BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25934_g1_i4 len=491 path=[14019:0-92 7513:93-112 16630:113-123
16641:124-125 16643:126-136 8114:137-169 16679:170-192 4868:193-230
4906:231-250 16915:251-251 16916:252-256 16921:257-274 16939:275-299
16949:300-427 17441:428-432 12150:433-490]

Length=491
                                                                      Score     E

ref|XP_004246063.1|  PREDICTED: uncharacterized aarF domain-conta...  60.8    2e-08   
ref|XP_006355235.1|  PREDICTED: uncharacterized aarF domain-conta...  59.7    3e-08   
ref|XP_009797124.1|  PREDICTED: uncharacterized aarF domain-conta...  58.5    4e-08   
ref|XP_009592940.1|  PREDICTED: uncharacterized aarF domain-conta...  60.5    9e-08   
ref|XP_006596147.1|  PREDICTED: uncharacterized aarF domain-conta...  55.5    6e-07   
gb|KHM99458.1|  Putative aarF domain-containing protein kinase, c...  55.5    6e-07   
ref|XP_006596148.1|  PREDICTED: uncharacterized aarF domain-conta...  55.5    6e-07   
ref|XP_007161302.1|  hypothetical protein PHAVU_001G058600g           57.0    8e-07   
ref|XP_009406484.1|  PREDICTED: uncharacterized aarF domain-conta...  55.5    8e-07   
ref|XP_004138761.1|  PREDICTED: uncharacterized aarF domain-conta...  55.5    1e-06   
ref|XP_010275114.1|  PREDICTED: uncharacterized aarF domain-conta...  57.4    1e-06   
ref|XP_002280681.2|  PREDICTED: uncharacterized aarF domain-conta...  55.8    1e-06   Vitis vinifera
emb|CDP18075.1|  unnamed protein product                              57.0    1e-06   
ref|XP_008786522.1|  PREDICTED: uncharacterized aarF domain-conta...  53.1    2e-06   
ref|XP_008786521.1|  PREDICTED: uncharacterized aarF domain-conta...  53.1    2e-06   
ref|XP_010930611.1|  PREDICTED: uncharacterized aarF domain-conta...  53.1    2e-06   
ref|XP_010930610.1|  PREDICTED: uncharacterized aarF domain-conta...  53.1    2e-06   
ref|XP_003577701.1|  PREDICTED: uncharacterized aarF domain-conta...  56.2    3e-06   
ref|XP_010930612.1|  PREDICTED: uncharacterized aarF domain-conta...  53.1    3e-06   
ref|XP_006601108.1|  PREDICTED: uncharacterized aarF domain-conta...  55.5    3e-06   
ref|XP_008445093.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    3e-06   
gb|EYU37471.1|  hypothetical protein MIMGU_mgv1a002530mg              53.9    3e-06   
gb|KHM99321.1|  Putative aarF domain-containing protein kinase, c...  55.5    4e-06   
ref|XP_003549224.1|  PREDICTED: uncharacterized aarF domain-conta...  55.5    4e-06   
ref|XP_011082127.1|  PREDICTED: uncharacterized aarF domain-conta...  55.1    5e-06   
gb|EPS60783.1|  hypothetical protein M569_14016                       55.1    5e-06   
gb|EMT25058.1|  Putative aarF domain-containing protein kinase        55.1    5e-06   
gb|KFK29740.1|  hypothetical protein AALP_AA7G172400                  54.7    7e-06   
ref|XP_006601107.1|  PREDICTED: uncharacterized aarF domain-conta...  54.7    8e-06   
ref|XP_006596149.1|  PREDICTED: uncharacterized aarF domain-conta...  54.7    8e-06   
ref|XP_004292889.1|  PREDICTED: uncharacterized aarF domain-conta...  52.8    9e-06   
ref|XP_010525874.1|  PREDICTED: uncharacterized aarF domain-conta...  52.8    1e-05   
emb|CDX68742.1|  BnaC01g07110D                                        54.3    1e-05   
ref|XP_010102855.1|  putative aarF domain-containing protein kinase   52.8    1e-05   
ref|XP_009127022.1|  PREDICTED: uncharacterized aarF domain-conta...  54.3    1e-05   
ref|XP_007225514.1|  hypothetical protein PRUPE_ppa002350mg           51.6    1e-05   
ref|XP_008219922.1|  PREDICTED: uncharacterized aarF domain-conta...  51.2    1e-05   
ref|XP_004498586.1|  PREDICTED: uncharacterized aarF domain-conta...  50.8    2e-05   
ref|XP_006826450.1|  hypothetical protein AMTR_s00004p00178250        53.5    2e-05   
ref|XP_011031343.1|  PREDICTED: uncharacterized aarF domain-conta...  53.5    2e-05   
ref|XP_006382172.1|  hypothetical protein POPTR_0006s29050g           53.5    2e-05   
ref|XP_006382173.1|  ABC1 family protein                              53.5    2e-05   
ref|XP_007011575.1|  Kinase superfamily protein isoform 2             52.8    3e-05   
ref|XP_007011574.1|  Kinase superfamily protein isoform 1             52.8    3e-05   
gb|ABA92061.1|  ABC1 family protein, expressed                        52.8    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662827.1|  PREDICTED: uncharacterized aarF domain-conta...  52.8    3e-05   
gb|EAZ17828.1|  hypothetical protein OsJ_33372                        52.8    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67885.1|  hypothetical protein OsI_35541                        52.8    3e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001067509.1|  Os11g0216300                                     52.8    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283264.1|  hypothetical protein CARUB_v10004295mg           52.4    4e-05   
gb|KDP33439.1|  hypothetical protein JCGZ_07010                       52.4    4e-05   
ref|XP_006450139.1|  hypothetical protein CICLE_v10007657mg           49.3    4e-05   
ref|XP_006450140.1|  hypothetical protein CICLE_v10007657mg           49.3    4e-05   
gb|KDO67246.1|  hypothetical protein CISIN_1g005446mg                 48.9    4e-05   
ref|XP_002869329.1|  ABC1 family protein                              52.4    4e-05   
ref|XP_006483592.1|  PREDICTED: uncharacterized aarF domain-conta...  48.9    5e-05   
gb|KDO67245.1|  hypothetical protein CISIN_1g005446mg                 48.9    5e-05   
ref|NP_001031763.1|  ABC1-like kinase related to chlorophyll degr...  52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194867.2|  ABC1-like kinase related to chlorophyll degrada...  52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669443.1|  PREDICTED: uncharacterized aarF domain-conta...  52.0    5e-05   
gb|KHG19603.1|  hypothetical protein F383_08735                       50.4    6e-05   
ref|XP_002527966.1|  Protein ABC1, mitochondrial precursor, putative  52.0    6e-05   Ricinus communis
ref|XP_006412598.1|  hypothetical protein EUTSA_v10024610mg           50.8    1e-04   
ref|XP_008678051.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    2e-04   
gb|AFW60588.1|  hypothetical protein ZEAMMB73_742334                  50.4    2e-04   
gb|KEH39767.1|  Serine/Threonine kinase, ABC1 family protein          50.4    2e-04   
gb|KEH39768.1|  Serine/Threonine kinase, ABC1 family protein          50.4    2e-04   
ref|XP_010447563.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    2e-04   
ref|XP_010438044.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    2e-04   
ref|XP_010432869.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    2e-04   
ref|XP_004964300.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    2e-04   
ref|XP_004964299.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    2e-04   
gb|KCW82613.1|  hypothetical protein EUGRSUZ_C04003                   48.1    9e-04   
ref|XP_010049808.1|  PREDICTED: uncharacterized aarF domain-conta...  48.1    0.001   



>ref|XP_004246063.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Solanum lycopersicum]
Length=662

 Score = 60.8 bits (146),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -1

Query  401  GNIF-LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G IF LVGR  EIVW+LGLY    VYD++V  D+E+VPF  +QL +LLCD
Sbjct  99   GQIFSLVGRGIEIVWSLGLYWTTLVYDYLVGRDEEVVPFRARQLRKLLCD  148


 Score = 24.3 bits (51),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  430  VQNKLLESMGVIFSLLA  380
            V+NK+LES G IFSL+ 
Sbjct  90   VRNKVLESRGQIFSLVG  106



>ref|XP_006355235.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Solanum tuberosum]
Length=662

 Score = 59.7 bits (143),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -1

Query  401  GNIF-LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G IF LVGR  EIVW+LG+Y    VYD++V  D+E+VPF  +QL +LLCD
Sbjct  99   GQIFSLVGRGIEIVWSLGIYWTTLVYDYLVGRDEEVVPFRARQLRKLLCD  148


 Score = 23.9 bits (50),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  430  VQNKLLESMGVIFSLLA  380
            V+NK+LES G IFSL+ 
Sbjct  90   VRNKVLESRGQIFSLVG  106



>ref|XP_009797124.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Nicotiana sylvestris]
Length=154

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  407  NGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  + LVGR  EIVWNLGLY    VYD++V  D+E+VPF  +QL  LLCD
Sbjct  90   RGQILSLVGRGIEIVWNLGLYWTTLVYDYLVGRDEEVVPFRARQLRTLLCD  140



>ref|XP_009592940.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Nicotiana tomentosiformis]
Length=662

 Score = 60.5 bits (145),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            LVGR  EIVWNLGLY    VYD++V  D+E+VPF  +QL  LLCD
Sbjct  104  LVGRGVEIVWNLGLYWTTLVYDYLVGRDEEVVPFRARQLRTLLCD  148


 Score = 21.9 bits (45),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  430  VQNKLLESMGVIFSLLA  380
            V+NK+LES G I SL+ 
Sbjct  90   VRNKVLESRGQILSLVG  106



>ref|XP_006596147.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X1 [Glycine max]
Length=668

 Score = 55.5 bits (132),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  105  GSILSLMLRGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  154


 Score = 23.9 bits (50),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  433  IVQNKLLESMGVIFSLL  383
            IV+NK+LES G I SL+
Sbjct  95   IVRNKVLESRGSILSLM  111



>gb|KHM99458.1| Putative aarF domain-containing protein kinase, chloroplastic 
[Glycine soja]
Length=671

 Score = 55.5 bits (132),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  108  GSILSLMLRGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  157


 Score = 23.9 bits (50),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  433  IVQNKLLESMGVIFSLL  383
            IV+NK+LES G I SL+
Sbjct  98   IVRNKVLESRGSILSLM  114



>ref|XP_006596148.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X2 [Glycine max]
Length=646

 Score = 55.5 bits (132),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  105  GSILSLMLRGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  154


 Score = 23.9 bits (50),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  433  IVQNKLLESMGVIFSLL  383
            IV+NK+LES G I SL+
Sbjct  95   IVRNKVLESRGSILSLM  111



>ref|XP_007161302.1| hypothetical protein PHAVU_001G058600g [Phaseolus vulgaris]
 gb|ESW33296.1| hypothetical protein PHAVU_001G058600g [Phaseolus vulgaris]
Length=659

 Score = 57.0 bits (136),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  99   GSTLSLMLRGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  148


 Score = 22.3 bits (46),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  433  IVQNKLLESMGVIFSLL  383
            IV+NK+LES G   SL+
Sbjct  89   IVRNKVLESRGSTLSLM  105



>ref|XP_009406484.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Musa acuminata subsp. malaccensis]
Length=680

 Score = 55.5 bits (132),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVWNLGLY     YD +V  D+E+VP+  +QL +LLCD
Sbjct  115  GSILSLIGRGVEIVWNLGLYWSALTYDCLVGRDEEVVPYRARQLRKLLCD  164


 Score = 23.9 bits (50),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G I SL+ 
Sbjct  102  TPETVRNKVLESRGSILSLIG  122



>ref|XP_004138761.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Cucumis sativus]
 ref|XP_004160844.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Cucumis sativus]
 gb|KGN62876.1| hypothetical protein Csa_2G378580 [Cucumis sativus]
Length=661

 Score = 55.5 bits (132),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY    +YD  V  D+E+VPF  QQL +LLCD
Sbjct  100  GAVLSLISRGVEIVWNLGLYWSILMYDCFVGRDEEVVPFRAQQLRKLLCD  149


 Score = 23.5 bits (49),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLAE  377
            +   V+NK+LES G + SL++ 
Sbjct  87   SPETVRNKVLESRGAVLSLISR  108



>ref|XP_010275114.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Nelumbo nucifera]
Length=685

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  +FLV R  EIVWNLGLY     YD  V  D+E+VP+  +QL  LLCD
Sbjct  121  GAILFLVARGVEIVWNLGLYWSGLTYDFFVGRDEEVVPYRARQLRNLLCD  170



>ref|XP_002280681.2| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Vitis vinifera]
 emb|CBI20774.3| unnamed protein product [Vitis vinifera]
Length=662

 Score = 55.8 bits (133),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            LVGR  EIVWNLGLY    +YD +V  D+E+VP+  +QL  LLCD
Sbjct  104  LVGRGVEIVWNLGLYWSTLMYDCLVGRDEEVVPYRARQLRNLLCD  148


 Score = 22.7 bits (47),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G I SL+ 
Sbjct  86   TPETVRNKVLESRGQILSLVG  106



>emb|CDP18075.1| unnamed protein product [Coffea canephora]
Length=611

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVW LGLY    VYD+ V  D+E+VPF   QL  LLCD
Sbjct  48   GAILSLIGRGVEIVWKLGLYWSTLVYDYFVGRDEEVVPFRASQLRNLLCD  97



>ref|XP_008786522.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X2 [Phoenix dactylifera]
Length=686

 Score = 53.1 bits (126),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVWNLGLY     YD +V  D+E+VP+  +QL  LLC+
Sbjct  123  GAILSLIGRGVEIVWNLGLYWSALTYDCLVGRDEEVVPYRARQLRNLLCN  172


 Score = 24.6 bits (52),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G I SL+ 
Sbjct  110  TPETVRNKVLESRGAILSLIG  130



>ref|XP_008786521.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X1 [Phoenix dactylifera]
Length=688

 Score = 53.1 bits (126),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVWNLGLY     YD +V  D+E+VP+  +QL  LLC+
Sbjct  123  GAILSLIGRGVEIVWNLGLYWSALTYDCLVGRDEEVVPYRARQLRNLLCN  172


 Score = 24.6 bits (52),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G I SL+ 
Sbjct  110  TPETVRNKVLESRGAILSLIG  130



>ref|XP_010930611.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X2 [Elaeis guineensis]
Length=662

 Score = 53.1 bits (126),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVWNLGLY     YD +V  D+E+VP+  +QL  LLC+
Sbjct  104  GAILSLIGRGVEIVWNLGLYWSALTYDCLVGRDEEVVPYRARQLRNLLCN  153


 Score = 24.3 bits (51),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G I SL+ 
Sbjct  91   TPETVRNKVLESRGAILSLIG  111



>ref|XP_010930610.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X1 [Elaeis guineensis]
Length=667

 Score = 53.1 bits (126),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVWNLGLY     YD +V  D+E+VP+  +QL  LLC+
Sbjct  104  GAILSLIGRGVEIVWNLGLYWSALTYDCLVGRDEEVVPYRARQLRNLLCN  153


 Score = 24.3 bits (51),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G I SL+ 
Sbjct  91   TPETVRNKVLESRGAILSLIG  111



>ref|XP_003577701.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Brachypodium distachyon]
Length=682

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G +G  I L  R  EI+W LG Y  + VYD++V  D+E+VPF  +QL  LLCD
Sbjct  113  LGSSGSIISLASRGVEIIWKLGFYWSSLVYDYLVGRDEEIVPFRARQLRNLLCD  166



>ref|XP_010930612.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X3 [Elaeis guineensis]
Length=620

 Score = 53.1 bits (126),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVWNLGLY     YD +V  D+E+VP+  +QL  LLC+
Sbjct  104  GAILSLIGRGVEIVWNLGLYWSALTYDCLVGRDEEVVPYRARQLRNLLCN  153


 Score = 24.3 bits (51),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G I SL+ 
Sbjct  91   TPETVRNKVLESRGAILSLIG  111



>ref|XP_006601108.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X3 [Glycine max]
Length=547

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  108  GSILSLMLRGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  157



>ref|XP_008445093.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized aarF domain-containing 
protein kinase At4g31390, chloroplastic [Cucumis melo]
Length=711

 Score = 53.5 bits (127),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY    +YD  V  D+E+VPF  +QL +LLCD
Sbjct  100  GAVLSLISRGVEIVWNLGLYWSILMYDCFVGRDEEVVPFRARQLRKLLCD  149


 Score = 23.5 bits (49),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLAE  377
            +   V+NK+LES G + SL++ 
Sbjct  87   SPETVRNKVLESRGAVLSLISR  108



>gb|EYU37471.1| hypothetical protein MIMGU_mgv1a002530mg [Erythranthe guttata]
Length=662

 Score = 53.9 bits (128),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  +IVWNLG Y    +YD  V  D+E+VPF  +QL  LLCD
Sbjct  99   GAILSLIGRGVQIVWNLGFYWSTLMYDCFVGRDEEVVPFRARQLRNLLCD  148


 Score = 23.1 bits (48),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 13/21 (62%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V NK+LES G I SL+ 
Sbjct  86   TPESVSNKVLESRGAILSLIG  106



>gb|KHM99321.1| Putative aarF domain-containing protein kinase, chloroplastic 
[Glycine soja]
Length=614

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  51   GSILSLMLRGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  100



>ref|XP_003549224.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X1 [Glycine max]
Length=671

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  108  GSILSLMLRGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  157



>ref|XP_011082127.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Sesamum indicum]
Length=667

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVWNLG Y    +YD  V  D+E+VPF  +QL  LLCD
Sbjct  104  GAILSLIGRGVEIVWNLGFYWSTLMYDCFVGRDEEVVPFRARQLRNLLCD  153



>gb|EPS60783.1| hypothetical protein M569_14016 [Genlisea aurea]
Length=646

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVWNLG Y    +YD+VV  D+E+VPF  +QL  LLCD
Sbjct  85   GAILSLFNRGVEIVWNLGFYWSTLMYDYVVGRDEEVVPFRARQLRNLLCD  134



>gb|EMT25058.1| Putative aarF domain-containing protein kinase [Aegilops tauschii]
Length=687

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G +G  + L  R  EI+W LG Y  + VYD++V  D+E+VPF  +QL  LLCD
Sbjct  120  LGSSGSVLSLASRGVEIIWKLGFYWSSLVYDYLVGRDEEIVPFRARQLRNLLCD  173



>gb|KFK29740.1| hypothetical protein AALP_AA7G172400 [Arabis alpina]
Length=679

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + LV R  EIVWNLGLY    +YD +V  D+E+VPF  +QL  LLC+
Sbjct  124  GAVVSLVSRGVEIVWNLGLYWSTLMYDFLVGRDEEVVPFRARQLRNLLCN  173



>ref|XP_006601107.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X2 [Glycine max]
Length=558

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  380  REEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  3    RGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  44



>ref|XP_006596149.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X3 [Glycine max]
Length=558

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  380  REEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            R  EIVWNLGLY  N VYD +V  D+E+VP+  +QL  LLCD
Sbjct  3    RGVEIVWNLGLYWSNLVYDFLVGRDEEVVPYRARQLRNLLCD  44



>ref|XP_004292889.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Fragaria vesca subsp. vesca]
Length=658

 Score = 52.8 bits (125),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  407  NGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            NG    L+ R  EIVW LGLY    +YD+ V  DQE+VP   +QL  LLCD
Sbjct  103  NGAVASLISRGVEIVWTLGLYWSTLMYDYFVGRDQEVVPKRARQLRNLLCD  153


 Score = 22.7 bits (47),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G + SL++
Sbjct  91   TPETVRNKVLESNGAVASLIS  111



>ref|XP_010525874.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Tarenaya hassleriana]
Length=701

 Score = 52.8 bits (125),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + LV R  EIVWNLGLY    +YD +V  D+E+VPF  +QL  LLC+
Sbjct  136  GAILSLVLRGVEIVWNLGLYWSTLMYDFLVGRDEEVVPFRARQLRNLLCN  185


 Score = 22.7 bits (47),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  430  VQNKLLESMGVIFSLL  383
            V+NK+LES G I SL+
Sbjct  127  VRNKVLESRGAILSLV  142



>emb|CDX68742.1| BnaC01g07110D [Brassica napus]
Length=670

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVWNLGLY    VYD +V  D+E+VPF  +QL  LLC+
Sbjct  115  GSVVSLASRGVEIVWNLGLYWSTLVYDFLVGRDEEVVPFRARQLRNLLCN  164



>ref|XP_010102855.1| putative aarF domain-containing protein kinase [Morus notabilis]
 gb|EXB94236.1| putative aarF domain-containing protein kinase [Morus notabilis]
Length=764

 Score = 52.8 bits (125),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            L+ R  EIVWNLGLY    +YD +V  D+E+VPF  +QL  LLCD
Sbjct  114  LILRGVEIVWNLGLYWSALMYDFLVGRDEEVVPFRARQLRNLLCD  158


 Score = 22.3 bits (46),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLL  383
            T   V+NK+LES G + SL+
Sbjct  96   TPDTVRNKVLESRGAVASLI  115



>ref|XP_009127022.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Brassica rapa]
 emb|CDY28265.1| BnaA01g05840D [Brassica napus]
Length=676

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVWNLGLY    VYD +V  D+E+VPF  +QL  LLC+
Sbjct  121  GSVVSLASRGVEIVWNLGLYWSTLVYDFLVGRDEEVVPFRARQLRNLLCN  170



>ref|XP_007225514.1| hypothetical protein PRUPE_ppa002350mg [Prunus persica]
 gb|EMJ26713.1| hypothetical protein PRUPE_ppa002350mg [Prunus persica]
Length=683

 Score = 51.6 bits (122),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVW+LGLY     YD  V  D+E+VPF  +QL  LLCD
Sbjct  120  GAIVSLISRGVEIVWSLGLYWSALTYDCFVGRDEEVVPFRARQLRNLLCD  169


 Score = 23.5 bits (49),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  430  VQNKLLESMGVIFSLLA  380
            V+NK+LES G I SL++
Sbjct  111  VRNKVLESRGAIVSLIS  127



>ref|XP_008219922.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Prunus mume]
Length=683

 Score = 51.2 bits (121),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVW+LGLY     YD  V  D+E+VPF  +QL  LLCD
Sbjct  120  GAILSLISRGVEIVWSLGLYWSALTYDCFVGRDEEVVPFRARQLRNLLCD  169


 Score = 23.9 bits (50),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  430  VQNKLLESMGVIFSLLA  380
            V+NK+LES G I SL++
Sbjct  111  VRNKVLESRGAILSLIS  127



>ref|XP_004498586.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Cicer arietinum]
Length=657

 Score = 50.8 bits (120),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVW+LG Y    +YD +V  D+E+VP+  +QL  LLCD
Sbjct  94   GAILSLISRGVEIVWSLGFYWSTLMYDFLVGRDEEVVPYRARQLRNLLCD  143


 Score = 23.9 bits (50),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  430  VQNKLLESMGVIFSLLA  380
            V+NK+LES G I SL++
Sbjct  85   VRNKVLESRGAILSLIS  101



>ref|XP_006826450.1| hypothetical protein AMTR_s00004p00178250 [Amborella trichopoda]
 gb|ERM93687.1| hypothetical protein AMTR_s00004p00178250 [Amborella trichopoda]
Length=689

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+GR  EIVW LGLY     YD +   DQE+VPF   QL  LLCD
Sbjct  126  GAILSLIGRGVEIVWKLGLYWSALTYDCLTGRDQEIVPFRAMQLRNLLCD  175



>ref|XP_011031343.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Populus euphratica]
Length=668

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            L+ R  EIVWNLGLY  N  YD +V  D+E+VP+  +QL  LLCD
Sbjct  111  LMLRGVEIVWNLGLYWSNLAYDFLVGRDEEVVPYRARQLRNLLCD  155



>ref|XP_006382172.1| hypothetical protein POPTR_0006s29050g [Populus trichocarpa]
 gb|ERP59969.1| hypothetical protein POPTR_0006s29050g [Populus trichocarpa]
Length=669

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            L+ R  EIVWNLGLY  N  YD +V  D+E+VP+  +QL  LLCD
Sbjct  111  LMLRGVEIVWNLGLYWSNLAYDFLVGRDEEVVPYRARQLRNLLCD  155



>ref|XP_006382173.1| ABC1 family protein [Populus trichocarpa]
 gb|ERP59970.1| ABC1 family protein [Populus trichocarpa]
Length=737

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            L+ R  EIVWNLGLY  N  YD +V  D+E+VP+  +QL  LLCD
Sbjct  111  LMLRGVEIVWNLGLYWSNLAYDFLVGRDEEVVPYRARQLRNLLCD  155



>ref|XP_007011575.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29194.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=639

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            L+ R  EIVWNLGLY  + +YD +V  D+E+VPF  +QL  LLCD
Sbjct  112  LILRGVEIVWNLGLYWSSLMYDCLVGRDKEVVPFRARQLRNLLCD  156



>ref|XP_007011574.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29193.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=670

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            L+ R  EIVWNLGLY  + +YD +V  D+E+VPF  +QL  LLCD
Sbjct  112  LILRGVEIVWNLGLYWSSLMYDCLVGRDKEVVPFRARQLRNLLCD  156



>gb|ABA92061.1| ABC1 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAG90282.1| unnamed protein product [Oryza sativa Japonica Group]
Length=675

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  G  + L  R  EI+W LGLY    +YD +V  D+E+VPF  +QL  LLCD
Sbjct  106  LGSRGSVLSLASRGVEIIWKLGLYWSALMYDFLVGRDEEIVPFRARQLRNLLCD  159



>ref|XP_006662827.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X1 [Oryza brachyantha]
Length=677

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  G  + L  R  EI+W LGLY    +YD +V  D+E+VPF  +QL  LLCD
Sbjct  108  LGSRGSVLSLASRGVEIIWKLGLYWSALMYDFLVGRDEEIVPFRARQLRNLLCD  161



>gb|EAZ17828.1| hypothetical protein OsJ_33372 [Oryza sativa Japonica Group]
Length=708

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  G  + L  R  EI+W LGLY    +YD +V  D+E+VPF  +QL  LLCD
Sbjct  169  LGSRGSVLSLASRGVEIIWKLGLYWSALMYDFLVGRDEEIVPFRARQLRNLLCD  222



>gb|EEC67885.1| hypothetical protein OsI_35541 [Oryza sativa Indica Group]
Length=709

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  G  + L  R  EI+W LGLY    +YD +V  D+E+VPF  +QL  LLCD
Sbjct  140  LGSRGSVLSLASRGVEIIWKLGLYWSALMYDFLVGRDEEIVPFRARQLRNLLCD  193



>ref|NP_001067509.1| Os11g0216300 [Oryza sativa Japonica Group]
 dbj|BAF27872.1| Os11g0216300, partial [Oryza sativa Japonica Group]
Length=734

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  G  + L  R  EI+W LGLY    +YD +V  D+E+VPF  +QL  LLCD
Sbjct  165  LGSRGSVLSLASRGVEIIWKLGLYWSALMYDFLVGRDEEIVPFRARQLRNLLCD  218



>ref|XP_006283264.1| hypothetical protein CARUB_v10004295mg [Capsella rubella]
 gb|EOA16162.1| hypothetical protein CARUB_v10004295mg [Capsella rubella]
Length=673

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVW LGLY    VYD +V  D+E+VPF  +QL  LLC+
Sbjct  118  GSVVSLASRGVEIVWTLGLYWSTLVYDFIVGRDEEVVPFRARQLRNLLCN  167



>gb|KDP33439.1| hypothetical protein JCGZ_07010 [Jatropha curcas]
Length=685

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLG Y    +YD +V  D+E+VP+  +QL  LLCD
Sbjct  122  GSVLSLISRGVEIVWNLGFYWSTLMYDFLVGRDKEVVPYRARQLRNLLCD  171



>ref|XP_006450139.1| hypothetical protein CICLE_v10007657mg [Citrus clementina]
 gb|ESR63379.1| hypothetical protein CICLE_v10007657mg [Citrus clementina]
Length=645

 Score = 49.3 bits (116),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  I L+ R  EIVW+LGLY  N +YD +V  D+E+VP   +QL  LLC+
Sbjct  112  GAVISLMSRGVEIVWSLGLYWSNLMYDCLVGRDKEVVPDRARQLRNLLCN  161


 Score = 23.9 bits (50),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G + SL++
Sbjct  99   TPETVRNKVLESRGAVISLMS  119



>ref|XP_006450140.1| hypothetical protein CICLE_v10007657mg [Citrus clementina]
 gb|ESR63380.1| hypothetical protein CICLE_v10007657mg [Citrus clementina]
Length=675

 Score = 49.3 bits (116),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  I L+ R  EIVW+LGLY  N +YD +V  D+E+VP   +QL  LLC+
Sbjct  112  GAVISLMSRGVEIVWSLGLYWSNLMYDCLVGRDKEVVPDRARQLRNLLCN  161


 Score = 23.9 bits (50),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G + SL++
Sbjct  99   TPETVRNKVLESRGAVISLMS  119



>gb|KDO67246.1| hypothetical protein CISIN_1g005446mg [Citrus sinensis]
Length=559

 Score = 48.9 bits (115),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  I L+ R  EIVW+LGLY  N  YD +V  D+E+VP   +QL  LLC+
Sbjct  112  GAVISLMSRGVEIVWSLGLYWSNLTYDCLVGRDKEVVPDRARQLRNLLCN  161


 Score = 24.3 bits (51),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G + SL++
Sbjct  99   TPETVRNKVLESRGAVISLMS  119



>ref|XP_002869329.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45588.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata]
Length=682

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + LV R  EIVW LGLY    +YD +V  D+E+VPF  +QL  LLC+
Sbjct  127  GAVVSLVSRGVEIVWTLGLYWSTLMYDFLVGRDEEVVPFRARQLRNLLCN  176



>ref|XP_006483592.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Citrus sinensis]
 gb|KDO67244.1| hypothetical protein CISIN_1g005446mg [Citrus sinensis]
Length=675

 Score = 48.9 bits (115),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  I L+ R  EIVW+LGLY  N  YD +V  D+E+VP   +QL  LLC+
Sbjct  112  GAVISLMSRGVEIVWSLGLYWSNLTYDCLVGRDKEVVPDRARQLRNLLCN  161


 Score = 23.9 bits (50),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G + SL++
Sbjct  99   TPETVRNKVLESRGAVISLMS  119



>gb|KDO67245.1| hypothetical protein CISIN_1g005446mg [Citrus sinensis]
Length=696

 Score = 48.9 bits (115),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  I L+ R  EIVW+LGLY  N  YD +V  D+E+VP   +QL  LLC+
Sbjct  112  GAVISLMSRGVEIVWSLGLYWSNLTYDCLVGRDKEVVPDRARQLRNLLCN  161


 Score = 23.9 bits (50),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLLA  380
            T   V+NK+LES G + SL++
Sbjct  99   TPETVRNKVLESRGAVISLMS  119



>ref|NP_001031763.1| ABC1-like kinase related to chlorophyll degradation and oxidative 
stress 1 [Arabidopsis thaliana]
 gb|AEE85904.1| ABC1-like kinase related to chlorophyll degradation and oxidative 
stress 1 [Arabidopsis thaliana]
Length=657

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + LV R  EIVW LGLY     YD +V  D+E+VPF  +QL  LLC+
Sbjct  127  GAVVSLVSRGVEIVWTLGLYWSTLTYDFLVGRDEEVVPFRARQLRNLLCN  176



>ref|NP_194867.2| ABC1-like kinase related to chlorophyll degradation and oxidative 
stress 1 [Arabidopsis thaliana]
 sp|Q8RWG1.1|Y4139_ARATH RecName: Full=Uncharacterized aarF domain-containing protein 
kinase At4g31390, chloroplastic; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM13112.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37783.1| At4g31390 [Arabidopsis thaliana]
 gb|AEE85903.1| ABC1-like kinase related to chlorophyll degradation and oxidative 
stress 1 [Arabidopsis thaliana]
Length=682

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + LV R  EIVW LGLY     YD +V  D+E+VPF  +QL  LLC+
Sbjct  127  GAVVSLVSRGVEIVWTLGLYWSTLTYDFLVGRDEEVVPFRARQLRNLLCN  176



>ref|XP_010669443.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=666

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLGLY     YD +V  D+E+VP+  +QL  LLCD
Sbjct  106  GAILSLIERGVEIVWNLGLYWATLSYDCLVGQDEEVVPYRARQLRNLLCD  155



>gb|KHG19603.1| hypothetical protein F383_08735 [Gossypium arboreum]
Length=678

 Score = 50.4 bits (119),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            L+ R  EIVW LGLY  + +YD +V  D+E+VPF  +QL  LLCD
Sbjct  120  LILRGVEIVWKLGLYWSSLMYDCLVGRDKEVVPFRARQLRNLLCD  164


 Score = 22.3 bits (46),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = -2

Query  442  TTAIVQNKLLESMGVIFSLL  383
            +   V+NK+LES G + SL+
Sbjct  102  SPETVRNKVLESRGAVASLI  121



>ref|XP_002527966.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis]
 gb|EEF34378.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis]
Length=681

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L+ R  EIVWNLG Y  + +YD +V  D+E+VPF  +QL  LLCD
Sbjct  118  GTTLSLMLRGVEIVWNLGFYWSSLMYDCLVGRDKEVVPFRARQLRNLLCD  167



>ref|XP_006412598.1| hypothetical protein EUTSA_v10024610mg [Eutrema salsugineum]
 gb|ESQ54051.1| hypothetical protein EUTSA_v10024610mg [Eutrema salsugineum]
Length=667

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVW+LGLY    +YD +V  D+E+VPF  +QL  LLC+
Sbjct  112  GSVVSLASRGVEIVWSLGLYWSTLMYDFLVGRDEEVVPFRARQLRNLLCN  161



>ref|XP_008678051.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Zea mays]
Length=680

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EI+W LG Y  + VYD +V  D+E+VP+  +QL  LLCD
Sbjct  115  GSILSLASRGVEIIWKLGFYWSSLVYDFLVGQDEEIVPYRARQLRNLLCD  164



>gb|AFW60588.1| hypothetical protein ZEAMMB73_742334 [Zea mays]
Length=691

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EI+W LG Y  + VYD +V  D+E+VP+  +QL  LLCD
Sbjct  126  GSILSLASRGVEIIWKLGFYWSSLVYDFLVGQDEEIVPYRARQLRNLLCD  175



>gb|KEH39767.1| Serine/Threonine kinase, ABC1 family protein [Medicago truncatula]
Length=616

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  G  + L+ R  EIV +LGLY    VYD +V  D+E+VPF  +QL  LLCD
Sbjct  87   LGSRGSILSLISRGVEIVLSLGLYWSALVYDFLVGRDEEVVPFRARQLRNLLCD  140



>gb|KEH39768.1| Serine/Threonine kinase, ABC1 family protein [Medicago truncatula]
Length=654

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  416  FGVNGGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
             G  G  + L+ R  EIV +LGLY    VYD +V  D+E+VPF  +QL  LLCD
Sbjct  87   LGSRGSILSLISRGVEIVLSLGLYWSALVYDFLVGRDEEVVPFRARQLRNLLCD  140



>ref|XP_010447563.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Camelina sativa]
Length=683

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVW LGLY    +YD +V  D+E+VPF  +QL  LLC+
Sbjct  128  GSVVSLASRGVEIVWTLGLYWSTLMYDFMVGRDEEVVPFRARQLRNLLCN  177



>ref|XP_010438044.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Camelina sativa]
Length=683

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVW LGLY    +YD +V  D+E+VPF  +QL  LLC+
Sbjct  128  GSVVSLASRGVEIVWTLGLYWSTLMYDFMVGRDEEVVPFRARQLRNLLCN  177



>ref|XP_010432869.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like [Camelina sativa]
Length=683

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EIVW LGLY    +YD +V  D+E+VPF  +QL  LLC+
Sbjct  128  GSVVSLASRGVEIVWTLGLYWSTLMYDFMVGRDEEVVPFRARQLRNLLCN  177



>ref|XP_004964300.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X2 [Setaria italica]
Length=675

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EI+W LG Y  + VYD +V  D+E+VP+  +QL  LLCD
Sbjct  110  GSILSLASRGVEIIWKLGFYWSSLVYDFLVGRDEEIVPYRARQLRNLLCD  159



>ref|XP_004964299.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic-like isoform X1 [Setaria italica]
Length=677

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  404  GGNIFLVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            G  + L  R  EI+W LG Y  + VYD +V  D+E+VP+  +QL  LLCD
Sbjct  110  GSILSLASRGVEIIWKLGFYWSSLVYDFLVGRDEEIVPYRARQLRNLLCD  159



>gb|KCW82613.1| hypothetical protein EUGRSUZ_C04003 [Eucalyptus grandis]
Length=636

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            LV R  EIVW LG Y    +YD  +  D+E+VPF   QL  LLCD
Sbjct  113  LVMRGVEIVWKLGFYWSTLMYDCFIGQDEEIVPFRAMQLRNLLCD  157



>ref|XP_010049808.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Eucalyptus grandis]
 gb|KCW82612.1| hypothetical protein EUGRSUZ_C04003 [Eucalyptus grandis]
Length=671

 Score = 48.1 bits (113),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -1

Query  389  LVGREEEIVWNLGLYCMNSVYDHVVDCDQELVPFCTQQLSQLLCD  255
            LV R  EIVW LG Y    +YD  +  D+E+VPF   QL  LLCD
Sbjct  113  LVMRGVEIVWKLGFYWSTLMYDCFIGQDEEIVPFRAMQLRNLLCD  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513327796892