREI
Sbjct  405  NLVSWNA--SGDHFPRLKHLHI-SCDKLEKIPIGLADIRSLQVMDLQNSTKSAAKSAREI  461

Query  705  CVKRHGKTNVKINAFNVFITP  767
              K++     K   F + + P
Sbjct  462  QAKKNKLQTAKSQKFELSVFP  482



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score =   169 bits (428),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 153/272 (56%), Gaps = 22/272 (8%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTN--------ICTLCTISPASCTSEIF  158
            I   IW M +LRHV TN S  LP   P + SR +         + TL T+SP SCT E+F
Sbjct  624  IKADIWKMIQLRHVKTNASTVLPG--PLSRSRKSKDEVLMSGTLQTLSTVSPESCTEEVF  681

Query  159  NKTPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN------SEKVELKV  320
             + P L+ LG+RG L +L LE K    L ++L  L  L+NLKL  +      SE    ++
Sbjct  682  ARAPNLKVLGIRGQLGKL-LEIKNGSMLFDSLGRLSHLENLKLINDVFPRPPSEGSLSRL  740

Query  321  TVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGL  500
                KF   LRKLTLS TL +W DM+ LG LE LEVLKL DNAF G+ W    D  F+GL
Sbjct  741  PHPYKFPPNLRKLTLSDTLLEWKDMSTLGMLENLEVLKLKDNAFKGEWWK-TEDGGFRGL  799

Query  501  KYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCER  680
            + L +G+ NL+TW  V S   FP L  L L++C  L ++P  F +V  L+V+++Y   E 
Sbjct  800  RVLHIGRTNLVTWN-VASGNHFPRLRHLFLKHCGYLASLPLVFGDVVCLQVVDIYCTNES  858

Query  681  VSDFAREICVKR---HGKTNVKINAFNVFITP  767
            V+  AR+I  ++    GK + + N F + + P
Sbjct  859  VAASARKIEGRKMELQGKQSGRGNGFKLSVYP  890



>ref|XP_009774012.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=887

 Score =   167 bits (423),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 153/253 (60%), Gaps = 13/253 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTN--ICTLCTISPASCTSEIFNKTPKL  176
            I   IWNM +LRHV TN S  LPS     S +G N  + TL TI+P  CT+EIF +TP L
Sbjct  623  IKADIWNMTRLRHVCTNASAILPSPKHPKSRKGVNHYLQTLSTIAPECCTAEIFTRTPNL  682

Query  177  QKLGVRGNLSELFLETK--QKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL--R  344
            +KLGVRG ++ L   +K      L +N+  L+CL+NLKL  ++ + + ++ +   ++  +
Sbjct  683  KKLGVRGKIAALLEASKGGSGSGLFSNIGKLECLENLKLVNDTRQSDKQLHLPPAYIFPQ  742

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +L+KLTL  T  +W DM++LG LE LEVLKL +NAF G+ W+ + D  F  L+ L + + 
Sbjct  743  KLKKLTLIDTWLKWKDMSILGLLEYLEVLKLKENAFRGQSWEPD-DGGFPRLQVLWIQRT  801

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L +W A  S  +FP L+ L+L +C  L+ +P   A+V +L++MEL+   E  +  AR I
Sbjct  802  DLSSWKA--SSLNFPQLKRLVLISCDKLEELPAALADVQSLQLMELHYTSESAAKSARAI  859

Query  705  CVKR----HGKTN  731
              KR     G TN
Sbjct  860  LKKRLRKEEGSTN  872



>ref|XP_006359790.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=886

 Score =   166 bits (419),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/263 (41%), Positives = 156/263 (59%), Gaps = 14/263 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSS-PPKNSSR---GTNICTLCTISPASCTSEIFNKTP  170
            I   IWNME+LRH+HTN+S +LP    PKNS       ++ TL TI+P SCT E+F +TP
Sbjct  627  IQANIWNMERLRHLHTNSSAKLPVPVAPKNSKVTLVNQSLQTLSTIAPESCTEEVFARTP  686

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNS--EKVELKVTVFDKFLR  344
             L+KLG+RG ++ L L+ K  V L  N++ L+ L+NLKL  +S  +  +L++     F  
Sbjct  687  NLKKLGIRGKIAVL-LDNKSAVSL-KNVKRLEYLENLKLINDSSIQTGKLRLPPAYIFPT  744

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKLTL  T  +W DM++LG LE LEVLK+ +N F+G+ W+      F  L  L + + 
Sbjct  745  KLRKLTLLDTWLEWKDMSILGQLEHLEVLKMKENGFTGESWESTGG--FCSLLVLWIERT  802

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL+TW A   D  FP L+ L+L  C  L+ +P   A++ + +VM L N  +  +  AR+I
Sbjct  803  NLVTWKASADD--FPRLKHLVLICCDYLKEVPIALADIRSFQVMMLQNSTKTAAISARQI  860

Query  705  CVKRHGKTN--VKINAFNVFITP  767
              K+  +T    K  AF + I P
Sbjct  861  QAKKDNQTQQGTKNIAFKLSIFP  883



>ref|XP_004248798.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=885

 Score =   166 bits (419),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 157/263 (60%), Gaps = 14/263 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSS-PPKNSSR---GTNICTLCTISPASCTSEIFNKTP  170
            I   IWNME+LRH+HTN+S +LP    PKNS       ++ TL TI+P SCT E+F +TP
Sbjct  626  IQANIWNMERLRHLHTNSSAKLPVPVAPKNSKVTLVNQSLQTLSTIAPESCTEEVFARTP  685

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNS--EKVELKVTVFDKFLR  344
             L+KLG+RG +S L L+ K    L  N++ L+ L+NLKL  +S  +  +L++     F  
Sbjct  686  NLKKLGIRGKISVL-LDNKSAASL-KNVKRLEYLENLKLINDSSIQTSKLRLPPAYIFPT  743

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKLTL  T  +W DM++LG LE LEVLK+ +N FSG+ W+  S   F  L  L + + 
Sbjct  744  KLRKLTLLDTWLEWKDMSILGQLEHLEVLKMKENGFSGESWE--STGGFCSLLVLWIERT  801

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL++W A   D  FP L+ L+L  C +L+ +P   A++ + +VM L N  +  +  AR+I
Sbjct  802  NLVSWKASADD--FPRLKHLVLICCDNLKEVPIALADIRSFQVMMLQNSTKTAAISARQI  859

Query  705  CVKRHGKTN--VKINAFNVFITP  767
              K+  +T    K  AF + I P
Sbjct  860  QAKKDNQTQQGTKNIAFKLSIFP  882



>emb|CDP16255.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   164 bits (416),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 151/263 (57%), Gaps = 12/263 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPS-SPPKN---SSRGTNICTLCTISPASCTSEIFNKTP  170
            I   IW M +LRH+HTN S  LP  + PK    +S   N+ TL +ISP SCT E+F + P
Sbjct  626  IKSDIWKMPQLRHLHTNASTSLPCPTTPKGKEEASVNANLQTLSSISPKSCTKELFERAP  685

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVEL-KVTVFDKFLRR  347
            KL+KL + G L+ + +E   +  L  +L  L+ L+NLKL        L ++   + F R+
Sbjct  686  KLKKLAICGRLA-ILIEANGQSRLFESLCTLQFLENLKLLNEDVSSPLNRLPQENNFPRK  744

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            L KLTLS T   W+ M+VLG LE LEVLKL DNAF G  W   S   F+ L++L +G  +
Sbjct  745  LTKLTLSKTFLPWNQMSVLGKLENLEVLKLKDNAFKGNRWRTESGG-FQSLQFLHIGSTD  803

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREIC  707
            L+ W A  ++   P L+ L+L++C  LQ +P  FA++  L++++L+     V+  A +I 
Sbjct  804  LVIWDA--AENHLPKLKCLVLKHCTELQGVPHSFADISTLQIIDLHCTNHSVAASAMKIY  861

Query  708  V---KRHGKTNVKINAFNVFITP  767
            V   ++  +   K N F +F+ P
Sbjct  862  VLKLEQAQQKATKSNRFKLFVYP  884



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score =   164 bits (415),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 159/261 (61%), Gaps = 12/261 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT----NICTLCTISPASCTSEIFNKTP  170
            I   I NM +LRH+ TNTS +LP+     +S+ T    ++ TL TI+P SCT  + ++ P
Sbjct  625  IQADILNMPRLRHLLTNTSAKLPALANPKTSKTTLVNQSLQTLSTIAPESCTEYVLSRAP  684

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL--HGNSEKVELKVTVFDKFLR  344
             L+KLG+RG +++L +E  Q V L+NN++ L+ L+NLKL   G  ++ +L++     F  
Sbjct  685  NLKKLGIRGKIAKL-MEPSQSV-LLNNVKRLQFLENLKLINVGQIDQTQLRLPPASIFPT  742

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKLTL  T  +WDDM+VL  LE L+VLKL DNAF G+ W+LN D  F  L+ L + + 
Sbjct  743  KLRKLTLLDTWLEWDDMSVLKQLENLQVLKLKDNAFKGENWELN-DGGFPFLQVLCIERA  801

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL++W A  S   FP L+ L + +C  L+ IP   A++ +L+VM+L N  +  +  AREI
Sbjct  802  NLVSWNA--SGDHFPRLKHLHI-SCDKLEKIPIGLADICSLQVMDLRNSTKSAAKSAREI  858

Query  705  CVKRHGKTNVKINAFNVFITP  767
              K++     K   F + + P
Sbjct  859  QAKKNKLQPAKSQKFELSVFP  879



>ref|XP_009625338.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=337

 Score =   156 bits (394),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 155/264 (59%), Gaps = 16/264 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRG--TNIC--TLCTISPASCTSEIFNKTP  170
            I   IWNM +LRHV TN S  LPS     SS+    N C  TL T +P  CT+E+F +TP
Sbjct  76   IKADIWNMTRLRHVCTNASATLPSPKRPKSSKDNLVNRCLQTLSTKAPECCTAEVFTRTP  135

Query  171  KLQKLGVRGNLSELFLETKQ---KVCLINNLQMLKCLKNLKLHGNSEKV--ELKVTVFDK  335
             L+KLGVRG L+ L LET +      L +N+  L CL+ LKL  ++ +   +L +     
Sbjct  136  NLKKLGVRGKLNAL-LETSKDGSSSGLFSNIGKLDCLEKLKLVNDTRQSSKQLHLPPAYI  194

Query  336  FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRM  515
            F ++L+KLTL  T F+W DM++LG L+ LEVLKL +NAF+G+ W+   +  F  L+ L +
Sbjct  195  FPQKLKKLTLIDTWFEWKDMSILGLLDYLEVLKLKENAFTGQSWE-PEEGGFPRLQVLWI  253

Query  516  GKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFA  695
             + +L +W +  S  +FP L+ L+L  C +L+ +P + A+V+NL++MEL +     +  A
Sbjct  254  ERTDLSSWKS--SCGNFPRLKRLVLIACDNLKELPAELADVENLQLMELQSTSVSAAKSA  311

Query  696  REICVKRHGKTNVKINAFNVFITP  767
            R I  K+  K     + F + + P
Sbjct  312  RAILKKKQEKEG---SGFKLSVIP  332



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score =   162 bits (411),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 147/252 (58%), Gaps = 20/252 (8%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--------NICTLCTISPASCTSEIF  158
            I   IW M +LRH+ TN S  LP   P + SR +        ++ TL T+SP SCT ++F
Sbjct  624  IKADIWKMIQLRHLKTNASTALPG--PLSKSRKSKDDALMIGSLQTLSTVSPESCTEDVF  681

Query  159  NKTPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN------SEKVELKV  320
             + P L+ LG+RG L++L LE K    L ++L  L  L+NLKL  +      SE     +
Sbjct  682  ARAPNLKVLGIRGQLAKL-LENKSGSMLFDSLGKLSHLENLKLLNDVFPRPPSEGKLTNL  740

Query  321  TVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGL  500
                KF  +L+KLTLS TL  W+DM+ LG LE LE+LKL DNAF G+ W    D  F+ L
Sbjct  741  PQRYKFPPKLKKLTLSDTLLDWNDMSTLGMLENLEILKLKDNAFKGEWWQ-PEDGGFRAL  799

Query  501  KYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCER  680
            + L +G+ +L++W A  S + FP L+ L +++C SL+ +P  FA++ +L+++ELY     
Sbjct  800  RILHIGRSDLVSWNA--SARHFPRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRS  857

Query  681  VSDFAREICVKR  716
             +  AR I  K+
Sbjct  858  AAASARIIQEKK  869



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/261 (40%), Positives = 152/261 (58%), Gaps = 17/261 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT----NICTLCTISPASCTSEIFNKTP  170
            I   IWNM +LRH+HTN+S +LP    + SS+ T    ++ TL TI+P SCT E+F + P
Sbjct  442  IQANIWNMARLRHLHTNSSAKLPVPIARKSSKVTLVNQSLQTLSTIAPESCTEEVFARAP  501

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKV--ELKVTVFDKFLR  344
             L+KLG+RG ++ L LE      L  N++ L+ L++LKL  +S +   EL +     F  
Sbjct  502  NLKKLGIRGKIAVL-LEPNTSTSL-KNVKKLEYLESLKLINDSIQTGKELHLPPAYIFPT  559

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKLTL  T   W+DM+VLG LE LEVLKL +N F G+ W+      F  L  L + + 
Sbjct  560  KLRKLTLLDTWLGWNDMSVLGQLEHLEVLKLKENGFIGECWEPKVGG-FSSLLVLWIERT  618

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL++W A  S   FP L+ L+L +C  L+ IP   A++ +L+ +ELYN  +  +  ARE+
Sbjct  619  NLVSWNA--SADQFPRLKRLVLISCDRLKEIPIGLADIRSLQTVELYNSTKTAAISAREL  676

Query  705  CVKRHG------KTNVKINAF  749
              K+        KT  K++ F
Sbjct  677  QYKKDKQPQGTEKTGFKLSIF  697



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score =   162 bits (409),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 148/252 (59%), Gaps = 20/252 (8%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--------NICTLCTISPASCTSEIF  158
            I   IW M +LRH+ TN S  LP   P + SR +        ++ TL T+SP SCT ++F
Sbjct  624  IKADIWKMIQLRHLKTNASTALPG--PLSKSRKSKDDALMIGSLQTLSTVSPESCTEDVF  681

Query  159  NKTPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN---SEKVELKVT--  323
             + P L+ LG+RG L++L LE K    L ++L  L  L+NLKL  +       E K+T  
Sbjct  682  ARAPNLKVLGIRGQLAKL-LENKSGSMLFDSLGKLSHLENLKLLNDVFPRPPSEGKLTNP  740

Query  324  -VFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGL  500
                KF  +L+KLTLS TL  W+DM+ LG LE LE+LKL DNAF G+ W    D  F+ L
Sbjct  741  PQRYKFPPKLKKLTLSDTLLDWNDMSTLGMLENLEILKLKDNAFKGEWWQ-PEDGGFRAL  799

Query  501  KYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCER  680
            + L +G+ +L++W A  S + FP L+ L +++C SL+ +P  FA++ +L+++ELY     
Sbjct  800  RILHIGRSDLVSWNA--SARHFPRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRS  857

Query  681  VSDFAREICVKR  716
             +  AR I  K+
Sbjct  858  AAASARIIQEKK  869



>ref|XP_009618247.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
 ref|XP_009618250.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
Length=255

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 148/252 (59%), Gaps = 13/252 (5%)
 Frame = +3

Query  24   MEKLRHVHTNTSMQLPSSPPKNSSRG--TNIC--TLCTISPASCTSEIFNKTPKLQKLGV  191
            M +LRHV TN S  LPS     SS+    N C  TL TI+P  CT+E+F +TP L+KLGV
Sbjct  1    MTRLRHVCTNASATLPSPKRPKSSKDNLVNRCLQTLSTIAPECCTAEVFTRTPNLKKLGV  60

Query  192  RGNLSELFLETKQKVC--LINNLQMLKCLKNLKLHGNSE--KVELKVTVFDKFLRRLRKL  359
            RG +  L   +K +    L +N+  L CL+ LKL  ++   + +L +     F ++L+KL
Sbjct  61   RGKIDALLETSKDESSSGLFSNIGKLDCLEKLKLVNDTRQSRKQLHLPPAYIFPQKLKKL  120

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            TL  T F+W DM++LG LE LEVLKL + AF G+ W+   D  F  L+ L + + +L +W
Sbjct  121  TLIDTWFEWKDMSILGLLEYLEVLKLKEYAFRGQSWE-PEDGGFPRLQVLWIERTDLSSW  179

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRH  719
             A  S  +FP L+ L+L  C +L+ +P + A+V+NL++MEL +     +  AR I  K+ 
Sbjct  180  KA--SSGNFPRLKRLVLIACDNLKELPAELADVENLQLMELQSTSVSAAKSARAILKKKQ  237

Query  720  GK--TNVKINAF  749
             K  +  K++ F
Sbjct  238  EKEGSGFKLSVF  249



>ref|XP_009614364.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=887

 Score =   160 bits (406),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 147/254 (58%), Gaps = 15/254 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTN--ICTLCTISPASCTSEIFNKTPKL  176
            I   IWNM  LRHV TN S  LPS     S +  N  + TL TI+P  CT+EIF +TP L
Sbjct  623  IKADIWNMTTLRHVCTNASAILPSPKHSKSRKEVNHYLQTLSTIAPECCTAEIFTRTPNL  682

Query  177  QKLGVRGNLSELFLETKQKVC---LINNLQMLKCLKNLKLHGNSEKV--ELKVTVFDKFL  341
            +KLGVRG ++ L LET +      L  N+  L CL+NLKL  ++ +   +L +     F 
Sbjct  683  KKLGVRGKIAAL-LETSKDGSGSGLFGNIGKLDCLENLKLVNDTRQSGKQLHLPPAYIFP  741

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
            ++L+KLTL  T F+W DM++LG LE LEVLKL  NAF G+ W+   D  F  L+ L + +
Sbjct  742  QKLKKLTLIDTWFEWKDMSILGLLEYLEVLKLKQNAFRGQSWE-PEDGGFPCLQVLWIER  800

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +L +W A  S  +FP L+ L+L +C  L+ +P   A+  +L++MEL+   E  +  AR 
Sbjct  801  TDLSSWKA--SSGNFPQLKRLVLISCDKLEELPAALADAQSLQLMELHYTSESAAKSARV  858

Query  702  ICVKR----HGKTN  731
            I  +R     G TN
Sbjct  859  ILKRRLRKEEGSTN  872



>ref|XP_009769019.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=884

 Score =   159 bits (403),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 145/250 (58%), Gaps = 11/250 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRG--TNIC--TLCTISPASCTSEIFNKTP  170
            I   IWNM +LRHV TN S  LPS     SS+    N C  TL TI+P  CT+E+F +TP
Sbjct  623  IKADIWNMTRLRHVCTNASATLPSPKRPKSSKENLVNRCLQTLSTIAPECCTAEVFTRTP  682

Query  171  KLQKLGVRGNLSELFLETKQKVC--LINNLQMLKCLKNLKLHGNSE--KVELKVTVFDKF  338
             L+KLGVRG +  L   +K      L +N+  L CL+ LKL  ++   + +L +     F
Sbjct  683  NLKKLGVRGKIDALLETSKDGSSSGLFSNIGKLDCLEKLKLVNDTRQSRKQLHLPPAYIF  742

Query  339  LRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG  518
             ++L+ LTL  T F+W DM++LG LE LEVLKL +NAF G+ W+   D  F  L+ L + 
Sbjct  743  PQKLKTLTLIDTWFEWKDMSILGLLEYLEVLKLKENAFRGQSWE-TKDGGFPRLQVLWIE  801

Query  519  KMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAR  698
            + +L +W A  S  +FP L+ L+L  C +L  +P + A+V+NL+++EL +     +  AR
Sbjct  802  RTDLSSWKA--SSGNFPRLKRLVLIACDNLNELPAELADVENLQLLELQSTSVSAARSAR  859

Query  699  EICVKRHGKT  728
             I  K+  K 
Sbjct  860  AILKKKQEKV  869



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score =   159 bits (403),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 152/263 (58%), Gaps = 15/263 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSR----GTNICTLCTISPASCTSEIFNKTP  170
            I   IWNM +LRH+HTN+S +LP      SS+      ++ TL TI+P SCT E+F +TP
Sbjct  628  IQANIWNMARLRHLHTNSSAKLPVPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTP  687

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE--LKVTVFDKFLR  344
             L+KLG+RG ++ L    K    L+ N++ L+ L+NLKL  +S +    L++     F  
Sbjct  688  NLKKLGIRGKIAVLLEPNKS---LLKNVKKLESLENLKLINDSSQTGKGLRLPPSYIFPT  744

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKL+L  T  +W+DM++LG +E LEVLKL +N F G+ W+  S   F  L  L + + 
Sbjct  745  KLRKLSLVDTWLEWNDMSILGQMEHLEVLKLKENGFMGECWE--SVGGFCSLLVLWIERT  802

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L++W A  S   FP L+ L+L  C  L+ IP   A++ + +VMEL N  +  +  AREI
Sbjct  803  DLVSWKA--SADHFPRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAAISAREI  860

Query  705  CVKRHGKTNVKI--NAFNVFITP  767
              K+  +T      N F + I P
Sbjct  861  RDKKDKQTQEGTNNNGFKLSIFP  883



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score =   159 bits (403),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 150/258 (58%), Gaps = 13/258 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSR----GTNICTLCTISPASCTSEIFNKTP  170
            I   IWNM +LRH+HTN+S +LP      SS+      ++ TL TI+P SCT E+F +TP
Sbjct  629  IQANIWNMARLRHLHTNSSAKLPVPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTP  688

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE--LKVTVFDKFLR  344
             L+KLG+RG ++ L    K    L+ N++ L+ L+NLKL  +S +    L++     F  
Sbjct  689  NLKKLGIRGKIAVLLEPNKS---LLKNVKKLEYLENLKLINDSSQTGKGLRLPPSYIFPT  745

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKL+L  T  +W+DM++LG LE LEVLKL +N F G+ W+  S   F  L  L + + 
Sbjct  746  KLRKLSLVDTWLEWNDMSILGQLEHLEVLKLIENGFMGECWE--SVGGFCSLLVLWIERT  803

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L++W A  S   FP L+ L+L  C  L+ IP   A++ + +VMEL N  +  +  AR+I
Sbjct  804  DLVSWKA--SADHFPRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAAISARDI  861

Query  705  CVKRHGKTNVKINAFNVF  758
              K+  +T    N  N F
Sbjct  862  RAKKDKQTQKGTNNNNGF  879



>ref|XP_011072127.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=885

 Score =   157 bits (398),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 148/261 (57%), Gaps = 9/261 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M +LRH+ TN S  LP+ P K+S  G  + TL TISP SCT E+F +   L+K
Sbjct  629  IKADIWKMIQLRHLKTNASSTLPN-PGKSSKEGEKLRTLGTISPQSCTDEVFERARNLKK  687

Query  183  LGVRGNLSELFLETK----QKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRL  350
            LG+RG L+ L ++ K      +  + N++ LK L ++     SE     +    KF ++L
Sbjct  688  LGIRGRLA-LLIDGKSGSFDSLGKLENVEKLKLLNDVFPSPPSEGQLRGLPPPYKFPKKL  746

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            + LTL+ T   W +M++LG LE LEVLKL DN+F GK W+  +D  F+ L+ L +G+ +L
Sbjct  747  KSLTLADTFLDWSNMSILGLLENLEVLKLKDNSFMGKRWE-AADGGFRHLEVLHIGRTDL  805

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
            + W A  S   FP L  L L+NC  L  +P   A+++N +V++LY+     +   + +  
Sbjct  806  VFWIA--SAHHFPQLRRLELQNCEELNEVPIGLADIENFQVLDLYHTKFASASAKKIVEA  863

Query  711  KRHGKTNVKINAFNVFITPLQ  773
            K+  + N K   F + I PL+
Sbjct  864  KKKQEQNGKAGGFKLSIFPLE  884



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score =   156 bits (395),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 139/229 (61%), Gaps = 13/229 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRG--TNIC--TLCTISPASCTSEIFNKTP  170
            I   IWNM +LRHV TN S  LPS+    SS+G   N C  TL TI+P  CT+E+F +TP
Sbjct  625  IKADIWNMTRLRHVCTNASATLPSTKRPKSSKGNLVNRCLQTLSTIAPECCTAEVFTRTP  684

Query  171  KLQKLGVRGNLSELFLETKQK---VCLINNLQMLKCLKNLKLHGNSE--KVELKVTVFDK  335
             L+KLGVRG +  L LET +      L +N+  L CL+ LKL  ++      L +     
Sbjct  685  NLKKLGVRGKIDAL-LETSKDGSGSVLFSNIGKLACLEYLKLVNDTRISSKPLHLPPAYI  743

Query  336  FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRM  515
            F ++L+KL+L  T F+W DM++LG L +LEVLKL +NAF G+ W+   D  F  L+ L +
Sbjct  744  FPQKLKKLSLVDTWFEWKDMSILGLLPDLEVLKLKENAFKGQSWE-QEDGGFPRLQVLWI  802

Query  516  GKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
             + +L +W A  S  +FP L+ L L +C  L+ +P + A+V NL+++EL
Sbjct  803  ERTDLTSWKA--SSGNFPRLKHLALISCDKLEELPAELADVKNLQLIEL  849



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score =   156 bits (394),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 149/261 (57%), Gaps = 17/261 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT----NICTLCTISPASCTSEIFNKTP  170
            I   IWNM +LRH+HTN+S +L     + SS+ T    ++ TL TI+P SCT E+F + P
Sbjct  621  IQANIWNMARLRHLHTNSSAKLSVPIARKSSKVTLVNQSLQTLSTIAPESCTEEVFARAP  680

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL--HGNSEKVELKVTVFDKFLR  344
             L+KLG+RG +S L LE      L  N++ ++ L++LKL   G     EL +     F  
Sbjct  681  NLKKLGIRGKISVL-LEPNTSTSL-KNVKKVEYLESLKLINDGIQTGKELHLPPAHIFPT  738

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKLTL  T   W+DM+VLG LE LEVLKL +N F G+ W+      F  L  L + + 
Sbjct  739  KLRKLTLVDTRLGWNDMSVLGQLEHLEVLKLKENGFMGECWEPKVGG-FSSLLVLWIERT  797

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL++W A  S   FP L+ L+L +C  L+ IP   A++ +L+ +ELYN  +  +  ARE+
Sbjct  798  NLVSWNA--SADQFPRLKRLVLISCDRLKEIPIGLADIRSLQAVELYNSTKTAAISAREL  855

Query  705  CVKRHG------KTNVKINAF  749
              K+        KT  K++ F
Sbjct  856  QDKKDKQPQGTEKTGFKLSIF  876



>ref|XP_009798793.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=704

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 154/267 (58%), Gaps = 19/267 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPK  173
            I+  I NM +LRH+HTN S  L +  PK+S        + TL TI+P SCT ++F + P 
Sbjct  442  IEADILNMPRLRHLHTNASAILRA--PKSSKAALVNQALQTLSTIAPESCTEDVFVRAPN  499

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL---HGNSEKVELKVTVFDKFLR  344
            ++KLG+RGN+  + LE+ +   L NN++ L+CL++LKL    G   +  L++     F R
Sbjct  500  MKKLGIRGNIG-MLLESNESA-LFNNVKKLECLESLKLINDVGQIGRTPLRLPPAYIFPR  557

Query  345  RLRKLTLSGTLFQWD-DMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
            +LRKLTL  T   WD DM++LG L+ LEVLKL +NAF G+ W+      F  L+ L + +
Sbjct  558  KLRKLTLINTWLDWDHDMSILGQLQYLEVLKLKENAFKGEYWEPKVGG-FGSLQVLWIQR  616

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +L  W A  S  +FP L+ L+L +C  L  IP   A+V +L+VMEL    +  +  AR+
Sbjct  617  TDLAAWHA--SADNFPRLKRLVLVSCEKLAEIPLGLADVRSLQVMELNVTTKLAAKCARD  674

Query  702  ICVKRHGKTN-----VKINAFNVFITP  767
            I  K+  + N     +K + F + I P
Sbjct  675  IQTKKLKQANLEGNYIKSSGFKLSIYP  701



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score =   153 bits (387),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRG--TNIC--TLCTISPASCTSEIFNKTP  170
            I   IWNM +LRHV TN S  LPS+    SS+    N C  TL TI+P  CT+E+F +TP
Sbjct  625  IKADIWNMTRLRHVCTNASATLPSTKRPKSSKDNLVNRCLQTLSTIAPECCTAEVFTRTP  684

Query  171  KLQKLGVRGNLSELFLETKQKVC--LINNLQMLKCLKNLKLHGNSE--KVELKVTVFDKF  338
             L+KLGVRG +  L   +K      L +N+  L CL+ LKL  ++      L +     F
Sbjct  685  NLKKLGVRGKIDALLESSKDGSGSGLFSNIGKLGCLEYLKLVNDTRLSSKPLHLPPAYIF  744

Query  339  LRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG  518
             ++L+KL+L  T F+W DM++LG L ELEVLKL +NAF G+ W+   D  F  L+ L + 
Sbjct  745  PQKLKKLSLVDTWFEWKDMSILGLLPELEVLKLKENAFKGQSWE-QEDGGFPRLQVLWIE  803

Query  519  KMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
            + +L +W A  S  +FP L+ L L +C  L+ +P + A+V NL+++EL
Sbjct  804  RTDLTSWKA--SSGNFPRLKHLALISCDKLEELPAELADVKNLQLIEL  849



>ref|XP_009793189.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=873

 Score =   151 bits (382),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 144/239 (60%), Gaps = 10/239 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNI----CTLCTISPASCTSEIFNKTP  170
            I   I NM +LRH HTNTS +L  S    +++ T++     TL TI P SCT  +F + P
Sbjct  622  IQADICNMPQLRHFHTNTSAKLCRSAAIATNKPTSVHGTLQTLSTIEPESCTEYVFARCP  681

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN-SEKVELKVTVFDKFLRR  347
             L+KLG+RG + E+ L++ +    +N+ Q LKCL+ LKL  + S   +L +   + F + 
Sbjct  682  YLKKLGIRGKI-EVLLQSNRVGPFLND-QNLKCLEKLKLVNDLSAGGKLHLPSENIFPKS  739

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            L+KLTL GT   W +M  L  LE LEVLKL +NAF+GKLW+ ++   F  LK L + + +
Sbjct  740  LKKLTLLGTGLDWKEMGRLCKLEVLEVLKLKENAFTGKLWE-STVGTFPSLKVLLIERSD  798

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            L++W A  S + FP L  L+LR+   L+ +P + A + NL+V+EL N     ++ AREI
Sbjct  799  LVSWKA--SSEQFPRLARLVLRSLHKLEEVPIELAKIHNLQVIELENTTRTAAESAREI  855



>ref|XP_009614965.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
 ref|XP_009614966.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=886

 Score =   151 bits (381),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 152/267 (57%), Gaps = 19/267 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPK  173
            I+  I NM +LRH+HTN S  L +  PK+S        + TL TI+P SCT ++F + P 
Sbjct  624  IEADILNMPRLRHLHTNASAILRA--PKSSKAALVNQALQTLSTIAPESCTEDVFVRAPN  681

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL---HGNSEKVELKVTVFDKFLR  344
            ++KLG+RG +  + LE+ +   L NN++ L+CL++LKL    G   +  L++     F R
Sbjct  682  MKKLGIRGKIG-MLLESNES-ALFNNVKKLECLESLKLINDVGQVGRTPLRLPPAYIFPR  739

Query  345  RLRKLTLSGTLFQWD-DMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
            +LRKLTL  T   WD DM++LG L+ LEVLKL +NAF G+ W+      F  L+ L + +
Sbjct  740  KLRKLTLIDTWLDWDHDMSILGQLQYLEVLKLKENAFKGEYWEPKVGG-FCSLQVLWIQR  798

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +L  W A  S  +FP L+ L+L +C  L  IP   A+V +L+VMEL       +  AR+
Sbjct  799  TDLAAWHA--SADNFPRLKRLVLVSCEKLTEIPLGLADVRSLQVMELNVTTILAAKCARD  856

Query  702  ICVKRHGKTN-----VKINAFNVFITP  767
            I  K+  + N     +K + F + I P
Sbjct  857  IQTKKLKQANLEGNGIKSSGFKLSIYP  883



>ref|XP_009798711.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=663

 Score =   149 bits (376),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 134/231 (58%), Gaps = 11/231 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LPS     S + + +  LC ++P SC  ++  K   L+K
Sbjct  337  IKADIWNMLQLRHLHTNIPAKLPSPAATTSGKPSCLQILCMVAPESCKKDVLAKACNLRK  396

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV---FDKFLRRLR  353
            L ++G ++  FLETK     INNL+ LKCL++LKL  ++  ++  + +   F +FLR LR
Sbjct  397  LSIQGKMAA-FLETKGG---INNLEELKCLEHLKLLNDAAYMKTSLHLPPAFFRFLRTLR  452

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM-NL  530
            KLTL+ T F W +   LG LE LEVLKL ++AF G  W       F  L+ L + K   L
Sbjct  453  KLTLANTRFSWSEANKLGQLESLEVLKLKEDAFIGDSWQPEIRG-FSQLQVLWIEKATKL  511

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
             TW A  S+ +FPVL  L+L +C  L+ +P   A++ NL+ M L N  + V
Sbjct  512  ETWEA--SNLNFPVLRHLVLISCDKLKAVPLGLADIPNLQEMRLENTSKAV  560



>emb|CDP00590.1| unnamed protein product [Coffea canephora]
Length=899

 Score =   150 bits (378),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 130/225 (58%), Gaps = 11/225 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSR------GTNICTLCTISPASCTSEIFNK  164
            I   IW M +LRH+HTN S  LP    KN         G N+ TL T+SP SC  E+F +
Sbjct  632  IKADIWRMPQLRHLHTNASTLLPCPDNKNQRSKEEALIGENLLTLHTVSPESCKEEVFER  691

Query  165  TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVEL-KVTVFDKFL  341
            T +L+KLG+RG L++LF E   +  L   L+ L  L+NLKL  +     L  +     F 
Sbjct  692  TTRLKKLGIRGKLAKLF-EITGESSLFGYLRKLDSLENLKLLNDDISSRLFGLPSHKSFP  750

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
            R L KLTL  TL  W +M+ LG LE LEVLKL DNAF G+LW       F  LK+L +G+
Sbjct  751  RELTKLTLLNTLLDWSEMSTLGKLENLEVLKLKDNAFKGRLWQTEKGG-FLRLKFLHIGR  809

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVM  656
             +L+ W A  S   FP L+SL+LRNC  L+  P D A++ +L+++
Sbjct  810  TDLVVWEA--SVDQFPKLKSLVLRNCDKLRAFPHDLADIPSLQMV  852



>ref|XP_009591232.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=743

 Score =   149 bits (376),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 143/265 (54%), Gaps = 13/265 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IWNM +LRH+HTN   +L       S + +++ TLC ++P SC  E+  K   L+K
Sbjct  489  VKADIWNMLQLRHLHTNIPAKLQPPTATTSGKASSLQTLCMVAPESCEKEVLAKACHLKK  548

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN---SEKVELKVTVFDKFLRRLR  353
            L +RG ++      K     INNL  LKCL+ L L  +     K       F + +R ++
Sbjct  549  LSIRGQMAAFLGAYKGG---INNLVELKCLEQLNLLNDVLYMNKAPHLPPTFSQLVRTVK  605

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
            KLTL+ T F W +   LG LE LEVLK  +NAF+G  W   +   F  L+ L + +  L 
Sbjct  606  KLTLTNTRFAWSEADKLGKLESLEVLKFKENAFAGDSWKPKTG--FSALQVLWIERSELE  663

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
            +W A  SD +FPVL  L+L +C  L+ +P + AN+ NL+ M L N  + V   A+EI  +
Sbjct  664  SWVA--SDINFPVLRHLVLISCDKLEAVPLELANIPNLQEMRLENTSKVVKS-AKEIQER  720

Query  714  RHGKTNVKINAFNVFITPLQSQATE  788
            +  K+ +K N F +F     S+AT+
Sbjct  721  KTSKS-IKFN-FTIFPPEAGSKATK  743



>emb|CDP11831.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   149 bits (377),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 128/221 (58%), Gaps = 6/221 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I+  IW M KLRH+HTNTS  LP  P + S  G N+ TL T+SP S T E+F +   L+K
Sbjct  600  IEANIWAMTKLRHLHTNTSTTLPKCPDQ-SPGGENLQTLSTVSPESLTKEVFKRAKNLKK  658

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVEL-KVTVFDKFLRRLRKL  359
            LG+RG L  L +E   +    ++L  +  L+NLKL+G+    +L  +    KF  RL +L
Sbjct  659  LGIRGKLHNL-VEGNGESSFFDSLCEVDSLENLKLYGDDVNSKLLALPQAHKFPPRLTRL  717

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            +L  T   W+ M++LG L  LEVLKL D AF G  W       F  LK   +G  +L  W
Sbjct  718  SLHNTSLDWNYMSILGDLRYLEVLKLKDYAFKGDYWKTKQGG-FPSLKVFFIGATDLTRW  776

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
             A  +D  FP L+ LIL+ C +LQ IP DFA + NL+++++
Sbjct  777  DAKAND--FPELKCLILKQCKTLQRIPSDFAFMKNLEMIKV  815



>emb|CDP11611.1| unnamed protein product [Coffea canephora]
Length=921

 Score =   149 bits (376),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/261 (39%), Positives = 153/261 (59%), Gaps = 13/261 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   +W M +LRH+H N S  LP    +  +   N+ TL TISP SCT+++F +TPKL+K
Sbjct  666  IQLDLWKMTQLRHLHANASTTLPKC--QEQTIMVNLQTLSTISPESCTTDVFKRTPKLKK  723

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD-KFLRRLRKL  359
            LG+RGN+  L ++  ++  L + L  L+ L+ LKLH +    +L+   F+ KF  +L +L
Sbjct  724  LGIRGNIG-LLVQPSRESSLSDGLLRLELLEKLKLHNDDVTCKLQALPFEHKFPAKLTRL  782

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            +L  T   W  M+ LG L+ LEVLKL DNAF GK W+   D  F+ LK L +G  +L  W
Sbjct  783  SLQSTSLDWSHMSTLGKLKCLEVLKLKDNAFKGKHWE-TEDGGFRYLKVLFIGATDLKVW  841

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAR-----EI  704
             A  S+  FP L+SL+L+ C +L+ IP D AN  +L+V++L +  + V   A+     ++
Sbjct  842  KAKSSN--FPELKSLVLKQCRNLEAIPSDLANAKSLQVIDLEHTSQTVVASAKNMQLLQL  899

Query  705  CVKRHGKTNVKINAFNVFITP  767
             V R  K +++ +   V I P
Sbjct  900  RVLRQ-KRDIETSELKVKIYP  919



>ref|XP_009803469.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=297

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 143/243 (59%), Gaps = 13/243 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I  GIWNM +LRH+ TN     P   P  +S  + + TL  ++P SC  ++  K   L+K
Sbjct  52   IKAGIWNMSRLRHLRTNKPANFP---PPTTSTSSCLQTLSLVAPESCKEDVLAKASNLKK  108

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKFLRRLRK  356
            L +RGN++  FLET +     +N ++L+ L++L L  +  S  + L   +F  +L +L+K
Sbjct  109  LSIRGNMAT-FLETSKGE--FSNFRVLERLESLTLLNDYLSRALHLPSALFV-YLPKLKK  164

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            LTLS T F+W++   LG LE LEVLKL +NAF+G  W + +   F+ L+ L + +  L++
Sbjct  165  LTLSKTRFEWNEANRLGHLECLEVLKLKENAFTGNSWKMEAGG-FRKLQVLWIERAELVS  223

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
            W A  S+ SFP L +L+  +C++L  +P + A+++ L+ M L N   +  D A+EI  KR
Sbjct  224  WEA--SNCSFPRLRNLVFVSCLNLAKVPPELADLEYLQEMVLDNT-SKAGDSAKEIERKR  280

Query  717  HGK  725
              K
Sbjct  281  KEK  283



>emb|CDP16256.1| unnamed protein product [Coffea canephora]
Length=702

 Score =   146 bits (368),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 143/261 (55%), Gaps = 9/261 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKL  176
            I   IW M +LRH+HTN  TS+  P++P   +    N+ TL +ISP SCT E+F +TPKL
Sbjct  441  IKSDIWKMPQLRHLHTNASTSLPCPTTPRCETLVNANLQTLSSISPQSCTKELFERTPKL  500

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELK-VTVFDKFLRRLR  353
            +KL + G L+ LF     +  +  +L  L  L+NLKL        LK +     F R+L 
Sbjct  501  KKLAICGKLAVLF-RANGRSNVFESLCALDFLENLKLLNEYVSSPLKRLPQEHNFPRKLT  559

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
             LTLS TL  W+ M+ LG L  LEVLKL  NAF G  W   S   F+ L++L +G   L 
Sbjct  560  MLTLSKTLLPWNQMSTLGKLANLEVLKLKINAFKGDRWRTESGG-FQSLQFLHIGSTGLS  618

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI---  704
            +W    +D   PVL+SL+L++C  L+ +P    ++  L++++L      V+  A++I   
Sbjct  619  SWDVAAAD-HLPVLKSLVLKHCPDLRRLPPSLGHISTLQLIDLSCTNPSVASSAKDIENL  677

Query  705  CVKRHGKTNVKINAFNVFITP  767
             +K+  +   K N F + + P
Sbjct  678  KLKQAQQKGNKSNRFMLLVYP  698



>emb|CDP00592.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   147 bits (370),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 127/226 (56%), Gaps = 9/226 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPK----NSSRGTNICTLCTISPASCTSEIFNKTP  170
            I   IW M +LRH+ TNTS  LP    K      S   N+ TL +ISP SC  ++F + P
Sbjct  669  IKADIWKMPQLRHLITNTSACLPLPLAKIHKGEPSISANLQTLSSISPESCKRDVFERVP  728

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD-KFLRR  347
            KL+KLG+ G L+  F++   +  L ++   L+ L+NLKL       +L     + KF R 
Sbjct  729  KLKKLGICGRLAS-FMQGNNESSLFDSFSKLEFLENLKLINADFNSKLHFLPHESKFPRS  787

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            L +LTL  T+  W  M++LG LE LEVLKL DNAF G+ W    +  F  L+ L +G  +
Sbjct  788  LTRLTLLNTMLDWKHMSILGKLENLEVLKLKDNAFEGERWQ-TEEGGFLRLQVLNIGSTS  846

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
            L+TW A  SD  FP L  L+L +C  L+ IP   A + +L+ +E+Y
Sbjct  847  LVTWNASASD--FPRLRCLVLMHCSKLEAIPHGLAQIASLQAVEVY  890



>ref|XP_009596917.1| PREDICTED: disease resistance protein RPP13-like [Nicotiana tomentosiformis]
Length=896

 Score =   146 bits (369),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 138/235 (59%), Gaps = 9/235 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW + +LRH+HTN   +LP  PP  +   + + TL  I+P SCT + F K   L+K
Sbjct  649  IKADIWKLLRLRHLHTNVPAELPL-PPIPTGEASCLQTLSLITPKSCTKDAFAKACNLKK  707

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN-SEKVELKVTVFDKFLRRLRKL  359
            LG+RGN+ E FLET +      NL+ L CL+ L ++ + S   +  +  F K LR L+KL
Sbjct  708  LGIRGNM-EAFLETSKGGW--QNLKELWCLERLIIYNDGSYSRKPYLPPFFKCLRTLKKL  764

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            TLS T+F W +  +LG LE LEVLKL +NAF G LW +     F  L+ L++   +L  W
Sbjct  765  TLSNTMFDWSEADILGRLECLEVLKLKENAFEGMLWKVKRGG-FNELQVLKIEGADLENW  823

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             A  S+  FP L  L+L++C +L+ +P + A+V + + M+L N   + +  AREI
Sbjct  824  EA--SEYHFPQLRHLVLKSCENLEALPCELADVPSFEEMKLENT-RKAAKSAREI  875



>ref|XP_009594795.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=882

 Score =   146 bits (369),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 125/232 (54%), Gaps = 14/232 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKL  176
            +   IWNM +LRH+HTN   +L   PP  ++ G   C  TLC ++P SC  E+  K   L
Sbjct  628  VKADIWNMLQLRHLHTNIPAKL--QPPTATTSGKASCLQTLCMVAPESCEKEVLAKACHL  685

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN---SEKVELKVTVFDKFLRR  347
            +KL +RG ++      K     INNL+ LKCL+ LKL  +     K       F + +R 
Sbjct  686  KKLSIRGQMAAFLGAYKGG---INNLEELKCLEQLKLLNDVLYMNKAPHLPPTFSQLVRT  742

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            ++KLTL+ T F W +   LG LE LE+LK  +NAF+G  W     + F  L+ L + +  
Sbjct  743  VKKLTLTNTRFAWSEADKLGQLESLEILKFKENAFAGDSW--KPKMGFSALRVLWIERAE  800

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
              TW A  S+ +FPVL +L+L +C  L  +P + AN+ NL  M L N  + V
Sbjct  801  FETWEA--SEHNFPVLRNLVLMSCDKLDAVPFELANISNLHEMRLENTSKAV  850



>emb|CDP16841.1| unnamed protein product [Coffea canephora]
Length=900

 Score =   145 bits (367),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 135/242 (56%), Gaps = 9/242 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I+  IW M KLRH+HTNT+  LP    K SS   N+ TL T+SP S  +E+F +T KL+K
Sbjct  641  IEADIWEMTKLRHLHTNTTTCLPKCK-KQSSGSENLQTLSTVSPESLKNEVFGRTKKLRK  699

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF---DKFLRRLR  353
            LG+RGNL  L +E   +  L  +   L  L+ LKLH +++    +  V     KF R L 
Sbjct  700  LGIRGNLGTL-VEANGESSLFQSHCKLDSLETLKLHHDTDDGNQRQLVLPQPHKFPRTLT  758

Query  354  KLTLSGTLFQWD-DMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +L+L  T   W+  M +LG L  LEVLKL DNAF GK W    +  F  LK L +G  +L
Sbjct  759  RLSLHNTRLHWEVHMPILGKLRYLEVLKLKDNAFVGKDWR-TEEGGFHSLKVLFIGATDL  817

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
              W A  ++  FP L  LIL++C +L  IP DF ++ NL+ + L     ++   AR I  
Sbjct  818  ECWLAKATN--FPELRYLILKHCRTLIQIPPDFVHMKNLEKINLERTNAKLVSSARRIFS  875

Query  711  KR  716
            +R
Sbjct  876  QR  877



>ref|XP_004236957.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010319428.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score =   145 bits (366),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 148/253 (58%), Gaps = 14/253 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IWNM +LRH+HT+   +LPS P     + +++ TL  ++P SC  ++  K   L+K
Sbjct  627  VKADIWNMLQLRHLHTSIPAKLPS-PTVTKGKSSSLQTLSMVAPESCKKDVLAKACHLKK  685

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN----SEKVELKVTVFDKFLRRL  350
            LG+RG ++  FLE++     I+NL+ LKCL++LKL  +    ++ ++L  + F + +R +
Sbjct  686  LGIRGQMAS-FLESRGG---ISNLEELKCLEHLKLLNDVLYMNKTIQLP-SAFFRLVRTV  740

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTL+ T F W +   L  LE LEVLKL +NAF G  W       F  L+ L + +  L
Sbjct  741  KKLTLANTRFAWSEAEKLAQLESLEVLKLKENAFMGDTWKPEVGG-FSKLRVLWIERAEL  799

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
             TW A  S+ ++P+L +L+L +C  L  +P + A++ NL+ M+L N  + V   A++I +
Sbjct  800  ETWEA--SNLNYPILRNLVLVSCDKLNAVPVELADIPNLREMKLENTIKAVKS-AKDILL  856

Query  711  KRHGKTNVKINAF  749
            K+      K++ F
Sbjct  857  KKSQTVTFKLSIF  869



>emb|CDP08032.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   141 bits (355),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 129/235 (55%), Gaps = 6/235 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M KLRH+ TN+SM LP    + S+   N+ TL  +SP S T E+  +   L+K
Sbjct  160  IQADIWAMTKLRHLITNSSMSLPRCE-EQSTICENLQTLSVVSPESLTDEVLKRATNLKK  218

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVEL-KVTVFDKFLRRLRKL  359
            LG+ GNL  L ++ K +  L ++L  L  L+ LKL  N    +L  +    KF +RL KL
Sbjct  219  LGISGNLGTL-MKAKGESNLFDHLCELNFLERLKLCSNDVNSKLLALPQPHKFPKRLTKL  277

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            +L  T   WD M++LG L+ LEVLKL D AF+G  W    +  F+ LK L +G  +L  W
Sbjct  278  SLQNTSLGWDQMSILGKLQYLEVLKLKDYAFTGDDWQ-TEEGGFRSLKVLFIGATDLKCW  336

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             A  +D  FP L  LILR C  LQ IP DF ++  L+ + L +    V   AR I
Sbjct  337  EAQATD--FPELRRLILRQCKQLQRIPPDFVDMKKLEDIHLEHTTGSVISSARRI  389



>gb|EYU24144.1| hypothetical protein MIMGU_mgv1a001094mg [Erythranthe guttata]
Length=891

 Score =   145 bits (366),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 143/258 (55%), Gaps = 14/258 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   I NM +LRH+ TN S  L   P K S  G  + TL TIS  SCT  +  K   L+K
Sbjct  639  IRADILNMIQLRHLKTNASATL-IKPGKASKEGDMLQTLGTISTESCTEALIVKARNLKK  697

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD---KFLRRLR  353
            LGVRGNL+ L ++ K      ++L+ L  L+NLKL  ++     K+       +F ++LR
Sbjct  698  LGVRGNLA-LLMDPKSGS--FDSLRKLGSLENLKLINDAFPHPSKLGDLPPSYRFPKKLR  754

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
             LTLS TL  W DM++LGSLE L VLKL D AF G+ W+  +D  F+ L+ L +G  NL 
Sbjct  755  SLTLSSTLLDWTDMSILGSLENLLVLKLKDKAFMGRSWE-AADAGFRRLEVLHIGHTNLA  813

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
             W A+     FP L  L LRNC +L+ +P   A++   + ++L+   E+ +  A++I   
Sbjct  814  VWVALGH--HFPRLRCLKLRNCENLEGVPIGLADIPTFQELDLFR-TEKAAASAKKI---  867

Query  714  RHGKTNVKINAFNVFITP  767
            R  +T   +  F +FI P
Sbjct  868  RKNRTTNGLTEFKLFIFP  885



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   144 bits (363),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 143/267 (54%), Gaps = 16/267 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTN--TSMQLPSSPPKNSSRG----TNICTLCTISPASCTSEIFNK  164
            I   +W M + RH+HT+  + +  P +  +  S       NI T+CTI P  CT  I ++
Sbjct  623  IQADLWKMLQFRHLHTSGLSCLHGPRAETRKDSEDPFVRRNIQTICTIVPECCTENILSR  682

Query  165  TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE-LKVTVFD---  332
            TP L+KLG+RG L  + ++ +  + L +NL  L  L+ LKL  ++  ++  K  +     
Sbjct  683  TPNLKKLGIRGKLV-MLVQERGGMSLFDNLAKLDHLETLKLLNDTFPLDPFKCHIPGLPQ  741

Query  333  --KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKY  506
              KF   L+KLTLS TL  W +M+ LG L  LEVLKL D AF G  W+   D  F+ L+ 
Sbjct  742  SYKFPPNLKKLTLSDTLLDWSEMSTLGMLPNLEVLKLKDYAFKGSRWE-PLDGGFRLLRV  800

Query  507  LRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVS  686
            L++G+ +L+ W A  S   FP LE ++L++C  L+ IP  F  V  L+ MELY      +
Sbjct  801  LQLGRSDLVHWHA--SSHHFPRLERVVLKHCTHLEEIPCGFGEVSALQNMELYWPTPAAA  858

Query  687  DFAREICVKRHGKTNVKINAFNVFITP  767
              AR I  ++     +  +AF + I P
Sbjct  859  ASARLIQHQKQQDQRMVNSAFKLLIYP  885



>ref|XP_009793040.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=881

 Score =   144 bits (362),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 137/260 (53%), Gaps = 19/260 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKL  176
            +   IWNM +LRH+HTN   +L   PP  ++ G   C  TLC ++P SC  E+  K   L
Sbjct  627  VKADIWNMLQLRHLHTNIPAKL--QPPTATTSGKASCLQTLCMVAPESCEKEVLAKACHL  684

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN---SEKVELKVTVFDKFLRR  347
            +KL +RG ++      K     INNL  LKCL+ LKL  +     K       F + +R 
Sbjct  685  KKLSIRGQMAAFLGAYKGG---INNLAELKCLEQLKLLNDVLYMNKAPHLPPTFSQLVRT  741

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            ++KLTL+ T F W +   LG LE LE+LK  +NAF+G  W     + F  L+ L + +  
Sbjct  742  VKKLTLTNTRFAWSEAEKLGQLESLEILKFKENAFAGDSW--KPKMGFSALRVLWIERAE  799

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREIC  707
              TW A  S+ +FPVL +L+L +C  L  +P + AN+  L  M L N  + V   A++I 
Sbjct  800  FETWEA--SELNFPVLRNLVLMSCDKLDAVPFELANISELYEMRLENTSKAVKS-AKDIL  856

Query  708  VKRHGKTNVKINAFNVFITP  767
              +  K+ +K   FN+ I P
Sbjct  857  ESKIAKS-IK---FNLTIFP  872



>ref|XP_009604446.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=644

 Score =   142 bits (359),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 141/239 (59%), Gaps = 10/239 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNI----CTLCTISPASCTSEIFNKTP  170
            I   I NM +LRH HTNTS +L  S    +++ T++     TL TI P SCT  +F +  
Sbjct  283  IQADICNMPQLRHFHTNTSAKLCRSAAIETNKPTSVHGTLQTLSTIEPESCTEYVFARCQ  342

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN-SEKVELKVTVFDKFLRR  347
             L+ L +RG + E+ L+  +    +N+ + LKCL+ LKL  + S   +L +   + F + 
Sbjct  343  YLKNLSIRGKI-EVLLQANRVGPFLND-RNLKCLEKLKLVNDLSAGGKLHLPSENIFPKS  400

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            L+K+TL GT   W++M  L  LE LEVLKL +NAF+G+LW+ + D IF  LK L + + +
Sbjct  401  LKKITLLGTGLDWNEMGRLCKLEVLEVLKLKENAFTGELWE-SRDGIFPSLKVLLIERSD  459

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            L++W A  S + FP L  L+LR+   L  +P + A + NL+VMEL N     ++ AREI
Sbjct  460  LVSWKA--SSEQFPRLVRLVLRSLHKLVEVPIELAKIRNLQVMELENTTRTAAESAREI  516



>emb|CDP18959.1| unnamed protein product [Coffea canephora]
Length=890

 Score =   144 bits (362),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 134/237 (57%), Gaps = 6/237 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW + +LRHVHTN S  L  S  K      ++ TL TISP SC +E+F + PKL+K
Sbjct  633  IKADIWKLPQLRHVHTNASTSLVESK-KELIINAHLKTLSTISPESCRAELFVRAPKLKK  691

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVEL-KVTVFDKFLRRLRKL  359
            LGV G L  +   T Q   L  NL  L+ L+NLKL  +    +L  +   + F R+L +L
Sbjct  692  LGVCGKLVNVIQPTGQS-SLFANLFKLEDLENLKLLNDDITFKLHALPQENMFPRKLTRL  750

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            TL  TL  W  M+ LG LE+LEVLKL DNAF G+LW       F+ LK L +G  NL+ W
Sbjct  751  TLLNTLLDWKHMSTLGKLEKLEVLKLKDNAFQGELWRTEGGG-FRNLKVLHIGSTNLVMW  809

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
             A+ S   FP+L SL LR+C  L+ +P    ++  L+ ++LY     V+  AR I V
Sbjct  810  KALAS--HFPILRSLFLRHCTKLEAVPSGLGDIATLQEIDLYCTNSMVAKSARNIQV  864



>emb|CDP20211.1| unnamed protein product [Coffea canephora]
Length=694

 Score =   143 bits (360),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/236 (40%), Positives = 137/236 (58%), Gaps = 8/236 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW+M KLR++HTNTS  LP    + S  G N+ TL T+SP S T ++F +T  L+K
Sbjct  437  IQADIWSMTKLRYLHTNTSTILPKCL-EQSPGGENLQTLSTVSPESLTKDVFKRTRNLKK  495

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKFLRRLRK  356
            LG+ G L+ + +E   +  L + L  L  L+NLKL+G+  S K+ L +    KF  RL +
Sbjct  496  LGICGKLNNI-VEANGESSLFDCLCELNSLENLKLYGDDVSSKL-LALPQAHKFPPRLAR  553

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L+L  T   WD M++LG+L+ LEVLKL D AF G  W       F  LK   +G  +L  
Sbjct  554  LSLHNTSLNWDYMSILGNLQYLEVLKLKDYAFKGDYWKTKQGG-FPSLKVFFIGATDLTR  612

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            W A  +D  FP L+ LIL+ C +L+ IP DF ++  L+++++ +  + V   AR I
Sbjct  613  WDAKAND--FPELKCLILKQCKTLERIPSDFVHMKKLEMIKVEHTKDSVVSSARRI  666



>ref|XP_009618066.1| PREDICTED: putative late blight resistance protein homolog R1B-23, 
partial [Nicotiana tomentosiformis]
Length=738

 Score =   142 bits (358),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 147/260 (57%), Gaps = 18/260 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LPS P   + + + + TL  ++P SC  ++  K   L+K
Sbjct  489  IKADIWNMLQLRHLHTNIPAKLPS-PAITTGKASFLQTLSLVAPESCKKDVLAKACHLRK  547

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN----SEKVELKVTVFDKFLRRL  350
            L +RG ++  FL+T++    INNL+ LKCL++LKL  +    ++ + L    F + +R L
Sbjct  548  LNIRGQMAA-FLDTQKGG--INNLEELKCLEHLKLLNDVIYMNQALHLPAAFF-RIVRTL  603

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK-MN  527
            ++LTL+ T F W +   LG LE LEVLKL ++AF G  W       F  L+ L + K   
Sbjct  604  KRLTLANTRFAWSEANRLGQLESLEVLKLKEDAFIGDSWQPEVGG-FSQLQVLWIEKAAE  662

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREIC  707
            L TW A  S+ +FP+L  L+L +C  LQ +P   A++ NLK M L N  + V   A++I 
Sbjct  663  LETWEA--SNLNFPILRHLVLISCDKLQAVPRGLADIPNLKEMRLENTSKAVKS-AKDIL  719

Query  708  VKRHGKTNVKINAFNVFITP  767
              +  K+    + FN+ + P
Sbjct  720  ESKTSKS----SKFNLTVFP  735



>ref|XP_009792813.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=421

 Score =   138 bits (348),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 132/242 (55%), Gaps = 9/242 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +L S   + +   + + TL  ++P SC  ++  +   L+K
Sbjct  146  IKADIWNMLQLRHLHTNVPAKLTSPATQTTYGSSCLQTLSKVAPGSCGEDVLLRACNLKK  205

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVT----VFDKFLRRL  350
            + ++G ++E FLET +      N   LK L++LKL  +  +   KV      F ++L++L
Sbjct  206  VSIQGEMAE-FLETNKGG--FRNFAKLKFLEHLKLLNDFGRSMRKVVQLPPAFAEYLQKL  262

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
             KLTLS T F W D  +L  LE LEVLKL +NAFSG  WDL+    F  LK L + + + 
Sbjct  263  NKLTLSHTKFPWSDANILARLECLEVLKLKENAFSGTTWDLDIGGCFSQLKVLFIQRADF  322

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
              W A  SD SF  L+ L+L +C  L+ +P + A V +L+ M L N  + +       C 
Sbjct  323  EIWKA--SDLSFQRLKCLVLISCDKLEVVPFELAGVSSLQQMTLENTNKAIKSAKAIECR  380

Query  711  KR  716
            KR
Sbjct  381  KR  382



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score =   142 bits (359),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 143/270 (53%), Gaps = 20/270 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRG-------TNICTLCTISPASCTSEIFN  161
            I   IW M +LRH+HT + +   + PP  + +         NI T+ TISP SCT  I  
Sbjct  624  ILADIWKMLQLRHLHT-SGISFLNGPPSQTRKNYEDPFVRRNILTISTISPDSCTENILA  682

Query  162  KTPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD---  332
            +TP L+KLG+RG L  L +E K    + + L  L  L++LKL  ++  ++    +     
Sbjct  683  RTPNLRKLGIRGKLITL-VEEKGGSTMFDILAKLDRLESLKLLNDAFPLDPSRCIIPGLP  741

Query  333  ---KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLK  503
               KF   L+K+TLS TL  WD M+ LG L  LEVLKL D AF G  W+   D  F+ L+
Sbjct  742  PSYKFPPNLKKITLSDTLLDWDHMSTLGMLPNLEVLKLKDYAFKGSRWE-PLDGGFRLLR  800

Query  504  YLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
             L++G+ +LI W A  S   FP L+ ++ R+C SL+ IP   A V  L+ MEL+      
Sbjct  801  VLKIGRTDLIWWDA--SGHHFPRLQCVVFRHCSSLEAIPSGLAEVSALQNMELHWPKPTA  858

Query  684  SDFAREICVKRHGKTNVKI--NAFNVFITP  767
            +  AR I  ++     + +   AF +FI P
Sbjct  859  AYSARLIQRQKLQMQQLGLLNTAFKLFIYP  888



>gb|EYU22232.1| hypothetical protein MIMGU_mgv1a002671mg [Erythranthe guttata]
Length=648

 Score =   141 bits (355),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 128/225 (57%), Gaps = 7/225 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M +LRH+ TN S  LP +  K+S  G  + TL TISP SCT E+F++   L++
Sbjct  389  IKADIWKMIQLRHLKTNASAVLPKTG-KSSKEGEKLQTLGTISPQSCTEEVFDRARNLKR  447

Query  183  LGVRGNLSELF---LETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLR  353
            LG+RG L+ L    + +   +  + NL+ LK L ++  +  SE     +    KF  +LR
Sbjct  448  LGIRGRLASLIEGKVGSFDSLGKLGNLEKLKLLNDVFPNPPSEGQLRGLPQPYKFPPKLR  507

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
             LTL+ T   W  M+++G LE LEVLKL + AF GK W + +D  F+ L+ L +G+ +L+
Sbjct  508  SLTLADTFLDWCHMSIIGLLENLEVLKLKEKAFVGKSW-VAADGGFRCLEVLHIGRTDLV  566

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
             W A  S   FP L  L L  C  LQ +P   A++  L++++LY 
Sbjct  567  VWVA--SGHHFPRLRRLELHYCEELQEVPIGLADIPTLQLLDLYR  609



>ref|XP_009757879.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=917

 Score =   141 bits (356),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 130/226 (58%), Gaps = 13/226 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LP +  + +   + + TL  ++P SC  ++  +   L+K
Sbjct  643  IKADIWNMLRLRHLHTNVPAKLPPAT-QTTEESSCLQTLSKVAPGSCREDVLARACNLRK  701

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVT----VFDKFLRRL  350
            + ++G +++ FLE  +     NN + LKCL+ LKL  +    + KV      F +FLR+L
Sbjct  702  VSIQGEMAD-FLEINKGG--FNNFRKLKCLEQLKLLNDVGMSKSKVLQLPPAFLEFLRKL  758

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F W D   LG LE L+VLKL +NAFSG  WD      F  LK L + + + 
Sbjct  759  KKLTLSNTKFVWSDANGLGRLECLQVLKLKENAFSGTAWDSEG---FSQLKVLWIERADF  815

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
              W A  S++SF  L+ L+L +C  L+ +P +FA V +L+ M L N
Sbjct  816  TNWRA--SNRSFQRLKYLVLISCDKLEAVPFEFAGVSSLQEMTLEN  859



>ref|XP_009620237.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=928

 Score =   141 bits (356),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/253 (39%), Positives = 134/253 (53%), Gaps = 11/253 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW+M KL H+HTN  ++LP  P       + + TL  ++P SCT ++ +    L+K
Sbjct  677  IKADIWSMLKLMHLHTNIPVRLPPPPTPTGKISSALQTLSVVAPESCTKDVISIACNLKK  736

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNS----EKVELKVTVFDKFLRRL  350
            L +RGNL E FLE         N + LKCL++LKL  ++    EK+ L   +F  FLR L
Sbjct  737  LSIRGNLVE-FLEINGGGW--RNFEELKCLEHLKLLNDALYTDEKIHLP-PLFITFLRTL  792

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KL LS T F W +   LG LE LEVLKL +NAF GK W       F  L+ L +   +L
Sbjct  793  KKLILSNTKFDWSEANSLGELESLEVLKLKENAFIGKSWKPEIGG-FSELQVLLIKTTDL  851

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
             TW A  S+  FP L  L+L +C  L  +P + A V +L+ M L N C      A+EI  
Sbjct  852  ETWEA--SEFHFPRLRQLVLISCDKLTAVPYELAYVHSLREMRLVNACSTAVRSAKEIER  909

Query  711  KRHGKTNVKINAF  749
            K+      K+  F
Sbjct  910  KKLESIKFKLTVF  922



>ref|XP_009761103.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score =   141 bits (355),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 138/260 (53%), Gaps = 19/260 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKL  176
            +   IWNM +LRH+HTN   +L   PP  +S G   C  TL  ++P SC  E+  K   L
Sbjct  626  VKADIWNMLQLRHLHTNIPAKL--QPPAATSSGKASCLQTLSMVAPESCEKEVLAKACHL  683

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN---SEKVELKVTVFDKFLRR  347
            +KL +RG ++      K     INNL+ LKCL+ L L  +     K       F + +R 
Sbjct  684  KKLSIRGQMAAFLGAYKGG---INNLEELKCLEQLNLVNDVLYMNKAPHLPPTFSQLVRT  740

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            ++KLTL+ T F W +   LG LE LEVLK  +NAF+G  W   +   F  L+ L + +  
Sbjct  741  VKKLTLTNTRFGWSEADKLGKLEALEVLKFKENAFAGDSWKPKTG--FCALQVLWIERSE  798

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREIC  707
            L +W A  SD +FP+L  L+L +C  L+ +P + AN+ NL+ M L N  + V   A++I 
Sbjct  799  LESWEA--SDINFPMLRHLVLISCDKLEAVPLELANITNLQEMRLENTSKAVKS-AKDI-  854

Query  708  VKRHGKTNVKINAFNVFITP  767
              +  KT   I  FN+ I P
Sbjct  855  --QESKTAKSIK-FNLTIFP  871



>dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum]
Length=364

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 123/205 (60%), Gaps = 13/205 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSR----GTNICTLCTISPASCTSEIFNKTP  170
            I   IWNM +LRH+HTN+S +LP      SS+      ++ TL TI+P SCT E+F +TP
Sbjct  165  IQANIWNMARLRHLHTNSSAKLPLPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTP  224

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE--LKVTVFDKFLR  344
             L+KLG+RG ++ L    K    L+ N++ L+ L+NLKL  +S +    L++     F  
Sbjct  225  NLKKLGIRGKIAVLLEPNKS---LLKNVKKLEYLENLKLINDSSQTGKGLRLPPSYIFPT  281

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +LRKL+L  T  +W+DM++LG LE LEVLKL +N F G+ W+  S   F  L  L + + 
Sbjct  282  KLRKLSLVDTWLEWNDMSILGQLEHLEVLKLIENGFMGECWE--SVGGFCSLLVLWIERT  339

Query  525  NLITWTAVDSDKSFPVLESLILRNC  599
            +L++W A  S   FP L+ L+L  C
Sbjct  340  DLVSWKA--SADHFPRLKHLVLICC  362



>ref|XP_009803158.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=895

 Score =   140 bits (353),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 137/238 (58%), Gaps = 13/238 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW + +LRH+HTN   +LP  P   +   + + TL  I+P SCT ++F K   L+K
Sbjct  646  IKANIWKLLRLRHLHTNVPAELPPPP-IPTGEPSCLQTLSLITPKSCTKDVFAKACNLKK  704

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN----SEKVELKVTVFDKFLRRL  350
            LG+RGN+ E FLET +      NL  LKCL+ L ++ +    S K  L  + F K  R L
Sbjct  705  LGIRGNM-EAFLETSKGGW--RNLGELKCLERLMIYNDGSNYSSKPHLPPSFF-KIRRTL  760

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T+F W +  +LG LE LEVLKL +NAF G  W++     F  L+ L +   +L
Sbjct  761  KKLTLSKTMFDWSEADILGQLECLEVLKLKENAFKGMSWEVERGA-FNNLQVLWIEGADL  819

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
              W A  S+  FP L  L+L+ C +LQ +P + A+V + + M+L N   + ++ AREI
Sbjct  820  KNWEA--SEYHFPKLRHLVLKFCENLQAVPYELADVPSFEEMKLENT-RKAAESAREI  874



>ref|XP_009778215.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=899

 Score =   139 bits (351),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 132/242 (55%), Gaps = 9/242 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +L S   + +   + + TL  ++P SC  ++  +   L+K
Sbjct  624  IKADIWNMLQLRHLHTNVPAKLTSPATQTTYGSSCLQTLSKVAPGSCGEDVLVRACNLKK  683

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVT----VFDKFLRRL  350
            + ++G ++E FLET +      N   LK L++LKL  +  +   KV      F + L++L
Sbjct  684  VSIQGEMAE-FLETNKGG--FRNFAKLKFLEHLKLLNDFGRSMRKVVQLPPAFAEHLQKL  740

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
             KLTLS T F W D  +L  LE LEVLKL +NAFSG  WDL+    F  LK L + + +L
Sbjct  741  NKLTLSNTKFPWSDANILARLECLEVLKLKENAFSGTTWDLDIGGCFSQLKVLFIQRADL  800

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
              W A  SD SF  L+ L+L +C  L+ +P + A V +L+ M L N  + +       C 
Sbjct  801  EIWKA--SDLSFQRLKCLVLISCDKLEVVPFELAGVSSLQQMTLENTNKAIKSAKAIECR  858

Query  711  KR  716
            KR
Sbjct  859  KR  860



>ref|XP_009630452.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=902

 Score =   139 bits (349),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 132/226 (58%), Gaps = 13/226 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LP +  + +   + + TL  ++P SC  ++  +   L+K
Sbjct  628  IKADIWNMLRLRHLHTNVPAKLPPAT-QTTDESSCLQTLSKVAPGSCREDVLARACNLRK  686

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLH---GNSEKVELKVT-VFDKFLRRL  350
            + ++G +++ FLE  +     NN + LKCL+ LKL    G+S    L++   F +FL +L
Sbjct  687  VSIQGEMAD-FLEINKGG--FNNFRKLKCLEQLKLLNDVGSSMSKILQLPPAFVEFLCKL  743

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F W D   LG LE L+VLKL +NAFSG  WD +    F  LK L + +++ 
Sbjct  744  KKLTLSNTKFVWSDANTLGRLECLQVLKLKENAFSGTAWDSDG---FSQLKVLWIERVDF  800

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
             TW A  S+ SF  L+ L+L +C  L+ +P +FA V +L  M L N
Sbjct  801  ETWKA--SNSSFQRLKYLVLISCDKLEAVPFEFAGVSSLHEMTLEN  844



>ref|XP_011072129.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=884

 Score =   139 bits (349),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 145/273 (53%), Gaps = 36/273 (13%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M +LRH+ TN S  LP    K+S  G  + TL TI+P SCT E+F +   L+K
Sbjct  629  IKADIWKMIQLRHLKTNASTTLPKV--KSSKEGEKLRTLGTIAPQSCTDEVFERARNLKK  686

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD----------  332
            LG+RG L+ L ++ K                +L    N EK++L   VF           
Sbjct  687  LGIRGRLA-LLIDGKSG-----------SFDSLGKLENLEKLKLLNDVFPSPPSEGQLRG  734

Query  333  -----KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKG  497
                 KF ++L+ LTL+ T   W +M++LG LE LEVLKL D +F GK W+  +D  F+ 
Sbjct  735  LPPPYKFPKKLKSLTLADTFLDWSNMSILGLLENLEVLKLKDKSFMGKCWE-AADGGFRR  793

Query  498  LKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCE  677
            L+ L +G+ +L+ W A  S   FP L  L L+NC  L+ +P   A+++N ++++LY   +
Sbjct  794  LEVLHIGRTDLVFWIA--SAHHFPRLRRLELQNCEELKEVPIGLADIENFQILDLYRT-K  850

Query  678  RVSDFAREI--CVKRHGKTNVKINAFNVFITPL  770
              S  A++I    K+ G+T  K   F + I P+
Sbjct  851  FASASAKKIGEAKKKQGQTG-KAGGFKLSIFPI  882



>ref|XP_004234046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=866

 Score =   138 bits (347),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 133/235 (57%), Gaps = 14/235 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I+  I NM  LRHVHTN S +L  S  K  +  + + TL  I   + T ++F +   L+K
Sbjct  627  IEADICNMPHLRHVHTNASGKLCPSVLKTRNHRSALQTLSIIEAETLTEDVFARCQNLKK  686

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            LG+RG++++          L+  L++    K   ++  S K++L    +  F RRL++LT
Sbjct  687  LGIRGDMTK----------LVGLLKLEYLEKLKLMNLASGKLQLDSENYG-FPRRLKQLT  735

Query  363  LSGTLFQWDDM-TVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            LSGT   W+++   +G LE LEVLK+ +NAF G  W+L  D +F  LK L + +  L+ W
Sbjct  736  LSGTWLDWEEIHRAVGHLELLEVLKVKENAFRGDSWELKKDYVFPCLKVLWIERSELVCW  795

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
               D +  FP LE L+LRN   L+ IP +FAN+ NLK+MEL N  +     A++I
Sbjct  796  KGCDEN--FPSLERLVLRNLNKLEEIPINFANISNLKMMELVNTTKSTVKSAQKI  848



>gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Erythranthe guttata]
Length=766

 Score =   137 bits (346),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/263 (37%), Positives = 139/263 (53%), Gaps = 15/263 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM  LRH+ TN S  LP     +   G  + TL TISP SC+ ++F+    L+K
Sbjct  506  IKADIWNMLHLRHLKTNASASLPKRDNNSDKGGQKLQTLDTISPESCSEQVFDTACNLKK  565

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN------SEKVELKVTVFDKFLR  344
            LG+RG L+ L      K+    +L+ L  L+NLKL  +      SE     +    +F  
Sbjct  566  LGIRGPLASLI---DGKIGSFGSLRKLDHLENLKLLNDVFSRPASEGQLRYLPQPYEFPP  622

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +L+ LTLS T   W  M++LG LE+L VLKL DNAF GK W   +D  F+ L+ L +G  
Sbjct  623  KLKSLTLSDTSLDWSHMSILGLLEKLIVLKLKDNAFMGKTWK-TADGGFRHLEVLHIGPT  681

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL+ W A  S   FP L  L L NC  L  +P   A++ +L+ +EL N     +  A+EI
Sbjct  682  NLVVWKA--SGHHFPKLRRLELYNCEELIQVPIGLADIQSLQFLEL-NCSNFAAASAKEI  738

Query  705  --CVKRHGKTNVKINAFNVFITP  767
                K+  +  ++++ F + + P
Sbjct  739  RNIKKKQQEQTMQVSIFKLSVFP  761



>ref|XP_006367931.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X2 [Solanum tuberosum]
Length=932

 Score =   137 bits (345),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 133/237 (56%), Gaps = 12/237 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IWN+ +LRH HTN   +LP+ P   + + + + TL  ++P SC  ++  K   L+K
Sbjct  627  VKADIWNLLQLRHFHTNIPAKLPA-PATTTGKTSCLQTLSMVAPESCKKDVLAKACLLKK  685

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV---FDKFLRRLR  353
            L +RG ++  FLE K     I+NL+ LKCL++LKL  +   +   + +   F + +R ++
Sbjct  686  LSIRGQMAS-FLEPKGG---ISNLEELKCLEHLKLLNDVLYINKTIHLPPAFFRLVRTVK  741

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
            KLTL  T F W D   L  LE LEVLKL +NAF G  W L     F  L+ L + + +L 
Sbjct  742  KLTLVNTRFSWSDANKLAQLEHLEVLKLKENAFIGNSWTLEIGC-FSALQVLWIERSDLE  800

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +W A  S  +FP+L  L+L +C  L+ +P   A++ N + M L++  E V   A+EI
Sbjct  801  SWMA--SSCNFPILRHLVLISCDKLKAVPLGLADIHNFQEMRLHDSKEAVKS-AKEI  854



>ref|XP_006367930.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X1 [Solanum tuberosum]
Length=932

 Score =   137 bits (345),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 133/237 (56%), Gaps = 12/237 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IWN+ +LRH HTN   +LP+ P   + + + + TL  ++P SC  ++  K   L+K
Sbjct  627  VKADIWNLLQLRHFHTNIPAKLPA-PATTTGKTSCLQTLSMVAPESCKKDVLAKACLLKK  685

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV---FDKFLRRLR  353
            L +RG ++  FLE K     I+NL+ LKCL++LKL  +   +   + +   F + +R ++
Sbjct  686  LSIRGQMAS-FLEPKGG---ISNLEELKCLEHLKLLNDVLYINKTIHLPPAFFRLVRTVK  741

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
            KLTL  T F W D   L  LE LEVLKL +NAF G  W L     F  L+ L + + +L 
Sbjct  742  KLTLVNTRFSWSDANKLAQLEHLEVLKLKENAFIGNSWTLEIGC-FSALQVLWIERSDLE  800

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +W A  S  +FP+L  L+L +C  L+ +P   A++ N + M L++  E V   A+EI
Sbjct  801  SWMA--SSCNFPILRHLVLISCDKLKAVPLGLADIHNFQEMRLHDSKEAVKS-AKEI  854



>gb|EYU21173.1| hypothetical protein MIMGU_mgv1a002728mg [Erythranthe guttata]
Length=643

 Score =   136 bits (342),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 136/261 (52%), Gaps = 18/261 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM  LRH+ TN S  LP     +   G  + TL TISP SC+ ++F+    L+K
Sbjct  391  IRADIWNMLHLRHLKTNASASLPKRDSSDKG-GQKLQTLDTISPQSCSEQVFDTACNLKK  449

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN------SEKVELKVTVFDKFLR  344
            LG+RG L+ L      K+     L+ +  L+NLKL  +      SE     +    +F  
Sbjct  450  LGIRGPLASLI---DGKIGSFGILRKMDHLENLKLLNDVFPRPASEGQLRYLPQPYEFPP  506

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +L+ LTLS T   W  M +LGSLE+L VLKL DNAF G++W   +D  F+ L+ L +G  
Sbjct  507  KLKSLTLSDTSLDWSHMPILGSLEKLIVLKLKDNAFMGEIWK-TADGGFRHLEVLHIGPT  565

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL+ W A  SD+ FP L  L L NC  L  +P   A++ +L+ +EL       S+FA   
Sbjct  566  NLVVWRA--SDRHFPKLRRLELYNCEELVQVPIGLADIQSLQFLEL-----NCSNFAAAS  618

Query  705  CVKRHGKTNVKINAFNVFITP  767
              K       +++ F + + P
Sbjct  619  AKKIRNIKKQQVSIFKLSVFP  639



>ref|XP_009596888.1| PREDICTED: uncharacterized protein LOC104092904 [Nicotiana tomentosiformis]
Length=267

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 124/221 (56%), Gaps = 17/221 (8%)
 Frame = +3

Query  24   MEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKLQKLGVRG  197
            M +LRH+HTN   +LP   P   +   ++C  TL  ++P SC  ++  +   L+K+ ++G
Sbjct  1    MLRLRHLHTNVPAKLP---PGTQTTDESLCLQTLSKVAPGSCREDVLVRACNLRKVSIQG  57

Query  198  NLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVT----VFDKFLRRLRKLTL  365
             +++ FLE  +     NN Q LKCL+ LKL  +    + KV      F +FLRRL+KLTL
Sbjct  58   EMAD-FLEINKGG--FNNFQKLKCLEQLKLLNDVGMSKSKVLQLPPAFLEFLRRLKKLTL  114

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            S T F W D   LG LE L+VLKL  NAFSG  WD      F  LK L + + +  TW  
Sbjct  115  SNTKFVWSDANRLGRLECLQVLKLKGNAFSGTAWDSEG---FSQLKVLWIERADFETWKT  171

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
              S+ SF  L+ L+L +C  L+ +P +FA + +L+ M L N
Sbjct  172  --SNLSFQRLKYLVLISCDKLEAVPFEFAGISSLQEMTLEN  210



>ref|XP_009788462.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=877

 Score =   136 bits (343),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 141/242 (58%), Gaps = 12/242 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I+  IWNM +LRH+HTN   +LPS     +S+ + + TL  ++P SC  ++  +   L+K
Sbjct  621  INADIWNMLRLRHLHTNVPAKLPSPSSTPTSKHSCLQTLSKVAPESCRKDVLARACNLRK  680

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKFLRRLRK  356
            L ++G +   F  +K      +N   LKCL++LKL  +  S+ + L  T F  FLR L+K
Sbjct  681  LCIQGQMVSFFETSKGG---FSNFGELKCLEHLKLLNDVLSKDLHLPPTFFG-FLRNLKK  736

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDV-IFKGLKYLRMGKMNLI  533
            LTLS T F+W +   L  LE LEVLKL +NAF G  W+  S++  F   K L + + +L 
Sbjct  737  LTLSKTQFEWSEANRLAQLECLEVLKLKENAFIGTSWE--SEIGGFSLPKVLWIDRADLK  794

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
            +W    S+  F  L++L+L++C+ L+ +P + A+V +L+ M L N  + +   A+EI +K
Sbjct  795  SWKV--SNAQFQNLKNLVLKSCVELEAVPIELADVRSLQEMRLENTIKAIKS-AKEIELK  851

Query  714  RH  719
            + 
Sbjct  852  KQ  853



>ref|XP_004236959.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=884

 Score =   136 bits (343),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 142/248 (57%), Gaps = 18/248 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   +WN+ +LRH+HTN   +LPS P   + + + + TL  ++P SC  ++  K   ++K
Sbjct  625  VKADLWNLLQLRHLHTNIPAKLPS-PTTTTGKPSCLQTLSMVAPESCEEQVLAKACNVKK  683

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL-----HGNSEKVELKVTVFDKFLRR  347
            L +RG + E FL   +    INNL+ LK L++LKL     H  ++ V+L  T F + +R 
Sbjct  684  LSIRGQM-EAFLGAYKGG--INNLEELKRLEHLKLLNDVPHYMNKTVQLPATFF-RLVRT  739

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLW--DLNSDVIFKGLKYLRMGK  521
            ++KLTL  T F W +   LG LE LEVLKL +NAF G  W  +L     F  L+ L + +
Sbjct  740  VKKLTLRNTRFSWSEAEKLGQLESLEVLKLKENAFVGDTWKPELGG---FCKLRVLWIER  796

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
              L TW A  S+ ++P+L +L+L +C  L  +P + A++ NL+ M+L N  + V   A++
Sbjct  797  AELETWEA--SNLNYPILRNLVLVSCDKLNAVPVELADIPNLREMKLENTIKAVKS-AKD  853

Query  702  ICVKRHGK  725
            I  ++  K
Sbjct  854  ILERKKSK  861



>ref|XP_011072005.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=886

 Score =   136 bits (342),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 141/264 (53%), Gaps = 14/264 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M +LRH+ TN S  LP +  K+S  G  + TL TISP SCT E+F +   L+K
Sbjct  629  IKADIWKMIQLRHLKTNASTTLPKTG-KSSKEGERLRTLGTISPQSCTEEVFERARNLKK  687

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN------SEKVELKVTVFDKFLR  344
            LG+RG L+ L      K    ++L  L+ L+ LKL  +      SE     +    KF R
Sbjct  688  LGIRGRLAMLI---DGKSGSFDSLGKLENLEKLKLLNDVFPSPPSEGQLRSLPPPYKFPR  744

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +L+ LTLS T   W  ++ LG LE LEVLKL+D +F GK W   +D  F+ L+ L +G+ 
Sbjct  745  KLKSLTLSDTFLDWSHISTLGLLENLEVLKLNDKSFMGKCWQ-AADGGFRRLEVLHIGRT  803

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNV-CERVSDFARE  701
            +L+ W A  S   FP L  L L NC  L+ +P   A ++N +V++LY       S     
Sbjct  804  DLVFWVA--SAHHFPRLRRLELHNCEELKEVPIGLAEIENFQVLDLYRTKFAAASAKKIG  861

Query  702  ICVKRHGKTNVKINAFNVFITPLQ  773
               K+  + N K+ AF + I PL+
Sbjct  862  DAKKKKEEQNGKVGAFKLSIFPLE  885



>ref|XP_009630520.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=889

 Score =   136 bits (342),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/242 (36%), Positives = 141/242 (58%), Gaps = 12/242 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LPS     +S+ + + TL  ++P SC  ++  +   L+K
Sbjct  633  IKADIWNMLRLRHLHTNVPAKLPSPSSTPTSKHSCLQTLSKVAPESCRKDVLARACNLRK  692

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKFLRRLRK  356
            L ++G +   F  +K      +N   LKCL++LKL  +  ++ + L  T F  FLR L+K
Sbjct  693  LCIQGQMVSFFETSKGG---FSNFGELKCLEHLKLLNDVLTKDLHLPPTFFG-FLRNLKK  748

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDV-IFKGLKYLRMGKMNLI  533
            LTLS T F+W +   L  LE LEVLKL +NAF G  W+  S++  F  LK L + + +L 
Sbjct  749  LTLSKTQFEWSEANRLAQLECLEVLKLKENAFIGTSWE--SEIGGFSLLKVLWIDRADLK  806

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
            +W    S+  F  L++L+L++C+ L+ +P + A++ +L+ M L +  + +   A+EI +K
Sbjct  807  SWKV--SNAQFQNLKNLVLKSCVELEAVPIELADIRSLQEMRLESTIKAIKS-AKEIELK  863

Query  714  RH  719
            + 
Sbjct  864  KQ  865



>ref|XP_009626721.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009626722.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=903

 Score =   135 bits (341),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 101/255 (40%), Positives = 140/255 (55%), Gaps = 16/255 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKL  176
            I   IWNM +LRH+HTN   +LP  PP +S +G   C  TL  +SP SCT +I  K   L
Sbjct  648  IKANIWNMLRLRHLHTNIPAKLP--PPPHSPKGKASCLQTLSVVSPESCTKDILAKACNL  705

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL----HGNSEKVELKVTVFDKFLR  344
            +KL ++G + +    +K   C   NL+ LKCL++LK+    H   + + +   +F KFLR
Sbjct  706  KKLSIQGRMIDFLGTSKGGWC---NLEELKCLEHLKMLNDIHSWGKTLHIP-PLFFKFLR  761

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             L+KLTL  T F W +   LG LE LEVLKL +NAF+G+ W       F  L+ L + + 
Sbjct  762  TLKKLTLLNTWFDWSEAERLGQLECLEVLKLKENAFAGESWRPERGG-FSQLQILWIERA  820

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L  W A  S+  FP L  L+L +C  LQ +P + A V +L+ M L N    V   AREI
Sbjct  821  DLKIWEA--SELHFPRLRHLVLISCDRLQAVPCELAGVPSLQEMSLENTYRAVKS-AREI  877

Query  705  CVKRHGKTNVKINAF  749
              K+   T  K+  F
Sbjct  878  ERKKMDSTKFKLTIF  892



>emb|CDP00589.1| unnamed protein product [Coffea canephora]
Length=907

 Score =   134 bits (338),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 130/236 (55%), Gaps = 7/236 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I+  IW M KLRH+ TNTS  LP    + SS   N+ TL T++P   T+++  +T KL+K
Sbjct  649  IEADIWGMTKLRHLRTNTSTLLPECSRQCSS-SENLQTLSTVAPECLTNDVLERTKKLKK  707

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE-LKVTVFDKFLRRLRKL  359
            LG+RGNL  L ++   +  L + L  L  L+NLKL  +    + L +    KF  RL +L
Sbjct  708  LGIRGNLGTL-VKANGESRLFDMLCELVSLENLKLRNDEVTSKLLALPPVHKFPARLTRL  766

Query  360  TLSGTLFQWD-DMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            +L  T   W   M +LG L  LEVLKL DNAF G+ W       F+ LK L +G  NL +
Sbjct  767  SLQDTSLDWQIHMPILGKLRFLEVLKLKDNAFMGEDWQTEGGG-FRCLKVLFIGSTNLKS  825

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            W A  ++  FP L  L+L+ C  L  IP DF  + +L++++L    + V   AR I
Sbjct  826  WDAKATN--FPQLRCLVLKQCKKLVRIPSDFVYMKHLEMIDLEYAKDSVVSSARRI  879



>emb|CDP16498.1| unnamed protein product [Coffea canephora]
Length=909

 Score =   133 bits (335),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 125/226 (55%), Gaps = 10/226 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTN----ICTLCTISPASCTSEIFNKTP  170
            I   IW M KLRH+HTNT+  LP    ++SS G      + TL  ISP S   E+F +T 
Sbjct  642  IQADIWGMTKLRHLHTNTTTSLPEYQDQSSSSGNRQTLPLQTLSAISPRSLRKEVFERTK  701

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELK-VTVFDKFLRR  347
            KL+KLG+ G+L  L +E      L + L  L  ++NLKLHG     EL+ +   +KF   
Sbjct  702  KLKKLGICGSLGTL-VEPDGDSHLFDYLCKLSTIENLKLHGADINSELQALPKSNKFPTN  760

Query  348  LRKLTLSGTLFQWD-DMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            L++L+L  T  +W+  M ++G L+ LEVLKL DNAF G  W       F+ LK L +G  
Sbjct  761  LKRLSLEKTSLKWNIHMPIIGKLQSLEVLKLKDNAFVGAEWKTEKGG-FRSLKVLFIGDT  819

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
            +L  W     D   P L  LIL+   SL+ +P DF ++ NL+ ++L
Sbjct  820  DLDNWEVEGDD--LPELRCLILKRIKSLEQMPSDFEHMKNLERIDL  863



>ref|XP_011072177.1| PREDICTED: disease resistance RPP8-like protein 3 [Sesamum indicum]
Length=861

 Score =   132 bits (333),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 127/234 (54%), Gaps = 9/234 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IW M +LR++ TN S+ L             + T   +SP SCT     K   L++
Sbjct  607  VKADIWQMIQLRYLKTNASITLAFETTGKGG-AEKLQTFYNLSPESCTENFCKKARYLKE  665

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN-----SEKVELKVTVFDKFLRR  347
            LG+RG L+ L      +    + ++M++ L+NLKL  +       + +LK+    KF  +
Sbjct  666  LGIRGRLALLLDAKGSRYSPFDFVEMMQHLENLKLINDLSLSPPSEWQLKIPPPFKFPPK  725

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            LR LTLS T F+W +M+VLG LE LEVLKL DNAF GK W+  +D  F+ L+ L++G  +
Sbjct  726  LRFLTLSFTYFEWSNMSVLGLLENLEVLKLKDNAFVGKSWE-TTDGGFRRLEVLQIGYTD  784

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
            L+ W A  S   FP L  L LRNC  L+ +P   A + +L++M L+   +   D
Sbjct  785  LVYWVA--SAHHFPRLRCLELRNCEELEEVPFGLAEIPSLEIMHLHRSTKSAVD  836



>gb|EYU40383.1| hypothetical protein MIMGU_mgv1a001106mg [Erythranthe guttata]
Length=888

 Score =   132 bits (331),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 136/261 (52%), Gaps = 16/261 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M +LRH  T  ++ L S     ++   N+ +L  +S   CT E+FNKTP L  
Sbjct  634  IKANIWKMRQLRHFKTKAAITLSSELKGEAAE--NLQSLSRLSTQCCTEELFNKTPNLIN  691

Query  183  LGVRGNLSELFLETKQKVCLI--NNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
            LG+RG+L+ L        CLI  N LQ LK L ++     SE    ++   D+F   L+ 
Sbjct  692  LGIRGDLATL----SDSRCLIKLNRLQKLKLLYDVFPDVTSENPLSRLAQPDRFPPNLKI  747

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L LS T   W  M+ LG L  L+VLKL D AF GK W+   +  F  L++L + + +L  
Sbjct  748  LELSATHLSWKHMSTLGKLGALKVLKLKDFAFVGKFWEAGVEGKFASLEFLLIARTDLEF  807

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
            WTA  S   FP L+ L+L+NC  L+ IP       +L+++++  V +  +  AR+I  ++
Sbjct  808  WTA--SSDCFPGLKCLVLKNCERLEEIPLLLHK--SLQILDIERVSKTAAASARKIEAEK  863

Query  717  ---HGKTN-VKINAFNVFITP  767
               HG+ +  K   F + I P
Sbjct  864  ECMHGQQHRAKRGGFKLIIAP  884



>ref|XP_009622940.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=890

 Score =   131 bits (329),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 141/266 (53%), Gaps = 22/266 (8%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I  GIW M +LRH+HTN  ++LP  P    S+ + + TL  I+P SCT  +  K   L+K
Sbjct  642  IKEGIWKMLQLRHLHTNKPVKLPL-PSNPISKSSCLQTLSKIAPESCTRNVLAKVCNLKK  700

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKFLRRLRK  356
            LG+ G L  L            + + LKCL+ LK+  +  S K++L   +F  +LR L+K
Sbjct  701  LGIEGKLEALLG--------FESFEELKCLERLKMLNDIMSPKIQLP-QLFFTYLRTLKK  751

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            LTLS T   W +   LG LE LEVLKL DNA  GK W   +   F+ L+ L +   +L T
Sbjct  752  LTLSSTKIDWSEAKELGKLESLEVLKLKDNACMGKSWKPEAGS-FRLLQVLWIHLTDLKT  810

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
            W    S+  F  L  L+L +C +L+ +P + AN   L  + L+N  +   + A+EI  K+
Sbjct  811  WDT--SNCRFGRLRHLVLISCYNLEAVPHELANSPYLTEIRLHNT-QNAENSAKEIKRKK  867

Query  717  ---HGKTNVKINAFNVFITPLQSQAT  785
                   N++   FN+ I P Q+ A+
Sbjct  868  LEMQAPGNIE---FNLVIFPPQADAS  890



>ref|XP_004236958.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score =   130 bits (328),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 129/231 (56%), Gaps = 13/231 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IWN+ +LRH+HTN   +LPS P   + + + + TL  ++P SC  E+  K   ++K
Sbjct  622  VKADIWNLLQLRHLHTNIPAKLPS-PTTTTGKPSCLQTLSMVTPESCEKEVLAKACNVKK  680

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN----SEKVELKVTVFDKFLRRL  350
            L +RG ++      K     INNL+ L+CL++LKL  +    ++ + L  T F + +  +
Sbjct  681  LSIRGQMAAFLGAYKGG---INNLKELQCLEHLKLLNDVLFMNKALHLPST-FSELVHTV  736

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTL+ T F W +   LG+LE LEVLK  +NAF+G  W+  S   F  L+ L + +  L
Sbjct  737  KKLTLTNTRFTWSEAEKLGTLESLEVLKFKENAFTGDFWEPKSG--FSALQVLWIERSEL  794

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
             +W A  S  +FP L  L+L +C  L  +P + A++ +L  M L N  + V
Sbjct  795  ESWEA--SVVNFPALRQLVLISCDKLDAVPLELADIPSLVEMRLDNTSKAV  843



>emb|CDP16500.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   128 bits (321),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 138/250 (55%), Gaps = 10/250 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M KLR +HTNT+  LP    ++SS    + TL TIS  S T E+F +T KL+K
Sbjct  435  IQADIWMMTKLRLLHTNTTASLPKCHDQSSS-SEYLQTLSTISSHSLTKEVFERTKKLKK  493

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            LG+ G+L  L ++T     L   L  L  L+NL+LH +  K+ L +   DKF + L++L+
Sbjct  494  LGISGSLGTL-VKTNGDSDLFECLCRLSSLENLRLHSDESKL-LALPQPDKFPKNLKRLS  551

Query  363  LSGTLFQWDD-MTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            L  T  +W++ M +LG L+ LEVLKL D AF G  W       F+ LK L +G  +L  W
Sbjct  552  LHKTGLEWNNHMPILGGLQSLEVLKLKDKAFVGVEWKTEKGG-FRSLKVLFIGDTDLENW  610

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRH  719
                 D   P L  LIL++  SL+ +P DF ++ NL+ ++L      +   A++I   + 
Sbjct  611  EVKADD--LPELRWLILKHIKSLEQMPSDFEHMKNLERIDLERTNRWLVKSAKDI---QK  665

Query  720  GKTNVKINAF  749
             +  +K++ +
Sbjct  666  SRPQIKLSVY  675



>ref|XP_011071970.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=906

 Score =   127 bits (320),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 142/262 (54%), Gaps = 23/262 (9%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            ++  IW + +LRH+ T  +++L     +    G N+ TL  +SP SC  E+F K   L++
Sbjct  650  VEANIWKLIQLRHLKTKAAIKLLEIKGEGRKAGENLQTLSRLSPESCKDEVFTKARNLKR  709

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN-SEKVE----LKVTVFDKFL-R  344
            LG+ G L  L     +  C + NL     L+NLKL  + S ++E    L+  +  KFL R
Sbjct  710  LGISGRLHNLL----EAHCSLENLAF---LENLKLVNDLSYELETGKSLRSLLQPKFLPR  762

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFS-GKLWDLNSDVIFKGLKYLRMGK  521
            +L++LTLS T   W DM+ LG ++ L+VLKL + AFS G  W +  D  F+ L++L +  
Sbjct  763  KLKRLTLSATYLDWSDMSTLGEIDTLQVLKLKNKAFSRGSRWKVQ-DGSFEKLQFLLIAN  821

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +LI W A  S   FP L  L+LRNC  L  IP   A  ++L+ +++ +V +   D A++
Sbjct  822  TDLIYWVA--SAGHFPSLRCLVLRNCEKLSEIPLCLA--ESLEKLDIAHVPDSAFDSAKK  877

Query  702  ICVKRH----GKTNVKINAFNV  755
            I  K+     G+ N +   F +
Sbjct  878  IQEKKELMSLGQENARWGTFEL  899



>ref|XP_006362553.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362554.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=239

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 115/188 (61%), Gaps = 9/188 (5%)
 Frame = +3

Query  114  TLCTISPASCTSEIFNKTPKLQKLGVRGNLSELFLETKQK---VCLINNLQMLKCLKNLK  284
            TL TI+P  CT+E+F +TP L+KLGVRG +  L LET +      L +N+  L CL+ LK
Sbjct  14   TLSTIAPECCTAEVFTRTPNLKKLGVRGKIDAL-LETSKDGSGSVLFSNIGKLACLEYLK  72

Query  285  LHGNSE--KVELKVTVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSG  458
            L  ++      L +     F ++L+KL+L  T F+W DM++LG L +LEVLKL + AF G
Sbjct  73   LVNDTRLSSKPLHLPPAYIFPQKLKKLSLVDTWFEWKDMSILGLLPDLEVLKLKEYAFKG  132

Query  459  KLWDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANV  638
            + W+   D  F  L+ L + + +L +W A  S  +FP L+ L L +C  L+ +P + A+V
Sbjct  133  QSWE-QEDGGFPRLQVLWIERTDLTSWKA--SSGNFPRLKHLALISCDKLEELPAELADV  189

Query  639  DNLKVMEL  662
             NL+++EL
Sbjct  190  KNLQLIEL  197



>ref|XP_011072180.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=879

 Score =   127 bits (320),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 143/255 (56%), Gaps = 14/255 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M  LRH+ TN S+ L ++    +  G  I TL  ISP SCT  +F +   L+K
Sbjct  629  IKADIWKMVHLRHLKTNASVILQNAGAGGN--GEKIQTLVNISPQSCTDNLFERAINLKK  686

Query  183  LGVRGNLSELFLETKQKVCLINNL------QMLKCLKNLKLHGNSEKVELKVTVFDKFLR  344
            LG+RG L+ + L+ K      +NL      + LK L +L +H    K+   +     F +
Sbjct  687  LGIRGQLT-MLLDDKGGSTTFDNLGKLQQLEKLKLLNDLHIHPKEAKLP-GLPPPHIFPK  744

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +L  LTLS TL  W+ M+VLG LE L+VLKL ++AF+G+ W+  +D  F+ L+ L++   
Sbjct  745  KLISLTLSYTLLGWEQMSVLGMLENLKVLKLKNDAFTGERWE-AADGGFQQLEVLQIEYA  803

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L+ W A  S   FP L+ L LRNC  L+ +P   A++ +L+V++L+   +  +  AREI
Sbjct  804  DLVFWEA--SSHHFPKLQHLSLRNCEELKALPFGLADILSLQVIDLHRTTKLAAVSAREI  861

Query  705  CVKRHGKTNVKINAF  749
                 G+  +K++ F
Sbjct  862  QADNKGR-RLKLSIF  875



>emb|CDP08033.1| unnamed protein product [Coffea canephora]
Length=869

 Score =   127 bits (318),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 119/238 (50%), Gaps = 30/238 (13%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M KLRH+ TN+SM LP    +++  G N+ TL  +SP S T+E+  +   L+K
Sbjct  628  IQADIWAMTKLRHLITNSSMSLPRCQEQSTISG-NLQTLSVVSPESLTNEVLERAKNLKK  686

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSE-KVELKVTVF---DKFLRRL  350
            LG+ GNL  L                      +K +G S   V  K+       +F  RL
Sbjct  687  LGISGNLGTL----------------------MKANGESNNDVNSKLLALPQPHRFPARL  724

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
             KL+L  T   WD M++LG L+ LEVLKL D AF+G+ W    +  F  LK L +G  +L
Sbjct  725  TKLSLQNTSLGWDQMSILGKLQYLEVLKLKDYAFTGEDWQ-TEEGGFLSLKVLFIGATDL  783

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
              W A  +D  FP L  LILR C  L  IP DF ++  L+ + L +    V   AR I
Sbjct  784  KCWEAQAND--FPELRCLILRQCKQLWRIPPDFVDMKKLEAIHLEHTTGSVISSARRI  839



>gb|EYU17742.1| hypothetical protein MIMGU_mgv1a023281mg [Erythranthe guttata]
Length=753

 Score =   126 bits (317),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 131/234 (56%), Gaps = 17/234 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            ++G +W+M +LRH+ T  +M L      N+  G NI TL T+SP SCT  +      +++
Sbjct  507  MNGNLWSMVRLRHLKTKAAMVLDQEQKGNA--GENIQTLSTLSPESCTETVAENARNVKE  564

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            LGVRGNL  LF + K         ++L   K   +H  S K+ L  T F  F R L++LT
Sbjct  565  LGVRGNLDTLF-DAK------FLEKLLSLEKLKLVHEISGKISLPKTSF--FPRNLKRLT  615

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            L  T  QW DM+ L  +E+LEVLKL   AF+G  W + SDV F  L++L M   +L+ W 
Sbjct  616  LRKTSLQWSDMSTLAKIEKLEVLKLKQGAFTGIKW-MVSDV-FPSLQFLLMDNADLVIWE  673

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            A  S + FP L  L ++ C  L+ IP + A  +NL+ +++Y + +  ++ AR I
Sbjct  674  A--SAEHFPSLTCLSIKKCRRLKEIPLELA--ENLQRLDIYFLRKSATESARAI  723



>ref|XP_009796670.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X4 [Nicotiana sylvestris]
Length=887

 Score =   125 bits (315),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 133/238 (56%), Gaps = 23/238 (10%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKLQKLG  188
            IWNM +LRH+H+N  ++LP   PK + +G   C  TL  ++P SC S +  K   L+KL 
Sbjct  635  IWNMLRLRHLHSNIPVRLPR--PK-TPKGEISCLRTLSMVAPESCNSCVLAKVGNLKKLS  691

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV------FDKFLRRL  350
            ++GN++  FLE  +     +N   LKCL+NLKL  +   V   ++V      F +F R L
Sbjct  692  IKGNMAP-FLEINKDG--FSNHGELKCLENLKLLND---VFTMISVLHLPPNFFRFARTL  745

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F W +   L  LE LEVLKL D AF+GK W L  +V F  L+ L +   + 
Sbjct  746  KKLTLSDTRFDWREAIGLEQLECLEVLKLKD-AFTGKSWKL--EVGFSELQALSIDTTDF  802

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             TW A  S   FP L  L+L  C  L+ +P  FA++ +L+ M L N  + V   A+EI
Sbjct  803  ETWEA--STHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRS-AKEI  857



>ref|XP_009796668.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009796669.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
Length=898

 Score =   125 bits (315),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 133/238 (56%), Gaps = 23/238 (10%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKLQKLG  188
            IWNM +LRH+H+N  ++LP   PK + +G   C  TL  ++P SC S +  K   L+KL 
Sbjct  635  IWNMLRLRHLHSNIPVRLPR--PK-TPKGEISCLRTLSMVAPESCNSCVLAKVGNLKKLS  691

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV------FDKFLRRL  350
            ++GN++  FLE  +     +N   LKCL+NLKL  +   V   ++V      F +F R L
Sbjct  692  IKGNMAP-FLEINKDG--FSNHGELKCLENLKLLND---VFTMISVLHLPPNFFRFARTL  745

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F W +   L  LE LEVLKL D AF+GK W L  +V F  L+ L +   + 
Sbjct  746  KKLTLSDTRFDWREAIGLEQLECLEVLKLKD-AFTGKSWKL--EVGFSELQALSIDTTDF  802

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             TW A  S   FP L  L+L  C  L+ +P  FA++ +L+ M L N  + V   A+EI
Sbjct  803  ETWEA--STHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRS-AKEI  857



>ref|XP_009796671.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
 ref|XP_009796672.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
Length=776

 Score =   125 bits (314),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 133/238 (56%), Gaps = 23/238 (10%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKLQKLG  188
            IWNM +LRH+H+N  ++LP   PK + +G   C  TL  ++P SC S +  K   L+KL 
Sbjct  495  IWNMLRLRHLHSNIPVRLPR--PK-TPKGEISCLRTLSMVAPESCNSCVLAKVGNLKKLS  551

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV------FDKFLRRL  350
            ++GN++  FLE  +     +N   LKCL+NLKL  +   V   ++V      F +F R L
Sbjct  552  IKGNMAP-FLEINKDG--FSNHGELKCLENLKLLND---VFTMISVLHLPPNFFRFARTL  605

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F W +   L  LE LEVLKL D AF+GK W L  +V F  L+ L +   + 
Sbjct  606  KKLTLSDTRFDWREAIGLEQLECLEVLKLKD-AFTGKSWKL--EVGFSELQALSIDTTDF  662

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             TW A  S   FP L  L+L  C  L+ +P  FA++ +L+ M L N  + V   A+EI
Sbjct  663  ETWEA--STHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRS-AKEI  717



>ref|XP_009796664.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=916

 Score =   125 bits (315),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 133/238 (56%), Gaps = 23/238 (10%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKLQKLG  188
            IWNM +LRH+H+N  ++LP   PK + +G   C  TL  ++P SC S +  K   L+KL 
Sbjct  635  IWNMLRLRHLHSNIPVRLPR--PK-TPKGEISCLRTLSMVAPESCNSCVLAKVGNLKKLS  691

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV------FDKFLRRL  350
            ++GN++  FLE  +     +N   LKCL+NLKL  +   V   ++V      F +F R L
Sbjct  692  IKGNMAP-FLEINKDG--FSNHGELKCLENLKLLND---VFTMISVLHLPPNFFRFARTL  745

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F W +   L  LE LEVLKL D AF+GK W L  +V F  L+ L +   + 
Sbjct  746  KKLTLSDTRFDWREAIGLEQLECLEVLKLKD-AFTGKSWKL--EVGFSELQALSIDTTDF  802

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             TW A  S   FP L  L+L  C  L+ +P  FA++ +L+ M L N  + V   A+EI
Sbjct  803  ETWEA--STHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRS-AKEI  857



>ref|XP_009796665.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009796666.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=906

 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 133/238 (56%), Gaps = 23/238 (10%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC--TLCTISPASCTSEIFNKTPKLQKLG  188
            IWNM +LRH+H+N  ++LP   PK + +G   C  TL  ++P SC S +  K   L+KL 
Sbjct  635  IWNMLRLRHLHSNIPVRLPR--PK-TPKGEISCLRTLSMVAPESCNSCVLAKVGNLKKLS  691

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV------FDKFLRRL  350
            ++GN++  FLE  +     +N   LKCL+NLKL  +   V   ++V      F +F R L
Sbjct  692  IKGNMAP-FLEINKDG--FSNHGELKCLENLKLLND---VFTMISVLHLPPNFFRFARTL  745

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F W +   L  LE LEVLKL D AF+GK W L  +V F  L+ L +   + 
Sbjct  746  KKLTLSDTRFDWREAIGLEQLECLEVLKLKD-AFTGKSWKL--EVGFSELQALSIDTTDF  802

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             TW A  S   FP L  L+L  C  L+ +P  FA++ +L+ M L N  + V   A+EI
Sbjct  803  ETWEA--STHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRS-AKEI  857



>ref|XP_011087333.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=841

 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 131/258 (51%), Gaps = 10/258 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   I  M +LRH+ T  ++ L  +       G N+ TL  +SP  CT ++F++ P L+ 
Sbjct  588  IKADILKMMQLRHLKTKAAVIL--TKEGKGEAGVNLRTLTRLSPQCCTKQVFDRAPYLKT  645

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            LG+RG L  L L   + +  +  L+ LK + +      SE     +   D+F   LR LT
Sbjct  646  LGIRGQL--LTLLDNRSLANLGRLEKLKLVNDAFPRVASENPLQGLPQPDRFPPNLRILT  703

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            LS T   W +M VLG L  LEVLKL +NAF GK WD+ +   F  L++L + + +L  WT
Sbjct  704  LSSTFLDWKNMFVLGMLNALEVLKLKENAFMGKCWDVVAGG-FNSLEFLYIARTDLQFWT  762

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK---  713
                   FP L  L+L+NC  L  +P     V+ L+ +++  V +     AR+I  +   
Sbjct  763  LSGRGDHFPKLRCLVLKNCEKLHEVPTCL--VEKLQTLDMERVTKHAVAAARKIEQEKQM  820

Query  714  RHGKTNVKINAFNVFITP  767
            ++G+ + +   F + I P
Sbjct  821  KYGEQSTRRGGFKLIIAP  838



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score =   125 bits (313),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 123/233 (53%), Gaps = 11/233 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--NICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M KLRH+H +  ++  S+   +S+     N+ T+  + P+S   E+  + P L  LG
Sbjct  619  IWQMVKLRHLHYSGELEFESASLSSSTPFVLYNLQTISQVRPSSSIQEVLARMPNLVNLG  678

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKL-HGNSEKVELKVTVFDKFLRRLRKLTL  365
                LS+       K     +L  L+ L+ L   +      +  +    KF   L+KLTL
Sbjct  679  CHLTLSD-----AMKHAQFPDLSRLRMLETLTFDYQTLNMAKFFLPQPSKFPPNLKKLTL  733

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
             G+   W +M+++G L  LEVLK+ DN F+   W++  D  F  LK+L++   +L  W+A
Sbjct  734  VGSYVDWKEMSIIGMLPNLEVLKIKDNFFNAPRWEV-MDEAFSHLKFLKLSNTDLQQWSA  792

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
              S  SFP L+ L+L  C +LQ IP  F ++D L+ +ELY   + V+D AR+I
Sbjct  793  --SSSSFPCLQQLVLDGCPNLQEIPSSFRSIDTLEAIELYYSSQSVADSARQI  843



>gb|EYU17689.1| hypothetical protein MIMGU_mgv1a024130mg [Erythranthe guttata]
Length=872

 Score =   124 bits (311),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 130/239 (54%), Gaps = 5/239 (2%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            +W+M++L+H+   T   LP+  P   S   N+ TL  +SP SCT ++F   P LQKLG+R
Sbjct  627  VWDMKELKHLEV-TGRNLPN--PSEGSLLPNLLTLLDVSPQSCTKDVFEGMPNLQKLGIR  683

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLSGT  374
               +    E+      +++L  LK LK + ++   +   +    F  F  RL+KL+LSG 
Sbjct  684  IEFAPDASESSNCFDHVSHLNELKSLKCVVVNPVFDTKVVAPPKFSIFPERLKKLSLSGF  743

Query  375  LFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVDS  554
             + W+DM  +  L  LEVLKL  +AF G +W+++   +F+ L+YL +   +L+ WTA   
Sbjct  744  GYPWEDMNKIALLPNLEVLKLQCHAFRGSIWEMHGSALFRELRYLLIEDTDLVHWTA--E  801

Query  555  DKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHGKTN  731
            D SFP L+ L +++C  L+ IP        L+++E+ +    V + A EI   R  + N
Sbjct  802  DGSFPWLKRLSIKHCYKLERIPRRLITYGFLELIEVVDCNPSVVNVALEIEESREKRNN  860



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score =   123 bits (309),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 132/260 (51%), Gaps = 34/260 (13%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPK-----NSSRGTNICTLCTISPASCTSEIFNKTPKLQ  179
            IW M  LRH+H   S+ LPS   +     NS    N+ TL  I+ A CT+++F+ TPKL+
Sbjct  650  IWKMPNLRHLHIKPSICLPSQTNEERNGYNSLVLNNLQTLTNITLADCTTDVFSSTPKLK  709

Query  180  KLGVRGNLSEL---------FLETKQKV--------------CLINNLQMLKCLKNLKLH  290
            KLG+   +            FL T + +              CL  NL +L  L+ LK+ 
Sbjct  710  KLGICETVEYTYPVQIPWSDFLYTSENLWPYCSDTISDLWSDCL-RNLALLPQLEALKIV  768

Query  291  GNSEKVELKVTVF--DKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL  464
            G    V++    F  D     L+KLTLS T   W+ MT L  L  LEVLKL   AF+G  
Sbjct  769  GLRAPVQVPKLAFHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKPYAFTGTK  828

Query  465  WDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDN  644
            W+   +  F  LK L++   +L  W+A  S+  FPVLE L+L+ C+ L +IP D  ++  
Sbjct  829  WE-QVEEGFCSLKLLQIEMFDLEHWSA--SNDHFPVLEHLVLKCCLHLDSIPHDLGDIPT  885

Query  645  LKVMELYNVCERVSDFAREI  704
            L+++EL N  +     A+EI
Sbjct  886  LQIIELENSSQSAVLSAKEI  905



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score =   123 bits (308),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 90/268 (34%), Positives = 136/268 (51%), Gaps = 19/268 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRG-------TNICTLCTISPASCTSEIFN  161
            I   IW M + +H++T + +     PP  + +         NI T+ T+ P  C   I  
Sbjct  623  IQVDIWKMSQFKHLYT-SGLSCLRGPPAKTRKDNEDPFVRRNIQTISTVLPDCCKENILA  681

Query  162  KTPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKV---ELKVTVFD  332
            +TP L+KLG+RG ++ L + T     L +NL  L  L+ LKL  ++  +   + +++   
Sbjct  682  RTPGLRKLGIRGKVATL-VATNGDSSLFDNLAKLDNLETLKLLNDTFPLPPSQCQISGLP  740

Query  333  ---KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLK  503
               KF   L+KLTLS T   W  ++ LG L  LEVLKL D AF G  W+   D  F+ L+
Sbjct  741  QSYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWE-PLDGGFRLLR  799

Query  504  YLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
             L +G+ NL  W A  S   FP L+ + L++C SL  IP     V +L+ MEL+      
Sbjct  800  VLHIGRTNLEHWNA--SGHHFPRLQQVFLKHCSSLNEIPFGLVEVPSLQNMELFWPTPAA  857

Query  684  SDFAREICVKRHGKTNVKINAFNVFITP  767
            +  AR I  ++  K ++K N F + I P
Sbjct  858  AASARFIQQEKQ-KGDIKDNVFKLVIYP  884



>ref|XP_009797674.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=711

 Score =   122 bits (307),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 136/265 (51%), Gaps = 13/265 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LP  P  ++ + + + TL  ++  SC   +F K   L+K
Sbjct  460  IKADIWNMLRLRHIHTNDPAKLPC-PSTSTGKASILQTLSQVASQSCRKNVFKKACHLKK  518

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            L +RG +   FLETK              L N  L+ +SE + + V  F KF+R L+KLT
Sbjct  519  LSIRGPMKS-FLETKCVNLEELKSLEELKLLNDFLY-SSEVLHIPVAFF-KFVRTLKKLT  575

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            LS T F W + + LG LE LEVLKL  +AF+G+ W       F  L+ L +   +L  W 
Sbjct  576  LSNTKFDWSEASRLGELECLEVLKLKQDAFTGESWRPEVGG-FSELQVLWIEMADLKLWE  634

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHG  722
               S   FP L  L+L +C  L+ +P + A++ + + M L N  + V   AREI  K+  
Sbjct  635  V--SQLHFPRLRHLVLISCDKLEAVPYELASIHSFQEMRLENTIKAVKS-AREIQRKKLE  691

Query  723  KTNVKINAFNVFITPLQSQATEHNQ  797
              N     FN+ I P +S   +  Q
Sbjct  692  SIN-----FNLTIFPPESDDLKATQ  711



>ref|XP_009591235.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=837

 Score =   122 bits (307),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 121/215 (56%), Gaps = 13/215 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWN+ +LRH+ TN   +L   PP  +  G+ +  L  ++P SC   +  K   L+K
Sbjct  629  IKANIWNLSRLRHLKTNIPAEL-LPPPNPTVEGSCLQILSKVAPESCNKVVLAKAGNLKK  687

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN----SEKVELKVTVFDKFLRRL  350
            L ++G L   FLET +     +  Q L  L+ LKL  +    SE + L   +F +FLR+L
Sbjct  688  LSIQGRLGA-FLETNKDG--FSTFQGLGRLEKLKLMNDVPYMSEALHLPPELF-RFLRKL  743

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F+W++   LG LE LEVLKL ++AF+GK W       FK L+ L + K +L
Sbjct  744  KKLTLSNTRFKWNEADRLGQLECLEVLKLKEDAFTGKSWKPEKGG-FKQLQVLWIQKADL  802

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFAN  635
              W A  S   FP L+ L+L NC  L+N+P + ++
Sbjct  803  ECWEA--SRDHFPRLKKLVL-NCAKLENVPVELSH  834



>gb|ABJ99598.1| NBS-LRR type resistance protein [Beta vulgaris]
Length=895

 Score =   122 bits (307),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 130/244 (53%), Gaps = 13/244 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQL---PSSPPK--NSSRGTNICTLCTISPASCTSEIFNKT  167
            I   IW M +LRH+HTN S      PSS  K  N    ++I TL +IS  SCTS++  + 
Sbjct  630  IRADIWKMFQLRHLHTNVSANFVMRPSSKTKKQNHQGPSHIKTLTSISADSCTSKLLARI  689

Query  168  PKLQKLGVRGNLSELFLETKQK-VCLINNLQMLKCLKNLKLHGN-SEKVELKVTVF---D  332
            P + KLG    L EL +  +   V     L  +K L+ LK +G+ S     K++ F   +
Sbjct  690  PTVTKLGHSRKLEELIMPPQGGGVSTFEALANMKYLETLKFYGDVSSNARSKISHFPGHN  749

Query  333  KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLR  512
            KF   LR LT++ T+  W+   +LG L  L +LKL +NAF G+ W    D  F+ L+   
Sbjct  750  KFPPNLRNLTITDTMLSWEHTDILGMLPNLVMLKLKENAFMGEYWKPKDDG-FRTLEVFY  808

Query  513  MGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDF  692
            +G+ NL  W A  S+  FP L+ LIL+ C  L+ +    A++  L++++++     V+  
Sbjct  809  LGRTNLQKWEA--SNYHFPSLKKLILKFCDRLEGLSSSLADISTLQLIDIHMANPVVAAC  866

Query  693  AREI  704
            AR+I
Sbjct  867  ARQI  870



>ref|XP_009763000.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Nicotiana 
sylvestris]
 ref|XP_009763001.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Nicotiana 
sylvestris]
 ref|XP_009763002.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Nicotiana 
sylvestris]
Length=840

 Score =   122 bits (307),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 121/215 (56%), Gaps = 13/215 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWN+ +LRH+ TN   +L   PP  +  G+ +  L  ++P SC   +  K   L+K
Sbjct  629  IKANIWNLSRLRHLKTNIPAEL-LPPPNPTVEGSCLQILSKVAPESCNKVVLAKAGNLKK  687

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN----SEKVELKVTVFDKFLRRL  350
            L ++G L   FLET +     +  Q L  L+ LKL  +    SE + L   +F +FLR+L
Sbjct  688  LSIQGRLGA-FLETNKDG--FSTFQGLGRLEKLKLMNDIPYMSEALHLPPELF-RFLRKL  743

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS T F+W++   LG LE LEVLKL ++AF+GK W       FK L+ L + K +L
Sbjct  744  KKLTLSNTRFKWNEADRLGQLECLEVLKLKEDAFTGKSWKPEKGG-FKQLQVLWIQKADL  802

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFAN  635
              W A  S   FP L+ L+L NC  L+N+P + ++
Sbjct  803  ECWEA--SRDHFPRLKKLVL-NCAKLENVPVELSH  834



>ref|XP_006357457.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=985

 Score =   122 bits (306),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/227 (36%), Positives = 120/227 (53%), Gaps = 24/227 (11%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I  GIW M  LRH+H       P      S++  N+  L  ++  SCTSE+F+  P L+K
Sbjct  626  IPAGIWQMSNLRHLHIGDFFSFPIP----SNKLQNLQELSRLALTSCTSELFSAIPNLKK  681

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL--RRLRK  356
            L + GN     +E K++      L  L CLK L++    +       +  K++    L++
Sbjct  682  LKIIGNY---LMEMKRE-----RLNSLSCLKKLEILKYRDDGIQPSQIPSKYVLPASLKR  733

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            LTLS T   W DM  + +L  LEVLK+ DN F G  W LN + IFK LK+L      LI+
Sbjct  734  LTLSCTSLPWKDMANVITLPNLEVLKIKDNGFLGDEWMLNDEEIFKQLKFL------LIS  787

Query  537  WTAVDSDKS----FPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
            WT +   K+    FP L+ L L+ C++L+ IP+DF  +  L+ +EL+
Sbjct  788  WTGLKHWKAGSVNFPKLQRLFLKRCMNLEKIPQDFGEICTLESIELH  834



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score =   122 bits (306),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 123/227 (54%), Gaps = 24/227 (11%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I  GIW M  LRH+H       P      S++  N+  L  ++ +SCT E+F+  P L+K
Sbjct  628  IPEGIWQMRNLRHLHIGDFFSFPIP----SNKLQNLQELSRLALSSCTCELFSAIPNLKK  683

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL--RRLRK  356
            L + GN     +E K++      L  L CL+ L++    +       +  K++    L++
Sbjct  684  LKIIGNY---LMEMKRE-----RLNSLSCLEKLEILKYRDDGIQPSQIPSKYVLPASLKR  735

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            LTLS T   W+DM  + +L  LEVLK+ DN F G +W LN + IFK LK+L      LI+
Sbjct  736  LTLSCTSLPWEDMANIITLPNLEVLKIKDNGFLGDVWMLNDEEIFKQLKFL------LIS  789

Query  537  WTAVDSDKS----FPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
            WT +   K+    FP L+ L L+ C++L+ IP+DF ++  L+ +EL+
Sbjct  790  WTGLKHWKAGSVNFPKLQRLFLKRCMNLEEIPQDFGDICTLESIELH  836



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 135/260 (52%), Gaps = 34/260 (13%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPK-----NSSRGTNICTLCTISPASCTSEIFNKTPKLQ  179
            IW M  LRH+H   S+ LPS   +     NS    N+ TL  I+ A CT+++F+ TPKL+
Sbjct  642  IWKMPNLRHLHIKPSICLPSQTNEERSGHNSLVLNNLQTLTNITLADCTTDVFSSTPKLK  701

Query  180  KLGVRGNLSEL---------FLETKQKV--------------CLINNLQMLKCLKNLKLH  290
            KLG+   +            FL T + +              CL  NL +L  LK LK+ 
Sbjct  702  KLGICETVEYTYPVQIPWSDFLYTSENLWPYCSDTISDLWSDCL-RNLALLPQLKALKIV  760

Query  291  GNSEKVEL-KVTV-FDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL  464
            G +  V++ K+ +  D     L+KLTLS T   W+ M  L  L  LEVLKL + AF+G  
Sbjct  761  GLTPPVQVPKLALHLDALPENLKKLTLSFTYLPWESMASLCRLPNLEVLKLKNYAFTGPK  820

Query  465  WDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDN  644
            W+   +  F  LK L +   ++  W+A  S+  FPVLE L+L++C+ L +IP D  ++  
Sbjct  821  WE-QVEEGFGSLKLLLIEISDIKHWSA--SNDHFPVLEHLVLKSCLHLDSIPHDLGDIPT  877

Query  645  LKVMELYNVCERVSDFAREI  704
            L+++EL N  +     A+EI
Sbjct  878  LQIIELENSSQSAVLSAKEI  897



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 134/255 (53%), Gaps = 18/255 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M +LRH++   S+ +  S P +   G N+ ++  +SP  CT EIF    K++KL +R
Sbjct  628  IWQMSQLRHLY---SIGISLSSPGDKVLG-NLQSVSGLSPRCCTKEIFEGIKKVKKLAIR  683

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHG------NSEKVELKVTVFDKFLRRLRK  356
            G   E   + K     I+NL+ L+ L++L +        N  +    +T  D F ++L+K
Sbjct  684  GWNGEYPTDLKW----IDNLKHLQDLESLSIEIQYWSTINGTRF-FSLTSSDSFPQKLKK  738

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L LS T   W+ M+++  L ELEVLKL  +A  G  W     +    L++L +  +NL  
Sbjct  739  LKLSRTCLPWEYMSIISKLPELEVLKLKYDALVGDEWKATDQIGLPKLRFLLLANLNLEK  798

Query  537  W-TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
            W T   S   FP LE +I+ NC  L+ IP+ FA+   L+++EL+     +  FA +I  K
Sbjct  799  WRTTAGSHDHFPGLECVIITNCKFLKEIPQGFADSKKLELIELHKCDPSLVAFAEKIQEK  858

Query  714  RH--GKTNVKINAFN  752
                G+  +K+ AFN
Sbjct  859  HEDLGRNKLKVTAFN  873



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/281 (34%), Positives = 155/281 (55%), Gaps = 25/281 (9%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTL------CTISPASCTSEIFNKTPK  173
            GIW + +LRH+H  TSM +  SP K S    N   L        +S + CT E+F    K
Sbjct  620  GIWGLSQLRHLHC-TSMYV-HSPRKVSVNEVNHPILEKLLSVSGLSLSCCTKEMFEGIKK  677

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKV---ELKVTVFDKFLR  344
            ++KLG+ G  +E F++  +  CL +NL  L  L+ LK+ G +  +   + ++     F  
Sbjct  678  VKKLGIFGTGNE-FIDVPE--CL-DNLIHLHELETLKIAGFNMDLLDFDFRLPRLVSFPP  733

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAF----SGKLWDLNSDVIFKGLKYLR  512
             L+KLTLS T   W+DMT++  L +LEVL+L ++AF    S + W++ +++ F  LK++ 
Sbjct  734  NLKKLTLSKTYLPWEDMTIISKLPKLEVLQLKNSAFVEAWSAERWEV-TEMGFPELKFVL  792

Query  513  MGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDF  692
            + K++L  W A D D +FP LE +++RNC  L+ IP+ FA+   L+ +EL+     +  F
Sbjct  793  LEKLDLKYWRAADIDDNFPCLERVVIRNCSYLKQIPKVFADSGTLQRIELWGCSPSLVTF  852

Query  693  AREICVKRH--GKTNVKINAFNVFITPLQSQATEHNQEYGE  809
            A++I       G   +K+ AF+   T  +  + E N+E  E
Sbjct  853  AKKIQENHEDLGNNMLKVYAFD---TIGEVNSDEVNEEAAE  890



>ref|XP_009603760.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 130/249 (52%), Gaps = 8/249 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LPS P  ++ + +++ TL  ++   C   +  K   L+K
Sbjct  633  IKADIWNMLRLRHIHTNVPAKLPS-PSTSTGKASSLQTLSQVASQCCRKNVLAKACHLKK  691

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            L VRG +   FLET               L N  L+ + E + + V  F  F+R L+KLT
Sbjct  692  LSVRGPMKS-FLETNCVNLEELKFLEELKLLNDFLY-SGEVLRIPVAFF-TFVRTLKKLT  748

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            LS T F W + + LG LE LEVLKL  +AF+G+ W       F+ L+ L +   +L  W 
Sbjct  749  LSNTKFDWSEASRLGKLECLEVLKLKQDAFTGESWRPEVGGFFE-LRVLWIEMEDLKLWE  807

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHG  722
            A  S+  FP L  L+L +C  L+ +P + A++ + + M L N  + V   AREI  K+  
Sbjct  808  A--SELHFPRLRHLVLISCDKLEAVPYELASIHSFQEMRLENTIKAVKS-AREIQRKKLE  864

Query  723  KTNVKINAF  749
              N K+  F
Sbjct  865  SINFKLTIF  873



>ref|XP_009603761.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=880

 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 130/249 (52%), Gaps = 8/249 (3%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LPS P  ++ + +++ TL  ++   C   +  K   L+K
Sbjct  629  IKADIWNMLRLRHIHTNVPAKLPS-PSTSTGKASSLQTLSQVASQCCRKNVLAKACHLKK  687

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            L VRG +   FLET               L N  L+ + E + + V  F  F+R L+KLT
Sbjct  688  LSVRGPMKS-FLETNCVNLEELKFLEELKLLNDFLY-SGEVLRIPVAFF-TFVRTLKKLT  744

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            LS T F W + + LG LE LEVLKL  +AF+G+ W       F+ L+ L +   +L  W 
Sbjct  745  LSNTKFDWSEASRLGKLECLEVLKLKQDAFTGESWRPEVGGFFE-LRVLWIEMEDLKLWE  803

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHG  722
            A  S+  FP L  L+L +C  L+ +P + A++ + + M L N  + V   AREI  K+  
Sbjct  804  A--SELHFPRLRHLVLISCDKLEAVPYELASIHSFQEMRLENTIKAVKS-AREIQRKKLE  860

Query  723  KTNVKINAF  749
              N K+  F
Sbjct  861  SINFKLTIF  869



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score =   121 bits (304),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/238 (33%), Positives = 125/238 (53%), Gaps = 18/238 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M+ LRH+H    +S ++PSS   +  +  N+  L  IS + CT  +F   P L++L 
Sbjct  635  IWKMKLLRHLHVRKISSFRVPSSKEGSGFKLQNLEGLSDISISCCTKGLFTGFPNLKRLK  694

Query  189  VRGNLSE----LFLETKQKVCLINNLQMLK--CLKNLKLHGNSEKVELKVTVFDKFLRRL  350
            + G  +E    +  +T   +  +N L++LK  C + L  H    K  L  +        L
Sbjct  695  IHGAWAECRRDMIFQTLNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTS--------L  746

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            ++LTL  T   W+DM  + +L  L+VLK+ DN F G +W LN+   F  LK+L + + NL
Sbjct  747  KRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNL  806

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
              W A     +FP L+ L+L+ C+ L+ IP+D   +  L+ +EL+N    V+   +EI
Sbjct  807  KHWDA--GSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEI  862



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score =   121 bits (303),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/275 (31%), Positives = 141/275 (51%), Gaps = 21/275 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M+ LRH+H    +S ++PSS   +  +  N+  L  IS + CT  +F   P L++L 
Sbjct  635  IWKMKLLRHLHVRKISSFRVPSSKEGSGFKLQNLEGLSDISISCCTKGLFTGFPNLKRLK  694

Query  189  VRGNLSE----LFLETKQKVCLINNLQMLK--CLKNLKLHGNSEKVELKVTVFDKFLRRL  350
            + G  +E    +  +T   +  +N L++LK  C + L  H    K  L  +        L
Sbjct  695  IHGAWAECRRDMIFQTLNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTS--------L  746

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            ++LTL  T   W+DM  + +L  L+VLK+ DN F G +W LN+   F  LK+L + + NL
Sbjct  747  KRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNL  806

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
              W A     +FP L+ L+L+ C+ L+ IP+D   +  L+ +EL+N    V+   +EI  
Sbjct  807  KHWDA--GSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQE  864

Query  711  KRHGKTNVKINAFNVFITPLQSQATEHNQEYGEVN  815
            ++    N  I +  +   P ++Q    ++EY ++ 
Sbjct  865  EQESMAN-DILSVRIHEKPCENQTI--SKEYFQIR  896



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score =   121 bits (303),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 132/267 (49%), Gaps = 17/267 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNK  164
            I   IW M + +H++T+    L   P K            NI T+ T+ P  C   I  +
Sbjct  623  IQVDIWKMSQFKHLYTSGLSCLRGPPAKTRKDNADPFVRRNIQTISTVLPDCCKENILAR  682

Query  165  TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKV---ELKVTVFD-  332
            TP L+KLG+RG L+ L + T     L +NL  L  L+ LKL  ++  +   + ++     
Sbjct  683  TPGLRKLGIRGKLATL-VATNGDSSLFDNLAKLDNLETLKLLNDTFPLPPSQCQIPGLPQ  741

Query  333  --KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKY  506
              KF   L+KLTLS T   W  ++ LG L  LEVLKL D AF G  W+   D  F+ L+ 
Sbjct  742  SYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWE-PLDGGFRLLRV  800

Query  507  LRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVS  686
            L +G+ NL  W A  S   FP L+ + L++C SL  IP     V +L+ +EL+      +
Sbjct  801  LHIGRTNLEHWNA--SGHHFPRLQQVFLKHCSSLNEIPFGLVEVSSLQNIELFWPTPAAA  858

Query  687  DFAREICVKRHGKTNVKINAFNVFITP  767
              AR I  +   + ++K N F + I P
Sbjct  859  ASAR-IIQQEKQEGDIKDNVFKLVIYP  884



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score =   121 bits (303),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/275 (31%), Positives = 141/275 (51%), Gaps = 21/275 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M+ LRH+H    +S ++PSS   +  +  N+  L  IS + CT  +F   P L++L 
Sbjct  619  IWKMKLLRHLHVRKISSFRVPSSKEGSGFKLQNLEGLSDISISCCTKGLFTGFPNLKRLK  678

Query  189  VRGNLSE----LFLETKQKVCLINNLQMLK--CLKNLKLHGNSEKVELKVTVFDKFLRRL  350
            + G  +E    +  +T   +  +N L++LK  C + L  H    K  L  +        L
Sbjct  679  IHGAWAECRRDMIFQTLNNLSCLNKLEILKIICSRKLYPHPLPSKYALPTS--------L  730

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            ++LTL  T   W+DM  + +L  L+VLK+ DN F G +W LN+   F  LK+L + + NL
Sbjct  731  KRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLIDRTNL  790

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
              W A     +FP L+ L+L+ C+ L+ IP+D   +  L+ +EL+N    V+   +EI  
Sbjct  791  KHWDA--GSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKEIQE  848

Query  711  KRHGKTNVKINAFNVFITPLQSQATEHNQEYGEVN  815
            ++    N  I +  +   P ++Q    ++EY ++ 
Sbjct  849  EQESMAN-DILSVRIHEKPCENQTI--SKEYFQIR  880



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score =   120 bits (302),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 132/260 (51%), Gaps = 34/260 (13%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT-----NICTLCTISPASCTSEIFNKTPKLQ  179
            IW M  LRH+H   S+ LPS      +R +     N+ TL  I+ A CT ++F+ TPKL+
Sbjct  647  IWTMPNLRHLHVKPSICLPSPTKVECNRYSSLVLNNLQTLVNITLADCTKDVFSSTPKLK  706

Query  180  KLGVRGNLSEL---------FLETKQKV--------------CLINNLQMLKCLKNLKLH  290
            KLG+  ++            FL T +K+              C   NL +L  L+ LK+ 
Sbjct  707  KLGICESIEYTYPVQIPWSDFLYTSEKLWPYGSETISDLWSDCF-RNLALLPQLEALKIF  765

Query  291  GNSEKV-ELKVTV-FDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL  464
            G    V ELK+    D     L+KLTLS T   W+ MT L  L  LEVLKL + AF+G  
Sbjct  766  GLKPPVQELKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPK  825

Query  465  WDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDN  644
            W+   +  F  LK L +   +L  W+A  S+  FP LE L+L+ C+ L +IP +  ++  
Sbjct  826  WE-QVEEGFCSLKLLLIEMSDLEHWSA--SNDHFPCLEHLVLKGCLHLDSIPHELGDIPT  882

Query  645  LKVMELYNVCERVSDFAREI  704
            L+++EL N  +     A+EI
Sbjct  883  LQIIELENSSQSALLSAKEI  902



>ref|XP_009764014.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=411

 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 124/232 (53%), Gaps = 26/232 (11%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M+ LRH+H    +   + P K+  +  N+  L  ++ ++CT E+F+  P L++
Sbjct  163  IPETIWKMKHLRHLHVVKRVFSLAIPIKSGFKLENLEGLSCLNLSNCTYELFSAIPNLKR  222

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRR-----  347
            L + GN  E     ++K+    +L  L CLK L++        LK     ++ RR     
Sbjct  223  LKIYGNWREC---KREKIS--QHLDSLSCLKELEI--------LKFRYQGRYRRRLPRKL  269

Query  348  -----LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLR  512
                 L++LTL  T F  +D+T + +L  LEVLK+ D  F    W LN D IF  LK+L 
Sbjct  270  SLPTSLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKD-VFYNDEWILNDDEIFSQLKFLL  328

Query  513  MGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
            +   +L  W AV  +  FP L+ L+LR+CI L+ IP+DF  + +L+ +ELY+
Sbjct  329  ISVTSLRHWKAVSVN--FPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYD  378



>ref|XP_009764013.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score =   117 bits (292),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 124/232 (53%), Gaps = 26/232 (11%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M+ LRH+H    +   + P K+  +  N+  L  ++ ++CT E+F+  P L++
Sbjct  163  IPETIWKMKHLRHLHVVKRVFSLAIPIKSGFKLENLEGLSCLNLSNCTYELFSAIPNLKR  222

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRR-----  347
            L + GN  E     ++K+    +L  L CLK L++        LK     ++ RR     
Sbjct  223  LKIYGNWREC---KREKIS--QHLDSLSCLKELEI--------LKFRYQGRYRRRLPRKL  269

Query  348  -----LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLR  512
                 L++LTL  T F  +D+T + +L  LEVLK+ D  F    W LN D IF  LK+L 
Sbjct  270  SLPTSLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKD-VFYNDEWILNDDEIFSQLKFLL  328

Query  513  MGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
            +   +L  W AV  +  FP L+ L+LR+CI L+ IP+DF  + +L+ +ELY+
Sbjct  329  ISVTSLRHWKAVSVN--FPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYD  378



>ref|XP_009600123.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=902

 Score =   120 bits (300),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 136/264 (52%), Gaps = 23/264 (9%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC-----TLCTISPASCTSEIFNKTPKLQ  179
            IW + +LRH+H    M L S    + ++  N+      T+  ++P+ CT E+F    K++
Sbjct  620  IWKLSQLRHLHC-WCMYLESPQTVSGNKVKNLVLESIQTVSGLTPSCCTKEVFEGIKKVK  678

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK--------  335
            KL + G   E    T  +    NNL+ LK L+ L +      V  +     +        
Sbjct  679  KLEIAGKAEEFHSTTGWE----NNLKYLKELETLNVAVWHRLVMFRSNAVPRSINPSPGS  734

Query  336  FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRM  515
            F   L+KLTLSGT   W+ M +   L  LEVL+L D+AF G  W++ +++ F  LK+L +
Sbjct  735  FPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEV-TEMGFPKLKFLLL  793

Query  516  GKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFA  695
              + L  WTA  +D  F  LE + +R+C+ LQ IPE FA+   L+++EL+  C  +  FA
Sbjct  794  EHLFLSYWTA--TDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSLVIFA  851

Query  696  REI--CVKRHGKTNVKINAFNVFI  761
             +I    +  G   +K+ AF+ F+
Sbjct  852  EQIQETHEELGNNLLKVYAFDSFL  875



>ref|XP_009777218.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777219.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777220.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777221.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=791

 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 124/242 (51%), Gaps = 26/242 (11%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQL--PSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW +  LRH+  N    L  PS+   + ++ +N+    T+  +SCT+EIF+  P L++L 
Sbjct  541  IWKLTDLRHIRVNRCSYLCSPSTAGLHKTKMSNLEEFSTLCFSSCTNEIFSAIPNLKRLS  600

Query  189  VRGNLSEL----------FLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKF  338
            +R   SE           FL+    + ++  LQ  KC     +H    +  L+  +F   
Sbjct  601  IRQTYSESLKCALRNTDHFLD----MSILRKLQASKCF--FYVH---YRCSLRRYIFPTC  651

Query  339  LRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG  518
            L+RL   TL G+   W++++ L  L  LEVLKL +     ++W L  D  F  +K L +G
Sbjct  652  LKRL---TLKGSYLPWEELSSLVVLPNLEVLKLKNCKRDDQVWSLKDDEEFARIKLLLIG  708

Query  519  KMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAR  698
               L  W A      FP+L+SL+L++C  L+NIPEDF N   L+ +ELY+     +D AR
Sbjct  709  NTKLKRWEACSD--CFPMLQSLVLKDCTELENIPEDFVNSCLLESIELYDCSTSAADSAR  766

Query  699  EI  704
             I
Sbjct  767  SI  768



>ref|XP_009786264.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=884

 Score =   119 bits (297),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 118/219 (54%), Gaps = 7/219 (3%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP--SSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW +E LRH+H       P  S   K   +  N+  L  +  +SCTSE+F+  P L++L 
Sbjct  636  IWQIEHLRHLHVTGFFSFPITSREVKPGFKLQNLERLSCLCLSSCTSELFSAIPNLKRLK  695

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLS  368
            V G+  E   E ++    +N+L  LK L+  KL+G+  ++    ++F   +  L++LTLS
Sbjct  696  VHGDWEEC--EGRKMSQYLNSLSCLKELEMFKLNGDGLQLPRIPSIFALPIC-LKRLTLS  752

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             T   W+DM  +  L  L+ LK+  N F G +W LN +  F  LK+L +  +NL  W A 
Sbjct  753  YTSLPWEDMANIVVLPNLQELKIKYNGFDGDVWKLNDEEAFNQLKFLLISTINLKHWEA-  811

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
             S  +FP LE L+L+ C  L+ IP+D   +  L  +EL+
Sbjct  812  -SSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELH  849



>ref|XP_009786258.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786259.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786260.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786261.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786262.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786263.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=884

 Score =   119 bits (297),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 118/219 (54%), Gaps = 7/219 (3%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP--SSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW +E LRH+H       P  S   K   +  N+  L  +  +SCTSE+F+  P L++L 
Sbjct  636  IWQIEHLRHLHVTGFFSFPITSREVKPGFKLQNLERLSCLCLSSCTSELFSAIPNLKRLK  695

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLS  368
            V G+  E   E ++    +N+L  LK L+  KL+G+  ++    ++F   +  L++LTLS
Sbjct  696  VHGDWEEC--EGRKMSQYLNSLSCLKELEMFKLNGDGLQLPRIPSIFALPIC-LKRLTLS  752

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             T   W+DM  +  L  L+ LK+  N F G +W LN +  F  LK+L +  +NL  W A 
Sbjct  753  YTSLPWEDMANIVVLPNLQELKIKYNGFDGDVWKLNDEEAFNQLKFLLISTINLKHWEA-  811

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
             S  +FP LE L+L+ C  L+ IP+D   +  L  +EL+
Sbjct  812  -SSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELH  849



>ref|XP_009597655.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=884

 Score =   118 bits (296),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 117/219 (53%), Gaps = 7/219 (3%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP--SSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW +E LRH+H       P  S   K   +  N+  L  +  +SCTSE+F+  P L++L 
Sbjct  636  IWQIEHLRHLHVTDFFSFPITSREVKPGFKLQNLERLSCLCLSSCTSELFSAIPNLKRLK  695

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLS  368
            V G+  E   E ++    +N+L  LK L+ LK +G+  ++    + F      L++LTLS
Sbjct  696  VHGDWEEC--EGRKMSQYLNSLSCLKELEMLKFNGDGLQLPRIPSKF-ALPVCLKRLTLS  752

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             T   W+DM  +  L  L+ LK+  N F G +W LN + +F  LK+L +  +NL  W A 
Sbjct  753  YTSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLNDEEVFNQLKFLLISAINLKHWEA-  811

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
             S  +FP LE L+L+ C  L+ IP+D   +  L  +EL+
Sbjct  812  -SSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELH  849



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score =   118 bits (296),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 117/218 (54%), Gaps = 12/218 (6%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M  LRH+H       P      S++  N+  L  ++  SCTSE+F+  P L+KL + 
Sbjct  636  IWQMRNLRHLHIGDFFSFPIP----SNKLQNLQELSCLALTSCTSELFSAIPNLKKLQIV  691

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLSGT  374
            GN     +E K++   +N+L  LK L+ LK   +  +   ++         L++LTL  T
Sbjct  692  GNY---LMEMKREH--LNSLSCLKELEILKYRDDGIQPS-RIPSMYALPTSLKRLTLCFT  745

Query  375  LFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVDS  554
               W+DM  +  L  LEVLK+ DN F G +W LN + IF  LK+L +    L  W A  S
Sbjct  746  SLPWEDMANIVKLPNLEVLKIKDNGFLGDVWKLNDEEIFNQLKFLLISWTGLKHWEA--S  803

Query  555  DKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
              +FP L+ L L+ C++L+ IP+DF  +  L+ +EL++
Sbjct  804  SVNFPKLQRLFLKRCMNLEEIPQDFGEICTLESIELHD  841



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score =   118 bits (295),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 117/219 (53%), Gaps = 7/219 (3%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP--SSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW +E LRH+H       P  S   K   +  N+  L  +  +SCTSE+F+  P L++L 
Sbjct  636  IWQIEHLRHLHVTDFFSFPITSREVKPGFKLQNLERLSCLCLSSCTSELFSAIPNLKRLK  695

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLS  368
            V G+  E   E ++    +N+L  LK L+ LK +G+  ++    + F      L++LTLS
Sbjct  696  VHGDWEEC--EGRKMSQYLNSLSCLKELEMLKFNGDGLQLPRIPSKF-ALPVCLKRLTLS  752

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             T   W+DM  +  L  L+ LK+  N F G +W LN + +F  LK+L +  +NL  W A 
Sbjct  753  YTSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLNDEEVFNQLKFLLISAINLKHWEA-  811

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
             S  +FP LE L+L+ C  L+ IP+D   +  L  +EL+
Sbjct  812  -SSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELH  849



>gb|AAV31175.1| Putative disease resistance protein, identical [Solanum tuberosum]
Length=842

 Score =   118 bits (295),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 135/255 (53%), Gaps = 18/255 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M +LRH+    ++ +  S P +   G N+ ++  +SP+ CT EIF    K++KL + 
Sbjct  546  IWQMSQLRHL---CAIGISLSSPGDKVLG-NLQSVSGLSPSCCTKEIFEGIKKVKKLAIS  601

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHG------NSEKVELKVTVFDKFLRRLRK  356
            G   E   + K     I+NL+ L+ L++L +        NS +    +T  D F ++L+K
Sbjct  602  GRKEEYPTDLKW----IDNLKYLQDLESLSIAIQYWYIINSTRF-FSLTSPDSFPQKLKK  656

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L LS T   W+ M+++  L  LEVL+L   AF G  W     + F+ L++L +  + L  
Sbjct  657  LKLSRTCLPWEYMSIISKLPVLEVLQLKRYAFRGHKWKATDQIGFQKLRFLLLENLMLDK  716

Query  537  WTAVD-SDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
            WT    S   FP LE +++ +CI L+ IP+ FA+   L+++EL+     +  FA +I  K
Sbjct  717  WTITTVSHDHFPSLERVLITDCIYLKEIPQGFADSKKLELIELHRCDPSLVAFAEKIQEK  776

Query  714  RH--GKTNVKINAFN  752
                G+  +K+ AFN
Sbjct  777  HEDLGRNKLKVTAFN  791



>ref|XP_009614325.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009614326.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=806

 Score =   118 bits (295),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 96/173 (55%), Gaps = 10/173 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWNM +LRH+HTN   +LPS   + +   + + TL  ++P SCT ++  +   L+K
Sbjct  630  IKADIWNMLQLRHLHTNVPAKLPSPATQTTDESSRLQTLSKVAPESCTEDVLARACNLRK  689

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLH---GNSEKVELKV-TVFDKFLRRL  350
            + ++G ++E F   K      NN Q LK L+ LKL    G+S    L++   F  FL RL
Sbjct  690  VSIQGQMAEFFEANKGG---FNNFQKLKSLEQLKLLNDVGSSMSKVLQLPQAFLGFLHRL  746

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYL  509
             KLTLS T F W D   LG LE L+VLKL +NAF G  WD    V F  LK L
Sbjct  747  HKLTLSNTKFVWSDANKLGQLECLQVLKLKENAFCGTAWD---SVGFTKLKVL  796



>gb|EYU23536.1| hypothetical protein MIMGU_mgv1a001875mg [Erythranthe guttata]
Length=745

 Score =   117 bits (292),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 125/235 (53%), Gaps = 18/235 (8%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   +W M  LRH  T  ++ L     K    G NI TL T+SP SCT  +  K   +++
Sbjct  499  MSANLWAMLCLRHFKTKAAVVLDQE--KEGKGGQNIQTLSTLSPESCTETVAKKARNMKE  556

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            L VRGNLS LF          N L+ L+ L+ LKL      + L  T  + F + L++L+
Sbjct  557  LRVRGNLSTLFDGNN------NFLEKLRSLEKLKLVHEKSMIRLPKT--NCFPKNLKRLS  608

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW-  539
            L  T   W DM++L  +E+L+VLKL  NAF+G  W ++    F  L++L + + +L+ W 
Sbjct  609  LRKTCLDWSDMSILAQIEKLQVLKLKQNAFTGITWVVSR--TFCSLQFLLVSEADLVNWE  666

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            T VD    FP L  L ++ C  LQ IP + A    L+ +E+ ++ +  +D A+EI
Sbjct  667  TTVD---HFPSLTCLSIKKCGKLQKIPLELAK--KLQRLEIDSLQKSATDSAKEI  716



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score =   117 bits (293),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 133/265 (50%), Gaps = 25/265 (9%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC----TLCTISPASCTSEIFNKTPKLQ  179
            G W M +LRH+ +      P  PPK S     +     ++  + P  CT E+F    K++
Sbjct  585  GTWKMSQLRHLDSAFFYLCP--PPKVSGNKYRVLEHLQSVHGLRPECCTKEMFEGIKKVK  642

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLK--LHGNSEK---VELKVTVFDKFLR  344
            KLG+ G  S  F +  +K   +NNL  L  L+ L+  L+  S     +   V     F  
Sbjct  643  KLGICGRASH-FKDAPKK--FLNNLIYLPELEALRISLYDRSSSDFLLRQPVPCVGSFPP  699

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLD-----DNAFSGKLWDLNSDVIFKGLKYL  509
             L+KLTL GT   W  +TV+  L  LEVLKL       N      W++ S + F  LK+L
Sbjct  700  NLKKLTLQGTRLLWSQLTVISKLPNLEVLKLKALKLFGNELGETAWEV-SKIEFPKLKFL  758

Query  510  RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
             + K  L  WTA   D SFP LE +I++NC SLQ IP+ FA+   L+++EL      + +
Sbjct  759  LIEKKGLEYWTA--EDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVN  816

Query  690  FAREI---CVKRHGKTNVKINAFNV  755
            FAREI     +R G   +++ A+++
Sbjct  817  FAREIQEEQQQRLGNNILQVYAYDI  841



>ref|XP_006355046.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=887

 Score =   117 bits (292),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 137/239 (57%), Gaps = 11/239 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC---TLCTISPASCTSEIFNKTPK  173
            I   IWNM +LRH+ TN    LP     ++S  TN C   TL  ++P SC   + +K   
Sbjct  633  IKADIWNMPRLRHLRTNKPAILPPPTASSTSSSTNSCLLQTLSLVTPESCNGNVLSKAGN  692

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKFLRR  347
            ++K+ + GNL+  FLET  K    +N Q+LK L++L L  +  S K     + F + L  
Sbjct  693  VKKMSIEGNLTP-FLET-SKGEFFSNFQVLKLLESLTLLNDDKSNKALHLPSTFSECLPN  750

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            L+KLTLS T F W+    LG ++ L+VLKL +NAF+G  W +     FK L+ L +   +
Sbjct  751  LKKLTLSKTRFDWNQAYRLGQVKNLQVLKLKENAFTGPSWKMEPGG-FKKLQVLWIEMAD  809

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             ++W A  S+  FP L SL+L +C++L+ +P + A++DNL+ M L N   + S+ AREI
Sbjct  810  FVSWEA--SNCPFPRLRSLVLISCLNLEAVPLELADLDNLQEMTLDNT-SKASESAREI  865



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   117 bits (292),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 135/258 (52%), Gaps = 19/258 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPKL  176
            IW M +LRH+ + T M L S PP  S          N+ ++C + P  CT EIF    K+
Sbjct  676  IWEMSQLRHLRS-TRMYLYSPPPMVSDNEVKYRALENLQSVCGLIPGCCTKEIFEGIKKV  734

Query  177  QKLGVRGNLSELFLETKQKVCLIN--NLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRL  350
            +KLG+ G   +   E +   CL N  +L  L+ L  +     +    L +     F   L
Sbjct  735  KKLGIYGTKDDFNSEPR---CLENLMDLHELEALTIVSYRKFNSNTFLSLPCPGSFPPNL  791

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL-WDLNSDVIFKGLKYLRMGKMN  527
            +KLTL  T   W DMT++  L +LEVL+L +NAF   + W + +++ F  LK+L + ++N
Sbjct  792  KKLTLCCTFLLWKDMTIVSMLPKLEVLQLRNNAFVPNIGWKV-TEMQFPKLKFLLLEQLN  850

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI-  704
            +  W A  +D  FP LE +I+RNC  L  IP++FA+   L+++EL+     + + A  I 
Sbjct  851  IKYWRA--TDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELIQ  908

Query  705  --CVKRHGKTNVKINAFN  752
               ++  G   +K+ AF+
Sbjct  909  KEQLESLGNNMLKVYAFD  926



>gb|EYU17763.1| hypothetical protein MIMGU_mgv1a002610mg [Erythranthe guttata]
Length=654

 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 123/234 (53%), Gaps = 17/234 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            ++G +W+M +LRH+ T  +M L      N+  G NI TL T+SP SCT  +      +++
Sbjct  408  MNGNLWSMVRLRHLKTKAAMVLDQEQKGNA--GENIQTLSTLSPESCTEIVAKNARNVKE  465

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            L VRGNL  LF     +       ++L   K   +H  S K+ L  T F  F R L++LT
Sbjct  466  LRVRGNLDTLFDARFLE-------KLLSLEKLKLVHEKSGKISLPKTSF--FPRNLKRLT  516

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            L  T  QW DM+ L  +E+LEVLKL   AF G  W +    +F  L++L +   +L+ W 
Sbjct  517  LRKTSLQWSDMSTLAKIEKLEVLKLKQGAFVGIQWTVRD--VFPSLQFLLIDDADLVIWE  574

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            A  S K FP L  L ++ C  L+ IP + A   NL+ +++  + +  +  AR I
Sbjct  575  A--SAKHFPSLTCLSIKKCQKLKEIPLELAK--NLQRLDIDFLRKSATASARAI  624



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 135/258 (52%), Gaps = 19/258 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPKL  176
            IW M +LRH+ + T M L S PP  S          N+ ++C + P  CT EIF    K+
Sbjct  584  IWEMSQLRHLRS-TRMYLYSPPPMVSDNEVKYRALENLQSVCGLIPGCCTKEIFEGIKKV  642

Query  177  QKLGVRGNLSELFLETKQKVCLIN--NLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRL  350
            +KLG+ G   +   E +   CL N  +L  L+ L  +     +    L +     F   L
Sbjct  643  KKLGIYGTKDDFNSEPR---CLENLMDLHELEALTIVSYRKFNSNTFLSLPCPGSFPPNL  699

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL-WDLNSDVIFKGLKYLRMGKMN  527
            +KLTL  T   W DMT++  L +LEVL+L +NAF   + W + +++ F  LK+L + ++N
Sbjct  700  KKLTLCCTFLLWKDMTIVSMLPKLEVLQLRNNAFVPNIGWKV-TEMQFPKLKFLLLEQLN  758

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI-  704
            +  W A  +D  FP LE +I+RNC  L  IP++FA+   L+++EL+     + + A  I 
Sbjct  759  IKYWRA--TDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELIQ  816

Query  705  --CVKRHGKTNVKINAFN  752
               ++  G   +K+ AF+
Sbjct  817  KEQLESLGNNMLKVYAFD  834



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score =   117 bits (292),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 133/266 (50%), Gaps = 25/266 (9%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC----TLCTISPASCTSEIFNKTPKLQ  179
            G W M +LRH+ +      P  PPK S     +     ++  + P  CT E+F    K++
Sbjct  718  GTWKMSQLRHLDSAFFYLCP--PPKVSGNKYRVLEHLQSVHGLRPECCTKEMFEGIKKVK  775

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLK--LHGNSEK---VELKVTVFDKFLR  344
            KLG+ G  S  F +  +K   +NNL  L  L+ L+  L+  S     +   V     F  
Sbjct  776  KLGICGRASH-FKDAPKK--FLNNLIYLPELEALRISLYDRSSSDFLLRQPVPCVGSFPP  832

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLD-----DNAFSGKLWDLNSDVIFKGLKYL  509
             L+KLTL GT   W  +TV+  L  LEVLKL       N      W++ S + F  LK+L
Sbjct  833  NLKKLTLQGTRLLWSQLTVISKLPNLEVLKLKALKLFGNELGETAWEV-SKIEFPKLKFL  891

Query  510  RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
             + K  L  WTA   D SFP LE +I++NC SLQ IP+ FA+   L+++EL      + +
Sbjct  892  LIEKKGLEYWTA--EDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVN  949

Query  690  FAREI---CVKRHGKTNVKINAFNVF  758
            FAREI     +R G   +++ A+++ 
Sbjct  950  FAREIQEEQQQRLGNNILQVYAYDII  975



>ref|XP_004237189.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Solanum lycopersicum]
 ref|XP_010319380.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Solanum lycopersicum]
Length=890

 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 140/249 (56%), Gaps = 12/249 (5%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNIC---TLCTISPASCTSEIFNKTPK  173
            I   IWNM +LRH+ TN    LP     +SS  TN C   TL  ++P SC   + +K   
Sbjct  635  IKADIWNMPRLRHLRTNKPAILPPPTSSSSSSSTNSCFLQTLSLVTPESCKGNVLSKARN  694

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKFLRR  347
            ++K+ V+GNL+  FLET  K    +N Q+LK L++L L  +  S K     + F + L  
Sbjct  695  VKKMSVKGNLTP-FLET-SKGEFFSNFQVLKLLESLTLLNDDKSNKSLHLPSAFSECLPN  752

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            L+KLTLS T F W+    LG ++ L+VLK+ +NAF G  W +     FK L+ L +   +
Sbjct  753  LKKLTLSKTRFDWNQAYRLGQVKNLQVLKMKENAFMGPSWRMEPGG-FKKLQVLWIEMAD  811

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI-  704
             ++W A  S+  FP L SL L +C++L+ +P D A++DNL+ M L N   + S  AREI 
Sbjct  812  FVSWEA--SNCPFPRLRSLFLISCLNLEAVPLDLAHLDNLQEMTLENT-SKASKSAREIE  868

Query  705  CVKRHGKTN  731
            C K+  + +
Sbjct  869  CEKKKKQAD  877



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 128/243 (53%), Gaps = 25/243 (10%)
 Frame = +3

Query  21   NMEKLRHVHTNT-SMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVRG  197
            NM KLRH+HT   S+ +P +    + R  ++ TL  + P+SC  E+F + P L+KLG+  
Sbjct  500  NMPKLRHIHTKKFSLFIPPTSLI-AERENHLQTLTGLMPSSCNEEVFLRIPNLKKLGI--  556

Query  198  NLSELFLE---TKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV--------FDKFLR  344
                L ++   T QK   ++NL  L  L+ LK+      +  + T+         D F  
Sbjct  557  ----LIVDDSDTIQKCYCLDNLVHLTQLEKLKVEVRESWLIFRPTIKGWVDIPHCDNFPP  612

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK-  521
             L+KLTL  T  +W+DM +L  L  LEVLKL D+AF G +W L SD    G   L+    
Sbjct  613  NLKKLTLCTTHLEWEDMNILSKLPNLEVLKLKDHAFRGHIWKL-SDEDADGFLKLKFLLL  671

Query  522  --MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFA  695
              M+L  W A  +   FP LE L+L +C SL+ IP DFA +  L+++EL+N    V   A
Sbjct  672  EHMHLEQWEA--TSYHFPSLEHLVLTHCHSLEQIPFDFAEIQTLQLIELHNCMRSVLVSA  729

Query  696  REI  704
             +I
Sbjct  730  EQI  732



>ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score =   116 bits (290),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 121/238 (51%), Gaps = 22/238 (9%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSP-----PKNSSRGTNICTLCTISPASCTSEIFNKTPKLQ  179
            IWNM +LRH+   T   LPS P       +S    N+ +L  +  A C   +    P L 
Sbjct  629  IWNMPQLRHL-LFTESNLPSLPGLEIDANDSVLLKNLQSLSDVHAACCIKNVLRHVPNLT  687

Query  180  KLGVRGNLSELFLETKQKVCL-INNLQMLKCLKNLKLHG--NSEKVELKVTVFDKFLRRL  350
            KLG        ++E    V L +N L+ L+  K + L+   N E   L   VF K    L
Sbjct  688  KLGT-------WVEEPSDVHLCLNQLEKLESFKFIVLNPIPNPENNFLPKLVFPK---TL  737

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
             KLTLSG    W+DM ++  L  LEVLKL + AF G  WDL  ++ F  LK+L +  + L
Sbjct  738  TKLTLSGCGLHWEDMAIIEELPNLEVLKLREFAFQGPKWDLE-EMFFPELKFLLLEALQL  796

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
              WTA  SD +FP LE LI+R+C  L+ IP + A +  L++++L +        A+EI
Sbjct  797  QIWTA--SDDNFPSLERLIIRHCYELEKIPPEIAEIGPLRLIQLVDCSPTAVASAQEI  852



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score =   115 bits (288),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 115/220 (52%), Gaps = 11/220 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M+ LRHV     +   +PSS   +S +  N+  L  +  + CT ++F+  P L+ L 
Sbjct  651  IWKMKLLRHVEIKGISDFCVPSSKEGSSFKLQNLEHLSYLKISCCTEKLFSDIPNLKTLK  710

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLS  368
            + G   ++  E     CL N L+ LK   N + +    + +  +         L++LTL 
Sbjct  711  IYGAKGDITSELNSLSCL-NKLETLKIACNRRYYERPPQSKFALPT------SLKRLTLE  763

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             T   W+DM  +  L  L+VLK+ DN F G +W LN ++IF  LK+L + + NL  W A 
Sbjct  764  STYLPWEDMANIVMLPNLQVLKIKDNGFDGDVWRLNDEMIFNQLKFLLIYETNLKQWKA-  822

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
                +FP L+ L+L+ C SL+ IP+D   +  L+ +EL+N
Sbjct  823  -GSVNFPELQCLVLKECRSLKTIPQDIGEIYTLESIELHN  861



>ref|XP_010319214.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=882

 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/256 (32%), Positives = 130/256 (51%), Gaps = 17/256 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M +LRH++    + L  SP  N   G N+ ++  +SP  CT EIF    K++KL +R
Sbjct  609  IWQMTQLRHLYAK-GIHL-CSPGDNKVLG-NLQSVSGLSPCCCTKEIFEGIKKVKKLVIR  665

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF------DKFLRRLRK  356
            G   E   + K     I+NL+ L+ L+++ +       +   T F      D F ++L++
Sbjct  666  GTREEFPTDVKW----IDNLKYLQHLESVSIENIDFIFQKNTTSFFSLTSPDSFPQKLKE  721

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L L  T   W+ ++++  L ELEVLKL   +  G  W     V F  L++L +  + L  
Sbjct  722  LKLRCTYLPWECISIISKLPELEVLKLKSKSLIGNEWKATDQVGFPKLRFLLLDNLPLTE  781

Query  537  W-TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
            W     S   FP LE LI+ N   L+ IP+ FA+   L+++EL+     + DFA+ + V+
Sbjct  782  WENTTGSHDHFPSLERLIITNFKFLEEIPQGFADSKKLELIELHYCNPSLVDFAKNVQVE  841

Query  714  RH---GKTNVKINAFN  752
                 G+  +K+ AFN
Sbjct  842  HEEVLGRNKLKVTAFN  857



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score =   115 bits (287),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 129/260 (50%), Gaps = 34/260 (13%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT-----NICTLCTISPASCTSEIFNKTPKLQ  179
            IW M  LRH+H   S+ L S      +R +     N+ TL  I+ A CT ++F+ TPKL+
Sbjct  698  IWTMPNLRHLHVKPSICLQSPTKVECNRYSSWVLNNLQTLVNITLADCTKDVFSSTPKLK  757

Query  180  KLGVRGNLSEL---------FLETKQKV--------------CLINNLQMLKCLKNLKLH  290
            KLG+  ++            FL T +K+              C   NL +L  L+ LK+ 
Sbjct  758  KLGICESIDYTYPVQIPWSDFLYTSEKLWPYSSDTMSDLWSDCF-RNLALLPQLEALKIF  816

Query  291  GNSEKV-ELKVTV-FDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL  464
            G    V E K+    D     L+KLTLS T   W+ MT L  L  LEVLKL + AF+G  
Sbjct  817  GLKPPVQEPKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPK  876

Query  465  WDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDN  644
            W+   +  F  LK L +   +L  W+A  S+  FP LE L+L+ C+ L +IP D   +  
Sbjct  877  WE-QVEEGFCSLKLLLIEMSDLEQWSA--SNDHFPCLEHLVLKGCLHLDSIPRDLGFIPT  933

Query  645  LKVMELYNVCERVSDFAREI  704
            L+++EL N  +     A+EI
Sbjct  934  LQIIELDNSSQSAVLSAKEI  953



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score =   115 bits (287),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 137/258 (53%), Gaps = 19/258 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPKL  176
            IW M +LRH+ + T M L S PP  S          N+ ++  + P  CT EIF    K+
Sbjct  674  IWEMSQLRHLRS-TRMYLYSPPPMVSDNEVKYRALENLQSVSGLIPRCCTKEIFEGIKKV  732

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQM--LKCLKNLKLHGNSEKVELKVTVFDKFLRRL  350
            +KLG+ G   +  +E +   CL N + +  L+ L  +          L++     F   L
Sbjct  733  KKLGIYGTKDDFNIEPR---CLENLMDLFELEALTIVSYRKFKADTFLRLPCPGSFPPNL  789

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL-WDLNSDVIFKGLKYLRMGKMN  527
            +KLTL  T   W DMT++  L +L+VL+L +NAF   + W++ +++ F  LK+L + ++N
Sbjct  790  KKLTLCCTFLLWKDMTIVSMLPKLKVLQLRNNAFVPNIVWEV-TEMQFPKLKFLLLEQLN  848

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI-  704
            +  W A  +D  FP LE +I+RNC  L+ IP++FA+   L+++EL+     + + A  I 
Sbjct  849  IRYWRA--TDDCFPCLERIIIRNCRFLKEIPQEFADSMTLQLIELHQCSPSLVNSAELIQ  906

Query  705  --CVKRHGKTNVKINAFN  752
               ++  G   +K+ AF+
Sbjct  907  KEQLESLGNNMLKVYAFD  924



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score =   115 bits (287),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 129/260 (50%), Gaps = 34/260 (13%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT-----NICTLCTISPASCTSEIFNKTPKLQ  179
            IW M  LRH+H   S+ L S      +R +     N+ TL  I+ A CT ++F+ TPKL+
Sbjct  683  IWTMPNLRHLHVKPSICLQSPTKVECNRYSSWVLNNLQTLVNITLADCTKDVFSSTPKLK  742

Query  180  KLGVRGNLSEL---------FLETKQKV--------------CLINNLQMLKCLKNLKLH  290
            KLG+  ++            FL T +K+              C   NL +L  L+ LK+ 
Sbjct  743  KLGICESIDYTYPVQIPWSDFLYTSEKLWPYSSDTMSDLWSDCF-RNLALLPQLEALKIF  801

Query  291  GNSEKV-ELKVTV-FDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKL  464
            G    V E K+    D     L+KLTLS T   W+ MT L  L  LEVLKL + AF+G  
Sbjct  802  GLKPPVQEPKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPK  861

Query  465  WDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDN  644
            W+   +  F  LK L +   +L  W+A  S+  FP LE L+L+ C+ L +IP D   +  
Sbjct  862  WE-QVEEGFCSLKLLLIEMSDLEQWSA--SNDHFPCLEHLVLKGCLHLDSIPRDLGFIPT  918

Query  645  LKVMELYNVCERVSDFAREI  704
            L+++EL N  +     A+EI
Sbjct  919  LQIIELDNSSQSAVLSAKEI  938



>ref|XP_009763931.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=898

 Score =   114 bits (286),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 135/268 (50%), Gaps = 31/268 (12%)
 Frame = +3

Query  15   IWNMEKLRHVHT-NTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQK  182
            IW + +LRH+H     ++ P +   N  +     NI T+  ++P+ CT E+F    K++K
Sbjct  620  IWKLSQLRHLHCWCMYLESPQTVSGNKLKNLVLENIQTVSGLTPSCCTKEVFEGIKKVKK  679

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK---------  335
            L + G   E       K     NL+ LK L+ L +      V  ++ +F           
Sbjct  680  LEIAGKAEEF----HSKKGWETNLKYLKELEALNV-----AVWHRLAMFSSNAMPRSINP  730

Query  336  ----FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLK  503
                F   L+KLTLSGT   W+ M +   L  LEVL+L D+AF G  W++ +++ F  LK
Sbjct  731  CPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEV-TEMGFPKLK  789

Query  504  YLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
            +L +  + L  WTA  +D  F  LE + +R+C+ LQ IPE FA+   L+++EL+  C  +
Sbjct  790  FLLLEHLFLSYWTA--TDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSL  847

Query  684  SDFAREI--CVKRHGKTNVKINAFNVFI  761
              FA +I    +  G   +K+ AF  F+
Sbjct  848  VIFAEQIQEMHEELGNNLLKVYAFESFL  875



>ref|XP_009763930.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=909

 Score =   114 bits (286),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 135/268 (50%), Gaps = 31/268 (12%)
 Frame = +3

Query  15   IWNMEKLRHVHT-NTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQK  182
            IW + +LRH+H     ++ P +   N  +     NI T+  ++P+ CT E+F    K++K
Sbjct  631  IWKLSQLRHLHCWCMYLESPQTVSGNKLKNLVLENIQTVSGLTPSCCTKEVFEGIKKVKK  690

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK---------  335
            L + G   E       K     NL+ LK L+ L +      V  ++ +F           
Sbjct  691  LEIAGKAEEF----HSKKGWETNLKYLKELEALNV-----AVWHRLAMFSSNAMPRSINP  741

Query  336  ----FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLK  503
                F   L+KLTLSGT   W+ M +   L  LEVL+L D+AF G  W++ +++ F  LK
Sbjct  742  CPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEV-TEMGFPKLK  800

Query  504  YLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
            +L +  + L  WTA  +D  F  LE + +R+C+ LQ IPE FA+   L+++EL+  C  +
Sbjct  801  FLLLEHLFLSYWTA--TDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCCLSL  858

Query  684  SDFAREI--CVKRHGKTNVKINAFNVFI  761
              FA +I    +  G   +K+ AF  F+
Sbjct  859  VIFAEQIQEMHEELGNNLLKVYAFESFL  886



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score =   115 bits (287),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 141/260 (54%), Gaps = 22/260 (8%)
 Frame = +3

Query  12    GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPK  173
             GIW M +LRH+++  +M    SPP  S+         N+ ++  +SP  CT EIF    K
Sbjct  860   GIWEMSQLRHLYS--TMMYLYSPPMVSANEVSYRVLENLQSVSGLSPRCCTEEIFEAIKK  917

Query  174   LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE---LKVTVFDKFLR  344
             ++ LG+ G+ +E   E +   CL +NL  L  L+ L +   S + +   L++   D F  
Sbjct  918   VKNLGISGSENEFHSEPR---CL-DNLIYLHELEALSIVSYSRQPDGLFLRLPHLDSFPP  973

Query  345   RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGK-LWDLNSDVIFKGLKYLRMGK  521
              L+KLTL  T   W+DMT++  L ELEVL+L ++AF+G  +W++  +  F  LK+L + +
Sbjct  974   NLKKLTLRRTWLSWEDMTIISELPELEVLQLKEDAFAGNTVWEVTKEG-FPKLKFLLLEE  1032

Query  522   MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             ++L  W A   D  FP LE +I+RNC  L+ IP+ FA+   L+ +EL      +   A +
Sbjct  1033  LDLGYWVA--DDDYFPCLERIIIRNCTYLKEIPQGFADSTTLQQIELRRCSPSLVTLAEK  1090

Query  702   ICVKRH---GKTNVKINAFN  752
             I  K+    G   +K+  F+
Sbjct  1091  IQKKQEEEIGNNILKVCVFD  1110



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score =   114 bits (285),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 125/241 (52%), Gaps = 18/241 (7%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQL--PSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKL  176
            GIW + +LRH+    SM L  P +  +N  +     NI T+  + P+ CT EIF    K+
Sbjct  619  GIWKLSQLRHLDC-WSMYLDSPQTVSENEVKNLVLENIQTVSELIPSCCTKEIFEAINKV  677

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF-----DKFL  341
            +KL + G   E   ET  +     NL+ L  L  L +   ++ V  ++          F 
Sbjct  678  KKLEIAGTTEEFHSETGWE----TNLKYLIELGALNVTVPTDFVSDRLPCLINPSPGSFP  733

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              ++KLT SGT   W+ M +   L  LEVL+L D+AFSG  W++ +++ F  LK L +  
Sbjct  734  PNIKKLTFSGTCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEI-TEMGFPKLKCLLLED  792

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
            + L  WTA  SD  F  LE + +R C  LQ IPE FA+   L+++EL+  C  +  FA++
Sbjct  793  LYLRYWTA--SDDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQ  850

Query  702  I  704
            I
Sbjct  851  I  851



>ref|XP_011086979.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=870

 Score =   114 bits (285),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 130/238 (55%), Gaps = 17/238 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M KL H+    S  LP   P +S     + TL  IS +SCT ++F K P L++LG++
Sbjct  616  IWDMRKLSHLQVMGS-DLPDPSP-DSVPLRRLSTLLGISASSCTKKVFGKIPNLKRLGIQ  673

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE-LKVTVFDKFLRRLRKLTLSG  371
              L+ L + TK   C  +    L+ LK + ++      E L V++F+  LR LRK+TL+G
Sbjct  674  VELA-LDVPTKPLCCFDHLPYRLESLKCVIVNPKVVVAERLPVSIFE--LRYLRKVTLTG  730

Query  372  TLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVD  551
                W DM+  G L  LEVLKL  NA  G +W  + +V F+GL+YL +  ++L  W   D
Sbjct  731  LGLPWHDMSSFGKLPRLEVLKLRCNACRGPVWK-SDEVRFRGLRYLLLEDVDLEKW---D  786

Query  552  SDK-SFPVLESLILRNCISLQNIPED------FANVDNLKVMELYNVCERVSDFAREI  704
            +D  SF +L+ L +R+C  L+ IP +      F     LK +EL +  E V   A++I
Sbjct  787  ADCFSFQMLQYLSIRHCYKLKKIPLEIGKTIQFRGPPTLKGIELVDCGESVVASAKQI  844



>ref|XP_009601833.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=662

 Score =   114 bits (284),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 118/224 (53%), Gaps = 19/224 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--------NICTLCTISPASCTSEIFNKTP  170
            IWNM +LR +   +   L  S PK +  G         N+  L  +  ASCT+E+F+  P
Sbjct  411  IWNMTQLRRLRLLSGNYL--SKPKRTDEGATDTVLGLRNLEELSHLCFASCTAEVFSCLP  468

Query  171  KLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRL  350
             ++KLG+    S+   E  + + L+  L+ LKC+     +G      L ++ +   L  +
Sbjct  469  NIRKLGILDAASDDASEYLKNLVLLGKLETLKCV----CYGQKR---LSLSNWCASLTSV  521

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            ++L LSG L   +DM  L +L  LEVLKL DN F G+ W L+ +  F  LK+L + +  L
Sbjct  522  KRLILSGCLLLSEDMANLATLPNLEVLKLRDNEFEGQAWTLSDEDEFNQLKFLLLAEPRL  581

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
            + W A     +FP L+ L+LR CI L+ +P D   +  L+V+EL
Sbjct  582  VNWEA--GSVNFPTLQKLVLRKCIRLEEVPNDIVEICTLEVIEL  623



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score =   114 bits (285),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 125/241 (52%), Gaps = 18/241 (7%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQL--PSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKL  176
            GIW + +LRH+    SM L  P +  +N  +     NI T+  + P+ CT EIF    K+
Sbjct  629  GIWKLSQLRHLDC-WSMYLDSPQTVSENEVKNLVLENIQTVSELIPSCCTKEIFEAINKV  687

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF-----DKFL  341
            +KL + G   E   ET  +     NL+ L  L  L +   ++ V  ++          F 
Sbjct  688  KKLEIAGTTEEFHSETGWE----TNLKYLIELGALNVTVPTDFVSDRLPCLINPSPGSFP  743

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              ++KLT SGT   W+ M +   L  LEVL+L D+AFSG  W++ +++ F  LK L +  
Sbjct  744  PNIKKLTFSGTCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEI-TEMGFPKLKCLLLED  802

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
            + L  WTA  SD  F  LE + +R C  LQ IPE FA+   L+++EL+  C  +  FA++
Sbjct  803  LYLRYWTA--SDDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQ  860

Query  702  I  704
            I
Sbjct  861  I  861



>ref|XP_009796673.1| PREDICTED: uncharacterized protein LOC104243211 [Nicotiana sylvestris]
Length=270

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 120/203 (59%), Gaps = 11/203 (5%)
 Frame = +3

Query  162  KTPKLQKLGVRGNLSELFLETKQ---KVCLINNLQMLKCLKNLKLHGNSE--KVELKVTV  326
            +TP L+KL VRG +  L LET +      L +N+  L CL+ LKL  ++   + +L +  
Sbjct  66   ETPDLKKLCVRGKIDAL-LETSKDGSSSGLFSNIGKLDCLEKLKLVNDTRQSRKQLHLPP  124

Query  327  FDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKY  506
               F ++L+KLTL  T F+W DM++LG LE LEVLKL +NAF+G+ W+   D  F  L+ 
Sbjct  125  AYIFPQKLKKLTLIDTGFEWKDMSILGLLEYLEVLKLKENAFTGQSWE-PEDGGFPRLQV  183

Query  507  LRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVS  686
            L + + +L +W A  S  +FP L+ L+L  C +L  +P + A+V+NL+++EL +     +
Sbjct  184  LWIERTDLSSWKA--SSGNFPRLKRLVLIACDNLNELPAELADVENLQLLELQSTSVSAA  241

Query  687  DFAREICVKRHGK--TNVKINAF  749
              AR I  K+  K  +  K++ F
Sbjct  242  KSARAILKKKQEKEGSGFKLSVF  264



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score =   114 bits (284),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 91/263 (35%), Positives = 137/263 (52%), Gaps = 25/263 (10%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTL------CTISPASCTSEIFNKTPK  173
            GIW M +LRH+H+ T M L  SPPK S+     C L        +SP  CT EIF     
Sbjct  645  GIWEMSQLRHLHS-TRMSL-YSPPKVSANEVKYCVLENLQSVSGLSPCCCTKEIFEGIKN  702

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHG---NSEKVELKVTVFDKFLR  344
            ++KLG+ G   E   E    +CL +NL  L  L+ LK+         V L +     F  
Sbjct  703  VRKLGISGTEDEFDYEP---ICL-DNLIYLHELEELKISSYILTRYDVLLSLPFASSFPP  758

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFS-----GKLWDLNSDVIFKGLKYL  509
             L+KLTL  T   W+DMT++  L +LEVL+L  +AF        +W++ +++ F  LK+L
Sbjct  759  NLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADAFVISYPVDTVWEV-TEMGFLELKFL  817

Query  510  RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
             +  ++L  W A  +D  FP LE +++RNC +L+ IPE FA+   L+ ++L+     +  
Sbjct  818  LLEWLDLDYWRA--ADDYFPCLEHIVIRNCRTLKEIPEGFADSLTLQQIQLHRCTSSLVT  875

Query  690  FAREICVKRH--GKTNVKINAFN  752
            FA +I       G   +K+ +FN
Sbjct  876  FAEQIQENHESLGNNMLKVYSFN  898



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score =   114 bits (284),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 124/219 (57%), Gaps = 13/219 (6%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPK-NSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGV  191
            ++ M +LRHV   T + LP+   K N     ++ TLCT++   CT E+  K P L+KLGV
Sbjct  640  VFQMAQLRHVQM-TEIFLPNPIDKENPVVLKDLETLCTVANFRCTEEVLRKFPNLKKLGV  698

Query  192  R--GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTL  365
               G   E +     K     NL  L  L+NLKL  N    E+ +     F + L++LTL
Sbjct  699  YYYGAGIEDWSSYDLK-----NLVRLSKLENLKLVFNWPLNEVLLPNL-SFPQSLKELTL  752

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            + +   W+DM+++GSL  LEVLKL ++AF+G +W+   +  F  LK+L M +M L+ W A
Sbjct  753  NASKLSWEDMSIIGSLPHLEVLKLKEHAFTGGVWE-PVEGEFSRLKFLLMDRMELVWWIA  811

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
               +  FP LE LI+R+C +LQ IP    ++  LK++++
Sbjct  812  --ENTHFPCLEHLIIRSCHNLQAIPSGIGDIATLKMIDI  848



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score =   114 bits (284),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 124/234 (53%), Gaps = 8/234 (3%)
 Frame = +3

Query  15   IWNMEKLRHVHTN--TSMQLPSS--PPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            IW M+ LRH+     +S  +PSS     +SS+  N+  L  +S + C++E+F +TP L++
Sbjct  636  IWKMKLLRHLEVKKISSFPVPSSMYTTGSSSKLQNLEVLSDLSISCCSNEMFTRTPNLKR  695

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            L + G   E   +T  +  ++N+L  L  L+ LK+  + +     +         L +LT
Sbjct  696  LKLHGAWEECRRDTISQ--MLNSLYCLPQLEILKIICSRKLYPHPLPSTYVLPTSLVRLT  753

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            L  T   W+DM  +  L  L+VLK+ DN F G  W L+ + IF  LKYL + + N+ +W 
Sbjct  754  LRCTYLPWEDMANIVMLPNLQVLKIKDNGFDGDAWRLSDEQIFNQLKYLLIDRTNVKSWK  813

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            A     +FP L+ L+L+ CI L+ IP+D   V  L+ +EL N     +   +EI
Sbjct  814  A--GSVNFPKLQRLVLKRCIYLEEIPKDIGEVYTLESIELLNCRTSAAKSVKEI  865



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 134/266 (50%), Gaps = 30/266 (11%)
 Frame = +3

Query  12   GIWNMEKLRHVHT-NTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQ  179
            GIW + +LRH+H     +  P +  +N  +     NI T+  + P+ CT EIF    K++
Sbjct  620  GIWKLSQLRHLHCWCMYLDSPQTVSENEVKNLVLENIKTVSGLIPSCCTKEIFEAIKKVK  679

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK--------  335
            KL + G   E     + ++   NNL+ LK L+ L +    +       +FD+        
Sbjct  680  KLEIAGKAEEF----QSEMGWHNNLKYLKELEALNVTVPPD------FIFDRLPCLINPS  729

Query  336  ---FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKY  506
               F   L+KLTLS T   W+ M +   L  LEVL+L   AFSG  W++ ++  F  LK 
Sbjct  730  PGSFPPNLKKLTLSRTCLPWNCMNIFSKLPNLEVLELKARAFSGNEWEI-TETGFPKLKC  788

Query  507  LRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVS  686
            L +  + L  WTA  +D  F  LE + +R CI L+ IPE FA+ + L+++EL+     + 
Sbjct  789  LLLEDLYLRYWTA--TDDYFECLERVCIRECILLKEIPEGFADSETLQLIELHKCGRPLV  846

Query  687  DFAREICVKRH--GKTNVKINAFNVF  758
             FA++I  K    G   +K+ AF+ +
Sbjct  847  TFAKQIQGKHEELGNNMLKVYAFDSY  872



>ref|XP_006367921.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X6 [Solanum tuberosum]
Length=403

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 124/243 (51%), Gaps = 21/243 (9%)
 Frame = +3

Query  15   IWNMEKLRHVHT-NTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGV  191
            + NM +LRH+HT N S+ +P      + R  ++ T+  + P+SC  E+F + P L+KLG+
Sbjct  148  VLNMPQLRHIHTKNFSLFIPRPTSLIAERENHLLTITGLIPSSCNDEVFLRIPNLKKLGI  207

Query  192  RGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF---------DKFLR  344
              +++   +      CL +NL  L  L+ LK+      + +   +          D F  
Sbjct  208  LIDVASYPIRN----CL-DNLVHLTQLEKLKVVVREPFLLIFTPIIEGWMDIPHCDNFPP  262

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG--  518
             L+KLTL  T  QW+DM +L  L  LEVLKL D AF G  W L SDV   G   L+    
Sbjct  263  NLKKLTLCRTNLQWEDMNILRKLPNLEVLKLKDYAFRGLTWKL-SDVDEDGFLKLKFLLL  321

Query  519  -KMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFA  695
              ++L+ W A  +   FP LE  +L NC  L+ IP DFA +  L+++EL+     V   A
Sbjct  322  ESLHLMQWEA--TSYHFPSLEHFVLTNCRYLEKIPFDFAEIQTLQLIELHECMRSVLVSA  379

Query  696  REI  704
             +I
Sbjct  380  EQI  382



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 115/222 (52%), Gaps = 14/222 (6%)
 Frame = +3

Query  15   IWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M+ LRH+     +   +PSS   +S +  N+  L  ++ + CT ++F+  P L++L 
Sbjct  657  IWKMKILRHLEVKRISYFCVPSSKEGSSFKLQNLEQLSYLNISCCTEKLFSGIPNLKRLK  716

Query  189  VRGNLSELFLETKQKVCLINNLQMLK--CLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            + G+   +  E    +  +N L+ LK  C +         K  L  +        L++LT
Sbjct  717  IYGDKGNMTSEKLNSLSCLNKLETLKITCYRGYYERPPQSKFALPTS--------LKRLT  768

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            L  T   W+DM  +  L  L+VLK+ DN F    W LN ++IF  LK+L + K +L  W 
Sbjct  769  LESTYLPWEDMANIVMLPNLQVLKIKDNGFVDGRWRLNDEMIFNQLKFLLIHKTDLEQWK  828

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
            A     +FP L+ L+L+ CISL+ IP+D   +  L+ +EL+N
Sbjct  829  A--GSVNFPELQCLVLKECISLKKIPQDIGEIYTLESIELHN  868



>gb|EYU17764.1| hypothetical protein MIMGU_mgv1a026345mg [Erythranthe guttata]
Length=838

 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 134/248 (54%), Gaps = 17/248 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IW M  LRH+ T  ++ L      ++  G N+ TL T+SP SCT  + N+   +++
Sbjct  578  MKANIWRMVWLRHLKTKAAIVLDQKWEGDA--GENLQTLSTLSPESCTESVSNRARNIRE  635

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNL-KLHGNSE-----KVELKVTVFDKFLR  344
            LG+ GNL+E  L+   K   + NL++L+ LK +  +H  +      K  +++   ++F  
Sbjct  636  LGICGNLNETLLDNDNK--FLENLRLLEKLKLVHDVHYEAANDKDYKPMIRLPQHNRFPP  693

Query  345  RLRKLTLSGTLFQWDDM-TVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
             L++LTL+ T   W  M T L  + +LEVLKL DNAF+G +W       F  L++L +  
Sbjct  694  NLKRLTLTKTSLDWRHMSTTLAMIPKLEVLKLKDNAFTGMVWTAVGGG-FPSLQFLLVED  752

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +L+ W A  SD  FP L  L ++NC  L  IP + A   NL+ +++  +    +D AR 
Sbjct  753  ADLVIWKA--SDDHFPSLACLSIKNCGKLIEIPMEVAK--NLQKLDIDFLRRSATDSARN  808

Query  702  ICVKRHGK  725
            I ++R G+
Sbjct  809  I-LRRKGR  815



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 134/245 (55%), Gaps = 23/245 (9%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPK  173
            GIW M +LRH+H+ T M L  SPPK S+         N+ ++  +SP  CT EIF     
Sbjct  622  GIWEMSQLRHLHS-TRMSL-FSPPKVSANEVKYRILENLQSVSGLSPCCCTKEIFEGIKN  679

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHG---NSEKVELKVTVFDKFLR  344
            ++KLG+ G   E   E    +CL +NL  L  L+ LK+         V L++     F  
Sbjct  680  VRKLGISGTEDEFDYEP---ICL-DNLIYLPELEELKIASYILTRYDVLLRLPFAGSFPP  735

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAF-----SGKLWDLNSDVIFKGLKYL  509
             L+KLTL  T   W+DMT++  L +LEVL+L  +AF     +  +W++ +++ F  LK+L
Sbjct  736  NLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADAFVISYPTDTVWEV-TEMGFLELKFL  794

Query  510  RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
             +  ++L  W A  +D  FP LE +++RNC +L+ IPE F +   L+ ++L+     +  
Sbjct  795  LLEWLDLDYWRA--ADDYFPCLEHIVIRNCRTLKEIPEGFVDSLTLQQIQLHRCTSSLVT  852

Query  690  FAREI  704
            FA++I
Sbjct  853  FAKQI  857



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 119/220 (54%), Gaps = 11/220 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M+  RH+     +    + PK+  +  N+  L  ++ +SCT E+F+  P L++L + 
Sbjct  611  IWEMKHFRHLQVVKRV-FSLAIPKSGFKLENLEGLSCLNLSSCTYEMFSAIPNLKRLKIH  669

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL--RRLRKLTLS  368
            GN SE      ++  +  +L  L CLK L++     +   +  +  KF     L++LTL+
Sbjct  670  GNWSEC-----KRDKIYQHLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPTSLKRLTLT  724

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             TLF  +DMT +  L  LEVLK+ D  F    W LN + IF  LK+L +    L  W A 
Sbjct  725  NTLFPLEDMTNIVMLPNLEVLKIKD-VFENDEWRLNDEEIFSQLKFLLISVTFLRHWEA-  782

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
                +FP L+ L+LR+CI L+ IP+DF  + +L+ +ELY+
Sbjct  783  -GSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYD  821



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 119/220 (54%), Gaps = 11/220 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M+  RH+     +    + PK+  +  N+  L  ++ +SCT E+F+  P L++L + 
Sbjct  611  IWEMKHFRHLQVVKRV-FSLAIPKSGFKLENLEGLSCLNLSSCTYEMFSAIPNLKRLKIH  669

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL--RRLRKLTLS  368
            GN SE      ++  +  +L  L CLK L++     +   +  +  KF     L++LTL+
Sbjct  670  GNWSEC-----KRDKIYQHLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPTSLKRLTLT  724

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             TLF  +DMT +  L  LEVLK+ D  F    W LN + IF  LK+L +    L  W A 
Sbjct  725  NTLFPLEDMTNIVMLPNLEVLKIKD-VFENDEWRLNDEEIFSQLKFLLISVTFLRHWEA-  782

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
                +FP L+ L+LR+CI L+ IP+DF  + +L+ +ELY+
Sbjct  783  -GSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYD  821



>gb|EYU17761.1| hypothetical protein MIMGU_mgv1a000811mg [Erythranthe guttata]
 gb|EYU17762.1| hypothetical protein MIMGU_mgv1a000811mg [Erythranthe guttata]
Length=977

 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 134/252 (53%), Gaps = 20/252 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPP-KNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGV  191
            IW ++ LRH+   T   LP  P  +N+    N+ TL  +S ASCT E+    P L KL  
Sbjct  737  IWGLKHLRHL-LFTESDLPKIPAVRNTLLFANLQTLTNVSAASCTQEVLQNMPNLTKLA-  794

Query  192  RGNLSELFLETKQKVCL-INNLQMLKCLKNLKLHG-NSEKVELKVTVFDKFLRRLRKLTL  365
                  ++ E    + L +N ++ L+  K   L+    +KV+ +  ++  F R LRKL L
Sbjct  795  ------MWTEEPATIGLYLNEVEKLESFKFTVLNPIPKKKVDFQPRLY--FPRTLRKLRL  846

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            SG    W+DM+++  L  LEVLKL + AF G  W +     F+ LK+L +  ++L  W  
Sbjct  847  SGCSLPWEDMSIIAKLPLLEVLKLREIAFEGDEW-IPEKKEFRELKFLLLEYLDLKGW--  903

Query  546  VDSDKS-FPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI--CVKR  716
             D+D + +P L+ LILR+C  L +IPE F  +  L+++EL +      + A E+   +K+
Sbjct  904  -DADHTHYPKLQRLILRHCYELVDIPEKFDLLGCLELIELVDCSPDAVEAAEEMKKKLKK  962

Query  717  HGKTNVKINAFN  752
             G T +KI  ++
Sbjct  963  SGNTLLKIQTYS  974



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 134/245 (55%), Gaps = 23/245 (9%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPK  173
            GIW M +LRH+H+ T M L  SPPK S+         N+ ++  +SP  CT EIF     
Sbjct  622  GIWEMSQLRHLHS-TRMSL-FSPPKVSANEVKYRILENLQSVSGLSPCCCTKEIFEGIKN  679

Query  174  LQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHG---NSEKVELKVTVFDKFLR  344
            ++KLG+ G   E   E    +CL +NL  L  L+ LK+         V L++     F  
Sbjct  680  VRKLGISGTEDEFDYEP---ICL-DNLIYLPELEELKIASYILTRYDVLLRLPFAGSFPP  735

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAF-----SGKLWDLNSDVIFKGLKYL  509
             L+KLTL  T   W+DMT++  L +LEVL+L  +AF     +  +W++ +++ F  LK+L
Sbjct  736  NLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADAFVISYPTDTVWEV-TEMGFLELKFL  794

Query  510  RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
             +  ++L  W A  +D  FP LE +++RNC +L+ IPE F +   L+ ++L+     +  
Sbjct  795  LLEWLDLDYWRA--ADDYFPCLEHIVIRNCRTLKEIPEGFVDSLTLQQIQLHRCTSSLVT  852

Query  690  FAREI  704
            FA++I
Sbjct  853  FAKQI  857



>ref|XP_009786702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=928

 Score =   111 bits (277),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 147/268 (55%), Gaps = 27/268 (10%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTL------CTISPASCTSEIFNK  164
            +  GIW M +LRH+H+ T M L  SPP  S+     C L        +SP  CT + F  
Sbjct  665  LSNGIWKMSQLRHLHS-TRMYL-YSPPNVSANDVKYCFLENLQSVSGMSPRCCTKKTFEG  722

Query  165  TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHG-NSEK--VELKVTVFDK  335
              K+++LG+ GN S+ +   K+  CL +NL  L  L+ L +   NSE   + L++     
Sbjct  723  IKKVKELGIGGNTSDFY---KKPKCL-DNLIYLHELEALSIASYNSEPDGLFLRLPCPGY  778

Query  336  FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSG------KLWDLNSDVIFKG  497
            F   L+KLTL  T   W+DM ++  L +LEVL+L   AF+G       +W++ +++ F  
Sbjct  779  FPPNLKKLTLCRTFLPWEDMAIISKLPKLEVLQLKARAFAGIDIVGETVWEV-TEIGFLE  837

Query  498  LKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCE  677
            LK+L + K++L  W A  +D  FP LE +I++NC SLQ IP+ FA+   L+++EL+    
Sbjct  838  LKFLLLEKLHLDYWRA--TDDYFPCLERIIIKNCSSLQEIPKGFADSMTLQLIELHQCSP  895

Query  678  RV---SDFAREICVKRHGKTNVKINAFN  752
             +   ++  R+  ++  G   +K+ AF+
Sbjct  896  SLVNSAELIRKEQLESLGNNMLKVYAFD  923



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score =   110 bits (276),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 83/281 (30%), Positives = 128/281 (46%), Gaps = 36/281 (13%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKN-------SSRGTNICTLCTISPASCTSEIFN  161
            I   IW M+ LRH+H N     P S   +        ++  N+  L  ++ +SCTSE+F+
Sbjct  305  IPASIWKMKHLRHLHVNGFFSFPQSIIDSFGFFSFLQNKLQNLEVLSCLALSSCTSELFS  364

Query  162  KTPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL  341
              P L++L V         E  +    ++N   LK L+ LK  GN +           + 
Sbjct  365  AIPNLKRLTVHHEEELTEFERVEISQHLSNFSRLKELEILKFRGNRQ-----------YF  413

Query  342  RR----------LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIF  491
            RR          L  LTL+ T   W+D+  +  L  LEVLK+  + F G  W LN + IF
Sbjct  414  RRMPGKYSLPTSLNSLTLTDTYLPWEDIANIVMLPNLEVLKIKYHGFYGAFWRLNDNEIF  473

Query  492  KGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNV  671
              LK L + +  L  W A     +FP L+ L+L+ C  L+ IP+DF  +  L+ +EL+  
Sbjct  474  NQLKLLLINETYLKHWDA--GSVNFPKLQRLVLKRCFDLEEIPKDFGEICTLESIELHKC  531

Query  672  CERVSDFAREICVKRHGKTNVKINAFNVFIT---PLQSQAT  785
                +  A+ I  ++    N   +  +V I    P Q+QA 
Sbjct  532  KTSAAASAKNIQEEQESMGN---DCLSVLINDSGPAQAQAV  569



>ref|XP_009603185.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 128/237 (54%), Gaps = 22/237 (9%)
 Frame = +3

Query  78   PPKNSSRGT--NICTLCTISPA-SCTSEIFNKTPKLQKLGVRGNLSELFLETKQKVC--L  242
            PPK+ +     N+ TL +IS A S   EIF   PK++KL V        L+  + V   L
Sbjct  6    PPKSQNLLCLENLETLDSISVADSNWKEIFTGIPKVKKLVV-------CLQPWRSVTFNL  58

Query  243  INNLQMLKCLKNLKLHGNSEKVE-----LKVTVFDKFLRRLRKLTLSGTLFQWDDMTVLG  407
            I++L  L  L+ L++H +    E     L   + D F   L+ LTL GT   W+DMT LG
Sbjct  59   IDSLIRLVDLEKLRIHLDISPYENFSLRLPTLLLDVFPTFLKSLTLVGTRLLWEDMTTLG  118

Query  408  SLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLI  587
             L  LEVL+L   AF G+ W+LN    FK LK L++ + NL+ W A  S +S P LE LI
Sbjct  119  QLPNLEVLRLKCFAFQGRNWNLNEGG-FKKLKLLQINRKNLVLWEA--SSESLPRLEFLI  175

Query  588  LRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRH--GKTNVKINAFN  752
            L+ C  L++IP +  ++  +K++EL+N  +  +  A E+  ++   G   + + A+N
Sbjct  176  LKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLGNEVLVVRAYN  232



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score =   110 bits (276),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 129/256 (50%), Gaps = 13/256 (5%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNT-SMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
             IW M +LRH++    S+  P           N+ ++  +SP+ CT EIF    K+QKLG
Sbjct  622  AIWQMSQLRHLYAACFSLCSPRMVSVEHLVLRNLRSVSGLSPSCCTKEIFEGIKKVQKLG  681

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNS-----EKVE-LKVTVFDKFLRRL  350
            +     E   + K     I+NLQ L  L+ L +         E+VE   +T  D     L
Sbjct  682  ILCTRKEYPRDPK----WIDNLQYLPELEELSIATQGYLFEREEVECFSLTSPDALPLNL  737

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KL LS T  QW  M V+G L +LEVL+L D+AF G  W     V F  LK+L +  + L
Sbjct  738  KKLKLSKTYLQWKYMAVIGKLPKLEVLQLKDHAFVGNEWKATDQVRFHELKFLLLDCLYL  797

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
              W   DS+  F  LE +I++ C  L+ IPE FA   NL+++EL+     V   A++I  
Sbjct  798  RNWRTTDSNDHFSSLERVIIKGCNFLKEIPEGFAGSKNLELIELHKCTPSVVAIAQKIQE  857

Query  711  KR--HGKTNVKINAFN  752
            K   +G+  +K+  ++
Sbjct  858  KHEYYGRCKLKVIDYD  873



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score =   110 bits (276),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 120/220 (55%), Gaps = 11/220 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M+ LRH+     +    + PK+  +  N+  L  ++ +SCT E+F+  P L++L + 
Sbjct  612  IWEMKHLRHLQVVKRV-FSLAIPKSGFKLENLEGLSCLNLSSCTYEMFSAIPNLKRLKIH  670

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL--RRLRKLTLS  368
            GN  E     ++K+    +L  L CLK L++     +   +  +  KF     L++LTL+
Sbjct  671  GNWREC---KREKIS--QHLDSLSCLKELEILKFRYQGAYRRQLPRKFSLPTSLKRLTLT  725

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
             TLF  +DMT +  L  LEVLK+ D  F    W LN + IF  LK+L +    L  W A 
Sbjct  726  NTLFPPEDMTNITMLPNLEVLKMKD-VFDSDEWRLNDEEIFSQLKFLLISVTFLRHWEA-  783

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
                +FP L+ ++LR+CI L+ IP+DF  + +L+ +ELY+
Sbjct  784  -GSVNFPKLQRVVLRSCIGLEEIPKDFGEIYSLESIELYD  822



>gb|EYU40385.1| hypothetical protein MIMGU_mgv1a007613mg [Erythranthe guttata]
Length=402

 Score =   107 bits (268),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 123/261 (47%), Gaps = 32/261 (12%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M +LRH  T  ++ L S          N+ TL T+S   CT ++FNKTP +  
Sbjct  166  IKANIWKMRQLRHFKTKAAIILSSE--SQGEIADNLQTLSTLSTQCCTEDLFNKTPNIIN  223

Query  183  LGVRGNLSELFLETKQKVCL--INNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
            LG+RG+L+ L        CL  +N LQ LK L ++     SE    ++   D        
Sbjct  224  LGIRGDLATL----SDSKCLRKLNRLQKLKLLYDVFPDVTSENPLSRLPQPD--------  271

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
                     W  M+ LG L  L+VLKL D AF GK W+   +  F  L++L + + +L  
Sbjct  272  --------SWKHMSTLGKLGALKVLKLKDFAFVGKFWEAGVEGKFASLEFLLIARTDLEF  323

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
            WT+  S+  FP L+ L+L+NC  L+ IP       +L+V+++  V       AR+I  ++
Sbjct  324  WTS--SNDCFPSLKCLVLKNCEKLEEIPLLLHK--SLQVLDIERVSITAVASARKIEAEK  379

Query  717  HG----KTNVKINAFNVFITP  767
                  +   K   F + I P
Sbjct  380  QNMQGQQHRAKRGGFYLVIAP  400



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score =   110 bits (275),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 132/266 (50%), Gaps = 20/266 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT-----NICTLCTI--SPASCTSEIFNKTPK  173
            IW M  LRH+H    + L  SP  + S+       N+ TLCTI  S  S +  +    P 
Sbjct  614  IWKMPILRHIHVKGDVLLFGSPIADHSKRNFQVLGNLQTLCTITISTISFSHGLVATLPN  673

Query  174  LQKLG---VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLH----GNSEKVELKVTVFD  332
            L+ L    V G   + F       CL NNL+ +  L+ LKL      N+ +    +  ++
Sbjct  674  LKTLASNLVTGGNHDAFDVDWLGSCL-NNLEQMYSLETLKLLFNLPMNNPRPRNSIQRWN  732

Query  333  KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLR  512
             F   L+ LTLS +   W+D  VLG+L  LEVLKL D +F G  W+ + +  F  LKYL 
Sbjct  733  AFPPNLKNLTLSCSFLLWEDARVLGNLPNLEVLKLKDFSFQGPEWETDEEG-FHRLKYLL  791

Query  513  MGKMNLITWTAVDSDK-SFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
            +   +L+ W    +D   FPVL+ L+LR C  L+ IP +  ++ +L+V++L++     + 
Sbjct  792  VESRDLVVWKQASTDSYPFPVLQHLVLRFCYKLKEIPYEIGDIPSLQVIKLHSCSPYATR  851

Query  690  FAREICVKRHGKTNVKINAFNVFITP  767
             AR I  ++    N   +   VFI P
Sbjct  852  LARMIEKEQIDSGN---SCLEVFIHP  874



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score =   110 bits (275),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 128/258 (50%), Gaps = 17/258 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTN-TSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQK  182
            IW M +LR+++    S+  P     N        N+ T+  +SP+ CT E+     K++K
Sbjct  622  IWQMSQLRYLYARGISLCSPGLISGNEVERLVLGNLLTVSGLSPSCCTKEVIEGIKKVKK  681

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVE----LKVTVFDKFLRRL  350
            L +R    +   + +     I+NL+ L  L+ L +  N+         ++T  D     L
Sbjct  682  LAIRSTRHDFSKDPE----WIDNLKYLDELEALSIADNNYPSRTCPFFRLTSQDSLPPSL  737

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KL L+ T   W+ M ++G L  LEVL+L   AF G  W +    IFK LKY  + +   
Sbjct  738  KKLKLTTTHLPWEYMAIIGKLPNLEVLQLKKWAFEGNEWKVTE--IFKNLKYFLLDQSYF  795

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
              W + DS+  FP LE LI+R+C  L+ IP++F     L+++E++    RV D  + I  
Sbjct  796  QYWKS-DSNDHFPNLEQLIIRDCSFLKEIPQEFNTSKTLELIEVHGCTRRVVDLFKGILD  854

Query  711  KRH--GKTNVKINAFNVF  758
             +   G+  +K+N FN F
Sbjct  855  FQDLLGRDKLKVNDFNTF  872



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 127/245 (52%), Gaps = 23/245 (9%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNTSMQLPSSPPK---NSSRGT-NICTLCTISPASCTSEIFNKTPKLQ  179
            G W M +LRH+ +  S  L  SPPK   N  R   N+ ++  + P  CT E+F    K++
Sbjct  620  GTWKMSQLRHLDS-ASFYL-CSPPKVDGNKYRVLENLQSVYGLRPVCCTKEMFEGIKKVK  677

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL-----HGNSEKVELKVTVFDKFLR  344
            KLG+ G     +   K   CL +NL  L  L+ LK+     +G     +  V     F  
Sbjct  678  KLGICGRTGHFYDAPK---CL-DNLIYLPELEVLKILLYDAYGVDFLHKHPVPCVGSFPP  733

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGK-----LWDLNSDVIFKGLKYL  509
             L+KLTL GT   W  +T++  L +LEVL+L    F G      +W++ SD+ F  L++L
Sbjct  734  NLKKLTLQGTHLLWSQLTIISKLPKLEVLQLKALLFFGDELGETVWEV-SDMGFPKLRFL  792

Query  510  RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
             +    L  W A  SD SFP LE +I++NC  LQ IP+ F++   LK +EL+     + +
Sbjct  793  LVENKGLKNWNA--SDDSFPCLERVIIKNCRFLQEIPKGFSDSMTLKRIELWGCTPSLVN  850

Query  690  FAREI  704
            FA+EI
Sbjct  851  FAKEI  855



>ref|XP_011102162.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=997

 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 116/218 (53%), Gaps = 11/218 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M++LRH+       LP  P  N +   N+ TL  +S  SCT ++F + P L KLGV+
Sbjct  750  IWDMKELRHLQV-MGRDLPD-PTSNDAFLLNLSTLLGVSAHSCTYKVFERIPNLIKLGVQ  807

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK--FLRRLRKLTLS  368
              L+    +  + +C    L  L  L++LK    +  ++L V       F   L+KLTLS
Sbjct  808  MELAP---DVDEPLCCFELLASLHKLESLKWSVVNPNLQLLVPAASVPIFPPGLKKLTLS  864

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
            G  F W+ M+ +  LE LEVLKL   AF G++W+     IF  L++L +   +L  W   
Sbjct  865  GLGFPWEYMSTIARLENLEVLKLQCYAFQGQVWNTKLS-IFSKLRFLLIEDTDLEDWYV-  922

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
                 FP LE LILR+C  L+ I ++  ++  L+++EL
Sbjct  923  --KSWFPSLERLILRHCYKLKEISKEIGDIVCLEMIEL  958



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score =   109 bits (273),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 132/258 (51%), Gaps = 18/258 (7%)
 Frame = +3

Query  12   GIWNMEKLRHVHT-NTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQ  179
            GIW + +LRH+H     +  P +  +N  +     NI T+  + P+ CT EIF    K++
Sbjct  618  GIWKLSQLRHLHCWCMYLDSPQTVSENEVKNLVLENIKTVSGLIPSCCTKEIFEAIKKVK  677

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF-----DKFLR  344
            KL + G   E     + ++   NNL+ LK L+ L +    + +  ++          F  
Sbjct  678  KLEIAGKAEEF----QSEMGWHNNLKYLKELEALNVTVPPDFISDRLPCLINPSPGSFPS  733

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             L+KLTLS T   W+ M +   L  LEVL+L  +AFSG  W++ +++ F  LK L +  +
Sbjct  734  NLKKLTLSRTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEI-TEMGFPKLKCLLLEDL  792

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             L  WTA  +D  F  LE + +R C  L+ IPE FA+   L+++EL+     +  FA++I
Sbjct  793  YLRYWTA--TDDYFQCLERVCIRECTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQI  850

Query  705  CVKRH--GKTNVKINAFN  752
              K    G   +K+ AF+
Sbjct  851  QEKHEELGNNLLKVYAFD  868



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score =   109 bits (273),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 126/241 (52%), Gaps = 23/241 (10%)
 Frame = +3

Query  18    WNMEKLRHVHTNTSMQLPSSPPKNSSRGT-----NICTLCTISPASCTSEIFNKTPKLQK  182
             W+M  LRH+  + ++ L + P  NS         N+ TL TI  + CT E+F+  P L+K
Sbjct  877   WSMPSLRHLQCSVTIYLKNPPGANSELPQLFVPKNVQTLSTIKISCCTKEVFSVMPHLKK  936

Query  183   LGVRGNLSELFLETKQK--VC----LINNLQMLKCLKNLKLHGNSEKVELK-VTVFDKFL  341
             L +         ET++   +C    L+ NLQ LK L+ L+     ++VE + ++ F    
Sbjct  937   LEI--------CETEEDCGICEPSVLLGNLQYLKELETLECCFYKQRVEARQISFFSALP  988

Query  342   RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
               LR+L+LS +   W+D +++G L  LEVLKL   AF G  W+  +   F  L +L +  
Sbjct  989   CSLRQLSLSWSYLPWEDTSLIGMLPRLEVLKLKHFAFHGPKWEPKTKG-FCRLTHLLIEN  1047

Query  522   MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
              +L+ W A  +   FP L+ L+L++C  L+ IP D   +  L+ +EL++  +     ARE
Sbjct  1048  TDLVHWEA--TVHHFPRLQYLVLKSCKLLEEIPFDVEEIGTLQRIELHHCNKTTEILARE  1105

Query  702   I  704
             I
Sbjct  1106  I  1106



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score =   109 bits (272),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 132/258 (51%), Gaps = 18/258 (7%)
 Frame = +3

Query  12   GIWNMEKLRHVHT-NTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQ  179
            GIW + +LRH+H     +  P +  +N  +     NI T+  + P+ CT EIF    K++
Sbjct  619  GIWKLSQLRHLHCWCMYLDSPQTVSENEVKNLVLENIKTVSGLIPSCCTKEIFEAIKKVK  678

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF-----DKFLR  344
            KL + G   E     + ++   NNL+ LK L+ L +    + +  ++          F  
Sbjct  679  KLEIAGKAEEF----QSEMGWHNNLKYLKELEALNVTVPPDFISDRLPCLINPSPGSFPS  734

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             L+KLTLS T   W+ M +   L  LEVL+L  +AFSG  W++ +++ F  LK L +  +
Sbjct  735  NLKKLTLSRTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEI-TEMGFPKLKCLLLEDL  793

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             L  WTA  +D  F  LE + +R C  L+ IPE FA+   L+++EL+     +  FA++I
Sbjct  794  YLRYWTA--TDDYFQCLERVCIRECTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQI  851

Query  705  CVKRH--GKTNVKINAFN  752
              K    G   +K+ AF+
Sbjct  852  QEKHEELGNNLLKVYAFD  869



>ref|XP_006348578.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=915

 Score =   108 bits (271),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 84/257 (33%), Positives = 130/257 (51%), Gaps = 15/257 (6%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M  LRH+H   +  L   P +NS    N+  L  +  + CT+EIF+  P L++L V 
Sbjct  594  IWMMRNLRHLHVRKACTL-LLPSRNSI--LNLEELSNLCFSCCTNEIFSGIPDLKRLIVH  650

Query  195  GNLSELF-LETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLSG  371
               S  F +     +  +  L+ LKC+       ++  + +K + F K L+RL   TL G
Sbjct  651  HRYSSAFSVNDITDMSSLTKLEALKCVSEY-FWFSTPPISIKQSFFPKSLKRL---TLDG  706

Query  372  TL-FQWDDM-TVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
               F WDD+ T+L  L  LE LKL D+A +  +W L+++  F+ LK+L    +NL  W A
Sbjct  707  GFCFPWDDISTLLVMLPNLEELKLKDHAANDHVWRLSAETKFESLKFLLFHGLNLKYWEA  766

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHGK  725
              S  +FP L  L+L+ C  L  IP DF  +  L+ +ELY       + AR+I  ++   
Sbjct  767  --SSDNFPNLRRLVLKKCTKLNEIPIDFGEICTLESIELYQCGVGAEESARKIEQEQEDM  824

Query  726  TNVKINAFNVFITPLQS  776
             N   N   +FI  +++
Sbjct  825  GN---NFLKIFIHGIEA  838



>gb|EYU17692.1| hypothetical protein MIMGU_mgv1a019705mg [Erythranthe guttata]
Length=730

 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 110/214 (51%), Gaps = 8/214 (4%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW++ KL H+    S  LP   P+  S   N+  L  +S  SCT ++  + P LQKLG+R
Sbjct  518  IWDLRKLEHLQIMGS-NLPK--PREGSFLPNLLALLDVSAQSCTEDVLERIPNLQKLGIR  574

Query  195  GNLSELFLETKQKVCL--INNLQMLKCLKNLKLHGNSEKVELKVTVF--DKFLRRLRKLT  362
              L+   ++ K   C   I++L  L  LK + ++      E+   +F    F   L KLT
Sbjct  575  IELALENVDQKPFFCFDHISHLHELNTLKCVVVNPQITLSEIVAPIFPLSIFPSSLVKLT  634

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            LSG  + W++M+ + SL  L VLKL   AF G  W++     F+ L+ L +   +L+ WT
Sbjct  635  LSGLGYPWEEMSRISSLPNLRVLKLKCYAFRGPKWEVVGRFEFEALRILLIEDTDLVQWT  694

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDN  644
              D D  F  L  L +++C  L+ IP +F NV +
Sbjct  695  VAD-DYHFRHLSCLSIKHCYKLEEIPANFGNVSS  727



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score =   108 bits (270),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 135/269 (50%), Gaps = 30/269 (11%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNT----SMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQ  179
            GIW + +LRH+H       S QL S     +    N+ T+  + P+ CT EIF    K++
Sbjct  616  GIWKLSQLRHLHCWCMYLDSPQLASQNEAKNLILENLQTVYGLRPSCCTKEIFEGIKKVK  675

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD---------  332
            KL + G   E   ET       NNL+  + L+ LK+      V L    FD         
Sbjct  676  KLEIAGEAQEFNSETGWH----NNLKYFEELEALKV-----TVSLYCG-FDYPPCLINPS  725

Query  333  --KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKY  506
               F   L+KLTL+ T   W+ M +   L  LEVL+L + AFSG  W++ +++ F  LK+
Sbjct  726  SGSFPPNLKKLTLTRTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEI-TEMGFPKLKF  784

Query  507  LRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVS  686
            L +  + LI W A  +D  F  LE + +R C  LQ IPE FA+   L+++EL+  C  + 
Sbjct  785  LLLEDLLLIYWKA--TDDYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLV  842

Query  687  DFAREICVKRH--GKTNVKINAFNVFITP  767
             FA++I  K    G   +K+ AF+  +TP
Sbjct  843  TFAKQIQEKHEELGNNMLKVYAFDSNLTP  871



>ref|XP_006364072.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=584

 Score =   107 bits (267),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 118/233 (51%), Gaps = 24/233 (10%)
 Frame = +3

Query  21   NMEKLRHVHTNT-SMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVRG  197
            NM +LRH+HT   S+ +P      + R  ++ TL  + P+SC  E+F + P L+KLG+  
Sbjct  324  NMPQLRHIHTKKFSLFIPPPTSLIAKRENHLQTLTGLMPSSCNEEVFLRIPNLKKLGILI  383

Query  198  NLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKV--------------ELKVTVFDK  335
                   +T QK   ++NL  L  L+ LK+      +               L +   D 
Sbjct  384  VDDS---DTIQKCYCLDNLVHLSQLEKLKVQFRESYMLIFRWMSEDWMDLSSLHIPHCDN  440

Query  336  FLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRM  515
            F   L+KLTL  T  QW+DM +L  L  LEVLKL  +AF G +W L SD    G   L+ 
Sbjct  441  FPPNLKKLTLCRTHIQWEDMNILRKLPNLEVLKLKHHAFLGLIWKL-SDEDEDGFLKLKF  499

Query  516  GK---MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
                 MNL+ W A  +   FP LE L+L +C  L+ +P DFA +  L+++EL+
Sbjct  500  LLLENMNLMQWEA--TSYHFPNLEHLVLTDCYLLEQMPFDFAEIQTLQLIELH  550



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score =   107 bits (268),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 117/225 (52%), Gaps = 16/225 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPKL  176
            +W +++LRH+H N    LP+ P      G       N+ TL  +S +SCT ++    P L
Sbjct  528  LWTIQQLRHLHFNFCSFLPN-PAGAEINGQGDLVLRNLQTLSKLSFSSCTMQVIASLPNL  586

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELK--VTVFDKFLRRL  350
            +KLG    L E           I+N+  L  L+ LKL+  +   E +  V   D+F   L
Sbjct  587  KKLG----LYETAEAHSNCWSYISNVAQLHQLEILKLNFINLFAEERRWVPCVDEFPPNL  642

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTLS +   W DM VL  L  LEVLKL +NAF G  W+   +  F  LKYL + K +L
Sbjct  643  KKLTLSSSYLPWKDMNVLSMLPNLEVLKLKNNAFVGSDWE-QYEEGFSRLKYLLIDKTDL  701

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
            + W A  +   FP L+ L L  C  L+ +P DFA +  L+++++Y
Sbjct  702  VHWRATST--QFPSLKHLRLFRCRCLREVPLDFAEIPYLQIIDVY  744



>ref|XP_004243045.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
[Solanum lycopersicum]
Length=473

 Score =   106 bits (264),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 111/216 (51%), Gaps = 27/216 (13%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   +W M+  RH+    S+ LP +P   S++  N+  L  +  +SCT E+F+  P L+ 
Sbjct  275  IHETVWQMKHSRHLKLRQSISLPKNP---SNKLQNLEGLSCLRLSSCTFELFSAIPNLKT  331

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL-------  341
            L +RG+  E   +  QK  +  +L  L CLK L+        +LK+   D +L       
Sbjct  332  LILRGSQKEC--QGDQK--MFKHLNSLACLKRLE--------QLKIRCKDLYLFPIPCKY  379

Query  342  ---RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLR  512
                 LR LTLS T   W+DM  +  L +LEVLK+ +  F G +W LN   IF  LK+L 
Sbjct  380  TLPTSLRSLTLSYTYLPWEDMANIVKLPKLEVLKIKNYGFYGDVWRLNDGEIFNQLKFLL  439

Query  513  MGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIP  620
            +   +L  W A     +FP+L+ ++LR CI L+ IP
Sbjct  440  IRTNDLKQWKA--GSVNFPMLQRVVLRTCIYLKEIP  473



>emb|CDP05521.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   108 bits (269),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 123/250 (49%), Gaps = 26/250 (10%)
 Frame = +3

Query  15    IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
             IW M KLRH+  +   +  +  P ++    +I              +  + P ++ LG  
Sbjct  786   IWKMFKLRHLQISPEFEFETPWPNSAGPSRDI--------------LLARIPNVRNLGFH  831

Query  195   GNLSELFLETKQKVCLINNLQMLKCLKNLKL-HGNSEKVELKVTVFDKFLRRLRKLTLSG  371
               LS     +++      +L  L  L+ LK  +     V + ++  DKF   L+KLTL G
Sbjct  832   ITLS-----SREDPFNFFDLSGLNVLEKLKFEYQTYGMVPVTISSSDKFPSSLKKLTLVG  886

Query  372   TLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVD  551
             +   W++M+++G L  LEVLK+ DN F+G  W+   +  F+ L++L+   M+L  W A  
Sbjct  887   SHVNWEEMSIIGMLPNLEVLKVKDNFFNGPKWE-TCEGGFRRLRFLKFSHMDLQEWIATA  945

Query  552   SDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHGKTN  731
              D  FP LE L+L  C++L  IP  F +   L+V+E+Y   + V+D A   C  +  + N
Sbjct  946   DD--FPSLEKLVLNGCLALTEIPSAFGDSCTLQVIEVYRSSDTVADSA---CQIQESQRN  1000

Query  732   VKINAFNVFI  761
                + F VFI
Sbjct  1001  WGNDEFKVFI  1010



>gb|EYU24408.1| hypothetical protein MIMGU_mgv1a022062mg [Erythranthe guttata]
Length=740

 Score =   107 bits (267),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 115/212 (54%), Gaps = 11/212 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M+KL+HV    S QLP+  P   S   N+ TL  +S  SCT  +    P L+KLG++
Sbjct  494  IWDMKKLKHVQFMGSNQLPN--PSEGSYLPNLLTLSDMSARSCTKSVLESIPNLKKLGIQ  551

Query  195  GNLS-ELFLETKQKVCL--INNLQMLKCLKNLKLHGNSEKVELKVTV---FDKFLRRLRK  356
              LS E     +   C   I++L+ L+ LK + ++ +     + V        F   L+K
Sbjct  552  IELSPEAATNQEPSSCFDHISHLEKLESLKCVVVNPSFNTTRIAVCPPPPLSVFPSGLKK  611

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L+LSG  + W++M+ +  L  LEVLKL   AF G  WD+  D  F  L+++ +   +L+ 
Sbjct  612  LSLSGLGYPWEEMSKIALLPNLEVLKLRSCAFRGPKWDVE-DNRFLRLEFILIEDSDLVH  670

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFA  632
            WTA   ++SFP L+ L +++C  LQ +P  F+
Sbjct  671  WTA--GNRSFPYLDCLSIKHCYKLQVVPRQFS  700



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score =   107 bits (267),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 120/241 (50%), Gaps = 19/241 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP--SSPPKNS---SRGTNIC-----TLCTISPASCTSEIFNK  164
            IW ++ LRH++       P   S  K+S   SR +N+      T+  I+  S    +  +
Sbjct  613  IWEIKNLRHLYFRKCCYFPIVQSIQKDSLGSSRHSNLALTKLRTISYITFGSIKRRVLKR  672

Query  165  TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLK-LHGNSEKVELKVTVFDKFL  341
              KL+KLG+R +  E     +       NL+ L  L++L+   G   K  L     D F 
Sbjct  673  MHKLKKLGIRESEEECLTAEQMS----GNLKKLVLLEHLETFKGFFIKPWLPKQC-DVFP  727

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              L+KLTL G    WD MT+L  L +LEVLKL   AF G  W+ ++D  F+ LK+L +  
Sbjct  728  PTLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWE-STDERFQQLKFLLLDG  786

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +LI W A  S   FP LE+L+L+NC  L  IP+D A +  L  +ELY+      D A  
Sbjct  787  TDLIHWKA--SSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANR  844

Query  702  I  704
            I
Sbjct  845  I  845



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score =   107 bits (267),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 120/241 (50%), Gaps = 19/241 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP--SSPPKNS---SRGTNIC-----TLCTISPASCTSEIFNK  164
            IW ++ LRH++       P   S  K+S   SR +N+      T+  I+  S    +  +
Sbjct  613  IWEIKNLRHLYFRKCCYFPIVQSIQKDSLGSSRHSNLALTKLRTISYITFGSIKRRVLKR  672

Query  165  TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLK-LHGNSEKVELKVTVFDKFL  341
              KL+KLG+R +  E     +       NL+ L  L++L+   G   K  L     D F 
Sbjct  673  MHKLKKLGIRESEEECLTAEQMS----GNLKKLVLLEHLETFKGFFIKPWLPKQC-DVFP  727

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              L+KLTL G    WD MT+L  L +LEVLKL   AF G  W+ ++D  F+ LK+L +  
Sbjct  728  PTLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWE-STDERFQQLKFLLLDG  786

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +LI W A  S   FP LE+L+L+NC  L  IP+D A +  L  +ELY+      D A  
Sbjct  787  TDLIHWKA--SSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANR  844

Query  702  I  704
            I
Sbjct  845  I  845



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score =   107 bits (267),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 120/241 (50%), Gaps = 19/241 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP--SSPPKNS---SRGTNIC-----TLCTISPASCTSEIFNK  164
            IW ++ LRH++       P   S  K+S   SR +N+      T+  I+  S    +  +
Sbjct  613  IWEIKNLRHLYFRKCCYFPIVQSIQKDSLGSSRHSNLALTKLRTISYITFGSIKRRVLKR  672

Query  165  TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLK-LHGNSEKVELKVTVFDKFL  341
              KL+KLG+R +  E     +       NL+ L  L++L+   G   K  L     D F 
Sbjct  673  MHKLKKLGIRESEEECLTAEQMS----GNLKKLVLLEHLETFKGFFIKPWLPKQC-DVFP  727

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              L+KLTL G    WD MT+L  L +LEVLKL   AF G  W+ ++D  F+ LK+L +  
Sbjct  728  PTLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWE-STDERFQQLKFLLLDG  786

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             +LI W A  S   FP LE+L+L+NC  L  IP+D A +  L  +ELY+      D A  
Sbjct  787  TDLIHWKA--SSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANR  844

Query  702  I  704
            I
Sbjct  845  I  845



>emb|CDP00687.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 122/235 (52%), Gaps = 10/235 (4%)
 Frame = +3

Query  18   WNMEKLRHVHTNTSMQL--PSSPPKNSSR---GTNICTLCTISPASCTSEIFNKTPKLQK  182
            W+M  LRHVH   +  L  P +   N  R     ++ TL TI  + CT E F+  P L+K
Sbjct  136  WSMPSLRHVHITAACHLKNPFTVQDNLPRPFASEHLQTLYTIQFSCCTKEFFSVMPHLKK  195

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV-FDKFLRRLRKL  359
            LG+     +   ++  +V  +NNL  L+ L+ L+   +++  E++  +        L+ L
Sbjct  196  LGICETKEDYSTDSLSQV--LNNLVCLQELETLECSFHTQNREVRKNLGLAALPVTLKHL  253

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            +LS +   W+DMT +  L  LEVLKL + AF G  W+   +  F  LK+L +   +LI W
Sbjct  254  SLSWSYLPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPTEEG-FHSLKHLLIENTDLIHW  312

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             A+   + FP L+ L+L++C  L+ IP     +  L+ +E +   E + + A+EI
Sbjct  313  EAIIV-RHFPCLQHLVLKSCKLLEEIPFGVEELGTLQRLEAHYCSEPIENSAKEI  366



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   107 bits (266),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 109/224 (49%), Gaps = 8/224 (4%)
 Frame = +3

Query  18   WNMEKLRHVHTNTSMQL--PSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGV  191
            W M  LRH+H +    L  P  P +       + TL TI  ASCTS++F   P L+KLG+
Sbjct  765  WIMPWLRHLHISMPCYLSNPFDPSRCPLAPRYLQTLSTIRFASCTSDVFLVMPYLRKLGI  824

Query  192  RGNLSELFLETKQKVCLIN--NLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTL  365
                 E F+       L N  NLQ L+ LK      N+E   +       F   LRKLTL
Sbjct  825  -CETKEDFITDMSCRWLKNLANLQYLEALKCSFYKQNAEAPRILRPSVLHFPLTLRKLTL  883

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            S +   W D+  +  L  LEVLKL + AF G  W+   +  F+ LK+  +   NL  W A
Sbjct  884  SWSYLPWKDIACIAMLPNLEVLKLKNYAFQGPDWEPTEEA-FRRLKHFLIDSTNLENWEA  942

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCE  677
              S  +FP LE L+LR C  L+ IP+    ++ L+  EL+   E
Sbjct  943  --SSDNFPCLEHLVLRGCKFLKGIPDGIEEINTLQRFELHYCSE  984



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 134/284 (47%), Gaps = 51/284 (18%)
 Frame = +3

Query  15   IWNMEKLRHVH---------------------TNTSMQLPSSP-----PKNSSRG----T  104
            IW +E LRH++                     + +++ L   P     P   SR     T
Sbjct  613  IWEIEPLRHLYFRKCCYFRYVQSEQKDHQGTSSRSNLGLTRWPTFSYHPSEFSRSNLGLT  672

Query  105  NICTLCTISPASCTSEIFNKTPKLQKLGVRGNLSELFLETKQK-----VCLINNLQMLKC  269
             + TL  I+  S    IF   PKL+KLG+R +  E     K       + L+  L+ LKC
Sbjct  673  KLQTLSYITFGSIKRRIFKGMPKLKKLGIRESEEEHLTAKKMSRKLKKLVLLEKLETLKC  732

Query  270  LKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNA  449
               +K     E+        D F   L+KLTL G    W+ MT+L  L ELEVLKL D A
Sbjct  733  F-FIKPWILKER--------DVFPPTLKKLTLRGCQLPWNQMTILCMLPELEVLKLKDYA  783

Query  450  FSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDF  629
            F G  W+ ++D  F+ LK+L +   +LI W  VDS + FP LESL+L+NC  L  IP+D 
Sbjct  784  FQGSEWE-STDERFQQLKFLLLDGTDLIHWI-VDSIQ-FPKLESLVLKNCYCLSEIPDDV  840

Query  630  ANVDNLKVMELYNVCERVSDFAREICVKRHGKTN----VKINAF  749
            A +  L+ +ELY+        A  I  ++H   N    V+I+ F
Sbjct  841  AEIPTLQFIELYHCSSSADVSANRIQEEQHSMGNDDLVVRIHKF  884



>gb|EYU24406.1| hypothetical protein MIMGU_mgv1a002161mg [Erythranthe guttata]
Length=707

 Score =   106 bits (264),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 127/250 (51%), Gaps = 18/250 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M+KL+H+    S Q+P   P   S   N+ TL  IS  SC + +F   P L+KLG+R
Sbjct  461  IWDMKKLKHLQFTGSNQVPD--PGEGSFLPNLVTLSDISARSCNTGVFRSIPNLKKLGIR  518

Query  195  GNLS------ELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
              LS         L   Q +  +  L+ LKC+    +   +            F   L+K
Sbjct  519  IELSPDEATDREPLSCFQHISHLEKLESLKCVVVNPIFNTTGIAVCPPPPLSVFPSGLKK  578

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L+L G  + W++M+ +  L  LEVLKL   AF G  W++  D  F  L+++ +   +L+ 
Sbjct  579  LSLCGLGYPWEEMSKIALLPNLEVLKLRSYAFRGPKWEVE-DNRFLRLEFILIEDSDLVR  637

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
            WTA   + SFP LE L +++C  LQ +P  F+   +L  +++ +    V ++A+++    
Sbjct  638  WTA--GNGSFPFLECLNIKHCYKLQAMPRKFSF--DLGKIQVVDCTPLVVNWAKKL----  689

Query  717  HGKTNVKINA  746
              K +V+++A
Sbjct  690  -TKIDVRVDA  698



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 117/236 (50%), Gaps = 17/236 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISP------ASCTSEIFNKTPKL  176
            IWNM +LR +   +   L  S PK S+   ++  L  +        ASCT E+F+  P +
Sbjct  621  IWNMTQLRRLRLLSGNYL--SKPKRSTTTDDVLGLSNLEELSHLCFASCTEEVFSCLPSI  678

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
            +K+ +    S+   E  Q +  +  L+ LKC+     +G      L ++ +   L  +++
Sbjct  679  RKVSILDAASDDASEYLQNLVHLEKLETLKCV----CYGQKR---LTLSNWCASLTSVKR  731

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L LSG L    DM  L +L  LEVLKL DN F G  W L+ +  F  LK+L + +  L+ 
Sbjct  732  LILSGCLLLSQDMASLAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLAEPRLLN  791

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            W A     +FP L+ L+LR CI L+ IP D   +  L+++EL        + A EI
Sbjct  792  WEA--GSVNFPNLQKLVLRKCICLEEIPIDIGEICTLEMIELICCSSSAQNSANEI  845



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score =   106 bits (264),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/241 (32%), Positives = 120/241 (50%), Gaps = 22/241 (9%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP----SSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            IW M+ LRH+        P    +    +SS+  N+  L  +S + C++E+F +TP L++
Sbjct  636  IWKMKLLRHLEVKKISSFPVPSSTYTTGSSSKLQNLEVLSDLSISCCSNEMFTRTPNLKR  695

Query  183  LGVRGNLSELFLETKQKV-----CLINNLQMLK--CLKNLKLHGNSEKVELKVTVFDKFL  341
            L + G   E   +T  +      CL   L++LK  C + L  H    K  L  +      
Sbjct  696  LKLHGAWEECRRDTISQTLNSLYCL-TELEILKIKCSRKLYPHPLPSKYVLPNS------  748

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              L +LTL  T   W+DM  + +L  L+VLK+ DN F G  W L+ + IF  LK+L + +
Sbjct  749  --LMRLTLRCTYLPWEDMANIVTLPNLQVLKIKDNGFDGDAWRLSDEEIFNQLKFLLIDR  806

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
             NL  W A     +FP L+ L+L+ CI L+ IP+D   +  L+ +EL N     +   +E
Sbjct  807  TNLKRWKA--GSVNFPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAKSVKE  864

Query  702  I  704
            I
Sbjct  865  I  865



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score =   106 bits (264),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/233 (34%), Positives = 115/233 (49%), Gaps = 9/233 (4%)
 Frame = +3

Query  18   WNMEKLRHV--HTNTSMQLPSSPPKNSSR--GTNICTLCTISPASCTSEIFNKTPKLQKL  185
            WNM  LRH+      S+ +P  P  N        + TL TI   SCT E+F   P L++L
Sbjct  580  WNMPWLRHLGFTVTCSLCIPPIPEINYPYPLAPILQTLSTIRLTSCTREVFRSMPYLRRL  639

Query  186  GVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTL  365
             +     +    T +    ++NL  L  L+ LK     +    +   +D F   LRKLTL
Sbjct  640  AICETKEDH--NTNETSKYLSNLVHLPLLEALKCSFYRDAKPWRTLPWDAFPSNLRKLTL  697

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            S +   W+DMT +  L +LEVLKL + AF G  W+   D  F  LK L +   +L+ W A
Sbjct  698  SWSYLPWEDMTNISRLPKLEVLKLRNCAFLGPEWEPPEDE-FLHLKQLLIENSDLVQWKA  756

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
              S   FP L+ L+L NC  L+ IP +   +  L+++EL+N  +     A+EI
Sbjct  757  --STIHFPSLDRLVLVNCRFLEEIPVEIGEIPTLRLLELHNCSKSAEISAKEI  807



>ref|XP_006344326.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1302

 Score =   106 bits (264),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 128/257 (50%), Gaps = 22/257 (9%)
 Frame = +3

Query  15   IWNMEKLRHVHT-NTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGV  191
            IW M +++HV      M  P S  +      N      +  +   +EI  +TP + KL +
Sbjct  210  IWTMSEIKHVIIEQMDMPNPLSIEEQQPLFLNNLQTLALDSSPFLAEILKRTPNVDKLKI  269

Query  192  RG----NLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKL  359
            R     N    F++     CLIN LQ L+ L       NS ++ L        L+ LR  
Sbjct  270  RAANTHNEWSDFVD-----CLIN-LQRLEKLSITATEDNSPRI-LSSAFCAPNLKHLR--  320

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM-NLIT  536
             L+ T   W+DM VL +L  LEVLK D +AF+G  WDLN DV+F+ LKYLR+ +  +L  
Sbjct  321  -LAETSLPWEDMAVLANLPNLEVLKAD-HAFTGTDWDLNEDVVFQKLKYLRIKRADDLEM  378

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
            W A  +  SFP+LE L+L++   L++IP+ F  +  LK++++      V D AR I   +
Sbjct  379  WEA--ASDSFPMLEQLVLQHLEELEDIPQSFGEIMTLKLVQVKYCSPTVDDSARNILEDQ  436

Query  717  HGKTNVKINAFNVFITP  767
                N ++    + I P
Sbjct  437  QSWGNYEL---QIIIVP  450


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 128/254 (50%), Gaps = 25/254 (10%)
 Frame = +3

Query  9     GGIWNMEKLRHVHTNTSMQLPSSPPKNSSRG-----TNICTLCTISPASCTSEIFNKTPK  173
               IW M +++H+     M +P+       +       N+ TL  +  +   +EI  +TP 
Sbjct  1052  AEIWTMSQIKHLDIE-QMDMPNPLSIGDQQPEFLYLNNLQTL-ALDSSPFLAEILERTPN  1109

Query  174   LQKLGVRG----NLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL  341
             ++KL +R     N    F++     CLIN LQ L+ L       NS ++ L        L
Sbjct  1110  VEKLKIRAANTHNEWSDFVD-----CLIN-LQRLEKLSITATEDNSPRI-LSSAFCAPNL  1162

Query  342   RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
             + LR   L+ T   W++M VL +L  LEVLK D +AF+G  W LN DV+F+ LKYLR+  
Sbjct  1163  KHLR---LAYTSLPWEEMDVLANLPNLEVLKAD-SAFNGTDWTLNEDVVFQKLKYLRIWS  1218

Query  522   MN-LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAR  698
              + L  W A  +  +FP+LE L+L++   L+ IP+    +  LK++++ N    V   AR
Sbjct  1219  ADDLERWEA--TSDNFPMLEKLVLQHLEELEEIPQSVGEIMTLKLVQVENCNPAVDTSAR  1276

Query  699   EICVKRHGKTNVKI  740
              I  ++ G  N ++
Sbjct  1277  NILQEQQGWGNCEL  1290



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score =   105 bits (263),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 118/236 (50%), Gaps = 17/236 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISP------ASCTSEIFNKTPKL  176
            IWNM +LR +   +   L  S PK S+   ++  L  +        +SCT E+F+  P +
Sbjct  625  IWNMTQLRRLRLLSGNYL--SKPKRSTTTDDVLGLSNLEELSHLCFSSCTEEVFSCLPNI  682

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
            +KL +    S+   E  + +  +  L+ LKC+     +G      L ++ +   L  +++
Sbjct  683  RKLSILDAASDDASEYLKNLVHLEKLETLKCI----CYGQKR---LTLSNWCASLTSVKR  735

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            L LSG L   +DM  L +L  LEVLKL DN F G  W L+ +  F  LK+L + +  L+ 
Sbjct  736  LVLSGCLLLSEDMASLAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLSEPRLVN  795

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            W A     +FP L+ L+LR CI L+ IP D   +  L+++EL        + A EI
Sbjct  796  WEA--GSVNFPNLQKLVLRKCIRLEEIPLDIGEICTLEMIELICCSSSAQNSANEI  849



>ref|XP_011087137.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=870

 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 124/242 (51%), Gaps = 11/242 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IWNM +L+H+    S  LP+ P    +   N+ TL  IS  SCT EI  + P L+KLG +
Sbjct  619  IWNMRELKHLQVMGS-DLPN-PDSEGAFLPNLSTLLGISAHSCTEEILGRIPNLKKLGFQ  676

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK---FLRRLRKLTL  365
                EL L+  + + + N+ + LK LK   ++ N    ++ V        F   L+KLTL
Sbjct  677  ---VELPLDAVEPLHVANS-RGLKSLKCAIVNPNPSFDQVVVPALQGVSIFPSTLKKLTL  732

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            SG    W+DM+++  +  LEVLKL   AF G +W       FK L++L +  M+L  WT 
Sbjct  733  SGLSLPWEDMSIIACIWNLEVLKLRCYAFRGSVWQ-TCQKGFKNLRFLLIEDMDLEYWTG  791

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHGK  725
             +    FP L+ L + +C  L+ IP  F  V  L++ME+ +    +   A +I  ++ G 
Sbjct  792  -NRISFFPDLQRLTVGHCYKLKEIPCQFEEVLTLQMMEVVDCAPSLVASAEKIVKQQKGC  850

Query  726  TN  731
             N
Sbjct  851  GN  852



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 89/264 (34%), Positives = 132/264 (50%), Gaps = 30/264 (11%)
 Frame = +3

Query  12   GIWNMEKLRHVHTNT----SMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQ  179
            GIW + +LRH+H       S QL S     +    N+ T+  + P+ CT EIF    K++
Sbjct  616  GIWKLSQLRHLHCWCMYLDSPQLASQNEAKNLILENLQTVYGLRPSCCTKEIFEGIKKVK  675

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD---------  332
            KL + G   E   ET       NNL+  + L+ LK+      V L    FD         
Sbjct  676  KLEIAGEAQEFNSETGWH----NNLKYFEELEALKV-----TVSLYCG-FDYPPCLINPS  725

Query  333  --KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKY  506
               F   L+KLTL+ T   W+ M +   L  LEVL+L + AFSG  W++ +++ F  LK+
Sbjct  726  SGSFPPNLKKLTLTRTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEI-TEMGFPKLKF  784

Query  507  LRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVS  686
            L +  + LI W A  +D  F  LE + +R C  LQ IPE FA+   L+++EL+  C  + 
Sbjct  785  LLLEDLLLIYWKA--TDDYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLV  842

Query  687  DFAREICVKRH--GKTNVKINAFN  752
             FA++I  K    G   +K+ AF+
Sbjct  843  TFAKQIQEKHEELGNNMLKVYAFD  866



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 113/217 (52%), Gaps = 9/217 (4%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPK-NSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGV  191
            ++ M +LRHV   T + LP+   K N     ++ TLCT++   CT E+  K P L+KLGV
Sbjct  640  VFQMAQLRHVQM-TEIFLPNPIDKENPVVLKDLETLCTVANFRCTEEVLRKFPNLKKLGV  698

Query  192  RGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLSG  371
                + +          + NL  L  L+NLK   N    E  +     F + L+KLTL G
Sbjct  699  YYYGAGI---EDWSAYDLKNLVRLSKLENLKCVFNWPPNETLLPNL-SFPQSLKKLTLDG  754

Query  372  TLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVD  551
            +   W  M+++GSL  LEVLKL   AF+G +W    +  F  LK+L + KM L+ W A  
Sbjct  755  SNLSWKGMSIIGSLPHLEVLKLKQYAFTGAVWK-PVEREFSRLKFLLIEKMRLVRWIA--  811

Query  552  SDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
             +  FP LE LI+  C  LQ IP    ++  LK++++
Sbjct  812  ENTHFPCLEHLIISACHDLQAIPSGIGDIPTLKMIDI  848



>gb|AAT40487.1| putative disease resistance protein [Solanum demissum]
Length=2607

 Score =   105 bits (262),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 89/257 (35%), Positives = 133/257 (52%), Gaps = 15/257 (6%)
 Frame = +3

Query  12    GIWNMEKLRHVHTN--TSMQLPS-SPPKNSSRGTNICTLCT--ISPASCTSEIFNKTPKL  176
              + NM KLRH+H N   S  L + S    +S+  N+ T  T  +S       I  K P L
Sbjct  2269  SLLNMTKLRHIHVNDRASFNLDTMSESLANSQLANLQTFSTPYVSYGEDVEIILRKMPNL  2328

Query  177   QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
              KL      S    + +++  LI  L  L  L++L L  N+  VE  +  F+ F   LR+
Sbjct  2329  TKLKCIVGCSR---KWRRECVLIPRLDFLSRLESLNLFSNNCPVEC-LRGFN-FPSELRE  2383

Query  357   LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
             LTLS     W +++++G+L  LEVLKL + AF G  W++N D  F  L+YL++  +N   
Sbjct  2384  LTLSNFCLPWSEISIVGTLCNLEVLKLLNKAFEGVQWNVN-DTEFPQLRYLKLDSLNFAQ  2442

Query  537   WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
             W+   S+ SFP LE L+L NC  L+ IP    +V +LK +E+      V++ A EI   +
Sbjct  2443  WSI--SEDSFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANSAEEIQTTQ  2500

Query  717   HGKTNVKINAFNVFITP  767
             H   ++  +AF V I P
Sbjct  2501  H--EDMANDAFTVTIQP  2515



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   104 bits (259),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 122/225 (54%), Gaps = 11/225 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT-NICTLCTISPASCTSEIFNKTPKLQKLGV  191
            IW ME+LRH+    S+   + P +       N+ T   ++P +CT E+F + P ++KL +
Sbjct  610  IWRMEQLRHL--KFSLNCLTQPSQEKCLVLENLQTFSGLNPLNCTKEVFKRIPNVKKLMI  667

Query  192  RGNLSELFLETKQKVCLINNLQMLKCLKNLKLH--GNSEKVELKVTVFDKFLRRLRKLTL  365
             G++ + + E++   C  N+L  L  L++L  H   N   + L +     F + L+KLT 
Sbjct  668  LGHMVQ-YGESEMPDCF-NDLASLGKLESLGFHIQTNINHLNLCLPPPGNFPQNLKKLTF  725

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
              T   W +M ++G L  LEVLKL  +A  G+ W+  S+  F  LK+L +   +   W A
Sbjct  726  IFTYMPWKNMDIVGMLPNLEVLKLRSSACIGEEWE-PSENGFHQLKFLLLHCSDPNYWKA  784

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCER  680
              +   FP+LE L+LR+C  LQ IP DFA+   L+ +E+ N CER
Sbjct  785  --TSDHFPLLEHLVLRDCYHLQEIPLDFADSLTLQSIEIEN-CER  826



>emb|CDP21314.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 119/233 (51%), Gaps = 10/233 (4%)
 Frame = +3

Query  24   MEKLRHVHTNTSMQL--PSSPPKNSSR---GTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            M  LRHVH   +  L  P +   N  R     ++ TL TI  + CT E F+  P L+KLG
Sbjct  1    MPSLRHVHITAACHLKNPFTVQDNLPRPFASEHLQTLYTIQFSCCTKEFFSVMPHLKKLG  60

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV-FDKFLRRLRKLTL  365
            +     +   ++  +V  +NNL  L+ L+ L+   +++  E++  +        L+ L+L
Sbjct  61   ICETKEDYSTDSLSQV--LNNLVCLQELETLECSFHTQNREVRKNLGLAALPVTLKHLSL  118

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            S +   W+DMT +  L  LEVLKL + AF G  W+   +  F  LK+L +   +LI W A
Sbjct  119  SRSYLPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPTEEG-FHSLKHLLIENTDLIHWEA  177

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +   + FP L+ L+L+ C  L+ IP     +  L+ +E +   E + + A+EI
Sbjct  178  IIV-RHFPCLQHLVLKPCKLLEEIPFGVEELGTLQRLEAHYCSEPIENSAKEI  229



>ref|XP_011087136.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=877

 Score =   103 bits (256),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 121/222 (55%), Gaps = 14/222 (6%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            +W M++L+H+    S  LP+ P    +   N+ TL  IS  SCT E+  + P L +LG++
Sbjct  630  MWTMQELKHLQVMGS-DLPN-PSLEDACLPNLLTLLGISAHSCTKEVLERIPNLTRLGIQ  687

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV----FDKFLRRLRKLT  362
              L+   L+  + +C +++L+ L+ L++LK    +    L+V V       F   L+KLT
Sbjct  688  IGLT---LDVAKPLCCLDHLRYLRRLESLKCVILNPNPRLRVVVPTPPVTAFPSSLKKLT  744

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            LSG  F W+ M+ +  L  LEVLKL  +AF G +W+   D  F  LK+L +  ++L  W 
Sbjct  745  LSGLGFPWEYMSTIAKLRNLEVLKLRCHAFRGPVWN-AYDCQFLQLKFLLLEDIDLEYWY  803

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
                   FP LE LI+R+C  L+ IP     + +L+++EL +
Sbjct  804  ----RGLFPWLERLIIRDCYKLKRIPLGIKKISSLEMIELVD  841



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score =   103 bits (256),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 127/257 (49%), Gaps = 18/257 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHT-NTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQK  182
            IW + +LRH+H     +  P    +N  +     NI T+  + P+ CT EIF    K++K
Sbjct  620  IWKLSQLRHLHCWCMYLDSPQMVSENEVKNLVLENIQTVSGLIPSCCTKEIFEAIKKVKK  679

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF-----DKFLRR  347
            L + G   E   E   +     NL+ LK L+ L +      +  ++          F   
Sbjct  680  LEIAGKAKEFQSEMGWE----TNLKYLKELEALNVTVLPAVISDRLPCLINPGPGSFPPN  735

Query  348  LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
            L+KLTLS T   W+ M +   L  LEVL+L + AFSG  W++ +++ F  LK L +  + 
Sbjct  736  LKKLTLSRTCLPWNCMNIFSKLPNLEVLELKNYAFSGDEWEI-TEMGFPKLKCLLLEDLY  794

Query  528  LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI-  704
            L  WTA  +D  F  LE + +R C  LQ IPE FA+   L+++EL+     +  FA++I 
Sbjct  795  LRYWTA--TDDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKCYHPLVTFAKQIQ  852

Query  705  -CVKRHGKTNVKINAFN  752
               +  G   +K+ AF+
Sbjct  853  ETHEELGNNMLKVYAFD  869



>ref|XP_009784114.1| PREDICTED: uncharacterized protein LOC104232578 [Nicotiana sylvestris]
Length=208

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 87/147 (59%), Gaps = 10/147 (7%)
 Frame = +3

Query  243  INNLQMLKCLKNLKLH---GNSEKVELKVT-VFDKFLRRLRKLTLSGTLFQWDDMTVLGS  410
             NN Q LKCL+ LKL    G+S    L++   F  FLRRL KLTLS T F W D   LG 
Sbjct  12   FNNFQKLKCLEQLKLLNDVGSSMSKVLQLPHAFLGFLRRLHKLTLSNTRFVWSDANKLGQ  71

Query  411  LEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM-NLITWTAVDSDKSFPVLESLI  587
            LE LEVLKL +NAF G  WD    V F  LK L + +  +L TW +  S+ SF  L+ L+
Sbjct  72   LECLEVLKLKENAFCGTAWD---SVGFSKLKVLWIERATDLETWKS--SNFSFQRLKYLV  126

Query  588  LRNCISLQNIPEDFANVDNLKVMELYN  668
            L++C  L+ +P +FA V +L+ M L N
Sbjct  127  LKSCDKLEAVPFEFAGVTSLQEMTLNN  153



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 127/246 (52%), Gaps = 29/246 (12%)
 Frame = +3

Query  60   MQLPSSPPKNSSRGT--NICTLCTIS-PASCTSEIFNKTPKLQKLGV-----RGNLSELF  215
            M +P  PPK+ +     N+ TL +IS  AS   E F   PK++KL V     R  +S L 
Sbjct  1    MYMPV-PPKSQNLLCLENLETLDSISVAASNWKENFTAIPKVKKLAVCLPPWRSVMSNL-  58

Query  216  LETKQKVCLINNLQMLKCLKNLKLHGNSEKVE-----LKVTVFDKFLRRLRKLTLSGTLF  380
                     I++L  L  L+ L++H +    E     L   + D +   L+  TL GT  
Sbjct  59   ---------IDSLIRLVDLEKLRIHLDISPYENFSLRLPTLLSDVYPTFLKSSTLVGTCL  109

Query  381  QWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVDSDK  560
             W+DMT LG L  +EVL+L   AF G+ W+LN    FK LK L++ + NL+ W A  S +
Sbjct  110  LWEDMTTLGQLPNVEVLRLKCFAFQGRNWNLNEGG-FKKLKLLQINETNLVHWEA--SSE  166

Query  561  SFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRH--GKTNV  734
            S P LE LIL+ C  L++IP +  ++  LK+ EL+N  +  +  + EI  ++   G   +
Sbjct  167  SLPRLEFLILKYCYKLEDIPTEIGDIPTLKLTELHNCSQAAAPSSEEIGEEQQSLGNEVL  226

Query  735  KINAFN  752
             + A+N
Sbjct  227  VVRAYN  232



>ref|XP_011087139.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=988

 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 123/251 (49%), Gaps = 20/251 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M+ LRH+    S  LP  P    +   N+ TL  IS  SCT EI  + P L KLGV+
Sbjct  716  IWDMQGLRHLQVMGS-DLPD-PNYKGALLPNLSTLSGISARSCTKEILERIPNLIKLGVQ  773

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVEL-----KVTVFDKFLRRLRKL  359
              L+  F E    +C   +L  L  L++LK    +  ++L      V +F      L+KL
Sbjct  774  MELAPDFDEL---LCCFEHLASLHKLESLKWSVVNPNLKLLFPAASVLIFPP---GLKKL  827

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVI-FKGLKYLRMGKMNLIT  536
            TLSG    W+  + +  L+ LEVLKL   AF G++W    D I F  L+YL +   +L  
Sbjct  828  TLSGLGLPWEYNSTIAKLKNLEVLKLQRYAFQGRVWKRGDDRISFPKLRYLLIEDTDLEE  887

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAR-EICVK  713
            W      + F  L  LI R+C  L+ IP     + +L++ EL + C   S  A  E   K
Sbjct  888  WYV---SRRFTWLRRLIFRHCYKLKGIPRQIVRIKHLEI-EL-DDCNNPSLLASIEHWQK  942

Query  714  RHGKTNVKINA  746
            R G  N+++ A
Sbjct  943  RDGIRNLRVCA  953



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score =   102 bits (255),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 119/224 (53%), Gaps = 15/224 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRG---TNICTLCTISPASCTSEIFNKTPKLQKL  185
            IW +  +RH+  N    LP+ PP  S R    +N+ T+  +SP SCT E+ +    ++KL
Sbjct  628  IWELTGIRHLKLNL-FYLPN-PPNVSERYLVFSNVQTISGLSPCSCTKEVISSIQNVKKL  685

Query  186  GVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN----SEKVE-LKVTVFDKFLRRL  350
            G+ G+  +    T QK    +NL  L  L+ LK        SE++    +     F   L
Sbjct  686  GIVGDGGDY--RTFQKSAFFDNLVHLHQLETLKFQFRYVWMSEQISPATIPSAKAFPATL  743

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            + L L GT  +W+D+ ++G L  LEVLKL  +A  G+ W    +  F  LK L +   N+
Sbjct  744  KNLKLVGTGLRWEDLNIIGELPNLEVLKLILDACCGQEWH-PIEGGFTRLKLLLIQMCNI  802

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              W A  +  SFPVLE L++ +C  L+ IP +FA++ +L+++EL
Sbjct  803  KCWNA--TCDSFPVLERLVIISCSDLEEIPFEFADIQSLQLIEL  844



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score =   102 bits (254),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 125/252 (50%), Gaps = 18/252 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTIS---PASCTSEIFNKTPKLQKL  185
            IW M  LRH+H +  ++   +   +SSR   +  L TIS   P+SC  +I  K P L  L
Sbjct  627  IWKMVNLRHLHISGELEFERAC-SSSSRPFMLDNLQTISHLCPSSCIKDILAKMPNLVNL  685

Query  186  GVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD----KFLRRLR  353
            G   NLS        K  L  +L +LK L+ LK    +    L+          F   L+
Sbjct  686  GC--NLS---FSNTAKDFLFPDLSILKLLETLKFDIQTWGT-LQFCYSSPQPTSFPPSLK  739

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
            KLTL G+L  W +M+ +G L  LEVLK+ +N F+G+ W+  SD  F  LK+L++   NL 
Sbjct  740  KLTLIGSL-DWKEMSTIGRLPNLEVLKVKNNFFNGQQWE-TSDEGFHHLKFLKLSHTNLQ  797

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVK  713
             W A  S  SFP L  L+L  C+ L+ IP    ++  L+++E+ +     +D   +I   
Sbjct  798  RWIA--SSSSFPCLGHLVLHRCLVLEEIPPSIGDIQTLQMIEVSHSSLAAADSVWQIQES  855

Query  714  RHGKTNVKINAF  749
            +    N ++  F
Sbjct  856  QKSMGNFELKVF  867



>gb|EYU17740.1| hypothetical protein MIMGU_mgv1a018663mg [Erythranthe guttata]
Length=854

 Score =   102 bits (254),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 131/253 (52%), Gaps = 18/253 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M++L H+    +  LP+   +  S   N+ TL  +SP SCT  +F + P L+KLG+R
Sbjct  611  IWDMKQLEHLEIMGN-DLPNPNCEEESLLPNLLTLLDVSPKSCTKSVFKRLPNLKKLGIR  669

Query  195  ----GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
                 N  EL L     +  +N L+ LKC     +  +   V  ++ +F  F + L+KL 
Sbjct  670  IESESNADEL-LSCFDYISHLNGLETLKCTIENPVFTSGVVVGARLPIF--FPKCLKKLC  726

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
            LSG  + W++MT +GSL  L VLKL  NAF G  W+      F  L+YL +   +L  WT
Sbjct  727  LSGLGYPWEEMTKIGSLPNLRVLKLHCNAFRGPKWETRGGE-FPSLEYLLIEDSDLAVWT  785

Query  543  AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREIC-----  707
                D SF +L  L +R+C  L+ I  ++ N   ++ +E+ +     + +AR+I      
Sbjct  786  I--GDNSFNLLGHLNIRHCYKLKEIQGNYLNC--IRKIEVVDCNPLAAYYARQILFVGID  841

Query  708  VKRHGKTNVKINA  746
            V+   + + KINA
Sbjct  842  VRSSWEEDDKINA  854



>gb|ABJ99601.1| NBS-LRR type resistance protein [Beta vulgaris]
Length=899

 Score =   102 bits (254),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 105/193 (54%), Gaps = 8/193 (4%)
 Frame = +3

Query  141  CTSEIFNKTPKLQKLGVRGNLSELFLETKQK-VCLINNLQMLKCLKNLKLHGN-SEKVEL  314
            CTS+   + P + KLG+RG L EL +  +   V     L  +K L+ LK +G+ S     
Sbjct  685  CTSKFLARIPTVTKLGIRGKLEELIMPPQGGGVSTFEALANMKYLETLKFYGDVSSNARS  744

Query  315  KVTVF---DKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDV  485
            K++ F   +KF   LR LT++ T+  W+   +LG L  L +LKL +NAF G+ W    D 
Sbjct  745  KISHFPGHNKFPPNLRNLTITDTMLSWEHTDILGMLPNLVMLKLKENAFMGEYWKPKDDG  804

Query  486  IFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
             F+ L+   +G+ NL  W A  S+  FP L+ LIL+ C  L+ +    A++  L++++++
Sbjct  805  -FRTLEVFYLGRTNLQKWEA--SNYHFPSLKKLILKFCDRLEGLSSSLADISTLQLIDIH  861

Query  666  NVCERVSDFAREI  704
                 V+  AR+I
Sbjct  862  MANPVVAACARQI  874



>emb|CDP00690.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 122/235 (52%), Gaps = 10/235 (4%)
 Frame = +3

Query  18   WNMEKLRHVHTNTSMQL--PSSPPKNSSR---GTNICTLCTISPASCTSEIFNKTPKLQK  182
            W+M  LRHVH   +  L  P +   N  R     ++ TL TI  + CT E F+  P L+K
Sbjct  304  WSMPSLRHVHITAACHLKNPFTVQDNLPRPFASEHLQTLYTIQFSCCTKEFFSVMPHLKK  363

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV-FDKFLRRLRKL  359
            LG+     +   ++  +V  +NNL  L+ L+ L+   +++  E++  +        L+ L
Sbjct  364  LGICETKEDYSTDSLSQV--LNNLVCLQELETLECSFHTQNREVRKNLGLAALPVTLKHL  421

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            +LS +   W+DMT +  L  LEVLKL + AF G  W+   +  F  LK+L +   +LI W
Sbjct  422  SLSWSYLPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPTEEG-FHSLKHLLIENTDLIHW  480

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             A+   + FP L+ L+L++C  L+ IP     +  L+ +E +   E + + A+EI
Sbjct  481  EAIIV-RHFPCLQHLVLKSCKLLEEIPFGVEELGTLQRLEAHYCSEPIENSAKEI  534



>gb|AAT39951.2| Disease resistance protein, putative [Solanum demissum]
Length=2544

 Score =   102 bits (255),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 128/258 (50%), Gaps = 17/258 (7%)
 Frame = +3

Query  12    GIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTIS-PASCTSE----IFNKTPKL  176
              + NM KLRH+H N          + S   + +  L T S P     E    I  K P L
Sbjct  2289  SLLNMTKLRHIHVNDRASFNLDNMRESLANSQLANLQTFSTPYVSYGEDAEIILIKMPNL  2348

Query  177   QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
              KL      S    + + +  LI  L  L  L++L L  N+  VE  +  F+ F   LR+
Sbjct  2349  TKLKCIVGCSR---KWRGECVLIPRLDFLSRLESLNLFSNNCPVEC-LRGFN-FPSELRE  2403

Query  357   LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
             LTLS     W +++++G+L  LEVLKL + AF G  W++N D  F  L+YL++  +N   
Sbjct  2404  LTLSNFCLPWSEISIVGTLCNLEVLKLLNKAFEGIQWNVN-DTEFPELRYLKLDSLNFAQ  2462

Query  537   WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI-CVK  713
             W+   S+ SFP LE L+L NC  L+ IP  F +V +LK +E+      V++ A EI   +
Sbjct  2463  WSI--SEDSFPSLERLVLTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANSAGEIQTTQ  2520

Query  714   RHGKTNVKINAFNVFITP  767
             R    N   +AF V I P
Sbjct  2521  REDMAN---DAFTVTIQP  2535



>gb|EYU22216.1| hypothetical protein MIMGU_mgv1a019937mg [Erythranthe guttata]
Length=868

 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 118/252 (47%), Gaps = 13/252 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKN--SSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW + KL+H+       LP   P N  S     + TL  +   SCT  +  + P L KLG
Sbjct  611  IWKLHKLKHLEC-MGFDLPDPSPANDDSLILEKLLTLSGVGAHSCTERVLIRIPNLIKLG  669

Query  189  VR--GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
            +R   +L E F    +     +     KC+        S  V   V     F   +RK++
Sbjct  670  IRIDSSLDEKFNFLGEFASCYDEFDSFKCIVVDDPGIRSRFVSSPVL---NFPANIRKIS  726

Query  363  LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDL--NSDVIFKGLKYLRMGKMNLIT  536
            LSG  FQW  M V+G L  LEVLKL   AFSG  W++      +F  LK+L M  +++  
Sbjct  727  LSGCGFQWRSMGVIGELPNLEVLKLRWCAFSGAEWEIAGGEGELFPRLKFLLMEDLDVEV  786

Query  537  WTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKR  716
            W   +S   F  L  L++R+C  L+ IP   A+   L+V+E+ +    +++ AR I + +
Sbjct  787  WET-NSGGGFRRLSRLVIRHCYKLKEIPRGIADSAALEVIEVDDCSSSLANSARGIYMAK  845

Query  717  HGKTN--VKINA  746
            H   N  VKI  
Sbjct  846  HDWVNDHVKIRV  857



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 101/184 (55%), Gaps = 10/184 (5%)
 Frame = +3

Query  222  TKQKVCLINNLQMLKCLKNLKLHGNSEKVE-----LKVTVFDKFLRRLRKLTLSGTLFQW  386
            TKQ+     +L  L  L+ L++H +    E     L   + D F   L+ LTL GT   W
Sbjct  8    TKQRSQSRESLIRLVDLEKLRIHLDISPYENFSLRLPTLLLDVFPTFLKSLTLVGTRLLW  67

Query  387  DDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVDSDKSF  566
            +DMT LG L  LEVL+L   AF G+ W+LN    FK LK L++ + NL+ W A  S +S 
Sbjct  68   EDMTTLGQLPNLEVLRLKCFAFQGRNWNLNEGG-FKKLKLLQINRKNLVLWEA--SSESL  124

Query  567  PVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRH--GKTNVKI  740
            P LE LIL+ C  L++IP +  ++  +K++EL+N  +  +  A E+  ++   G   + +
Sbjct  125  PRLEFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLGNEVLVV  184

Query  741  NAFN  752
             A+N
Sbjct  185  RAYN  188



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score =   102 bits (253),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/216 (34%), Positives = 107/216 (50%), Gaps = 4/216 (2%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M KLRH+      QLP      +    N+ TL +++   C   I    P L+KLG+ 
Sbjct  670  IWRMPKLRHIFCFYIGQLPDPEGSATCGLENLQTLSSLTNFVCVERIIKMIPNLKKLGLA  729

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLSGT  374
               S+   E  +  CL  NL  L  L+ LK    S+        F  F  +LRKLTLSG 
Sbjct  730  FCTSDKPYEDIEHYCL-ENLVYLHQLEKLKFVVESDFPSPVKLHFPVFPMKLRKLTLSGW  788

Query  375  LFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVDS  554
               W DMT++GSL  L+VLKL ++A  G  W+   +  F  L +L + + +L  W    S
Sbjct  789  RLPWKDMTIVGSLPNLQVLKLRESACVGDTWE-TIEGEFLELNFLMIEESDLRNWITESS  847

Query  555  DKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
               FP L+ L++R C  L+ IP+    +  L+++E+
Sbjct  848  --HFPNLKWLVIRRCRYLREIPDGIGEIATLELIEV  881



>emb|CDP10323.1| unnamed protein product [Coffea canephora]
Length=686

 Score =   101 bits (252),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 111/235 (47%), Gaps = 11/235 (5%)
 Frame = +3

Query  18   WNMEKLRHVHTNTSMQLP--SSPPKNSSRGT----NICTLCTISPASCTSEIFNKTPKLQ  179
            W+M  LRH+HT     L   +    N  R       + TL T+    C  + F   P L 
Sbjct  444  WSMPNLRHLHTTMVAFLSYITDAASNIYRKPLPLGYLKTLSTVQFLCCRRDAFANMPYLA  503

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKL  359
            +LG+     E +   +   CL  +L  L  L+ L      E  E +   +D F   LRKL
Sbjct  504  ELGL-CETKEDYYRDRSCECL-KDLAYLHKLEALNCSFYREIREARTISWDAFPSNLRKL  561

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            TLS +   W+DMT +  L  LEVLKL + AF G  W L +D +F+ LK L + K +++ W
Sbjct  562  TLSASNLPWEDMTNVAKLPNLEVLKLKNYAFRGSTWKL-TDEVFRCLKQLLIEKTDIVQW  620

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             A   D  FP L+ LILR+C  L  +P     +  L+ +EL+   E     A+E 
Sbjct  621  EA--EDDHFPCLQFLILRSCEFLAELPYVLGEIPTLERIELHYCNESAELSAQEF  673



>ref|XP_011076796.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Sesamum indicum]
Length=880

 Score =   101 bits (252),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 132/263 (50%), Gaps = 16/263 (6%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IW M +LRH  TN S  LP     + + G  + TL  ISP +CT E+  +   L++
Sbjct  623  IKADIWQMIQLRHFKTNASATLPEIGQGSKASG-QLQTLSRISPQNCTKEVLERAQNLKE  681

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD------KFLR  344
            LG+RG L+ L L+   +  L +NL  L+ L  LKL  +       +          KF  
Sbjct  682  LGIRGELA-LLLDDDYR--LFDNLVKLEELVKLKLQNDVFPSPPSIHQLQSLPPSFKFPP  738

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             L+ LTLS T   W  +++LG L+ L+VLKL + AF G  W++     F  L++L +G+ 
Sbjct  739  NLKSLTLSHTFLDWKHISILGLLKNLKVLKLKEKAFVGDCWEVTGGG-FHHLEFLHIGRT  797

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            NL+TW A+     FP L+ L L NC  L+ IP   A+V     ++L    +  +  A++I
Sbjct  798  NLVTWVALGY--QFPKLKCLELHNCEQLRQIPVGLADVPYFHALDLCR-SKYATASAKKI  854

Query  705  --CVKRHGKTNVKINAFNVFITP  767
                +R     V++  F + I P
Sbjct  855  REAKERQADQAVEVEGFKLSIFP  877



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score =   101 bits (252),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 125/242 (52%), Gaps = 11/242 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M+ LRH+    S  LP+ P    +   N+ TL  +S  SCT ++  + P L+KLG+R
Sbjct  656  IWTMQGLRHLQVMGS-DLPN-PSSKDALLPNLLTLLDVSGRSCTRKVIKRIPNLKKLGIR  713

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLK---LHGNSEKVELKVTVFDKFLRRLRKLTL  365
                E   +  + +   +NL   + L++LK   ++   ++V   ++    F   L+KLTL
Sbjct  714  ---IETGPDDVEPLYCFDNLDFFRELQSLKCSVMNPIFQRVVPAISYNSIFPTSLKKLTL  770

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            SG  F W  M+ +  L  LEVLKL   AF G+ W+      F+ LK+L +   +L  W  
Sbjct  771  SGLRFPWGHMSDIAELRNLEVLKLRCYAFQGRAWETYEGEFFR-LKFLLIEDTDLEYWY-  828

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRHGK  725
            VD + SFP LE LIL++C  L+ +P +   + NL+ MEL +    +   A+ I  ++   
Sbjct  829  VDYE-SFPSLERLILQHCYKLKEMPSEIGELPNLEKMELVDCHPSLVASAKRIAEEQQSA  887

Query  726  TN  731
             N
Sbjct  888  GN  889



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score =   101 bits (252),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 119/237 (50%), Gaps = 13/237 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLP---SSPPKNSSRGT--NICTLCTIS-PASCTSEIFNKTPKL  176
            IW M +LRH+        P   S   K  S+    N+ T+ T++ P SC+ E+F   P L
Sbjct  628  IWMMPQLRHIRLKRGCYFPLPYSRGIKEKSQFVLQNLQTISTLTGPFSCSKEVFACLPAL  687

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
            +KL +    S    + +Q     +NL  L  L+ LK        + ++   D F   L+K
Sbjct  688  KKLEIFATESNS--KAEQTSEYFSNLASLNLLETLKCSFLYRPRKHRLPSGDHFPANLKK  745

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLIT  536
            LTLSG+   W+DM  L  L +LEVLKL   AF G++W       F+ LK L +   + ++
Sbjct  746  LTLSGSFLPWEDMAKLAVLPKLEVLKLRSFAFEGQIWGAVEGGFFQ-LKLLLVENSDPMS  804

Query  537  WTAVDSDKS-FPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            W   D+D S FP L+ L+LR C  L  IP+   ++  L+++E+ +    +   AR+I
Sbjct  805  W---DADASHFPSLQQLVLRECHRLTEIPQGIGDITTLQMIEVQDCSFYIVRSARKI  858



>ref|XP_009601897.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=636

 Score =   101 bits (251),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 125/250 (50%), Gaps = 29/250 (12%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSS--------RGTNICTLCTISPASCTSEIF  158
            + G IW M  LRH+H + +  LPS  P+  S           N+  L  +   SCT+E F
Sbjct  374  LPGKIWMMNNLRHIHLSRACYLPS--PRRESILNKYLVIGMPNLEELSNLCFTSCTNENF  431

Query  159  NKTPKLQKLGV-------RGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELK  317
            +  P L++L V       R N +   ++       +  L+ LKC+ N      S  ++  
Sbjct  432  SIIPNLKRLIVHHIGSSRRKNRANHLIDMSS----LTKLKALKCVSNASWSWRSTSIKRF  487

Query  318  VTVFDKFLRRLRKLTLSGTL-FQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFK  494
            V     F   L++LTL+G   F W+D++ L  L  LE LKL  NA S  +W L+ +  F+
Sbjct  488  V-----FPTSLKRLTLAGGFCFSWEDISTLVMLPNLEELKLKRNAVSDPIWRLSDEDKFE  542

Query  495  GLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVC  674
             LK L + ++    W A  S +SFP L+ L++RNCI+L+ IP DF  +  L+ +EL+N  
Sbjct  543  SLKLLLLSELEFGHWEA--SSESFPSLKRLVMRNCINLKEIPTDFGEICTLESIELHNCS  600

Query  675  ERVSDFAREI  704
              V   AR I
Sbjct  601  TVVEGCARNI  610



>gb|EYU23555.1| hypothetical protein MIMGU_mgv1a020380mg [Erythranthe guttata]
Length=884

 Score =   101 bits (252),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 111/205 (54%), Gaps = 11/205 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IWNMEKL+H+   T   LP   P   S   N+ TL  +S  SCT ++ ++ P L KLG+R
Sbjct  631  IWNMEKLKHLKV-TGCDLPY--PCEGSFLPNLLTLLDVSAQSCTRDVLSRIPNLLKLGIR  687

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKV--ELKVTVFDKFLRRLRKLTLS  368
                EL L+  + +C+ +++  L+ L  LK    + ++  E  +     F   L KLTLS
Sbjct  688  ---IELALDNVEPLCIFDHISNLRNLSGLKCVVVNPRIMSEFVIAPLSIFSSSLEKLTLS  744

Query  369  GTLFQWDDMT-VLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            G  +QW++M+ +  SL  L +LKL   AF G  W+++ +  F  L+YL +   +L+ WT 
Sbjct  745  GLGYQWEEMSKIASSLPNLVMLKLRCYAFRGPKWEVHENE-FSCLEYLLIEDTDLVQWT-  802

Query  546  VDSDKSFPVLESLILRNCISLQNIP  620
            V +   F  L+ L +R+C  L  IP
Sbjct  803  VGNRGFFQRLKKLSIRHCYRLVEIP  827



>ref|XP_011071973.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score =   101 bits (252),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 118/231 (51%), Gaps = 8/231 (3%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IWNM++LRH+       LP   P  +S    + +L  +S  SC+ ++F  TP L KLG+R
Sbjct  622  IWNMKQLRHIQFMGG-DLPD--PCGASL-PYLLSLSNVSGHSCSKQVFKATPNLMKLGIR  677

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSE-KVELKVTVFDKFLRRLRKLTLSG  371
              L+E        +  +  L  L+  K + ++   E +V  +      F   L+K+TLSG
Sbjct  678  IELAEDTATPLCLLDHLTLLSQLESFKCVIVNPTREFQVVARPDSVSIFPSTLKKITLSG  737

Query  372  TLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAVD  551
              F W+DM +L  L  LE LKL   AF G  W+L+ +  F  LK+L +  M++  W A  
Sbjct  738  CGFPWEDMKILAQLPNLEALKLGCYAFQGPEWELDEED-FIRLKFLLLEDMDIANWRA--  794

Query  552  SDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            + +    LE L++R+C +LQ IP     +  L+++E+ +    V D A  I
Sbjct  795  NGQILHRLERLVVRHCYNLQEIPYGIDYITTLQLVEVVDCSPSVVDSAMRI  845



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 112/218 (51%), Gaps = 11/218 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M +LRH+  + S   P  P   +    N+ TL  +    CT EI    P L+KLG+ 
Sbjct  634  IWRMAQLRHLVLSMSDPFPK-PSAGTFVLKNLQTLAIVRNFKCTKEIVQMIPNLKKLGIL  692

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK--FLRRLRKLTLS  368
              +  +    K +   ++NL  L  L+NLK+       E    +++K  F   L+KLTLS
Sbjct  693  YGVYGI----KWREYHLHNLVDLHQLENLKVWVEDISRE-PFPLWEKLAFPVMLKKLTLS  747

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
            G LF W+DMT +GSL+ LEV+KL   +F G  W+   +  F  LK+L++   NL  W  V
Sbjct  748  GCLFCWEDMTTVGSLQNLEVMKLTRCSFEGCKWE-TIEGEFPRLKFLKIRWTNLQHW--V  804

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
                 FP LE L L +C  L  IP+    +  LK++E+
Sbjct  805  TDSSHFPSLEHLQLFSCQRLGEIPDVLGEIPTLKIIEV  842



>gb|EYU17690.1| hypothetical protein MIMGU_mgv1a023002mg [Erythranthe guttata]
Length=908

 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 113/220 (51%), Gaps = 15/220 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M++L+H+    S    + P    +   N+ TL  ISP  C  EI  + P+L+KLG+R
Sbjct  647  IWDMQELKHLQITGS----NLPDPCGAILQNLSTLLDISPHCCRKEILERIPRLEKLGIR  702

Query  195  GNLSELFLETKQKV-----CLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKL  359
             +L+    +   K       + N+ + +KC+    +  +   V     +F     RL KL
Sbjct  703  FDLAH---DHDAKSLNWFDAVSNHTRTVKCVVVNPIPKSEVVVGPPAPLFTNIYSRLAKL  759

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            +LSG  + W+D++ + SL  L VLKL   AF G  W+   D  F+ L+ L +   +L+ W
Sbjct  760  SLSGFGYPWEDISKIASLPCLHVLKLRRYAFRGAKWE-TQDKSFRSLEVLLIEDSDLVEW  818

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVME  659
            TA    K+F  LE L L+NC  L+ IP D     N+++++
Sbjct  819  TA--GFKTFRCLEHLTLKNCHKLEQIPRDLYIRLNIELVD  856



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 130/271 (48%), Gaps = 32/271 (12%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSP------PKNSSRGTNICTLCTISPASC--TSEIFNKTP  170
            +W M  LRH+H    + L  SP       +N     N+ TLCTI+ ++   +  +    P
Sbjct  628  LWKMPILRHIHVKGDVLLFGSPIDDHHSKRNFRVLENLQTLCTITISTINFSHRLIATLP  687

Query  171  KLQKLG----VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELK-------  317
             L+ L       GN    +L +    CL NNL  +  L+ LKL  N   + +K       
Sbjct  688  NLKTLASNLVTGGNHDVDWLGS----CL-NNLHQMYSLETLKLLFN---LPMKNPLPRNS  739

Query  318  VTVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKG  497
            +  ++ F   L+ LTLS +L  W D  VLG+L  LEVLKL   +F G  W+ + +  F  
Sbjct  740  IQRWNAFPPNLKNLTLSCSLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEG-FHR  798

Query  498  LKYLRMGKMNLITWTAVDSDK-SFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVC  674
            LKYL +   +L+ W    +D   FP L+ L+ R C  L+ IP +  ++ +L+V+ELY+  
Sbjct  799  LKYLLVESRDLVVWKQASTDSYPFPALQHLVFRFCNKLKEIPYEIGDIPSLQVIELYSCS  858

Query  675  ERVSDFAREICVKRHGKTNVKINAFNVFITP  767
               +  AR I   +  + +   +   VFI P
Sbjct  859  PYATRLARMI---QQDQIDSGNSCLEVFIHP  886



>gb|EYU19283.1| hypothetical protein MIMGU_mgv1a026559mg [Erythranthe guttata]
Length=640

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 108/222 (49%), Gaps = 33/222 (15%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW+M KL+ ++      +P  PP + S   N  TL  +S  SCT E+ ++ P LQ++GVR
Sbjct  394  IWHMHKLKQLYC-MGFDVPPPPPPDDSHLENFLTLSAVSAHSCTMEVLSRIPNLQRIGVR  452

Query  195  --------------GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFD  332
                          G+ S ++ E +   C+I N        NL+           V  F 
Sbjct  453  IESAHDSMETFSFSGHFSSIYEELESVKCVIVN-------PNLRSQV--------VHCFP  497

Query  333  KFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLR  512
             F   ++K+ LSG  F W  M V+  L  L VLKL   AF G +W  N D  F GL Y+ 
Sbjct  498  LFPVYIKKICLSGCGFPWKKMEVIALLPTLRVLKLRWYAFCGSVWKTN-DPQFPGLDYVL  556

Query  513  MGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANV  638
            +  ++++ W +V   + FP L  +I+R+C  L+NIP+   +V
Sbjct  557  LEDLDIVHWESV--GEQFPCLSHVIIRHCYKLENIPDQLESV  596



>gb|EYU17782.1| hypothetical protein MIMGU_mgv1a0218242mg, partial [Erythranthe 
guttata]
Length=764

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 126/251 (50%), Gaps = 28/251 (11%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            +   IW +  LRH+ T  +++L  +       G N+ TL T+S  SCT  +   T K++K
Sbjct  485  MKANIWRLIHLRHLKTKAAIKL--NKDWGDVAGENLQTLGTLSHHSCTDNVSRNTCKIKK  542

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLR------  344
            LG+RGNL  LF      +  +++L+ LK + +  +  +S  ++      D          
Sbjct  543  LGIRGNLQTLF--RTDFLAKLDHLEKLKLVNDTYIGSSSNSIDDDDDDDDGDDDDKLSNN  600

Query  345  ------------RLRKLTLSGTLFQWDDM-TVLGSLEELEVLKLDDNAFSGKLWDLNS-D  482
                        +++ L+L+ T   W D+ T+L  ++ LEVLKL +NA +GK W+  + +
Sbjct  601  IHLIPRSSCLPGKMKSLSLTKTFLSWSDVSTILSKIDTLEVLKLKENACAGKTWEATAGN  660

Query  483  VIFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              F  L +L +  + L+ WTA  S   FP L  L ++NC  L+ IP + A  + L+ +E+
Sbjct  661  KGFCSLHFLLIADVELVDWTA--SSDQFPSLTCLSIKNCKELRQIPLELA--EKLENLEI  716

Query  663  YNVCERVSDFA  695
             N+C   +D A
Sbjct  717  DNLCRSATDSA  727



>ref|XP_009620169.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Nicotiana 
tomentosiformis]
Length=838

 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 121/216 (56%), Gaps = 16/216 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWN+ +LRH  TN   +LP    +     +++ TL  ++P SC   +      L+K
Sbjct  627  IKANIWNLSQLRHFQTNKPAKLPLPSTQKGEGRSSLQTLSIVAPESCNKVVLRNARNLKK  686

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHG----NSEKVELKVTVFDKFLRRL  350
            L +RG + + FL+T +     +  +   CL+NLKL       S+ ++L   +F +FL +L
Sbjct  687  LSMRGRIED-FLQTNKDG--FSTFEGFNCLENLKLISVDPCTSDALQLPRALF-RFLLKL  742

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVI--FKGLKYLRMGKM  524
            +KLTLS T+F W+D T LG LE L+VLKL  +AF+G+LW+    VI  F+ L+ L +   
Sbjct  743  KKLTLSNTMFDWNDATKLGQLECLKVLKLKKDAFTGRLWN---PVIGDFRELQVLWIQND  799

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFA  632
            +L  W A  +   FP +  L+L+ C +L++ P + +
Sbjct  800  DLQRWEA--TRVHFPKVRKLVLK-CPNLESEPAELS  832



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 130/271 (48%), Gaps = 32/271 (12%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSP------PKNSSRGTNICTLCTISPASC--TSEIFNKTP  170
            +W M  LRH+H    + L  SP       +N     N+ TLCTI+ ++   +  +    P
Sbjct  626  LWKMPILRHIHVKGDVLLFGSPIDDHHSKRNFRVLENLQTLCTITISTINFSHRLIATLP  685

Query  171  KLQKLG----VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELK-------  317
             L+ L       GN    +L +    CL NNL  +  L+ LKL  N   + +K       
Sbjct  686  NLKTLASNLVTGGNHDVDWLGS----CL-NNLHQMYSLETLKLLFN---LPMKNPLPHNS  737

Query  318  VTVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKG  497
            +  ++ F   L+ LTLS +L  W D  VLG+L  LEVLKL   +F G  W+ + +  F  
Sbjct  738  IQRWNAFPPNLKNLTLSCSLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEG-FHR  796

Query  498  LKYLRMGKMNLITWTAVDSDK-SFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVC  674
            LKYL +   +L+ W    +D   FP L+ L+ R C  L+ IP +  ++ +L+V+ELY+  
Sbjct  797  LKYLLVESRDLVIWKQASTDSYPFPALQHLVFRFCNKLKEIPFEIGDIPSLQVIELYSCS  856

Query  675  ERVSDFAREICVKRHGKTNVKINAFNVFITP  767
               +  AR I   +  + +   +   VFI P
Sbjct  857  PYATRLARMI---QQDQIDSGNSCLEVFIHP  884



>ref|XP_009620170.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
isoform X2 [Nicotiana tomentosiformis]
Length=693

 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 121/216 (56%), Gaps = 16/216 (7%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQK  182
            I   IWN+ +LRH  TN   +LP    +     +++ TL  ++P SC   +      L+K
Sbjct  482  IKANIWNLSQLRHFQTNKPAKLPLPSTQKGEGRSSLQTLSIVAPESCNKVVLRNARNLKK  541

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHG----NSEKVELKVTVFDKFLRRL  350
            L +RG + + FL+T +     +  +   CL+NLKL       S+ ++L   +F +FL +L
Sbjct  542  LSMRGRIED-FLQTNKDG--FSTFEGFNCLENLKLISVDPCTSDALQLPRALF-RFLLKL  597

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVI--FKGLKYLRMGKM  524
            +KLTLS T+F W+D T LG LE L+VLKL  +AF+G+LW+    VI  F+ L+ L +   
Sbjct  598  KKLTLSNTMFDWNDATKLGQLECLKVLKLKKDAFTGRLWN---PVIGDFRELQVLWIQND  654

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFA  632
            +L  W A  +   FP +  L+L+ C +L++ P + +
Sbjct  655  DLQRWEA--TRVHFPKVRKLVLK-CPNLESEPAELS  687



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 116/228 (51%), Gaps = 26/228 (11%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--------NICTLCTISPASCTSEIFNKTP  170
            IW M ++RH+    S+ +P+     S            N+ TL   S      EI  +TP
Sbjct  594  IWTMSEIRHLDIRWSIHMPNPLAAESHNSIEEQPLFLNNLQTLVLCSSPYLV-EILRRTP  652

Query  171  KLQKLGVRGNLSELFLETKQKVC--LINNLQMLKCLKNLKLHGN--SEKVELKVTVFDKF  338
             L KL V         E++   C  +++ L +L+ L+ L +  +  S+ + L   +F   
Sbjct  653  YLNKLTVLD-------ESRHSDCPAILDPLSLLQELETLTIEADLGSDPMILSRDIFPP-  704

Query  339  LRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG  518
               L++L LS T  QW+DM VL +L  LEVLK   +AF G  W LN DV+F+ LKYLR+ 
Sbjct  705  --NLKQLKLSYTTLQWEDMVVLANLPNLEVLK-AYSAFEGTYWRLNEDVVFQKLKYLRLQ  761

Query  519  KMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              +L  W A  ++ +FP+LE L+L     L+ IP+    +  LK++++
Sbjct  762  YGSLERWEA--TNDNFPMLEQLLLYGFRKLEEIPQSIGEIMILKLIQI  807



>emb|CDP15268.1| unnamed protein product [Coffea canephora]
Length=1484

 Score =   100 bits (248),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 112/220 (51%), Gaps = 13/220 (6%)
 Frame = +3

Query  15    IWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCT--ISPASCTSEIFNKTPKLQK  182
             +W+MEKLRHVH N   ++ L  S   +SS+  N+ +L    +     T +I  K  KLQK
Sbjct  1238  LWSMEKLRHVHVNNYAAIALQDSESTSSSQALNLVSLSCPYLLCGKGTEDIMRKLLKLQK  1297

Query  183   LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
             L      S +F E +      N+  +L  L  L+         + +    +F   L+KLT
Sbjct  1298  L------SCVFSELRDDSGKCNHFPVLNFLTELESLNVLYSGRIALPCKFEFPLNLKKLT  1351

Query  363   LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
             LS     WD ++ +G L  LEVLKL   AF GK+W++      K LK+L++  +N+  W 
Sbjct  1352  LSKFRLPWDSISEIGRLPNLEVLKLLSRAFEGKVWEMKGGEFLK-LKFLKLDSLNVAQWN  1410

Query  543   AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
             A  S    P L+ LILR+C  L+ +P  FA    L+++E+
Sbjct  1411  A--SSDHLPQLQHLILRSCRQLKEVPSGFAESCTLEMIEV  1448



>ref|XP_009761713.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
[Nicotiana sylvestris]
Length=320

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 120/237 (51%), Gaps = 26/237 (11%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--------NICTLCTISPASCTSEIFNKTP  170
            IW M ++RH+    S+ +P+S    S            N+ TL   S +   +EI  +TP
Sbjct  76   IWTMSEIRHLDIRWSIHMPNSLATESYNSIEEQPLFLNNLQTLVLCS-SPYLAEILRRTP  134

Query  171  KLQKLGVRGNLSELFLETKQKVC--LINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLR  344
             L KL +         E++   C  +++ L +L+ L+ L +  +    +L +   D F  
Sbjct  135  YLNKLTILD-------ESRHPDCPAILDPLSLLQELETLTIEADLGS-DLMILSRDIFPP  186

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             L++L LS    QW+DM VL +L  LEVLK   +AF G  W LN DV+F+ LKYLR+   
Sbjct  187  NLKQLKLSYATLQWEDMVVLANLPNLEVLK-AYSAFEGTNWKLNEDVVFQKLKYLRLQYG  245

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFA  695
             L  W A  ++ +F +LE L+L     L+ IP+   ++  LK++++    ER S  A
Sbjct  246  GLERWEA--TNDNFSMLEQLLLYGFRKLEEIPQSIGDIMILKLIQI----ERCSAAA  296



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 117/220 (53%), Gaps = 9/220 (4%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--NICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M KLRH+   T  +LP   P+N       N+ TL  +    C+ +IF + P L++LG
Sbjct  482  IWMMPKLRHLCI-TPCRLPV--PQNVRMLVLGNLQTLSEVRNLRCSVDIFKRIPNLKELG  538

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLS  368
            +   +S     +K ++  + NL  L+ LK L    +S   E+       F  +L++L L+
Sbjct  539  ISYEVSPSENWSKYQLEALVNLHQLETLK-LLFKYSSHASEIVNPPKLAFPEKLKRLILA  597

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
            G    W  MT++G+L  LEVLKL  NA  G  W+   +  F  LK+L + +++L+ W A 
Sbjct  598  GCGIPWSSMTIVGALPNLEVLKLRKNACQGVEWEPVEEQ-FCQLKHLLLEEVDLVQWVA-  655

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
             ++  FP L+ L++R+C  L+ IP     +  L+++EL +
Sbjct  656  -NETHFPCLQRLVIRSCYKLKEIPSGIGEIPTLELIELVD  694



>ref|XP_009777083.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=868

 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 119/227 (52%), Gaps = 24/227 (11%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--------NICTLCTISPAS-CTSEIFNKT  167
            IW M ++RH+    S+ +P+     S            N+ TL  + P+S   +EI  +T
Sbjct  624  IWTMSEIRHLDIRWSIHMPNPLAAESHNSIEEQPLFLNNLQTL--VLPSSPYLAEILRRT  681

Query  168  PKLQKLGVRGNLSELFLETK--QKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL  341
            P L KL +         E++  +   +++ + +L+ L+ L +  +    +L +   D F 
Sbjct  682  PYLNKLTILD-------ESRHPEYPAILDPISLLQELETLTIEADLGS-DLMILSRDIFP  733

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              L++L LS T  QW+DM VL +L  LEVLK   +AF G  W LN DV+F+ LKYLR+  
Sbjct  734  PNLKQLKLSYTTLQWEDMVVLANLPNLEVLK-AYSAFEGTNWKLNEDVVFQKLKYLRLQY  792

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              L  W A  ++ SFP+LE L+L     L+ IP+   ++  LK++++
Sbjct  793  GGLERWEA--TNDSFPMLEQLLLYGFRKLEEIPQSIGDIMILKLIQI  837



>ref|XP_009777084.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=838

 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 119/227 (52%), Gaps = 24/227 (11%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--------NICTLCTISPAS-CTSEIFNKT  167
            IW M ++RH+    S+ +P+     S            N+ TL  + P+S   +EI  +T
Sbjct  594  IWTMSEIRHLDIRWSIHMPNPLAAESHNSIEEQPLFLNNLQTL--VLPSSPYLAEILRRT  651

Query  168  PKLQKLGVRGNLSELFLETK--QKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL  341
            P L KL +         E++  +   +++ + +L+ L+ L +  +    +L +   D F 
Sbjct  652  PYLNKLTILD-------ESRHPEYPAILDPISLLQELETLTIEADLGS-DLMILSRDIFP  703

Query  342  RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              L++L LS T  QW+DM VL +L  LEVLK   +AF G  W LN DV+F+ LKYLR+  
Sbjct  704  PNLKQLKLSYTTLQWEDMVVLANLPNLEVLK-AYSAFEGTNWKLNEDVVFQKLKYLRLQY  762

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              L  W A  ++ SFP+LE L+L     L+ IP+   ++  LK++++
Sbjct  763  GGLERWEA--TNDSFPMLEQLLLYGFRKLEEIPQSIGDIMILKLIQI  807



>emb|CDP08019.1| unnamed protein product [Coffea canephora]
Length=1758

 Score = 99.8 bits (247),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 79/255 (31%), Positives = 123/255 (48%), Gaps = 31/255 (12%)
 Frame = +3

Query  15    IWNMEKLRHVHTNTSMQLPSSPPK--NSSRGTNICTL-C-TISPASCTSEIFNKTPKLQK  182
             IW +  LRH+H N  +   S   +  +S    N+ +  C ++S       I  + P L K
Sbjct  1074  IWRITSLRHLHVNLHVAFDSDAEELGDSFILENLVSFSCPSLSCGEDAERIIKRLPNLCK  1133

Query  183   LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRR-----  347
             L      S +F E+       N+   L CL +L+         LK+  +   L       
Sbjct  1134  L------SCIFYESPDSSMNCNHFPRLNCLTHLE--------SLKIFYYGSPLNNGEFSL  1179

Query  348   ---LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG  518
                L+KLTLS     W  ++ +G L  L+VLKL   AF GK+WD+  +  F+ LK+LR+ 
Sbjct  1180  PLNLKKLTLSNFRLPWSHISTIGRLPNLKVLKLLSGAFEGKIWDVEEE--FQNLKFLRLD  1237

Query  519   KMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAR  698
              +N+  W A   D  FP LE L+L+NC  L+ IPEDF N+  L ++E++  C R ++ + 
Sbjct  1238  NLNIAQWNASCDD--FPKLERLVLQNCKDLEEIPEDFGNIYTLGMIEVH-WCGRSAEESA  1294

Query  699   EICVKRHGKTNVKIN  743
             +   + +G   V I 
Sbjct  1295  KKIEEEYGDIEVLIR  1309


 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 79/136 (58%), Gaps = 4/136 (3%)
 Frame = +3

Query  348   LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
             L++LTLS     W  ++ + SL  LEVLKL   AF G+ WD+  D  F+ LK+L +  ++
Sbjct  1625  LKELTLSRFCLPWTHISAISSLPNLEVLKLLSGAFMGRTWDMMEDE-FQKLKFLSLETLD  1683

Query  528   LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREIC  707
             +  W A  S    P LE L+L++C  L+ IPED +++ +L+ +E++   + V + A EI 
Sbjct  1684  IAEWNA--SYDHLPRLERLVLQHCKDLEKIPEDLSDITSLETIEVHWCGQSVEESAIEIG  1741

Query  708   VKRHGKTNVKINAFNV  755
              K  G+  V I + N+
Sbjct  1742  -KATGEIKVLIRSSNL  1756



>ref|XP_006350238.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006350239.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
isoform X2 [Solanum tuberosum]
Length=908

 Score = 99.0 bits (245),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 142/260 (55%), Gaps = 11/260 (4%)
 Frame = +3

Query  3    IDGGIWNMEKLRHVHTNTSMQLPSSPPKNSS-RGTNICTLCTISPASCTSEIFNKTPKLQ  179
            I   IW + +LRH+H+N  ++LP  P   S  R + + TL  ++P SC   +  K   L+
Sbjct  649  IKEDIWKLLQLRHLHSNLPVKLPPPPTPTSKIRTSCLQTLSKVTPDSCKKTVLAKVIHLR  708

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKL--HGNSEKVELKVTVFDKFLRRLR  353
            KLG+ G L+ L  ++ ++    ++ Q L  ++NLKL  +G SE++ L    F   L  L 
Sbjct  709  KLGIEGQLAVLLGKSTKERGF-DSFQELTRIENLKLLNNGWSEELHLPPHFFS-ILETLN  766

Query  354  KLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG-KMNL  530
            KLTLS T F+W +  +LG L+ L+VLKL +NAF G  W+   +  F  L+ L +    N 
Sbjct  767  KLTLSNTGFEWSEADILGQLKCLKVLKLKENAFIGNKWE-PKEGSFSKLQVLWIDWAENW  825

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICV  710
             TW A  S+  F  L  L+L +C  L+ +P + A++  L+ M+L    + VS  A EI  
Sbjct  826  ETWDA--SNCRFQSLTHLVLISCYDLKAVPHELADLPYLQEMKLMRTFKAVSS-AIEIKS  882

Query  711  KRHGKTNVKINA-FNVFITP  767
            K+ GK N + +  FN+ I P
Sbjct  883  KKLGKQNPESSIKFNLIILP  902



>emb|CDP17920.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 99.4 bits (246),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 125/260 (48%), Gaps = 33/260 (13%)
 Frame = +3

Query  15    IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTIS--PASC---TSEIFNKTPKLQ  179
             IW++  LRH+H    +   S   K    G+ +  L + S    SC      I  + P L 
Sbjct  1248  IWSITSLRHLHVKVHVAFDSDD-KELGDGSMLENLVSFSCPSLSCGEDAERIIKRLPNLC  1306

Query  180   KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRR----  347
             KL      S +F E+       N    L CL +L+         LK+      L      
Sbjct  1307  KL------SCIFYESPDSSTNCNQFPRLNCLTHLE--------SLKIFYCGSPLNNGEFN  1352

Query  348   ----LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRM  515
                 L+KLTLS    QW  ++ +G L  LEVLKL   AF GK+W++  +  FK LK+L +
Sbjct  1353  LPLNLKKLTLSNFCLQWIRISTIGRLPNLEVLKLHSGAFEGKIWNVEEE--FKNLKFLSL  1410

Query  516   GKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFA  695
               +N+  W A  S  +FP LE L+L+NC  L+ IPEDF  + +L+++E++  C + ++ +
Sbjct  1411  DNLNIAQWNA--SCHNFPKLERLVLQNCKDLEEIPEDFGMIGSLRMIEVH-WCGKSAEES  1467

Query  696   REICVKRHGKTNVKINAFNV  755
              E   + +G   V I + N+
Sbjct  1468  AEQIKEDYGDIKVFIRSSNL  1487



>ref|XP_009602412.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602413.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602414.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=895

 Score = 98.6 bits (244),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 119/224 (53%), Gaps = 16/224 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSS------RGTNICTLCTISPASCTSEIFNKTPKL  176
            IW + +LR +  +      S+PP+ S         +NI T+  +SP+SCT E+ +    +
Sbjct  647  IWELMQLRQLRLHKFYL--SNPPRESDDEESYLAFSNIHTISGLSPSSCTKEVISGIRNV  704

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV--FDKFLRRL  350
            +KL + G  ++   E  Q+  L NNL  L  L+ L +     K +   T+     F   L
Sbjct  705  KKLVICGYANDY--EIFQRSGLFNNLAHLHQLETLSVEL-VRKWDSPATIPSIAAFPATL  761

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KL L  T   W+D+ ++G L  LEVLKL  NA  GK W    +  F  LK L +   +L
Sbjct  762  KKLKLVSTGVNWEDLNIVGELPNLEVLKLMRNACIGKEW-YPIEGGFTRLKLLLIVHCDL  820

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              W A  +D +FPVLE L++R+C  L+ IP +FA++ +L+++EL
Sbjct  821  KYWKA--TDDNFPVLERLLIRDCHRLEEIPIEFADIYSLQLIEL  862



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score = 99.0 bits (245),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/226 (36%), Positives = 118/226 (52%), Gaps = 14/226 (6%)
 Frame = +3

Query  15    IWNMEKLRHVHT--NTSMQLPSSPPKNSSRGTNICTLCT--ISPASCTSEIFNKTPKLQK  182
             IW+M KLRHVH   + +  L     K+SS+  N+ +  +  +S    T  I  + PKL+K
Sbjct  1172  IWSMAKLRHVHVINHAAFSLQDGIWKSSSQLHNLVSFSSPYLSCGERTENIMRRLPKLRK  1231

Query  183   LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLT  362
             L  R   SEL  +  +K      L  L  L +LKL   S ++ L    FD F   LRKLT
Sbjct  1232  L--RCTFSELS-DDNEKCNQFPKLNFLTELVSLKLL-YSGRIALPCK-FD-FPLNLRKLT  1285

Query  363   LSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWT  542
             LS     W  ++ +G L  LEVLKL   AF G++W++     F  LK+L++  +NL  W 
Sbjct  1286  LSKFHLPWSYISEIGKLPNLEVLKLLSKAFEGEVWEMKEGE-FLNLKFLKLDSLNLAEWN  1344

Query  543   AVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCER  680
             A  S    P L+ LILR+C  L+ +P  F  +  L+++E+  +C R
Sbjct  1345  A--SSDHLPQLQHLILRSCRQLKEVPSGFGEICTLEMIEV-QLCTR  1387



>ref|XP_009602410.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=938

 Score = 98.6 bits (244),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 119/224 (53%), Gaps = 16/224 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSS------RGTNICTLCTISPASCTSEIFNKTPKL  176
            IW + +LR +  +      S+PP+ S         +NI T+  +SP+SCT E+ +    +
Sbjct  690  IWELMQLRQLRLHKFYL--SNPPRESDDEESYLAFSNIHTISGLSPSSCTKEVISGIRNV  747

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTV--FDKFLRRL  350
            +KL + G  ++   E  Q+  L NNL  L  L+ L +     K +   T+     F   L
Sbjct  748  KKLVICGYANDY--EIFQRSGLFNNLAHLHQLETLSVEL-VRKWDSPATIPSIAAFPATL  804

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KL L  T   W+D+ ++G L  LEVLKL  NA  GK W    +  F  LK L +   +L
Sbjct  805  KKLKLVSTGVNWEDLNIVGELPNLEVLKLMRNACIGKEW-YPIEGGFTRLKLLLIVHCDL  863

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              W A  +D +FPVLE L++R+C  L+ IP +FA++ +L+++EL
Sbjct  864  KYWKA--TDDNFPVLERLLIRDCHRLEEIPIEFADIYSLQLIEL  905



>ref|XP_004246080.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=871

 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 123/237 (52%), Gaps = 12/237 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKN------SSRGTNICTLCTISPASCTSEIFNKTPKL  176
            IW M+KLR +H   +  LPS   K+      +    N+  L  +S  SCT+++F+  P +
Sbjct  622  IWMMKKLRCIHIREAFYLPSPGRKSILNKHLAIGMPNVEELYNLSITSCTNKVFSNIPNV  681

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
            ++L ++ N      +    +   ++L  L+ LK +K    S +  + +      L+RL  
Sbjct  682  KRLIIQNNALLRTGDRASSLVDTSSLTKLEALKFVKKLSWSARTLISIRSLPISLKRL--  739

Query  357  LTLSGT-LFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLI  533
             TL+G   F+W D++ L  L  LE LKL + A +G +W LN +  F+ L+ L    +N+ 
Sbjct  740  -TLAGWHSFRWTDISALVMLPNLEELKLKNYAANGYVWRLNDEDKFQSLELLLFCNINVE  798

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             W A  S  +FP L+ L+L+ C  L+ IP DF  + +L+ +EL+N      + AR+I
Sbjct  799  HWEA--SSDNFPNLKRLVLKECRKLKEIPIDFGEICSLESIELHNCSTLAEESARKI  853



>emb|CDP11163.1| unnamed protein product [Coffea canephora]
Length=2495

 Score = 99.0 bits (245),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 118/233 (51%), Gaps = 10/233 (4%)
 Frame = +3

Query  15    IWNMEKLRHVHTNT--SMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLG  188
             +W+M +LRH+H N   +  L         +  N+ +    S  SC  +   K   L+KL 
Sbjct  1149  VWHMTRLRHLHVNVHVAFDLDDEELGGCFQLENLISFSCPS-LSCGKDTAVKA--LKKLP  1205

Query  189   VRGNLSELFLETKQKVCLINNLQMLKCLKNLK-LHGNSEKVELKVTVFDKFLRRLRKLTL  365
                 L  +F E+++     +    L CL NL+ L  +     L  ++F   L  L++LTL
Sbjct  1206  NLRKLRCIFFESRESSKNCDQFPRLDCLTNLESLRVSYYGTPLTTSMFCLPLN-LKELTL  1264

Query  366   SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
             S     WD ++V+G L  LEVLKL   AF GK W++  +  F+ LK+L++  +N+  W A
Sbjct  1265  SYFRLPWDHISVIGRLPNLEVLKLLSGAFEGKRWEMREEE-FRELKFLKLDALNIAEWEA  1323

Query  546   VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
                    P LE L+L+NC  L  IP DF ++  L+V+E++   E   + A+EI
Sbjct  1324  CCD--HLPKLERLVLQNCKDLMQIPYDFESITTLEVIEVHWCGESAEESAKEI  1374


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 3/108 (3%)
 Frame = +3

Query  348   LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMN  527
             LRKLTLS     W+ ++ +G L +LEVLKL   AF G +WD+  D  F+ LK+L++  +N
Sbjct  2342  LRKLTLSNFHLPWNRISAIGKLPKLEVLKLLSGAFEGPIWDMG-DEEFQELKFLKLDSLN  2400

Query  528   LITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNV  671
             +  W A  S    P LE L+L+NC  L+ IP DFA +  L+++E+ N+
Sbjct  2401  VAQWNA--SCDHLPKLERLVLQNCKELEKIPHDFAEISMLEMIEIVNI  2446



>emb|CDP11161.1| unnamed protein product [Coffea canephora]
Length=871

 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 128/249 (51%), Gaps = 17/249 (7%)
 Frame = +3

Query  15   IWNMEKLRHVHTN--TSMQLPSSPPKNSSRGTNICTLCTISPASCTSE---IFNKTPKLQ  179
            IW+M +LRH+H N   + +L     ++ S+  N+ +   +S  SC  +   I  + P LQ
Sbjct  628  IWHMARLRHLHVNMHVAFKLDDEGLEDCSQLGNLVSFSRLS-ISCGEDVESIIKRLPNLQ  686

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKL  359
            KL       +   +   +   ++ L  L  L N+  +G++   E  +         LRKL
Sbjct  687  KLRCIFFHPQGSSKNSYQFPRLDFLTHLVSL-NVFYYGSAITREFILP------SNLRKL  739

Query  360  TLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITW  539
            TLS     W  ++ +G L  LEVLKL  +AF G +WD+  +  FK LK+L++  +N+  W
Sbjct  740  TLSNFRLPWSHISTIGRLPNLEVLKLLLDAFKGLIWDMEEEQ-FKELKFLKLDNLNVCQW  798

Query  540  TAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREICVKRH  719
             A  +    P LE L+L+NC  L+ IP DFA++  L+V+E++   + V + A+ I  +  
Sbjct  799  NA--TCDHLPKLERLVLQNCKGLEEIPYDFADIGTLEVIEVHWCRQSVEESAQRI-AEAT  855

Query  720  GKTNVKINA  746
            G T V I+ 
Sbjct  856  GDTKVLISG  864



>emb|CDP11825.1| unnamed protein product [Coffea canephora]
Length=1245

 Score = 98.6 bits (244),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 119/233 (51%), Gaps = 27/233 (12%)
 Frame = +3

Query  15    IWNMEKLRHV-----HTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTS-----EIFNK  164
             +WN++KLRH+     ++    +LP+   +N  +   +C L T+S     S     +IF K
Sbjct  992   LWNLKKLRHLVWIGQYSFGGFRLPT---ENLDKSPQLCNLDTLSRVRIFSWENRDKIFKK  1048

Query  165   TPKLQKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLH-----GNSEKVELKVTVF  329
              P ++K   +  L+      K++   I  L     L++L L      G    VE  +++ 
Sbjct  1049  FPNIRKF--KCELTAPHHPAKEQGDNILALDFSSRLESLSLRVPKGFGKPYPVEFHLSL-  1105

Query  330   DKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYL  509
                   +RKLTLSG    W  ++ + +L  LEVLKL + AF G+ WDL  +  F  L++L
Sbjct  1106  -----TVRKLTLSGFCLPWSKISAVANLPNLEVLKLLEEAFVGETWDLEGEE-FPELRFL  1159

Query  510   RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
             ++  ++++ WTA + + SFP L+ L+L  C +L+ IP    NV  L  +E+ +
Sbjct  1160  KLASLDIVKWTAFECENSFPRLQKLVLEKCHNLEEIPSSLGNVSTLDTIEVID  1212



>ref|XP_009779880.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=862

 Score = 98.2 bits (243),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 137/256 (54%), Gaps = 20/256 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPKL  176
            IW M +LRH+H+  S    SSPPK S+         N+ ++  +S + CT EIF    K+
Sbjct  591  IWEMSQLRHLHS--SKIYLSSPPKVSANEVKYRVLENLQSVYGLSSSCCTKEIFEGVKKV  648

Query  177  QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRK  356
            +KLG+     E   +++   CL +NL  L  L+ L +        +++   D F   L+K
Sbjct  649  KKLGIFDKNDEYDGKSR---CL-DNLIYLHELEELSIKSYMSSF-VRLPRLDSFPPNLKK  703

Query  357  LTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFS-GKLWDLNSDVIFKGLKYLRMGKMNLI  533
            LTL+GT   W DMT +  L +L VL+L + AF     W++ +++ F  LK+L + ++NL+
Sbjct  704  LTLNGTGLMWKDMTTISMLPKLNVLQLKNGAFRLTTAWEV-TEMGFPELKFLLLEELNLV  762

Query  534  TWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI---  704
             W A  ++  FP LE +I+RNC  L+ IP  F +   L+ +EL+     +  FA +I   
Sbjct  763  YWIA--AEDYFPCLERVIIRNCRYLREIPRGFTDSVTLQQIELHGCIPSLVTFAEQIQKE  820

Query  705  CVKRHGKTNVKINAFN  752
             ++  G   +K+ AF+
Sbjct  821  QLESSGSDMLKVYAFD  836



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 98.2 bits (243),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 117/220 (53%), Gaps = 9/220 (4%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT--NICTLCTISPASCTSEIFNKTPKLQKLG  188
            IW M KLRH+   T  +LP   P+N       N+ TL  +    C+ +IF + P L++LG
Sbjct  711  IWMMPKLRHLCI-TPCRLPV--PQNVRMLVLGNLQTLSEVRNLRCSVDIFKRIPNLKELG  767

Query  189  VRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTLS  368
            +   +S     +K ++  + NL  L+ LK L    +S   E+       F  +L++L L+
Sbjct  768  ISYEVSPSENWSKYQLEALVNLHQLETLK-LLFKYSSHASEIVNPPKLAFPEKLKRLILA  826

Query  369  GTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTAV  548
            G    W  MT++G+L  LEVLKL  NA  G  W+   +  F  LK+L + +++L+ W A 
Sbjct  827  GCGIPWSSMTIVGALPNLEVLKLRKNACQGIEWEPVEEQ-FCQLKHLLLEEVDLVQWVA-  884

Query  549  DSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
             ++  FP L+ L++R+C  L+ IP     +  L+++EL +
Sbjct  885  -NETHFPRLQRLVIRSCYKLKEIPSGIGEIPTLELIELVD  923



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 98.2 bits (243),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 120/229 (52%), Gaps = 19/229 (8%)
 Frame = +3

Query  15    IWNMEKLRHVHTNTSMQLPSSPPK---------NSSRGTNICTLCTISPASCTSEIFNKT  167
             IW M  LRH++      +PS  P          N     N+  L  I    C+ +I  + 
Sbjct  831   IWTMPNLRHLYF-----MPSCLPDPLGGQVLANNFVVLENLQALLDIRNFRCSKDILKRI  885

Query  168   PKLQKLGVRGNLS-ELFLETKQ-KVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFL  341
             P L+KLG+  ++S + +++  Q ++  + NL  L+ LK +  +      +        F 
Sbjct  886   PNLKKLGISYDVSSQAYVDWSQFELESLVNLHQLETLKIVIKNDPYRTSKFVNPPQLAFP  945

Query  342   RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
             ++L++LTLSG    W+ MT++GSL  LEVLKL  +A  G+ W+   +  F  LKYL + +
Sbjct  946   QKLKRLTLSGCGLPWETMTIVGSLPNLEVLKLKKDACRGQEWEPVEEQ-FCRLKYLLLEE  1004

Query  522   MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYN  668
             ++L+ W    ++  FP L+SLI+R+C  L+ IP    ++  L+++EL +
Sbjct  1005  LDLVQWRT--NEAHFPCLQSLIIRSCFRLREIPSAIGDITTLQMIELVD  1051



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 124/257 (48%), Gaps = 33/257 (13%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW + +LRH+ +    +LP  P +  S   N+ TL  +    CT +     P L+KL + 
Sbjct  514  IWMIPQLRHLVSFVFGRLPD-PERAISPLENLQTLSEVRDFRCTEKFLKMIPNLKKLSI-  571

Query  195  GNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRR---------  347
                  F     +   +NNL          LH +  + +LKV +F  FL R         
Sbjct  572  ----SYFRGKNDQEYQLNNL----------LHFHQLE-KLKVKIFPTFLFRRKLNLAFPP  616

Query  348  -LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             L+KLTLSG    W+DM ++  L  LEVLKL D AF G  W+  S+  F+ LK+L + K 
Sbjct  617  SLKKLTLSGWQRPWEDMGIVSLLPNLEVLKLRDYAFRGYKWE-TSEEEFRCLKFLLLDKS  675

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L  W  +     FP L+ L+L  C  L+ IP+ F  +  L+++++ +    + D AR+I
Sbjct  676  DLQHW--ITESSHFPNLKCLVLYRCWCLKEIPDGFGEIPTLELIKVDDGNISLVDSARQI  733

Query  705  CVKRHGKTNVKINAFNV  755
               + G  N   +AF V
Sbjct  734  QEVQQGWGN---DAFQV  747



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score = 98.2 bits (243),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 132/259 (51%), Gaps = 20/259 (8%)
 Frame = +3

Query  15    IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPKL  176
             IW   +LRH+    +  LP  PP +S  G       NI ++  + P  CT +I ++   +
Sbjct  1618  IWETTQLRHLKLR-NFYLPD-PPSSSIDGERNLFWPNIQSVSGLIPYCCTKKILSRFQNI  1675

Query  177   QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK-----FL  341
             +KL +RG++ +      ++V  + +L  L  L+ L +  +  +V    + F K     F 
Sbjct  1676  KKLCIRGHVYDY--GVHEEVMDLRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFP  1733

Query  342   RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              +L+KL L GT   W+++ ++G    LEVLKL  NA  G  W    +  F  LK+L +  
Sbjct  1734  IKLKKLKLVGTCLSWEELNIIGQWPNLEVLKLKPNACHGLEWR-PIEGRFPQLKFLLIEG  1792

Query  522   MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFARE  701
              NL  W A  ++  FP LE L++R+C  L+ IP +FA++ +L+++EL N   ++   A  
Sbjct  1793  TNLKCWKA--TNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCSAKLVASAGR  1850

Query  702   ICVKRH--GKTNVKINAFN  752
             I  ++   G   V + ++N
Sbjct  1851  IQEEQESLGSKAVDVRSYN  1869


 Score = 97.4 bits (241),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/234 (31%), Positives = 122/234 (52%), Gaps = 18/234 (8%)
 Frame = +3

Query  15    IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT------NICTLCTISPASCTSEIFNKTPKL  176
             IW   +LRH+    +  LP  PP +S  G       NI ++  + P  CT +I ++   +
Sbjct  2425  IWETTQLRHLKLR-NFYLPD-PPSSSIDGERNLFWPNIQSVSGLIPYCCTKKILSRFQNI  2482

Query  177   QKLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDK-----FL  341
             +KL +RG++ +      ++V  + +L  L  L+ L +  +  +V    + F K     F 
Sbjct  2483  KKLCIRGHVYDY--GVHEEVMDLRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFP  2540

Query  342   RRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              +L+KL L GT   W+++ ++G    LEVLKL  NA  G  W    +  F  LK+L +  
Sbjct  2541  IKLKKLKLVGTCLSWEELNIIGQWPNLEVLKLKPNACHGLEWR-PIEGRFPQLKFLLIEG  2599

Query  522   MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERV  683
              NL  W A  ++  FP LE L++R+C  L+ IP +FA++ +L+++EL N   ++
Sbjct  2600  TNLKCWKA--TNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCTAKL  2651


 Score = 83.2 bits (204),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 111/230 (48%), Gaps = 45/230 (20%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT-----NICTLCTISPASCTSEIFNKTPKLQ  179
            IW + +LRH+   TS  LP+SP  +          NI T+  +S   CT E+ +    ++
Sbjct  717  IWELTQLRHLEL-TSFLLPNSPTVSVDGQRYLGLPNIHTILGLSHGCCTKEVISGIRNVR  775

Query  180  KLGVRG--NLSELFLETKQKVCLINNLQMLKCLKNLK--LHGNSE-KVELKVTVFDKFLR  344
            KL V G  N  E F E++    L NNL  L+ L+ L   ++ + E  V + +     F  
Sbjct  776  KLKVEGDNNDYEGFQESR----LFNNLVHLQHLETLSVTIYADLEDSVPVTIPSAKAFPA  831

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSG----KLWDLNSDVIFKGLKYLR  512
             L+KL L GT  +WDD+ ++G L  LEVLKL  +A       K W++ +D          
Sbjct  832  TLKKLKLYGTGLRWDDLNIVGELPNLEVLKLIFDAVGEECHLKYWNITND----------  881

Query  513  MGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
                            +FPVLE L++ +C  L+ IP +F+   +LK++EL
Sbjct  882  ----------------NFPVLERLMIIDCTELEEIPIEFSETSSLKLIEL  915



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 118/240 (49%), Gaps = 18/240 (8%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPK--------NSSRGTNICTLCTISPASCTSEIFNKTP  170
            IW M  LRH++      +PS  P         N     N+ TL  +    C+  I  + P
Sbjct  733  IWTMPNLRHLYC-----MPSCLPDPVGEILANNFVVLENLQTLLDVRNFRCSKNILKRIP  787

Query  171  KLQKLGVRGNLSELFLETKQKVCL--INNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLR  344
             L+KLG+  ++S      + +  L  + NL  L+ LK +  +      +        F R
Sbjct  788  NLKKLGISYDVSSQAYVDRWQFNLESLANLHQLETLKIIIKNDPYRTSKFVNPPKLSFPR  847

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
            +L +LTLSG    W+ MT++G L  LEVLKL  +A  G+ W+   +  F  LKYL + ++
Sbjct  848  KLNRLTLSGCGLPWERMTIVGLLPCLEVLKLKKDACRGQEWETVEEQ-FCRLKYLLLEEL  906

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
            +L+ W     +  FP L+SLI+R+C  L+ IP    ++  L+++EL +       +A++I
Sbjct  907  DLVQWRT--KEAPFPRLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTWAKQI  964



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 135/271 (50%), Gaps = 27/271 (10%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRG------TNICTLCTISPASCTSEIFNKTPKL  176
            IW + +L  +  +      S+PP+ S         +NI ++  +SP+SCT E+ +    +
Sbjct  645  IWELMQLSQLRLHKFYL--SNPPRESDNEESYLAFSNIHSISGLSPSSCTKEVISGIRNV  702

Query  177  QKLGVRG--NLSELFLETKQKVCLINNLQMLKCLKNLKLH----GNSEKVELK---VTVF  329
            +KL + G  N  E+F E++    L +NL  L  L+ L       G+SE   +    +   
Sbjct  703  KKLVIHGHANDYEIFQESR----LFDNLVHLHQLETLSFEFRRWGSSENWRISPATIPSA  758

Query  330  DKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYL  509
              F   LRKL L  T  +W+D+ ++G L  LEVLKL   A  G+ W    +  F  LK L
Sbjct  759  KAFPVTLRKLKLKSTYVRWEDLNIVGELPNLEVLKLMWKACIGEEW-YPIEGGFTRLKLL  817

Query  510  RMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSD  689
             +   +L  W A  +D +FPVLE L+ R+C SL+ IP  FA +D+L+++EL N    +  
Sbjct  818  LIEHCDLKYWKA--TDDNFPVLERLLFRHCRSLEEIPIVFAYIDSLQLIELTNCTTELEA  875

Query  690  FAREICVKRHGKTNVKINAFNVFITPLQSQA  782
             A  I   +  +  + I   +V I+ L+  A
Sbjct  876  SAVRI---QEEQEELGIKPVDVRISSLKPAA  903



>ref|XP_009777040.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=902

 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 121/253 (48%), Gaps = 26/253 (10%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            I  M +LRH+  + +        K S    N+  L   +P  CT  +F   P L+KL +R
Sbjct  636  ILAMPQLRHLFLDWNYLQSYETTKKSLVLKNLQCLSGWNPCYCTGSVFRLFPNLKKLQIR  695

Query  195  GNLSELFLETKQKVCLINNLQMLK---------CLKN--------LKLHG----NSEKV-  308
            G   +         C ++ L+ L+         C  +        L+LH     N+E   
Sbjct  696  GIPKDFNHHALFDFCNLDQLEELEFCVTYPRFGCFLDRTTHPEGRLRLHNPPLFNAEDAF  755

Query  309  -ELKVTVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDV  485
               ++   + F + L+ L  SGT F W D++  G L +LE +KL  +AF  K W++  D 
Sbjct  756  APFQLPHPNNFPQNLKNLAFSGTFFCWKDLSGFGKLPKLESIKLGYDAFQDKEWEI-VDE  814

Query  486  IFKGLKYLRMGKMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
            +F  LK+L +  + +  W A  S  +FP LE L L+ C  L +IP+DFA++  L +++++
Sbjct  815  VFPRLKFLLLEDLEIRHWRA--SCDNFPCLERLFLKGCWYLDSIPQDFADITTLALIDIW  872

Query  666  NVCERVSDFAREI  704
               + V + A++I
Sbjct  873  RCAKSVENSAKQI  885



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 127/257 (49%), Gaps = 18/257 (7%)
 Frame = +3

Query  12   GIWNMEKLRHVHT-NTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQ  179
            GIW + +LRH+H     +  P +  +N  +     NI ++  + P+ CT EIF    K++
Sbjct  619  GIWKLFQLRHLHCWCMHLDTPQTVSENEVKNLVLENIQSVSGLIPSCCTKEIFEAIKKVK  678

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVF-----DKFLR  344
             L + G   E     + ++   NNL+ LK L+ L +      +  ++          F  
Sbjct  679  NLEIAGKAEEF----QSEMGWHNNLKYLKELEALMVTVPPGFISNRLPCLINPSSGSFPP  734

Query  345  RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKM  524
             L+KLTLS T   W+ M +   L  LEVL+L + A SG  W++ +++ F  LK L +  +
Sbjct  735  NLKKLTLSRTCLPWNCMNIFSKLPNLEVLELKNLACSGNEWEI-TEMGFPKLKCLLLEDL  793

Query  525  NLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAREI  704
             L  WTA  +D  F  LE + +R C  L+ IPE FA+   L+++EL+     +  FA++I
Sbjct  794  YLRYWTA--TDDYFQCLERVCIRECKLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQI  851

Query  705  CVKRH--GKTNVKINAF  749
              K    G   +K+  F
Sbjct  852  QEKHEELGNNMLKVYVF  868



>gb|EYU24183.1| hypothetical protein MIMGU_mgv1a021378mg, partial [Erythranthe 
guttata]
Length=828

 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 113/231 (49%), Gaps = 37/231 (16%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGT---NICTLCTISPASCTSEIFNKTPKLQKL  185
            IW M +LRHV   T + LP  P  N+ + T   N+ TL T+    C+ E+  + P ++KL
Sbjct  614  IWQMPQLRHVKAKT-ISLPDPPSDNAQKITVLENLQTLSTVGEFKCSEEVIKRIPNVKKL  672

Query  186  GVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLRR------  347
            G+              VC         CL NL   G   K+E     FD  + R      
Sbjct  673  GI--------------VCSTVGSH---CLSNL---GFLHKLESLSLAFDGTIGRGNMVFP  712

Query  348  --LRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGK  521
              ++KL LS     W+DM+++GSL  L+VLKL  NA  G+ W  N +  F  LK+L +  
Sbjct  713  SSVKKLCLSECKIPWEDMSIVGSLPNLQVLKLRSNAAVGQKWISNEEE-FVRLKFLLIEL  771

Query  522  MNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVC  674
              L  W A      FP LE L LR  ++L+ IP DF+ +  L+V++L N+C
Sbjct  772  RELEIWEA--DSTHFPCLEELHLRT-LNLKEIPSDFSEILPLQVIDL-NLC  818



>emb|CDP08021.1| unnamed protein product [Coffea canephora]
Length=854

 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 124/259 (48%), Gaps = 30/259 (12%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPK--NSSRGTNICTL-C-TISPASCTSEIFNKTPKLQK  182
            IW M  LRH+H N  +   S   +  +SS   N+ +  C ++S       I  + P L K
Sbjct  612  IWRMTCLRHLHVNVHVAFDSDVEESVDSSVLANLVSFSCPSLSCGEDAERIIKRLPNLCK  671

Query  183  LGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKVTVFDKFLR------  344
            L      S +F E++      N    LK L +L+         LK+  +   L       
Sbjct  672  L------SCIFYESQYSSTSCNQFPRLKFLSHLE--------SLKIFYYGNPLHNGEFNL  717

Query  345  --RLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMG  518
               L++LTLS     W  ++ +G+L  LEVLKL    F G+ WD+  D  F+ LK+L + 
Sbjct  718  PLSLKELTLSRFCLPWSHISAIGTLPNLEVLKLLSGTFVGRTWDMMEDE-FQKLKFLSLD  776

Query  519  KMNLITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMELYNVCERVSDFAR  698
             +++  W A  S    P LE L+LRNC  L+ IPED +N+ +L+ +E++   + V + A 
Sbjct  777  TLDIAEWNA--SYDHLPKLERLVLRNCKGLEKIPEDLSNIASLETIEVHWCGQSVEESAI  834

Query  699  EICVKRHGKTNVKINAFNV  755
            EI  K  G   V I + N+
Sbjct  835  EI-RKTTGDIKVLITSSNL  852



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 119/224 (53%), Gaps = 14/224 (6%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRG-----TNICTLCTISPASCTSEIFNKTPKLQ  179
            IW + +LRH+    S+ LP+ P  +         +NI T+  +SP+SCT E+ +    ++
Sbjct  700  IWKLTELRHLELE-SLDLPNPPSVSVDEERYLGFSNIQTISGLSPSSCTEEVISGIRNVK  758

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN---SEKVELKVTVFDKFLRRL  350
            KL + G   E   +  Q+  L +NL  L  L+ L    N   +E   + ++    F   L
Sbjct  759  KLRIFGEKDEY--QICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATL  816

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTL  T  +W+D+ ++G L  LE LKL ++A  G++W   S   F  LK L++    +
Sbjct  817  KKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKI  875

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              W A  ++ SFPVLE L ++ C  L+ IP +FA + +L+++ L
Sbjct  876  KYWKA--TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVL  917



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 122/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSP---PKNSSRGT--------------NICTLCTISPASC  143
            +W+M +LRH     S  L +SP    K++S                 N+ TL TI P SC
Sbjct  642  LWDMLELRHFRLKRSC-LSNSPIYYTKSASTSVLSLQDAEVRLRVLKNLQTLSTIRPISC  700

Query  144  TSEIFNKTPKLQKLGVRGNLSEL-FLETKQKVCLINNLQMLKCLKNLKLHGNSEKVELKV  320
            T E+F   P L+KLG+     +  F    +++  +  L+ LK   +     ++ K + ++
Sbjct  701  TQEVFLSVPNLRKLGIYQTEEDYRFRGWFEQLVHLQELETLKYAFSNPFVSSALKPD-RL  759

Query  321  TVFDKFLRRLRKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGL  500
              +  F  +L KLTLSGT   W+DM  L  L +LEVLKL + AFSG +W  + +  F  L
Sbjct  760  PSWRSFPPKLVKLTLSGTSLPWEDMVELSMLPKLEVLKLRNYAFSGSVWK-SREGGFPRL  818

Query  501  KYLRMGKMNLITWTAVDSDKS-FPVLESLILRNCISLQNIPEDFANVDNLKVMELY  665
            K+L +G  NL  W   D+D + FP L+ L+LR+C  L+ IP   +    L+ +EL+
Sbjct  819  KFLLIGSTNLEIW---DADGTHFPNLQQLVLRHCKFLKEIPYGISEAPLLEKIELH  871



>gb|EYU23525.1| hypothetical protein MIMGU_mgv1a018698mg, partial [Erythranthe 
guttata]
Length=795

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/216 (32%), Positives = 107/216 (50%), Gaps = 10/216 (5%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRGTNICTLCTISPASCTSEIFNKTPKLQKLGVR  194
            IW M++L+H+    S    + P    +   N+ TL  +SP  CT E+  + P L KL +R
Sbjct  554  IWEMQELKHLQITGS----NLPDPCGALLPNLVTLLDVSPRCCTKELLERIPLLSKLRIR  609

Query  195  GNLSELFLETKQKVC-LINNLQM--LKCLKNLKLHGNSEKVELKVTVFDKFLRRLRKLTL  365
             +LS    E+   +   I+ + +  LKC+    +      V  +  +   F  R+ KL+L
Sbjct  610  FDLSVDANESSNHLLDFISRVSLSSLKCVVLNPIPRCEFVVLPQAPIVTNFDSRVVKLSL  669

Query  366  SGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNLITWTA  545
            SG  + W+DM+ + S+  L+VLKL   AF G  W+   D  FK LK L +   +L+ WT 
Sbjct  670  SGFGYPWEDMSTISSMWSLQVLKLRRYAFRGPKWE-TRDRAFKSLKVLVIEDSDLMQWTV  728

Query  546  VDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKV  653
                K+F  LE L +R C  L+ IP  F  +  L +
Sbjct  729  --GIKTFRCLEHLTMRRCHRLEMIPSSFGEIFGLSI  762



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 119/224 (53%), Gaps = 14/224 (6%)
 Frame = +3

Query  15   IWNMEKLRHVHTNTSMQLPSSPPKNSSRG-----TNICTLCTISPASCTSEIFNKTPKLQ  179
            IW + +LRH+    S+ LP+ P  +         +NI T+  +SP+SCT E+ +    ++
Sbjct  700  IWKLTELRHLELE-SLDLPNPPSVSVDEERYLGFSNIQTISGLSPSSCTEEVISGIRNVK  758

Query  180  KLGVRGNLSELFLETKQKVCLINNLQMLKCLKNLKLHGN---SEKVELKVTVFDKFLRRL  350
            KL + G   E   +  Q+  L +NL  L  L+ L    N   +E   + ++    F   L
Sbjct  759  KLRIFGEKDEY--QICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFPATL  816

Query  351  RKLTLSGTLFQWDDMTVLGSLEELEVLKLDDNAFSGKLWDLNSDVIFKGLKYLRMGKMNL  530
            +KLTL  T  +W+D+ ++G L  LE LKL ++A  G++W   S   F  LK L++    +
Sbjct  817  KKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKI  875

Query  531  ITWTAVDSDKSFPVLESLILRNCISLQNIPEDFANVDNLKVMEL  662
              W A  ++ SFPVLE L ++ C  L+ IP +FA + +L+++ L
Sbjct  876  KYWKA--TNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVL  917



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5728754161476