BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25933_g2_i5 len=1142 path=[8924:0-58 19450:59-69 19475:70-83
19489:84-85 19509:86-93 19517:94-107 19531:108-110 19534:111-112
19536:113-113 19634:114-120 6764:121-205 6849:206-230 17594:231-323
6542:324-326 2217:327-329 2220:330-331 2222:332-390 19889:391-405
19904:406-428 2319:429-521 2412:522-532 2423:533-588 19975:589-624
19993:625-631 2522:632-636 2527:637-693 2584:694-725 2616:726-727
5250:728-765 5288:766-776 5299:777-800 20051:801-809 4892:810-820
4903:821-855 20086:856-864 4947:865-907 4990:908-1002 5085:1003-1076
5159:1077-1077 5160:1078-1090 5173:1091-1141]

Length=1142
                                                                      Score     E

ref|XP_006365692.1|  PREDICTED: putative late blight resistance p...    173   9e-45   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...    170   6e-43   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...    168   3e-42   
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...    168   7e-42   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...    166   1e-41   
dbj|BAD18094.1|  NBS-LRR protein                                        157   1e-41   Ipomoea batatas [batate]
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...    165   3e-41   
ref|XP_009799380.1|  PREDICTED: putative late blight resistance p...    161   1e-40   
gb|ACE79413.1|  NBS-coding resistance gene analog                       155   1e-40   Nicotiana tabacum [American tobacco]
gb|ACE79429.1|  NBS-coding resistance gene analog                       154   4e-40   Nicotiana tabacum [American tobacco]
ref|XP_004250409.1|  PREDICTED: putative late blight resistance p...    161   6e-40   
ref|XP_006365693.1|  PREDICTED: putative late blight resistance p...    162   8e-40   
gb|ACE79448.1|  NBS-coding resistance gene analog                       153   9e-40   Nicotiana tabacum [American tobacco]
gb|ACF22012.1|  NBS-coding resistance gene protein                      153   1e-39   Nicotiana tabacum [American tobacco]
gb|AFB17983.1|  Rx-like protein                                         154   2e-39   
gb|AEW48216.1|  disease resistance protein RX3                          160   2e-39   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...    159   4e-39   
gb|ACE79449.1|  NBS-coding resistance gene analog                       151   6e-39   Nicotiana tabacum [American tobacco]
gb|AEW48218.1|  disease resistance protein RX6                          159   6e-39   
gb|ACE79422.1|  NBS-coding resistance gene analog                       150   8e-39   Nicotiana tabacum [American tobacco]
gb|ACE79434.1|  NBS-coding resistance gene analog                       150   9e-39   Nicotiana tabacum [American tobacco]
gb|AEW48205.1|  disease resistance protein RGH2                         157   1e-38   
gb|AEW48197.1|  disease resistance protein RGH3                         157   2e-38   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...    157   2e-38   
gb|ABY61745.1|  resistance protein PSH-RGH6                             157   2e-38   Solanum tuberosum [potatoes]
gb|ACE79412.1|  NBS-coding resistance gene analog                       149   2e-38   Nicotiana tabacum [American tobacco]
gb|ACE79442.1|  NBS-coding resistance gene analog                       149   2e-38   Nicotiana tabacum [American tobacco]
gb|ACE79425.1|  NBS-coding resistance gene analog                       149   2e-38   Nicotiana tabacum [American tobacco]
ref|XP_009796570.1|  PREDICTED: putative late blight resistance p...    154   4e-38   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...    156   4e-38   
emb|CDP10671.1|  unnamed protein product                                155   6e-38   
gb|ACE79438.1|  NBS-coding resistance gene analog                       148   6e-38   Nicotiana tabacum [American tobacco]
gb|AEW48210.1|  disease resistance protein RGH5                         155   6e-38   
gb|ACF22011.1|  NBS-coding resistance gene protein                      148   7e-38   Nicotiana tabacum [American tobacco]
gb|ACF22014.1|  NBS-coding resistance gene protein                      148   8e-38   Nicotiana tabacum [American tobacco]
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...    155   8e-38   
gb|ACE79441.1|  NBS-coding resistance gene analog                       148   9e-38   Nicotiana tabacum [American tobacco]
gb|ACE79451.1|  NBS-coding resistance gene analog                       147   1e-37   Nicotiana tabacum [American tobacco]
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...    155   1e-37   
gb|AEW48204.1|  disease resistance protein RGH1                         154   2e-37   
gb|AFB17980.1|  Rx-like protein                                         149   2e-37   
gb|AEW48202.1|  disease resistance protein RGH4                         154   2e-37   
gb|AFB17979.1|  Rx-like protein                                         149   2e-37   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...    154   2e-37   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...    154   2e-37   
gb|AEW48217.1|  disease resistance protein RX5                          154   2e-37   
gb|AEW48211.1|  disease resistance protein RGH1                         153   3e-37   
gb|AEW48195.1|  disease resistance protein RGH6                         154   3e-37   
gb|AEW48194.1|  disease resistance protein RGH5                         154   3e-37   
gb|AFB17976.1|  Rx-like protein                                         148   3e-37   
gb|AEW48191.1|  disease resistance protein RGH2                         154   3e-37   
gb|AEW48214.1|  disease resistance protein RGH4                         154   3e-37   
ref|XP_009626593.1|  PREDICTED: putative late blight resistance p...    154   3e-37   
emb|CAB50786.1|  Rx protein                                             154   3e-37   Solanum tuberosum [potatoes]
gb|AEW48193.1|  disease resistance protein RGH4                         154   3e-37   
gb|AEW48201.1|  disease resistance protein RGH9                         153   4e-37   
ref|XP_006350137.1|  PREDICTED: putative late blight resistance p...    154   4e-37   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...    154   4e-37   
ref|XP_010312507.1|  PREDICTED: putative late blight resistance p...    153   4e-37   
ref|XP_009608888.1|  PREDICTED: putative late blight resistance p...    150   4e-37   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    152   6e-37   
gb|AEW48212.1|  disease resistance protein RGH1                         152   7e-37   
gb|ACF22008.1|  NBS-coding resistance gene protein                      145   8e-37   Nicotiana tabacum [American tobacco]
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...    152   8e-37   
ref|XP_006350138.1|  PREDICTED: putative late blight resistance p...    152   8e-37   
gb|ACE79424.1|  NBS-coding resistance gene analog                       145   8e-37   Nicotiana tabacum [American tobacco]
gb|AEW48215.1|  disease resistance protein RGH7                         152   9e-37   
ref|XP_009759016.1|  PREDICTED: putative late blight resistance p...    152   1e-36   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...    152   1e-36   
gb|AEW48198.1|  disease resistance protein RGH4                         152   1e-36   
gb|AEW48189.1|  disease resistance protein RGH9                         152   2e-36   
gb|AEW48196.1|  disease resistance protein RGH7                         152   2e-36   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...    152   2e-36   
emb|CAB56299.1|  NBS-LRR protein                                        152   2e-36   Solanum acaule
gb|AEW48209.1|  disease resistance protein RGH5                         151   2e-36   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2               151   2e-36   Solanum tuberosum [potatoes]
gb|AFB17978.1|  Rx-like protein                                         146   2e-36   
gb|AEW48190.1|  disease resistance protein RX4                          151   2e-36   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501    152   3e-36   
gb|AEW48192.1|  disease resistance protein RGH3                         151   3e-36   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...    150   4e-36   
gb|AFB17982.1|  Rx-like protein                                         144   4e-36   
gb|ABY61746.1|  resistance protein PSH-RGH7                             150   4e-36   Solanum tuberosum [potatoes]
gb|AEW48206.1|  disease resistance protein RGH4                         150   5e-36   
gb|AEW48208.1|  disease resistance protein RGH4                         150   5e-36   
gb|ACE79507.1|  NBS-coding resistance gene analog                       143   8e-36   Nicotiana sylvestris
gb|AAF76163.1|AF266747_1  RGC1                                          149   9e-36   Solanum tuberosum [potatoes]
ref|XP_006352021.1|  PREDICTED: putative late blight resistance p...    149   1e-35   
gb|AEW48188.1|  disease resistance protein RGH7                         149   2e-35   
gb|AEW48187.1|  disease resistance protein RGH5                         149   2e-35   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...    148   2e-35   
gb|AEW48207.1|  disease resistance protein RGH5                         148   3e-35   
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...    148   3e-35   
ref|XP_009606269.1|  PREDICTED: putative late blight resistance p...    142   4e-35   
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...    147   5e-35   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...    147   5e-35   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...    147   6e-35   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...    147   7e-35   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...    147   7e-35   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...    147   7e-35   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg                147   7e-35   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...    147   7e-35   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...    147   7e-35   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...    147   7e-35   
gb|AEQ61804.1|  NBS-LRR class disease resistance protein                137   8e-35   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...    146   1e-34   
ref|XP_006345616.1|  PREDICTED: putative late blight resistance p...    144   1e-34   
gb|ABV90190.1|  NBS-LRR type disease resistance protein                 137   1e-34   Ipomoea batatas [batate]
ref|XP_009777085.1|  PREDICTED: putative late blight resistance p...    144   1e-34   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...    146   1e-34   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...    145   1e-34   
gb|AEQ61805.1|  NBS-LRR class disease resistance protein                136   1e-34   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...    145   1e-34   
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...    145   2e-34   
gb|AEW48199.1|  disease resistance protein RGH6                         145   2e-34   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...    145   2e-34   
gb|EYU24351.1|  hypothetical protein MIMGU_mgv1a025953mg                143   2e-34   
ref|XP_004251533.1|  PREDICTED: putative late blight resistance p...    145   2e-34   
ref|XP_010323848.1|  PREDICTED: putative late blight resistance p...    144   2e-34   
gb|EYU21177.1|  hypothetical protein MIMGU_mgv1a018978mg                145   2e-34   
gb|EYU25639.1|  hypothetical protein MIMGU_mgv1a022176mg                142   2e-34   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...    145   3e-34   
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg                145   3e-34   
ref|XP_009603187.1|  PREDICTED: putative late blight resistance p...    143   3e-34   
ref|XP_009589053.1|  PREDICTED: putative late blight resistance p...    143   3e-34   
gb|AEW48186.1|  disease resistance protein RGH2                         144   4e-34   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...    144   4e-34   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...    144   5e-34   
ref|XP_009615718.1|  PREDICTED: putative late blight resistance p...    141   5e-34   
gb|ACE79493.1|  NBS-coding resistance gene analog                       137   6e-34   Nicotiana tabacum [American tobacco]
gb|ACE79487.1|  NBS-coding resistance gene analog                       137   6e-34   Nicotiana tabacum [American tobacco]
ref|XP_006366309.1|  PREDICTED: putative late blight resistance p...    142   6e-34   
gb|ACE79491.1|  NBS-coding resistance gene analog                       137   7e-34   Nicotiana tabacum [American tobacco]
gb|ACE79488.1|  NBS-coding resistance gene analog                       137   7e-34   Nicotiana tabacum [American tobacco]
gb|ACE79492.1|  NBS-coding resistance gene analog                       137   7e-34   Nicotiana tabacum [American tobacco]
gb|ACE79489.1|  NBS-coding resistance gene analog                       137   7e-34   Nicotiana tabacum [American tobacco]
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...    144   7e-34   
gb|ACE79495.1|  NBS-coding resistance gene analog                       136   7e-34   Nicotiana sylvestris
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...    144   9e-34   
gb|EYU23607.1|  hypothetical protein MIMGU_mgv1a019784mg                143   9e-34   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...    143   9e-34   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...    144   9e-34   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...    143   9e-34   
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...    143   1e-33   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg                143   1e-33   
ref|XP_006356854.1|  PREDICTED: disease resistance protein RPP13-...    143   1e-33   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...    143   1e-33   
gb|ACE79502.1|  NBS-coding resistance gene analog                       137   1e-33   Nicotiana tabacum [American tobacco]
gb|ACE79501.1|  NBS-coding resistance gene analog                       137   1e-33   Nicotiana tabacum [American tobacco]
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...    143   1e-33   
gb|ACE79506.1|  NBS-coding resistance gene analog                       137   1e-33   Nicotiana tabacum [American tobacco]
gb|ACE79503.1|  NBS-coding resistance gene analog                       137   1e-33   Nicotiana tabacum [American tobacco]
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...    143   1e-33   
gb|ACE79490.1|  NBS-coding resistance gene analog                       136   1e-33   Nicotiana tabacum [American tobacco]
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg                143   1e-33   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...    143   2e-33   
gb|ACE79505.1|  NBS-coding resistance gene analog                       137   2e-33   Nicotiana tabacum [American tobacco]
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg                142   2e-33   
gb|ACE79504.1|  NBS-coding resistance gene analog                       136   2e-33   Nicotiana tabacum [American tobacco]
gb|AAV88068.1|  NBS-LRR protein                                         142   2e-33   Ipomoea batatas [batate]
gb|AGX27506.1|  NBS-LRR class resistance protein Fy12-Ry1               140   3e-33   
gb|AGW28126.1|  NBS-LRR class resistance protein Fy12-Ry12              139   3e-33   
gb|AEW48200.1|  disease resistance protein RGH7                         142   3e-33   
gb|EYU29922.1|  hypothetical protein MIMGU_mgv1a0259201mg               141   3e-33   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg                140   3e-33   
ref|XP_006367915.1|  PREDICTED: putative disease resistance RPP13...    138   3e-33   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...    142   3e-33   
ref|XP_009768089.1|  PREDICTED: putative late blight resistance p...    142   4e-33   
gb|AAZ07910.1|  NBS-LRR protein                                         131   4e-33   Ipomoea batatas [batate]
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...    142   4e-33   
gb|AAM47597.1|AF513548_1  NBS/LRR resistance protein-like protein       132   5e-33   Capsicum annuum
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg                141   5e-33   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...    141   5e-33   
gb|AGX27505.1|  NBS-LRR class resistance protein Fy12-Ry1               139   6e-33   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...    141   6e-33   
ref|XP_006366837.1|  PREDICTED: putative late blight resistance p...    139   8e-33   
ref|XP_009780398.1|  PREDICTED: putative late blight resistance p...    132   1e-32   
gb|AEQ63709.1|  NBS-LRR class resistance protein                        130   1e-32   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...    140   1e-32   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...    140   1e-32   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...    140   2e-32   
gb|AEQ61809.1|  NBS-LRR class disease resistance protein                130   2e-32   
ref|XP_009769771.1|  PREDICTED: late blight resistance protein R1...    139   2e-32   
gb|AEQ61819.1|  NBS-LRR class disease resistance protein                130   2e-32   
ref|XP_011087309.1|  PREDICTED: putative disease resistance prote...    137   2e-32   
ref|XP_009617048.1|  PREDICTED: putative late blight resistance p...    139   2e-32   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg                139   2e-32   
gb|AEQ63710.1|  NBS-LRR class resistance protein                        130   2e-32   
gb|AEQ61808.1|  NBS-LRR class disease resistance protein                130   3e-32   
gb|AEQ61810.1|  NBS-LRR class disease resistance protein                130   3e-32   
gb|ACU82871.1|  nucleotide binding site-leucine rich repeat protein     130   3e-32   Solanum lycopersicum
gb|AEQ61817.1|  NBS-LRR class disease resistance protein                130   3e-32   
gb|ACO25629.1|  NBS-coding resistance protein                           130   3e-32   Nicotiana repanda
ref|XP_009773240.1|  PREDICTED: putative late blight resistance p...    137   3e-32   
ref|XP_010327575.1|  PREDICTED: putative late blight resistance p...    138   3e-32   
gb|AEQ61820.1|  NBS-LRR class disease resistance protein                129   4e-32   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...    139   4e-32   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...    139   4e-32   
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...    139   5e-32   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...    139   5e-32   
ref|XP_009763644.1|  PREDICTED: putative late blight resistance p...    134   5e-32   
gb|AEQ61815.1|  NBS-LRR class disease resistance protein                129   5e-32   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...    138   5e-32   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...    138   6e-32   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...    138   6e-32   
ref|XP_006367920.1|  PREDICTED: putative late blight resistance p...    135   6e-32   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...    138   6e-32   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...    138   6e-32   
gb|EYU23518.1|  hypothetical protein MIMGU_mgv1a019595mg                138   6e-32   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...    138   7e-32   
gb|AEQ61811.1|  NBS-LRR class disease resistance protein                129   7e-32   
ref|XP_011083930.1|  PREDICTED: putative late blight resistance p...    137   8e-32   
ref|XP_009777473.1|  PREDICTED: putative late blight resistance p...    138   8e-32   
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...    135   9e-32   
ref|XP_009794810.1|  PREDICTED: putative late blight resistance p...    133   9e-32   
gb|ACU82904.1|  nucleotide binding site-leucine rich repeat protein     128   9e-32   Solanum lycopersicum
gb|ACU82877.1|  nucleotide binding site-leucine rich repeat protein     128   1e-31   Solanum lycopersicum
gb|ACE79443.1|  NBS-coding resistance gene analog                       131   1e-31   Nicotiana tabacum [American tobacco]
gb|EYU23534.1|  hypothetical protein MIMGU_mgv1a023257mg                137   1e-31   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...    136   1e-31   
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...    137   1e-31   
ref|XP_009761982.1|  PREDICTED: putative late blight resistance p...    136   1e-31   
gb|AEQ61816.1|  NBS-LRR class disease resistance protein                128   1e-31   
gb|ACE79400.1|  NBS-coding resistance gene analog                       130   1e-31   Nicotiana tabacum [American tobacco]
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...    137   1e-31   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...    136   2e-31   
gb|AGW28125.1|  NBS-LRR class resistance protein Fy8-Ry8                136   2e-31   
emb|CDP00736.1|  unnamed protein product                                137   2e-31   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...    137   2e-31   
gb|ACE79436.1|  NBS-coding resistance gene analog                       130   2e-31   Nicotiana tabacum [American tobacco]
gb|EYU29928.1|  hypothetical protein MIMGU_mgv1a001694mg                136   2e-31   
ref|XP_011090484.1|  PREDICTED: putative late blight resistance p...    136   2e-31   
ref|XP_009761661.1|  PREDICTED: late blight resistance protein R1...    136   2e-31   
ref|XP_009598609.1|  PREDICTED: putative late blight resistance p...    134   3e-31   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2                136   3e-31   Capsicum chacoense
gb|AGW23829.1|  NBS-LRR class resistance protein Fy8-Ry8                135   4e-31   
gb|EYU25697.1|  hypothetical protein MIMGU_mgv1a026211mg                133   4e-31   
emb|CDP00688.1|  unnamed protein product                                134   4e-31   
gb|ACE79452.1|  NBS-coding resistance gene analog                       130   4e-31   Nicotiana tabacum [American tobacco]
gb|EPS64025.1|  hypothetical protein M569_10756                         129   4e-31   
gb|ACO25631.1|  NBS-coding resistance protein                           127   4e-31   Nicotiana repanda
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg                135   4e-31   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...    136   5e-31   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...    135   5e-31   
gb|ACE79419.1|  NBS-coding resistance gene analog                       129   5e-31   Nicotiana tabacum [American tobacco]
gb|ADA59479.1|  NBS-coding resistance protein-like protein RGA7         126   5e-31   Solanum aculeatissimum [Dutch eggplant]
ref|XP_011097122.1|  PREDICTED: late blight resistance protein R1...    134   6e-31   
gb|AEQ61813.1|  NBS-LRR class disease resistance protein                126   7e-31   
ref|XP_009592156.1|  PREDICTED: late blight resistance protein R1...    135   7e-31   
gb|AET22504.1|  hypothetical protein                                    135   7e-31   
gb|AEQ61807.1|  NBS-LRR class disease resistance protein                126   8e-31   
gb|EYU23522.1|  hypothetical protein MIMGU_mgv1a018893mg                134   8e-31   
ref|XP_009612837.1|  PREDICTED: putative late blight resistance p...    135   8e-31   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...    134   8e-31   
ref|XP_006365681.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
gb|ACU82878.1|  nucleotide binding site-leucine rich repeat protein     125   1e-30   Solanum lycopersicum
gb|EYU23504.1|  hypothetical protein MIMGU_mgv1a021434mg                134   1e-30   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg                134   1e-30   
ref|XP_009777373.1|  PREDICTED: putative late blight resistance p...    135   1e-30   
ref|XP_009777371.1|  PREDICTED: putative late blight resistance p...    135   1e-30   
gb|ACO25628.1|  NBS-coding resistance protein                           125   1e-30   Nicotiana repanda
gb|ACU82889.1|  nucleotide binding site-leucine rich repeat protein     125   1e-30   Solanum lycopersicum
ref|XP_009769811.1|  PREDICTED: putative late blight resistance p...    124   1e-30   
gb|ACF22031.1|  NBS-coding resistance gene protein                      128   1e-30   Nicotiana tabacum [American tobacco]
ref|XP_009765788.1|  PREDICTED: putative late blight resistance p...    130   1e-30   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
gb|ABV90191.1|  NBS-LRR type disease resistance protein                 125   1e-30   Ipomoea batatas [batate]
ref|XP_009777372.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
ref|XP_009787864.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...    135   1e-30   
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg                134   1e-30   
ref|XP_011072135.1|  PREDICTED: putative late blight resistance p...    131   1e-30   
gb|ADH03607.1|  nucleotide binding site and leucine rich repeat p...    126   2e-30   
gb|ACE79423.1|  NBS-coding resistance gene analog                       129   2e-30   
gb|EYU23531.1|  hypothetical protein MIMGU_mgv1a025687mg                133   2e-30   
gb|EYU24428.1|  hypothetical protein MIMGU_mgv1a001134mg                134   2e-30   
gb|ACF22033.1|  NBS-coding resistance gene protein                      128   2e-30   
emb|CDP00690.1|  unnamed protein product                                132   2e-30   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...    134   2e-30   
gb|ACF22032.1|  NBS-coding resistance gene protein                      128   2e-30   
gb|ACE79455.1|  NBS-coding resistance gene analog                       129   2e-30   
emb|CDP15579.1|  unnamed protein product                                134   2e-30   
gb|ACF22034.1|  NBS-coding resistance gene protein                      127   3e-30   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg                132   3e-30   
gb|ACE79453.1|  NBS-coding resistance gene analog                       128   3e-30   
gb|ACE79440.1|  NBS-coding resistance gene analog                       127   3e-30   
gb|AEO14737.1|  NBS-LRR class disease resistance protein                124   4e-30   
ref|XP_009592131.1|  PREDICTED: putative late blight resistance p...    133   4e-30   
gb|ACE79456.1|  NBS-coding resistance gene analog                       128   4e-30   
ref|XP_006357610.1|  PREDICTED: putative late blight resistance p...    133   4e-30   
ref|XP_011088084.1|  PREDICTED: putative late blight resistance p...    131   4e-30   
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...    132   4e-30   
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg                132   4e-30   
gb|ACE79426.1|  NBS-coding resistance gene analog                       127   5e-30   
emb|CDP12547.1|  unnamed protein product                                133   5e-30   
gb|ACE79435.1|  NBS-coding resistance gene analog                       128   5e-30   
gb|AGX27504.1|  NBS-LRR class resistance protein Fy8-Ry8                129   5e-30   
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...    132   5e-30   
ref|XP_009617727.1|  PREDICTED: putative late blight resistance p...    129   5e-30   
gb|ACE79427.1|  NBS-coding resistance gene analog                       127   5e-30   
ref|XP_009625970.1|  PREDICTED: putative late blight resistance p...    123   5e-30   
ref|XP_011093989.1|  PREDICTED: putative late blight resistance p...    131   6e-30   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg                132   6e-30   
gb|ACF21990.1|  NBS-coding resistance gene protein                      126   6e-30   
gb|ACF21987.1|  NBS-coding resistance gene protein                      126   6e-30   
ref|XP_009765789.1|  PREDICTED: putative late blight resistance p...    131   6e-30   
gb|ACE79431.1|  NBS-coding resistance gene analog                       126   6e-30   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...    132   7e-30   
ref|XP_009780986.1|  PREDICTED: late blight resistance protein R1...    131   9e-30   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
ref|XP_010661449.1|  PREDICTED: putative disease resistance RPP13...    126   1e-29   
ref|XP_009780985.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
ref|XP_011073066.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
emb|CDP20176.1|  unnamed protein product                                131   1e-29   
ref|NP_001289831.1|  putative late blight resistance protein homo...    132   1e-29   
ref|XP_009589795.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
ref|XP_004248007.2|  PREDICTED: putative late blight resistance p...    132   1e-29   
ref|XP_006356564.1|  PREDICTED: putative late blight resistance p...    130   1e-29   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...    131   1e-29   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg                131   1e-29   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg                131   1e-29   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...    130   1e-29   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg                131   1e-29   
ref|XP_010319291.1|  PREDICTED: disease resistance protein RPP13-...    131   1e-29   
gb|EYU31287.1|  hypothetical protein MIMGU_mgv1a022746mg                128   2e-29   
gb|ABS29403.1|  NBS-LRR type disease resistance protein                 122   2e-29   
gb|ACO25625.1|  NBS-coding resistance protein                           122   2e-29   
gb|ACE79511.1|  NBS-coding resistance gene analog                       124   2e-29   
gb|AFN86170.1|  reistance protein F variant 1.1                         131   2e-29   
gb|ACF21988.1|  NBS-coding resistance gene protein                      125   2e-29   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...    130   2e-29   
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...    130   2e-29   
ref|XP_010326937.1|  PREDICTED: putative late blight resistance p...    131   2e-29   
ref|XP_009604649.1|  PREDICTED: putative late blight resistance p...    130   2e-29   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg                130   2e-29   
gb|EYU21170.1|  hypothetical protein MIMGU_mgv1a025737mg                130   2e-29   
ref|XP_009604667.1|  PREDICTED: putative late blight resistance p...    129   3e-29   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...    130   3e-29   
gb|ACE79421.1|  NBS-coding resistance gene analog                       125   3e-29   
emb|CDP20204.1|  unnamed protein product                                130   3e-29   
ref|XP_011072134.1|  PREDICTED: putative late blight resistance p...    130   3e-29   
ref|XP_011072647.1|  PREDICTED: putative late blight resistance p...    128   3e-29   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...    130   3e-29   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg                130   3e-29   
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg                130   3e-29   
gb|AFN86171.1|  reistance protein F variant 1.2                         130   3e-29   
gb|AAG31015.1|  tospovirus resistance protein C                         130   3e-29   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...    129   3e-29   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...    130   4e-29   
ref|XP_010319247.1|  PREDICTED: putative late blight resistance p...    130   4e-29   
ref|XP_009613904.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    130   4e-29   
emb|CDP20153.1|  unnamed protein product                                130   4e-29   
gb|ACE79510.1|  NBS-coding resistance gene analog                       124   4e-29   
gb|ACF22030.1|  NBS-coding resistance gene protein                      124   4e-29   
emb|CDP11823.1|  unnamed protein product                                127   4e-29   
gb|ACE79509.1|  NBS-coding resistance gene analog                       124   4e-29   
gb|ACE79508.1|  NBS-coding resistance gene analog                       124   4e-29   
gb|ACE79417.1|  NBS-coding resistance gene analog                       125   4e-29   
gb|ACE79512.1|  NBS-coding resistance gene analog                       123   4e-29   
gb|ACE79461.1|  NBS-coding resistance gene analog                       125   5e-29   
gb|ACE79513.1|  NBS-coding resistance gene analog                       123   5e-29   
gb|ACF22006.1|  NBS-coding resistance gene protein                      121   5e-29   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg                129   5e-29   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg                129   5e-29   
ref|XP_009765786.1|  PREDICTED: putative late blight resistance p...    129   5e-29   
gb|EYU28611.1|  hypothetical protein MIMGU_mgv1a025283mg                129   6e-29   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...    129   6e-29   
ref|XP_009793286.1|  PREDICTED: putative late blight resistance p...    126   6e-29   
ref|XP_002273976.1|  PREDICTED: disease resistance protein RPP13        129   7e-29   
gb|AAG31017.1|  tospovirus resistance protein E                         129   7e-29   
gb|ACE79459.1|  NBS-coding resistance gene analog                       124   7e-29   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...    129   8e-29   
gb|ACE79454.1|  NBS-coding resistance gene analog                       124   8e-29   
ref|XP_011073039.1|  PREDICTED: putative late blight resistance p...    129   8e-29   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...    129   9e-29   
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg                129   9e-29   
ref|XP_011072144.1|  PREDICTED: putative late blight resistance p...    129   9e-29   
ref|XP_009787580.1|  PREDICTED: putative late blight resistance p...    128   9e-29   
ref|XP_009787579.1|  PREDICTED: putative late blight resistance p...    128   9e-29   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...    129   9e-29   
emb|CDP15598.1|  unnamed protein product                                128   9e-29   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...    129   1e-28   
gb|ACE79428.1|  NBS-coding resistance gene analog                       124   1e-28   
gb|ACE79439.1|  NBS-coding resistance gene analog                       124   1e-28   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg                128   1e-28   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...    128   1e-28   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...    128   1e-28   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg                128   1e-28   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...    128   1e-28   
gb|EYU24168.1|  hypothetical protein MIMGU_mgv1a022184mg                128   1e-28   
emb|CDP05594.1|  unnamed protein product                                129   1e-28   
ref|XP_009794857.1|  PREDICTED: disease resistance protein RPP13-...    125   1e-28   
gb|ACE79399.1|  NBS-coding resistance gene analog                       122   1e-28   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg                128   2e-28   
gb|AAG31016.1|  tospovirus resistance protein D                         129   2e-28   
ref|XP_009779957.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...    128   2e-28   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg                127   2e-28   
ref|XP_009783244.1|  PREDICTED: late blight resistance protein R1...    129   2e-28   
gb|ACE79446.1|  NBS-coding resistance gene analog                       123   2e-28   
ref|XP_010319327.1|  PREDICTED: disease resistance protein RPP13-...    125   2e-28   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...    128   2e-28   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...    129   2e-28   
gb|ABR37216.1|  NBS-LRR type disease resistance protein                 119   2e-28   
ref|XP_009783246.1|  PREDICTED: late blight resistance protein R1...    128   2e-28   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...    127   2e-28   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...    127   2e-28   
sp|Q6L3Z7.1|R1B14_SOLDE  RecName: Full=Putative late blight resis...    128   2e-28   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...    127   2e-28   
sp|Q6L403.1|R1B17_SOLDE  RecName: Full=Putative late blight resis...    128   2e-28   
ref|XP_008811538.1|  PREDICTED: putative disease resistance RPP13...    127   2e-28   
gb|AEQ61798.1|  NBS-LRR class disease resistance protein                119   2e-28   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...    127   3e-28   
emb|CDP05557.1|  unnamed protein product                                124   3e-28   
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg                127   3e-28   
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...    127   3e-28   
gb|AEQ61803.1|  NBS-LRR class disease resistance protein                119   3e-28   
ref|XP_009773969.1|  PREDICTED: putative late blight resistance p...    125   4e-28   
gb|ABH10959.1|  putative NBS-LRR disease resistance protein RIT-2       118   4e-28   
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...    127   4e-28   
ref|XP_010320780.1|  PREDICTED: putative late blight resistance p...    126   5e-28   
ref|XP_011072139.1|  PREDICTED: putative late blight resistance p...    126   5e-28   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...    126   5e-28   
ref|XP_009588708.1|  PREDICTED: putative late blight resistance p...    127   5e-28   
ref|XP_009608247.1|  PREDICTED: putative late blight resistance p...    124   5e-28   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...    126   5e-28   
ref|XP_004238960.1|  PREDICTED: putative late blight resistance p...    125   5e-28   
gb|EYU21842.1|  hypothetical protein MIMGU_mgv1a020462mg                126   5e-28   
ref|XP_009588709.1|  PREDICTED: putative late blight resistance p...    127   5e-28   
ref|XP_006362537.1|  PREDICTED: putative late blight resistance p...    126   5e-28   
emb|CDP20685.1|  unnamed protein product                                127   5e-28   
ref|XP_011071867.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    126   6e-28   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...    126   6e-28   
emb|CAN81877.1|  hypothetical protein VITISV_034529                     122   6e-28   
ref|XP_009613202.1|  PREDICTED: putative late blight resistance p...    125   6e-28   
ref|XP_009588710.1|  PREDICTED: putative late blight resistance p...    126   6e-28   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...    126   7e-28   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...    126   7e-28   
ref|XP_009600432.1|  PREDICTED: putative late blight resistance p...    125   7e-28   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...    126   7e-28   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...    126   8e-28   
gb|EYU24178.1|  hypothetical protein MIMGU_mgv1a024402mg                125   8e-28   
ref|XP_011072142.1|  PREDICTED: putative late blight resistance p...    125   9e-28   
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...    126   9e-28   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...    125   1e-27   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363    126   1e-27   
emb|CDP00692.1|  unnamed protein product                                126   1e-27   
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...    126   1e-27   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...    125   1e-27   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg                125   1e-27   
gb|ADL59408.1|  SNKR2GH7 protein                                        125   1e-27   
gb|ADL59407.1|  SNKR2GH6 protein                                        125   1e-27   
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg                125   1e-27   
gb|ADL59406.1|  SNKR2GH5 protein                                        125   1e-27   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...    125   1e-27   
ref|XP_008779382.1|  PREDICTED: putative disease resistance RPP13...    125   1e-27   
gb|EYU24175.1|  hypothetical protein MIMGU_mgv1a026011mg                125   1e-27   
ref|XP_007225260.1|  hypothetical protein PRUPE_ppa001560mg             125   1e-27   
ref|XP_010319324.1|  PREDICTED: disease resistance protein RPP13-...    125   1e-27   
ref|XP_006356562.1|  PREDICTED: putative late blight resistance p...    120   1e-27   
ref|XP_008778490.1|  PREDICTED: probable disease resistance RPP8-...    125   1e-27   
emb|CDP16902.1|  unnamed protein product                                125   1e-27   
ref|XP_009623262.1|  PREDICTED: putative late blight resistance p...    125   1e-27   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
ref|XP_011072146.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
ref|XP_006359360.1|  PREDICTED: disease resistance protein RPP13-...    125   2e-27   
ref|XP_009758685.1|  PREDICTED: late blight resistance protein R1...    125   2e-27   
gb|ABR37220.1|  NBS-LRR type disease resistance protein                 117   2e-27   
ref|XP_010319547.1|  PREDICTED: disease resistance protein RPP13-...    122   2e-27   
ref|XP_011072133.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg                124   2e-27   
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
gb|ABO93136.1|  NBS-LRR type disease resistance protein                 117   2e-27   
ref|XP_009760595.1|  PREDICTED: late blight resistance protein R1...    125   2e-27   
ref|XP_009773945.1|  PREDICTED: putative disease resistance RPP13...    125   2e-27   
gb|EYU29512.1|  hypothetical protein MIMGU_mgv1a022452mg                124   2e-27   
ref|XP_009760600.1|  PREDICTED: late blight resistance protein R1...    125   2e-27   
ref|XP_010913221.1|  PREDICTED: disease resistance protein RPP13-...    124   2e-27   
ref|XP_009791056.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
ref|XP_006356561.1|  PREDICTED: putative late blight resistance p...    124   2e-27   
ref|XP_010914752.1|  PREDICTED: putative disease resistance RPP13...    124   2e-27   
ref|XP_009760599.1|  PREDICTED: late blight resistance protein R1...    125   2e-27   
ref|XP_010319326.1|  PREDICTED: disease resistance protein RPP13-...    124   2e-27   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...    124   2e-27   
ref|XP_009791054.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
gb|EYU24159.1|  hypothetical protein MIMGU_mgv1a020220mg                124   2e-27   
ref|XP_008810409.1|  PREDICTED: disease resistance RPP8-like prot...    124   3e-27   



>ref|XP_006365692.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=592

 Score =   173 bits (438),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 163/297 (55%), Gaps = 30/297 (10%)
 Frame = -1

Query  887  QKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKG  708
            Q M S++QNL  +Q  L+ +         +K +E  IRDV + AE RI+  L +I LA  
Sbjct  30   QHMESIYQNLSAMQVFLEDTTKETKDVETLKVIEKRIRDVIYKAEDRIDSSLRSIILADR  89

Query  707  SLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGS  528
                  AC+   +E +++ E+Q  +           N+ L  +       +        S
Sbjct  90   EDKRQKACI-SFYEELLKVEQQVYFL----------NKELMLIEFNNHGSKSAELATMSS  138

Query  527  SLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGG  348
            SL                 S  +++ +VG +  F  ILD+L  Q  TK   V+ I GMGG
Sbjct  139  SLEK---------------STIEENTIVGMEDDFNTILDRLTAQ--TKKLTVIPIFGMGG  181

Query  347  IGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-GQDQLAES  171
            IGKTTLA+KVY++  I S FDK AW+TVS++Y+  QML  ++S +T ++++   D+L E 
Sbjct  182  IGKTTLARKVYDNSYIRSRFDKHAWVTVSEKYNERQMLLEVVSSITGSNQEMSNDRLMEI  241

Query  170  VRKCLKSQRYLIVIDDIWNTTAWDSVQRCFP-DDNNGSCILLTSRLKKVGEYASSGN  3
            V + LK +R+LIVIDDIW+T AWD +QR FP DDNN S ILLT+RLK V +Y S  +
Sbjct  242  VYRGLKGRRFLIVIDDIWSTKAWDQMQRIFPNDDNNKSRILLTTRLKYVADYVSCPD  298



>ref|XP_004250464.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=848

 Score =   170 bits (430),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 165/300 (55%), Gaps = 44/300 (15%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + SL QNL  LQD L  + +  D+ G +K +E  IR+V + AE R+++ L +I LA 
Sbjct  30   QQHLESLCQNLSALQDFLDNT-MTKDI-GTLKVIEKRIRNVVYKAEDRVDLSLRSIILAD  87

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQ------QLAKAASSQNQTLTDVSllgrirqrg  549
                   AC    +E +++ E+Q  + +      +  K  S   +  T+ S         
Sbjct  88   HEDKRQKACR-SFYEELLKVEEQVYFLKKEVMMVEFNKHGSKSAELATNPS---------  137

Query  548  lqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVV  369
                                  +   SKF+++ +VG +  F  ILD L TQ  T    V+
Sbjct  138  ----------------------TLEKSKFEEN-IVGMEDDFNTILDSLTTQ--TDELIVI  172

Query  368  SIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-G  192
             I+GMGGIGKTTLA+KV+    I S FDK AW+T+S+EY+  QML  ++S VT + ++  
Sbjct  173  PILGMGGIGKTTLARKVFGDSYIRSRFDKHAWVTISKEYNQRQMLLEVVSSVTGSKQEMS  232

Query  191  QDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
             DQL E   K LK +R+LIVIDDIW+T AWD +QR FP+D+N S ILLT+RLK + +Y S
Sbjct  233  DDQLMEIAYKGLKGRRFLIVIDDIWSTKAWDQIQRIFPNDDNKSRILLTTRLKNIADYVS  292



>ref|XP_006365682.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=835

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 162/297 (55%), Gaps = 31/297 (10%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            ++ + SL QNL  LQD L  +   +   G +K +E  IR+V + AE R++  L +I LA 
Sbjct  30   QEHLESLCQNLSALQDFLDNTTTKD--IGTLKVIEKRIRNVVYKAEDRVDSSLRSIILAD  87

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                   AC    +E +++ E+Q  +           N+ +  V       +        
Sbjct  88   HEDKRQKACR-SFYEELLKVEQQVYFL----------NKEVMLVKFNKHGIKSAESATNP  136

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL                 SK +++ +VG +  F  ILD++ +Q  T    V+ I GMG
Sbjct  137  SSLE---------------KSKIEENTIVGMEDDFNIILDRVTSQ--TDELTVIPIFGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-GQDQLAE  174
            GIGKTTLA+KV+    I S FDK AW+T+S+EY+  QML  ++S +T + ++   DQL E
Sbjct  180  GIGKTTLARKVFGDSYIRSRFDKHAWVTISEEYNERQMLLEVVSSITGSKQETSDDQLME  239

Query  173  SVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
             V K LK +R+LIVIDDIW+T AWD +QR FP+D+N S ILLT+RLK V +Y S  +
Sbjct  240  IVYKGLKGRRFLIVIDDIWSTKAWDQMQRIFPNDDNKSRILLTTRLKYVADYVSCPD  296



>ref|XP_006367243.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=1322

 Score =   168 bits (426),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 164/297 (55%), Gaps = 31/297 (10%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + SL+QNL  LQD L  +   +     +K +E  IR+V + AE RI+  L +I +A 
Sbjct  30   QQHVESLYQNLSALQDFLDDTTTKD--IETLKVIEKRIRNVVYKAEDRIDSSLRSIIVAD  87

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                   AC    +E +++ E+Q  +  +        N                     G
Sbjct  88   HEDKRQKACT-SFYEELLKVEQQVYFLNKEVMLIEFNNH--------------------G  126

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            S    L     I S+  K  S  +++ +VG +  F  ILD++ TQ  T    V+ I GMG
Sbjct  127  SKSAELAR---ISSSLEK--STIEENTIVGMEDDFNIILDRVTTQ--TDELTVIPIFGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-GQDQLAE  174
            GIGKTTLA+KVY+   I S FDK+AW+T+SQEY+  QML  L+S +T + ++   D+L E
Sbjct  180  GIGKTTLARKVYDDSYIRSRFDKQAWVTISQEYNERQMLLELVSSITGSKKETSDDELME  239

Query  173  SVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
             V + LK +++LIVIDDIW+T AWD +QR FP+D+N S ILLT+RLK V +Y +  +
Sbjct  240  IVYRGLKGRKFLIVIDDIWSTKAWDQMQRTFPNDDNRSRILLTTRLKYVADYVNCPD  296



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 110/155 (71%), Gaps = 7/155 (5%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            ++ +VG D   EK++++LL   +   R+VV+I GMGGIGKTTLA+K Y++P + S FD  
Sbjct  146  ENNVVGLDDDLEKVIERLLGYSSE--REVVAITGMGGIGKTTLAKKAYDYPRVRSRFDVH  203

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIWN  114
            AW+TVS+EY + ++L  L+ C+   + D      +DQLAES+ + LK +RYLIVIDDIW+
Sbjct  204  AWVTVSREYGMRRLLLSLVRCIPGMTTDKLVEKTEDQLAESLYRKLKDRRYLIVIDDIWS  263

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            T  WD V RCFPDD+NGS I+LTSRLK V  YA+ 
Sbjct  264  TKVWDDVTRCFPDDDNGSRIILTSRLKDVAAYANP  298



>dbj|BAD18094.1| NBS-LRR protein [Ipomoea batatas]
Length=255

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 107/184 (58%), Gaps = 37/184 (20%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVGCD  FE I  +L++   +K  +V+SIVGMGGIGKTTL Q+VYE+ SI SHFD RAW 
Sbjct  28   MVGCDDEFETIGHKLISH--SKKLEVISIVGMGGIGKTTLVQRVYENTSIVSHFDVRAWT  85

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDG----------------------------------  192
            TVSQEY++E+ML  LL C+   S  G                                  
Sbjct  86   TVSQEYNLEEMLLDLLGCIGKRSSVGVGSTIEGDTSNDDPPAIDPTDLPAININERAIVS  145

Query  191  QDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFP-DDNNGSCILLTSRLKKVGEYA  15
             D  A  +RK L  +RYLIVIDDIW+T AWD +  CFP +D  GS ILLT+RLK+V  YA
Sbjct  146  NDPPATRLRKALMGERYLIVIDDIWSTKAWDDIHTCFPKEDFIGSRILLTTRLKQVANYA  205

Query  14   SSGN  3
            S  N
Sbjct  206  SVSN  209



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 114/166 (69%), Gaps = 9/166 (5%)
 Frame = -1

Query  491  SNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYE  312
            S  S NA+  +D  +VG D   EK++++LL   +   R+VV+I GMGGIGKTTLA+K Y+
Sbjct  133  SKPSFNANLEND--VVGLDDDLEKVIERLLGYSSE--REVVAITGMGGIGKTTLAKKAYD  188

Query  311  HPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQ  147
            +P + S FD  AW+TVS+EY + ++L  L  C+   + D      +DQLAES+ + LK +
Sbjct  189  YPRVRSRFDVHAWVTVSREYGMRRLLLSLARCIPGMTADKLVEKTEDQLAESLYRKLKDR  248

Query  146  RYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            RYLIVIDDIW+T  WD V RCFPDD+NGS I+LTSRLK V  YA+ 
Sbjct  249  RYLIVIDDIWSTKVWDDVTRCFPDDDNGSRIILTSRLKDVAAYANP  294



>ref|XP_009799380.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=546

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 111/162 (69%), Gaps = 6/162 (4%)
 Frame = -1

Query  482  SKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPS  303
            S + S F  + +VG D   EKI+++LL   ++  R+V++I GMGGIGKTTLA+K Y+H  
Sbjct  4    SPSRSSFKTNAVVGLDDDLEKIIERLLG--SSSEREVIAITGMGGIGKTTLAKKAYDHLQ  61

Query  302  ITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQLAESVRKCLKSQRYLI  135
            + S FD  AW+TVS+EY + ++L  L+ C+   +       +D+LAE + + LK +RYLI
Sbjct  62   VRSRFDIHAWVTVSREYEMRRLLLSLVCCIPGMADKFLEKTEDELAELLYRKLKDRRYLI  121

Query  134  VIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            V+DDIW+T  WD+V RCFPDDNNGS I+LTS LK V  YA+ 
Sbjct  122  VVDDIWSTKVWDNVTRCFPDDNNGSQIILTSMLKDVAAYANP  163



>gb|ACE79413.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 105/155 (68%), Gaps = 7/155 (5%)
 Frame = -1

Query  455  SRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            S+M+G +  FE + DQL   +  +  +VVS+VGMGGIGKTTLA K+Y  P I SHFD RA
Sbjct  32   SKMIGLENEFEMMQDQL--SRGARELEVVSVVGMGGIGKTTLANKLYSDPFIMSHFDIRA  89

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----DQLAESVRKCLKSQRYLIVIDDIWNT  111
              TVSQEY    +L  LLS ++  + + Q     DQLA+ ++K LK  RYL+VIDDIW  
Sbjct  90   KATVSQEYCARNVLLRLLSSISGKTNEFQEQQEDDQLADRLQKLLKCGRYLVVIDDIWTR  149

Query  110  TAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
             AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  150  EAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|ACE79429.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22013.1| NBS-coding resistance gene protein [Nicotiana tabacum]
 gb|ACF22015.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P I SHFD R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----DQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++  + + Q     DQLA+ ++K LK  RYL+VIDD W 
Sbjct  89   AKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRYLVVIDDTWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>ref|XP_004250409.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=843

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 162/307 (53%), Gaps = 60/307 (20%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + SL +NL  LQD L  +    D+   +K +E  IRDV + AE +++  L +I LA 
Sbjct  30   QQHVESLQKNLSALQDFLDDT--TKDIE-TLKLIEKRIRDVIYKAEDKVDSTLRSIILAD  86

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
             +     AC L   E+V+  EK  D                                   
Sbjct  87   CTESREGACKLFEEELVL-VEKDVDS----------------------------------  111

Query  530  SSLHHLVHKKIIVSNFSKNASKFD-------------DSRMVGCDKMFEKILDQLLTQQT  390
                  + K+++   F+K+ ++++             ++ ++G D  F  ILD+L TQ  
Sbjct  112  ------LRKEVMQMEFNKHGTRYETTPSSPQKSSIDEENTIIGMDDEFNTILDRLTTQ--  163

Query  389  TKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT  210
            T    V+ I GMGGIGKTTLA+KVY+   I S FDK AW+T+S++++  QML  + S +T
Sbjct  164  TNELTVIPIFGMGGIGKTTLAKKVYDDSYIRSRFDKHAWVTISEDFNQRQMLLEVASSIT  223

Query  209  AASRD-GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLK  33
             ++++   DQL E V K LK +R+LIVIDDIW+T AWD +QR FP+D N S ILLT+RLK
Sbjct  224  GSNQEKSDDQLMEIVYKGLKGRRFLIVIDDIWSTEAWDQMQRIFPNDKNKSRILLTTRLK  283

Query  32   KVGEYAS  12
             V +  S
Sbjct  284  YVADNVS  290



>ref|XP_006365693.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=1113

 Score =   162 bits (409),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 160/297 (54%), Gaps = 32/297 (11%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + SL+QNL  LQD L  +    D+   +K +E  IR+V +  E R++  L  I  A 
Sbjct  30   QQHLESLNQNLSALQDFLDDT--TKDIE-TLKVVEKRIRNVVYKVEDRVDSSLRNILRAD  86

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                   AC    +E +++ E+Q  +  +        N                     G
Sbjct  87   REDKRQKACT-SFYEELLKVEQQVYFLNKEVMLVEFNNH--------------------G  125

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            S    L       ++ S   S  +++ +VG +  F  ILD+L  Q  T    V+ I GMG
Sbjct  126  SKSAELAR-----TSSSPEKSTIEENTVVGMEDDFNTILDRLTAQ--TDELIVIPIFGMG  178

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-GQDQLAE  174
            G+GKTTLA+K Y+  SI S FDK AW+T+S+EY+  +ML  ++S +T ++++   DQL E
Sbjct  179  GLGKTTLARKAYDDSSIRSRFDKHAWVTISEEYNAREMLLEVVSSITGSNQERSNDQLME  238

Query  173  SVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
             V + LK +R+LIVIDDIW+T AW+ +QR FP+D+N S ILLT+RLK V +Y S  +
Sbjct  239  IVYRGLKGRRFLIVIDDIWSTEAWEQMQRIFPNDDNKSRILLTTRLKYVADYFSCPD  295



>gb|ACE79448.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P I SHFD R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----DQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++  + + Q     DQLA+ ++K LK  RYL+VIDD W 
Sbjct  89   AKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRYLVVIDDTWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E AS+G
Sbjct  149  REAWDDIKRCFPDCNNGSRILMTTRNVEVAECASTG  184



>gb|ACF22012.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P + SHFD R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFVMSHFDIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----DQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++  + + Q     DQLA+ ++K LK  RYL+VIDD W 
Sbjct  89   AKATVSQEYCAGNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRYLVVIDDTWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|AFB17983.1| Rx-like protein, partial [Solanum chacoense]
Length=350

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = -1

Query  488  NFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEH  309
            +  ++A +  ++ MVG +  FE +LDQL   +  +  +VVSIVGMGGIGKTTLA K+Y  
Sbjct  6    SLPEHAVEQPENTMVGRENEFEMMLDQL--ARGGRELEVVSIVGMGGIGKTTLATKLYSD  63

Query  308  PSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVI  129
            P I S FD RA  TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VI
Sbjct  64   PYIMSRFDIRAKATVSQEYCVRNVLLGLLSL---TSDEPDDQLADRLQKHLKGRRYLVVI  120

Query  128  DDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            DDIW+T AWD ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  121  DDIWSTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYASSG  161



>gb|AEW48216.1| disease resistance protein RX3 [Solanum leptophyes x Solanum 
sparsipilum]
Length=937

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 159/291 (55%), Gaps = 33/291 (11%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ L  L+ IL+KS  I  D  G +  LE EI +V +  E  ++ E   ++ A+    
Sbjct  26   PFYEKLESLRAILEKSCNIMGDHEGLII-LEVEIVEVAYTTEDMVDSESRNVFFAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +Y     K   + + ++ D+              + SSL 
Sbjct  85   RSRA----MWEIFFVLEQALEYIDSTVKQWMAASDSMKDLKP------------QTSSLV  128

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGK  339
             L           ++A +  ++ MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGK
Sbjct  129  SL----------PEHAVEQPENIMVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGK  176

Query  338  TTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKC  159
            TTLA K+Y  P I S FD RA  TVSQEY V  +L  LLS +   S +  DQLA+ ++K 
Sbjct  177  TTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLALLSSI---SDEPDDQLADRLQKH  233

Query  158  LKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            LK +RYL+VIDDIW T AWD ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  234  LKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSG  284



>ref|XP_006365680.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X1 [Solanum tuberosum]
Length=881

 Score =   159 bits (402),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 116/298 (39%), Positives = 157/298 (53%), Gaps = 33/298 (11%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + SL+Q L  LQ  L  +    D+   +K LE  IR++ + AE R++  L  I LA 
Sbjct  30   QQHIESLYQKLSALQVFLDNT--TKDIE-TVKVLEKRIRNIVYKAEDRVDSCLRKIILAD  86

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                   AC              T +YQ+L K           V  L +   +      G
Sbjct  87   REDKRQKAC--------------TSFYQELLKVEEQ-------VYFLNKEVMQIEFNNHG  125

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            S    L     I S+  K  S  +++ +VG +  F  ILD++  Q  T    V+ I GMG
Sbjct  126  SKSAELAR---ISSSLEK--STIEENTVVGMEDDFNTILDRVTAQ--TDELTVIPIFGMG  178

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--GQDQLA  177
            GIGKTTLA+K Y+   I S FDK AW+T+SQ+Y+  QML  + S +T  S      DQL 
Sbjct  179  GIGKTTLARKAYDDSYIQSRFDKHAWVTISQKYNERQMLLEVASSITTGSNKYMSDDQLM  238

Query  176  ESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            E V + LK +R+LIVIDDIW+T AWD ++R FP+DNN S ILLT+RLK V  YASS +
Sbjct  239  EFVYRGLKGRRFLIVIDDIWSTEAWDQMKRIFPNDNNKSRILLTTRLKCVAGYASSPD  296



>gb|ACE79449.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P I SHFD R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++  + +     G DQLA+ ++K LK  RYL+VIDD+W 
Sbjct  89   AKATVSQEYCARNVLLGLLSSISGKTNEFHEQQGDDQLADQLQKLLKCGRYLVVIDDLWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AW+ +++CFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWNVIRQCFPDCNNGSRILMTTRNVEVVECASSG  184



>gb|AEW48218.1| disease resistance protein RX6 [Solanum hondelmannii]
Length=937

 Score =   159 bits (402),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 103/150 (69%), Gaps = 9/150 (6%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            MVGC+  FE +LDQL       GR+  VVSIVGMGGIGKTTLA K+Y  P I S FD RA
Sbjct  142  MVGCENEFEMMLDQL----ARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRA  197

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
              TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T AWD 
Sbjct  198  KATVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  255  IKLCFPDCYNGSRILLTTRNVEVAEYASSG  284



>gb|ACE79422.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  K  +VVSIVGMGGIGKTTLA K+Y  P I SHF  R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGAKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++    +       DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|ACE79434.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  K  +VVSIVGMGGIGKTTLA K+Y  P I SHF  R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGAKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++    +       DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score =   157 bits (398),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 162/293 (55%), Gaps = 37/293 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKSEIGNDVAGAMKDL---EAEIRDVWFNAEGRIEMELTTIYLAKGS  705
              ++ L  L+ IL+KS    ++ G  ++L   E EI +V +  E  +++E  +++LA+  
Sbjct  26   PFYEKLKSLRAILEKS---CNITGDHEELTILEVEIVEVAYTTEDMVDLESRSVFLAQNL  82

Query  704  LLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSS  525
                 A    + EI    E+  +      K   + + ++ D+             ++ SS
Sbjct  83   EERSRA----MWEIFFVLEQALECIDSTVKQWMATSYSMKDLK------------LQTSS  126

Query  524  LHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGI  345
            L           +F ++A +  ++ MVG +  FE +LDQL+  +  +  +VVSIVGMGGI
Sbjct  127  L----------VSFPEHAYEQPENIMVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGI  174

Query  344  GKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVR  165
            GKTTLA K+Y  P I S FD RA  TVSQEY V  +L  LLS +   S +  DQLA+ ++
Sbjct  175  GKTTLAAKLYSDPCIMSRFDIRAKATVSQEYCVRNVLHGLLSSI---SDEPDDQLADRLQ  231

Query  164  KCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            K LK +RYL+VIDDIW T  WD ++ CFPD  NGS I LT+R  +V EYASSG
Sbjct  232  KHLKGRRYLVVIDDIWTTEGWDDIKLCFPDCYNGSRIFLTTRNVEVAEYASSG  284



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD R  +
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRTKV  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  ++  LLS +   S +  DQLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVILGLLSSI---SNEPDDQLADRLQKNLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
            +CFPD NNGS ILLT+R  +V EYASSG
Sbjct  257  QCFPDCNNGSRILLTTRNVEVAEYASSG  284



>ref|XP_009773958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009773959.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=884

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 165/315 (52%), Gaps = 51/315 (16%)
 Frame = -1

Query  908  REVGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELT  729
            R + E ++ + SL+  L +LQD L+ +    +   A+K LE +IRD  + AE  I+    
Sbjct  22   RLISESRESIDSLYGTLSILQDFLEDTGNWINDQDALKLLEKKIRDAGYKAEDTID----  77

Query  728  TIYLAKGSLLHITACLLRLHEIVIEAEKQT---DYYQQLAKAASSQNQTLTDVSllgrir  558
                          CL R+H    + E+      +Y +L +   + +    DV       
Sbjct  78   -------------CCLRRIHVADTDHEQNNARRKFYDELQEIIEAMDSIQGDV-------  117

Query  557  qrglqLVKGSSLHHLVHKKIIVSNFSKNASKF----DDSRMVGCDKMFEKILDQLLTQQT  390
                  +K  ++H  + K +  + +    S      +++ +VG + +F  I DQL  Q  
Sbjct  118  ------MKFKNVHKRI-KDVPATTYLPPRSPGRVLDEENTLVGMEDVFNNIRDQLFGQ--  168

Query  389  TKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT  210
            T    VVSIVGMGGIGK+TLA+ ++ HPS++  FD  +W+TVSQ Y+ ++ML   L  ++
Sbjct  169  TPALNVVSIVGMGGIGKSTLARSLFNHPSVSRRFDISSWVTVSQAYNAKEML---LDVLS  225

Query  209  AASRDG--------QDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCI  54
                DG        +D+L + VR+ LK +RYLIV+D+IW   AWD V+R FPDD NGS I
Sbjct  226  FGILDGKAMYRNTSEDELLDQVRRKLKRKRYLIVLDNIWTIEAWDEVRRSFPDDENGSRI  285

Query  53   LLTSRLKKVGEYASS  9
            ++T+RL +V   AS+
Sbjct  286  MITTRLLEVANCASN  300



>gb|ABY61745.1| resistance protein PSH-RGH6 [Solanum tuberosum]
Length=873

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 159/291 (55%), Gaps = 33/291 (11%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ +  L+ IL+KS  I  D  G +  LE EI +V +  E  ++ E   ++LA+    
Sbjct  26   PFYEKIESLRAILEKSCNIMGDHEG-LTILEVEIAEVAYTTEDMVDSESRNVFLAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +      K   + + ++ D+              + SSL 
Sbjct  85   RSRA----MWEIFFVLEQALECIDSTVKQWMATSDSMKDLKP------------QTSSLV  128

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGK  339
             L           ++A +  ++ MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGK
Sbjct  129  SL----------PEHAFEQPENIMVGYENEFEMMLDQLV--RGGRELEVVSIVGMGGIGK  176

Query  338  TTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKC  159
            TTLA K+Y  P I   FD RA  TVSQEY V  +L+ LLS +   S +  DQLA+ ++K 
Sbjct  177  TTLATKLYSDPCIMPRFDIRAKATVSQEYCVRNVLQGLLSSI---SDEPDDQLADRLQKH  233

Query  158  LKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            LK +RYL+VIDDIW T  WD ++ CFPD NNGS ILLT+R  +V EYASSG
Sbjct  234  LKGRRYLVVIDDIWTTETWDDIKLCFPDCNNGSRILLTTRNVEVAEYASSG  284



>gb|ACE79412.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++            DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|ACE79442.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22007.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++            DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|ACE79425.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 107/166 (64%), Gaps = 8/166 (5%)
 Frame = -1

Query  488  NFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEH  309
            N S++  + +D +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  
Sbjct  22   NTSRHGLEPED-KMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSD  78

Query  308  PSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQR  144
            P + SHF  RA  TVSQEY    +L  LLS ++            DQLA+ ++K LK  R
Sbjct  79   PFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGR  138

Query  143  YLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            YL+VIDDIW   AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  139  YLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>ref|XP_009796570.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=557

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 158/294 (54%), Gaps = 33/294 (11%)
 Frame = -1

Query  872  LHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLLHI  693
             ++ L  L+ I++KS   N     +  LEA+I ++   AE ++++E   I+L +      
Sbjct  194  FYEKLESLRAIMEKS--CNVTGNVLTSLEAQIAELADEAEYKVDLESRNIFLPENEKKQR  251

Query  692  TACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLHHL  513
             A  + L+ +V E   + D    + K  + QN                    K  ++  L
Sbjct  252  RA-FVNLYSLVKEVVGRID--STMKKWMAIQN--------------------KLKNIQDL  288

Query  512  VHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTT  333
              + + + + S++  + +D +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTT
Sbjct  289  KAQDLSLVSTSRHGLEPED-KMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTT  345

Query  332  LAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESV  168
            LA K+Y  P + SHF  RA  TVSQEY    +L  LLS ++            DQLA+ +
Sbjct  346  LANKIYSDPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQL  405

Query  167  RKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            +K LK  RYL+VIDDIW   AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  406  QKLLKCGRYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  459



>ref|XP_010312513.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312514.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312515.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312516.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=881

 Score =   156 bits (395),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 109/296 (37%), Positives = 159/296 (54%), Gaps = 33/296 (11%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + +L+QNL  LQD L  +   +     +K +E  IRDV + AE +++  L +I LA 
Sbjct  30   QQHVENLNQNLSALQDFLDDTTTKD--IETLKVVEKRIRDVVYKAEDKVDSSLRSIILAD  87

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
             +     A      E +++ EK  D          S  + +T V                
Sbjct  88   STESREGAAKF-FEEELVKVEKDVD----------SLRKEVTVVEFNK------------  124

Query  530  SSLHHLVHKKIIVSNFSKN-ASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
               H     ++  + FS +  S   ++ +VG    F  ILD+L  Q  T    V+ I+GM
Sbjct  125  ---HGTKSAELATTPFSPDQKSTIVENTVVGMKDDFNIILDRLTAQ--TDELIVIPILGM  179

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT--AASRDGQDQL  180
            GGIGKTTLA+KVY+   I S FDK AW+T+SQEY+  QML  ++S +T   +     D+L
Sbjct  180  GGIGKTTLARKVYDDSCIRSRFDKLAWVTISQEYNERQMLLEVVSSITTKGSQEMSNDEL  239

Query  179  AESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
             E V + LK +R+LIVIDDIW+T AW+ +QR FP+D+N S ILLT+RLK V +Y +
Sbjct  240  MEIVYRGLKGRRFLIVIDDIWSTEAWNQMQRIFPNDDNKSRILLTTRLKYVADYVN  295



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score =   155 bits (392),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 162/299 (54%), Gaps = 39/299 (13%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            K+++ SLH  + LL+  L++SE   D  G+MK LE EIRDV++ A   I+ +L  +Y AK
Sbjct  28   KEQVESLHDKVNLLRGFLEESEKRYD-RGSMKHLELEIRDVFYKARKVIDSKLLNVYAAK  86

Query  710  GSLLHITA------CLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrg  549
             +     A       L +L E V    K+ +   Q  K A+S +                
Sbjct  87   SAKSWKKARRILRRSLRKLTEKVDFILKKLNKISQKRKNAASAD----------------  130

Query  548  lqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVV  369
                       L   + ++   S+    + ++ +VG +   + + D+L   Q+    + +
Sbjct  131  -----------LQAGEPVLGGLSRRV--YMENHVVGLNNDLQIVKDRL--TQSPLRLETI  175

Query  368  SIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ  189
             IVGMGG+GKTTLA+++YE PSI  HF  R W+TVSQ++ +  +L+ L         +  
Sbjct  176  PIVGMGGVGKTTLARRLYEDPSIVLHFHVRLWVTVSQDFQIRILLQDLCQLGNDNEMNNA  235

Query  188  DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
            D LAE + K LK +RYLIV+DDIW T AWD+V+  FPDDNNGS I+LTSRLK+V  +A+
Sbjct  236  D-LAEHLYKSLKGRRYLIVLDDIWCTEAWDAVKSIFPDDNNGSRIILTSRLKEVAVHAN  293



>gb|ACE79438.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P + SHF  R
Sbjct  31   EDKMVGLEDEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++            DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|AEW48210.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=904

 Score =   155 bits (393),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 113/291 (39%), Positives = 156/291 (54%), Gaps = 33/291 (11%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ L  L+ IL+KS  I  D  G +  LE EI +V +  E  ++ E   ++LA+    
Sbjct  26   PFYEKLKSLRAILEKSCNIMGDHEG-LTILEVEIIEVAYTTEDMVDSESRNVFLAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +      K   + + ++ D+                SS  
Sbjct  85   RSRA----MWEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLV--------SSPE  132

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGK  339
            H V +               ++ MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGK
Sbjct  133  HAVEQP--------------ENIMVGRENEFEVMLDQLV--RGGRELEVVSIVGMGGIGK  176

Query  338  TTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKC  159
            TTLA K+Y  P I S FD RA  TVSQEY V  +L+ LLS +   S +  DQLA+ ++K 
Sbjct  177  TTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSSI---SDEPDDQLADRLQKH  233

Query  158  LKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            LK +RYL+VIDDIW T AWD ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  234  LKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYASSG  284



>gb|ACF22011.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTL  K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTTLTNKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++            DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIERCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|ACF22014.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTL  K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTTLVNKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++            DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score =   155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 10/175 (6%)
 Frame = -1

Query  506  KKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLA  327
            + +IV+N S++  +  ++ MVG +  FE + DQL    T    QV+SIVGMGGIGK+TLA
Sbjct  122  QNLIVANTSQHDFQ-SENMMVGHENAFEIMQDQLARGATE--LQVISIVGMGGIGKSTLA  178

Query  326  QKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDG-----QD--QLAESV  168
             K+Y  P I SHFD RA + VSQEY    +L  +LS ++ +   G     QD  QLA+ +
Sbjct  179  IKLYNDPFIMSHFDIRAKVIVSQEYCKRNVLLGILSSISGSGTIGEFYEQQDDGQLADRL  238

Query  167  RKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            +K LK +RYLIVIDDIW T AWD V+ CFPD N GS ILLT+R  KV EYASSGN
Sbjct  239  QKYLKGKRYLIVIDDIWTTIAWDDVKLCFPDCNCGSRILLTTRNMKVAEYASSGN  293



>gb|ACE79441.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGTR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +   LLS ++            DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVPLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|ACE79451.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGK TLA K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKITLANKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++            DQLA+ ++K LK  RYL+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRYLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/298 (37%), Positives = 172/298 (58%), Gaps = 30/298 (10%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            K+++++LH+ +  L+  L+ SE  N V+  M DLEA I++V    E  I++ LT   +A 
Sbjct  31   KEEILTLHEKVSSLEVFLKNSERSN-VSEEMTDLEARIKEVANAVEYTIQLRLTEAAMAN  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +  +TA     HE+        D  QQ+A+  S   +    +   G+   +    V+G
Sbjct  90   DEMQKVTA-----HEMF------CDSLQQVAEDISHLQKESMKIQHKGKQASKKSL-VRG  137

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SS      K ++  N  KN        MVG D   +++L+ L T++++   +V+ I+GMG
Sbjct  138  SS----SAKDVL--NVKKN--------MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMG  182

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LA  177
            GIGKTTLA++VY   SI SHFD RAW TVS  ++V+++L  LL      +   +D+  LA
Sbjct  183  GIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELA  242

Query  176  ESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            + ++K LKS+RYLIV+DD+W++ AWD V++CFP +NN S +LLT+R   V  YA + N
Sbjct  243  DMLQKSLKSRRYLIVMDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVACYAGTEN  300



>gb|AEW48204.1| disease resistance protein RGH1 [Solanum fernandezianum]
Length=897

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 113/291 (39%), Positives = 159/291 (55%), Gaps = 33/291 (11%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ L  L+ IL+KS  I  D  G +  LE EI +V +  E  ++ E   ++LA+    
Sbjct  26   PFYEKLESLRAILEKSFNIKGDHEG-LTILEVEIIEVAYTTEDMVDSESRNVFLAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +      K   + + ++ D+              + SSL 
Sbjct  85   RSRA----MWEIFFVLEQALECIGSTVKQWMATSDSMKDLKP------------QTSSLV  128

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGK  339
             L           ++A +  ++ MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGK
Sbjct  129  SL----------PEHAFEQPENIMVGHENEFEMMLDQLV--RGGRELEVVSIVGMGGIGK  176

Query  338  TTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKC  159
            TTLA K+Y  P I S FD RA  TVSQEY V  +L  LLS   + S +  DQLA+ ++K 
Sbjct  177  TTLAAKLYSDPCIMSRFDIRAKATVSQEYYVRNVLLALLS---STSDEPDDQLADRLQKH  233

Query  158  LKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            LK +RYL+VIDDIW T AWD ++ CFPD  NGS ILLT+R  ++ EYASSG
Sbjct  234  LKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVELAEYASSG  284



>gb|AFB17980.1| Rx-like protein, partial [Solanum marinasense]
Length=350

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = -1

Query  488  NFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEH  309
            +  ++A +  ++ MVG +  FE +LDQL   +  +  +VVSIVGMGGIGKTTLA K+Y  
Sbjct  6    SLPEHAFEQPENIMVGRENEFEMMLDQL--ARGGRELEVVSIVGMGGIGKTTLATKLYSD  63

Query  308  PSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVI  129
            P I S FD RA  TVSQEY V  ++  LL    + S +  DQLA+ ++K LK +RYL+VI
Sbjct  64   PYIMSRFDIRAKATVSQEYCVRNVILGLLP---SRSDESDDQLADRLQKHLKGRRYLVVI  120

Query  128  DDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            DDIW T AWD ++ CFPD   GS ILLT+R  +V EYASSG
Sbjct  121  DDIWTTEAWDDIKLCFPDCYKGSRILLTTRNVEVAEYASSG  161



>gb|AEW48202.1| disease resistance protein RGH4 [Solanum ehrenbergii]
 gb|AEW48203.1| disease resistance protein RGH7 [Solanum ehrenbergii]
Length=914

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA +
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKV  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  ++  LLS +   S + ++QLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVILGLLSSI---SDEPENQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCYNGSRILLTTRNVEVAEYASSG  284



>gb|AFB17979.1| Rx-like protein, partial [Solanum marinasense]
Length=350

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = -1

Query  488  NFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEH  309
            +  ++A +  ++ MVG +  FE +LDQL   +  +  +VVSIVGMGGIGKTTLA K+Y  
Sbjct  6    SLPEHAFEQPENIMVGRENEFEMMLDQL--ARGGRELEVVSIVGMGGIGKTTLATKLYSD  63

Query  308  PSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVI  129
            P I S FD RA  TVSQEY V  ++  LL    + S +  DQLA+ ++K LK +RYL+VI
Sbjct  64   PYIMSRFDIRAKATVSQEYCVRNVILGLLP---SRSDESDDQLADRLQKHLKGRRYLVVI  120

Query  128  DDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            DDIW T AWD ++ CFPD   GS ILLT+R  +V EYASSG
Sbjct  121  DDIWTTEAWDDIKLCFPDCYKGSRILLTTRNVEVAEYASSG  161



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 161/305 (53%), Gaps = 48/305 (16%)
 Frame = -1

Query  881  MVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSL  702
            +++LH N+  L   L+  E  ND +G M DLEA+I++V    E  I+M LT   +A   +
Sbjct  1    LLALHGNVSSLGIFLKNFEKSND-SGEMTDLEAQIKEVAEAVEHTIQMTLTEALVANDEM  59

Query  701  LHITA------CLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqL  540
                A      CL ++ E +    K+T   Q   K AS+++  L   +            
Sbjct  60   QKEKAHGRLGDCLKQVAEDIDRVRKETKKIQDKGKKASNESLVLDSSTKD----------  109

Query  539  VKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIV  360
                           + N   N        MVG D   +++L+ L T+  +   +V+ IV
Sbjct  110  ---------------IPNLKNN--------MVGRDDERKRLLENL-TRGFSGEPKVIPIV  145

Query  359  GMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-----  195
            GMGGIGKTTLA++V+   SI SHFD RAW T+S +Y+V+ +   LL   T  ++D     
Sbjct  146  GMGGIGKTTLAKEVFNDASIRSHFDVRAWATISSQYNVKDIYVSLL-LFTKETKDERVHM  204

Query  194  -GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
              +  LA+ ++K LK +RYLIV+DD+WN+ AWD V++CFP ++ GS ILLT+R  +V  Y
Sbjct  205  KDEAMLADMLQKSLKGKRYLIVMDDMWNSKAWDDVRQCFPSEDKGSRILLTTRNTEVACY  264

Query  17   ASSGN  3
            A +GN
Sbjct  265  AGTGN  269



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P I SHFD R
Sbjct  141  EDKMVGLENEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIR  198

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----DQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++  + + Q     DQLA+ ++K LK  RYL+VIDD W 
Sbjct  199  AKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRYLVVIDDTWT  258

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  259  REAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSG  294



>gb|AEW48217.1| disease resistance protein RX5 [Solanum stenotomum]
Length=936

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 9/150 (6%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            MVG +  FE +LDQL       GR+  +VSIVGMGGIGKTTLA K+Y  P I S FD RA
Sbjct  142  MVGRENEFEMMLDQL----ARGGRELEIVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRA  197

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
              TVSQEY V  +L+ LLS +   S +  DQLA+ ++K LK +RYL+VIDDIW T AWD 
Sbjct  198  KATVSQEYCVRNVLQGLLSSI---SDEPDDQLADRLQKRLKCRRYLVVIDDIWTTEAWDD  254

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++ CFPD  NGS ILLT+R+ +V  YASSG
Sbjct  255  IKLCFPDCYNGSRILLTTRIVEVAAYASSG  284



>gb|AEW48211.1| disease resistance protein RGH1 [Solanum hougasii]
Length=814

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  42   MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKA  99

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  100  TVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  156

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  157  LCFPDCINGSRILLTTRNVEVAEYASSG  184



>gb|AEW48195.1| disease resistance protein RGH6 [Solanum chacoense]
Length=912

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA +
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKV  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  ++  LLS +   S + ++QLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVILGLLSSI---SDEPENQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCINGSRILLTTRNVEVAEYASSG  284



>gb|AEW48194.1| disease resistance protein RGH5 [Solanum chacoense]
Length=914

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LD+L+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  142  MVGYENEFEMMLDKLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L+ LLS +   S +  DQLA  ++K LK  RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVLQGLLSSI---SDEPDDQLAARLQKHLKGGRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDRYNGSRILLTTRNVEVAEYASSG  284



>gb|AFB17976.1| Rx-like protein, partial [Solanum acaule]
Length=350

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  19   MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKA  76

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +  DQLA+ +++ LK +RYL+VIDDIW T AWD ++
Sbjct  77   TVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQEHLKGRRYLVVIDDIWTTKAWDGIK  133

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD   GS  LLT+R  +V EYASSG
Sbjct  134  LCFPDCYKGSRTLLTTRNVEVAEYASSG  161



>gb|AEW48191.1| disease resistance protein RGH2 [Solanum chacoense]
Length=914

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LD+L+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  142  MVGYENEFEMMLDKLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L+ LLS +   S +  DQLA  ++K LK  RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVLQGLLSSI---SDEPDDQLAARLQKHLKGGRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDRYNGSRILLTTRNVEVAEYASSG  284



>gb|AEW48214.1| disease resistance protein RGH4 [Solanum leptophyes x Solanum 
sparsipilum]
Length=878

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 160/293 (55%), Gaps = 37/293 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKSEIGNDVAGAMKDL---EAEIRDVWFNAEGRIEMELTTIYLAKGS  705
              H+ L  L+ IL+KS    ++ G  ++L   E EI +V +  E  I++E  +++L +  
Sbjct  26   PFHEKLESLRAILEKS---CNITGDHEELTILEVEIVEVAYTTEDMIDLESRSVFLVQIL  82

Query  704  LLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSS  525
                 A    + E+    E+  +      K   + + ++ D+              + SS
Sbjct  83   EERSRA----MWEVFFVLEQALECIDSTVKQWMATSDSMKDLKP------------QTSS  126

Query  524  LHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGI  345
            L  L           ++A +  ++ MVG +  FE +LDQL+  +  +  +VVSIVGMGGI
Sbjct  127  LVSL----------PEHAVEQPENIMVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGI  174

Query  344  GKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVR  165
            GK TLA K+Y  P I S FD RA  TVSQEY V  +L+ LLS +   S +  DQLA+ ++
Sbjct  175  GKATLAAKLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSSI---SDEPDDQLADRLQ  231

Query  164  KCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            K LK +RYL+VIDDIW T AWD ++ CFPD  NGS I LT+R  +V EYASSG
Sbjct  232  KHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRIFLTTRNVEVAEYASSG  284



>ref|XP_009626593.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=879

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 158/295 (54%), Gaps = 31/295 (11%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLLH  696
            S ++ L  L+ IL+K          +K LEAEI ++  N E  +E E   ++LAK ++  
Sbjct  26   SFYEKLESLRSILEKPLKTKGDLEVLKSLEAEIIELACNTEDMVESESRKVFLAKDAVTR  85

Query  695  ITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLHH  516
                   L  ++ +A    DY   + K  + QN                      ++   
Sbjct  86   KIDSW-ELFSLLKQAVGHIDYV--MNKWMAVQNMY--------------------TNSKD  122

Query  515  LVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKT  336
            L  + + +++ S+ A + +++ MVG +  FE + DQL   +     ++VSIVGMGGIGKT
Sbjct  123  LKAQNLSLADVSQPALELENT-MVGHETEFEMLQDQL--ARGGSELEIVSIVGMGGIGKT  179

Query  335  TLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--GQD---QLAES  171
            TLA K+Y HP I SHFD RA  TVS EY    +L  LL  ++  + +  GQ    QLA+ 
Sbjct  180  TLANKIYTHPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISVKTYEFYGQQDVGQLADR  239

Query  170  VRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++K LK  RYL+VIDDIW T AWD ++ CF D NNGS ILLT+R   V EYASSG
Sbjct  240  LQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYASSG  294



>emb|CAB50786.1| Rx protein [Solanum tuberosum]
Length=937

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 102/150 (68%), Gaps = 9/150 (6%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            MVG +  FE +LDQL       GR+  VVSIVGMGGIGKTTLA K+Y  P I S FD RA
Sbjct  142  MVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRA  197

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
              TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T AWD 
Sbjct  198  KATVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  255  IKLCFPDCYNGSRILLTTRNVEVAEYASSG  284



>gb|AEW48193.1| disease resistance protein RGH4 [Solanum chacoense]
Length=914

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA +
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKV  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  ++  LLS +   S + ++QLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVILGLLSSI---SDEPENQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCINGSRILLTTRNLEVAEYASSG  284



>gb|AEW48201.1| disease resistance protein RGH9 [Solanum x edinense]
Length=838

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  42   MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKA  99

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  100  TVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  156

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  157  LCFPDCINGSRILLTTRNVEVAEYASSG  184



>ref|XP_006350137.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score =   154 bits (388),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  F+ +LDQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P +   FD RA  
Sbjct  145  MVGYENEFKMMLDQL--ARGERELEVVSIVGMGGIGKTTLATKLYNDPCMMYRFDIRAKA  202

Query  269  TVSQEYSVEQMLRCLLSCVTAASRD--GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVSQEY V  +   LLSC++    D     QLA+ ++K LK +RYL+VIDDIW T AWD 
Sbjct  203  TVSQEYCVRNVFLDLLSCISDKPYDQLHDGQLADRLQKLLKGKRYLVVIDDIWTTKAWDD  262

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            +Q CFPD +NGS ILLT+R  +V EYASSG
Sbjct  263  IQICFPDFHNGSRILLTTRNVEVAEYASSG  292



>ref|XP_009626592.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=920

 Score =   154 bits (388),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 158/295 (54%), Gaps = 31/295 (11%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLLH  696
            S ++ L  L+ IL+K          +K LEAEI ++  N E  +E E   ++LAK ++  
Sbjct  26   SFYEKLESLRSILEKPLKTKGDLEVLKSLEAEIIELACNTEDMVESESRKVFLAKDAVTR  85

Query  695  ITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLHH  516
                   L  ++ +A    DY   + K  + QN                      ++   
Sbjct  86   KIDSW-ELFSLLKQAVGHIDYV--MNKWMAVQNMY--------------------TNSKD  122

Query  515  LVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKT  336
            L  + + +++ S+ A + +++ MVG +  FE + DQL   +     ++VSIVGMGGIGKT
Sbjct  123  LKAQNLSLADVSQPALELENT-MVGHETEFEMLQDQL--ARGGSELEIVSIVGMGGIGKT  179

Query  335  TLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--GQD---QLAES  171
            TLA K+Y HP I SHFD RA  TVS EY    +L  LL  ++  + +  GQ    QLA+ 
Sbjct  180  TLANKIYTHPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISVKTYEFYGQQDVGQLADR  239

Query  170  VRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++K LK  RYL+VIDDIW T AWD ++ CF D NNGS ILLT+R   V EYASSG
Sbjct  240  LQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYASSG  294



>ref|XP_010312507.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=874

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 113/308 (37%), Positives = 160/308 (52%), Gaps = 65/308 (21%)
 Frame = -1

Query  887  QKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKG  708
            Q + SL QNL  LQD+L  +    D+   +K  E  +R+V + AE R++  L  I LA  
Sbjct  30   QHVQSLCQNLSALQDLLDDT--TKDIE-TLKVTEKRMRNVIYKAEYRVDSSLRRIILADR  86

Query  707  SLLHITACLLRLHEIVIEAEKQ---TDYYQQLAKAASSQNQTLTDVSllgrirqrglqLV  537
                             E ++Q   T +Y++L K                         V
Sbjct  87   -----------------EDKRQKAYTSFYEELLK-------------------------V  104

Query  536  KGSSLHHLVHKKIIVSNFSKNASK-----------FDDSRMVGCDKMFEKILDQLLTQQT  390
            KG  ++ L+ K+++  N  K+ SK             ++ +VG    F  ILD++  Q  
Sbjct  105  KGQ-IYFLI-KEVMQINIKKHGSKSAAFSQDQKSTIVENTVVGMKDDFNTILDRVTAQ--  160

Query  389  TKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT  210
            T    V+ I GMGGIGKTTLA+KVY+   I S FDK AW+T+S+EY+  QML  ++S VT
Sbjct  161  TNELTVIPIFGMGGIGKTTLAKKVYDDSFICSRFDKLAWVTISEEYNERQMLLEVVSSVT  220

Query  209  AASRD--GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRL  36
                     D+L E V + LK +R+LIVIDDIW+T AWD +QR FP+D+N S ILLT+RL
Sbjct  221  TGGNQEKSDDELMEIVYRGLKGRRFLIVIDDIWSTEAWDQMQRIFPNDDNKSRILLTTRL  280

Query  35   KKVGEYAS  12
            K V +Y +
Sbjct  281  KYVADYVN  288



>ref|XP_009608888.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana tomentosiformis]
Length=538

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 154/303 (51%), Gaps = 40/303 (13%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + S +Q+L  LQ  L+++          K LE  IRDV +  E R++  L ++ +A 
Sbjct  31   QQHIESTYQSLSALQVFLEEATKEAKDIETRKSLEKRIRDVVYKVEYRVDSRLRSVIVAD  90

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                   AC    +E + E EK+ D          S  + +  +       +        
Sbjct  91   CGDDRERACKA-FNEELQEVEKEVD----------SLKKEVIQIEFNKHGSKSAELATTS  139

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SS      ++  +  ++          +VG +  F  ILD+L  Q  T    V+S+VGMG
Sbjct  140  SS-----SRRYAIEQYT----------VVGMEDDFINILDRLTAQ--THDLTVISVVGMG  182

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--------  195
            GIGKTTLA+K Y+  SI   FD  AW+TVS+ Y+  Q+L   L  + + SRD        
Sbjct  183  GIGKTTLARKAYDDSSIRYRFDTHAWVTVSENYNERQVL---LDVIISISRDRTDESYET  239

Query  194  -GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
               DQLAE V K LK +R+LI+IDD+W+T AWD +QR FP+DNN S ILLT+RL  V +Y
Sbjct  240  MSTDQLAEIVYKGLKGRRFLIIIDDLWSTEAWDQMQRLFPNDNNKSRILLTTRLNYVADY  299

Query  17   ASS  9
            AS 
Sbjct  300  ASP  302



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   152 bits (385),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 115/175 (66%), Gaps = 11/175 (6%)
 Frame = -1

Query  509  HKKIIVSN--FSKNASKF---DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGI  345
            H K + +N  FS ++SK     ++ MVG +   + +LD L   + ++  +VVSIVGMGGI
Sbjct  109  HVKALPANEGFSPDSSKLSSQPENVMVGHNNELDLMLDHL--TRGSRELKVVSIVGMGGI  166

Query  344  GKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQDQLA  177
            GKTT A ++Y  P I S FD R  +TVSQE+ V ++L  LL+ +T+  R+       QLA
Sbjct  167  GKTTFATRIYYDPVIVSRFDTRPMVTVSQEFYVRRLLLGLLNSITSIPREICNESDGQLA  226

Query  176  ESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
            + +RK LK +RYLI IDDIW+T AWD ++ CFPDD NGS ILLT+R  +V EYAS
Sbjct  227  DRLRKGLKGRRYLIFIDDIWSTEAWDDMKLCFPDDGNGSRILLTTRNTEVAEYAS  281



>gb|AEW48212.1| disease resistance protein RGH1 [Solanum leptophyes x Solanum 
sparsipilum]
 gb|AEW48213.1| disease resistance protein RGH2 [Solanum leptophyes x Solanum 
sparsipilum]
Length=905

 Score =   152 bits (385),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE   DQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P+I S FD RA  
Sbjct  142  MVGRENEFEMTRDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS   + S +  DQLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVLLALLS---STSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCYNGSRILLTTRNVEVAEYASSG  284



>gb|ACF22008.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++            DQLA+ ++K LK  R L+VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRSLVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score =   152 bits (385),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 161/300 (54%), Gaps = 40/300 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS--EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSL  702
            S ++ L  L+ IL+K    IG+D+   +K LEAEI ++  +AEG +E     ++LAK ++
Sbjct  26   SFYEKLESLRSILEKPLKVIGDDIE-VLKSLEAEIIELACSAEGMVESVSRKVFLAKDAV  84

Query  701  LHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSL  522
                              ++ D ++      S   Q +  +            +   S  
Sbjct  85   -----------------TRRIDSWELF----SLLKQAVGHIGFAMNKWMAVQNMYTNSK-  122

Query  521  HHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGR---QVVSIVGMG  351
              L  + + +++ S+ A + +++ MVG +  FE + DQL     T+G    +VVSIVGMG
Sbjct  123  -DLEAQNLSLADVSQPALELENT-MVGHETEFEMLQDQL-----TRGASELEVVSIVGMG  175

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ----  183
            GIGKTTLA K+Y  P I SHFD RA  TVS EY    +L  LL  ++  + +  DQ    
Sbjct  176  GIGKTTLANKIYSDPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISGKTYEFYDQQDVG  235

Query  182  -LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
             LA+ ++K LK  RYL+VIDDIW T AWD ++ CF D NNGS ILLT+R   V EYASSG
Sbjct  236  QLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYASSG  295



>ref|XP_006350138.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score =   152 bits (385),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 108/169 (64%), Gaps = 4/169 (2%)
 Frame = -1

Query  506  KKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLA  327
            +   +S   + A +  +  MVG +  F+ +LDQL   +  +   VVSIVGMGGIGKTTLA
Sbjct  126  QNFCLSKIPERAVERSEDIMVGYENEFKMMLDQL--ARGERELAVVSIVGMGGIGKTTLA  183

Query  326  QKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--GQDQLAESVRKCLK  153
             K+Y  P +   FD RA  TVSQEY V  +   LLSC++    D     QLA+ ++K LK
Sbjct  184  TKLYNDPCMMYRFDIRAKATVSQEYCVRNVFLDLLSCISDKPYDQLHDGQLADRLQKLLK  243

Query  152  SQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
             +RYL+VIDDIW T AWD +Q CFPD +NGS ILLT+R  +V EYASSG
Sbjct  244  GERYLVVIDDIWTTKAWDDIQICFPDFHNGSRILLTTRNVEVAEYASSG  292



>gb|ACE79424.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P + SHF  R
Sbjct  31   EDKMVGLENEFEMVQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++  S +       DQLA+ ++K LK  R  +VIDDIW 
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKSDEFHEHQDDDQLADQLQKLLKCGRSSVVIDDIWT  148

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  149  REAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  184



>gb|AEW48215.1| disease resistance protein RGH7 [Solanum leptophyes x Solanum 
sparsipilum]
Length=921

 Score =   152 bits (385),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 104/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  145  MVGYENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKA  202

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L+ LL    + S +  DQLA+ ++K LK++RYL+VIDDIW T AWD ++
Sbjct  203  TVSQEYCVRNVLQGLLP---SRSDESDDQLADRLQKHLKARRYLVVIDDIWTTEAWDDIK  259

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD   GS ILLT+R  +V EYASSG
Sbjct  260  LCFPDCYKGSRILLTTRNVEVAEYASSG  287



>ref|XP_009759016.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana sylvestris]
Length=883

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 161/300 (54%), Gaps = 40/300 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS--EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSL  702
            S ++ L  L+ IL+K    IG+D+   +K LEAEI ++  +AEG +E     ++LAK ++
Sbjct  26   SFYEKLESLRSILEKPLKVIGDDIE-VLKSLEAEIIELACSAEGMVESVSRKVFLAKDAV  84

Query  701  LHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSL  522
                              ++ D ++      S   Q +  +            +   S  
Sbjct  85   -----------------TRRIDSWELF----SLLKQAVGHIGFAMNKWMAVQNMYTNSK-  122

Query  521  HHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGR---QVVSIVGMG  351
              L  + + +++ S+ A + +++ MVG +  FE + DQL     T+G    +VVSIVGMG
Sbjct  123  -DLEAQNLSLADVSQPALELENT-MVGHETEFEMLQDQL-----TRGASELEVVSIVGMG  175

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ----  183
            GIGKTTLA K+Y  P I SHFD RA  TVS EY    +L  LL  ++  + +  DQ    
Sbjct  176  GIGKTTLANKIYSDPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISGKTYEFYDQQDVG  235

Query  182  -LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
             LA+ ++K LK  RYL+VIDDIW T AWD ++ CF D NNGS ILLT+R   V EYASSG
Sbjct  236  QLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYASSG  295



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 161/295 (55%), Gaps = 33/295 (11%)
 Frame = -1

Query  872  LHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLLH  696
             ++ L  L+ I++KS  +  D+  A+  LEA+I ++   AE ++++E   I+L +     
Sbjct  27   FYEKLESLRAIMEKSCNVTGDL-DALTSLEAQIVELADEAENKVDLESRNIFLPENEKKQ  85

Query  695  ITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLHH  516
              A  + L+ +V E   + D   +   A   + + + D+              K   L  
Sbjct  86   RRA-FVNLYSLVKEVVGRIDSTMKKWMAIQKKLKNIQDL--------------KAQDLS-  129

Query  515  LVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKT  336
                  +VS  S++  + +D +MVG +  FE + DQL   +  K  +VVSIVGMGGIGKT
Sbjct  130  ------LVST-SRHGIEPED-KMVGLENEFEMMQDQL--ARGAKELEVVSIVGMGGIGKT  179

Query  335  TLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----DQLAES  171
            TLA K+Y  P I SHF  RA  TVSQEY    +L  LLS ++    +       DQLA+ 
Sbjct  180  TLANKIYSDPFIMSHFGIRAKATVSQEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADR  239

Query  170  VRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++K LK  RYL+VIDDIW   AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  240  LQKLLKCGRYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSG  294



>gb|AEW48198.1| disease resistance protein RGH4 [Solanum x edinense]
Length=901

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 113/293 (39%), Positives = 157/293 (54%), Gaps = 37/293 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ L  L+ IL+KS  I  D  G +  LE EI +V +  E  ++ E  +++LA+    
Sbjct  26   PFYEKLKSLRAILEKSCNIMGDHEG-LTILEVEIVEVAYTTEDMVDSESRSVFLAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +Y     K   + + ++ D+              + SSL 
Sbjct  85   RSRA----MWEIFFVLEQALEYIDSTVKQWMAASDSMKDLKP------------QTSSLV  128

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGI  345
             L           ++A +  ++ MVG +  FE +LDQL       GR+  VVSIVGMGGI
Sbjct  129  SL----------PEHAVEQPENIMVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGI  174

Query  344  GKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVR  165
            GKTTLA K+Y  P I S FD RA  TVSQEY V  ++  LL  +   S +  DQLA+ ++
Sbjct  175  GKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSI---SDEPDDQLADRLQ  231

Query  164  KCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            K LK +RYL+VIDDIW T AWD ++ CFPD  NGS ILLT+R  +V E A SG
Sbjct  232  KHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAECARSG  284



>gb|AEW48189.1| disease resistance protein RGH9 [Solanum albicans]
Length=912

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA +
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKV  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  ++  LLS +   S + ++QL + ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVILGLLSSI---SDEPENQLEDRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCINGSRILLTTRNVEVAEYASSG  284



>gb|AEW48196.1| disease resistance protein RGH7 [Solanum chacoense]
Length=914

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE   DQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P+I S FD RA  
Sbjct  142  MVGRENEFEMTRDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS   + S +  DQLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVLLALLS---STSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS IL+T+R  +V EYASSG
Sbjct  257  LCFPDCINGSRILMTTRNVEVAEYASSG  284



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 167/303 (55%), Gaps = 30/303 (10%)
 Frame = -1

Query  896  EVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYL  717
            +++++++ LH+ +  ++  L+ SE       AM +LEA I+     AE +IE  L    +
Sbjct  29   DLREEIIELHKKVSSIEAFLKNSEKQIHNHMAMTELEARIKGFANVAEDKIEFGLREAMI  88

Query  716  AKGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLV  537
             +  +    A     HE + E+       Q++AK      +    +      +   L L+
Sbjct  89   TEDEMQRGKA-----HEELRES------LQRVAKDIDCVQKESKKIQHHKGNQASTLSLL  137

Query  536  KGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVG  357
            + +S   ++   + VSN            MVG DK  E++L++L    +    +V+ IVG
Sbjct  138  RDTSSSEML-PNLDVSN-----------NMVGRDKEKERMLEEL-RGGSKDELKVIPIVG  184

Query  356  MGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT-----AASRDG  192
            MGGIGKTTLA++V+ HPSI S FD RAW T+ +EY+V+++L  LL  +        SRD 
Sbjct  185  MGGIGKTTLAKQVFNHPSIQSRFDVRAWATICKEYNVKEILLSLLQSIINIDDKVYSRD-  243

Query  191  QDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
            + +LA+ ++K LK +RYLIVIDDIW   AWD  ++CFP DNNGS ILLT+R  +V  YAS
Sbjct  244  EAELADLLQKKLKCRRYLIVIDDIWCYKAWDDTRQCFPIDNNGSRILLTTRHTEVAIYAS  303

Query  11   SGN  3
            S N
Sbjct  304  SSN  306



>emb|CAB56299.1| NBS-LRR protein [Solanum acaule]
Length=938

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 102/148 (69%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD   GS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCYKGSRILLTTRNVEVAEYASSG  284



>gb|AEW48209.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=908

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 103/153 (67%), Gaps = 9/153 (6%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFD  285
            D+ MVG +  FE +LDQL       GR+  VVSIVGMGGIGKTTLA K+Y  P I S FD
Sbjct  139  DNIMVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFD  194

Query  284  KRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTA  105
             RA  TVSQEY V  +L  LLS     S +   QLA+ ++K LK +RYL+VIDDIW T A
Sbjct  195  IRAKATVSQEYCVRNVLLGLLS---LTSDEPDYQLADRLQKHLKGRRYLVVIDDIWTTEA  251

Query  104  WDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            WD ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  252  WDDIKPCFPDCINGSRILLTTRNVEVAEYASSG  284



>gb|AAF04603.1|AF195939_1 disease resistance protein Gpa2 [Solanum tuberosum]
 emb|CAB55838.1| NBS-LRR protein [Solanum tuberosum subsp. andigenum]
Length=912

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 102/150 (68%), Gaps = 9/150 (6%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            MVG +  FE +LDQL       GR+  VVSIVGMGGIGKTTLA K+Y  P I S FD RA
Sbjct  142  MVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRA  197

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
              TVSQEY V  +L  LLS     S +   QLA+ ++K LK +RYL+VIDDIW T AWD 
Sbjct  198  KATVSQEYCVRNVLLGLLS---LTSDEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++ CFPD +NGS ILLT+R  +V EYASSG
Sbjct  255  IKLCFPDCDNGSRILLTTRNVEVAEYASSG  284



>gb|AFB17978.1| Rx-like protein, partial [Solanum brevicaule]
Length=350

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 100/148 (68%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P   S FD RA  
Sbjct  19   MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYFMSRFDIRAKA  76

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S    DQLA+ ++K LK +RYL+VIDDIW T A D ++
Sbjct  77   TVSQEYCVRNVLLGLLS---LTSDQPDDQLADRLQKHLKGRRYLVVIDDIWTTEAGDDIK  133

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  134  LCFPDCINGSRILLTTRNVEVAEYASSG  161



>gb|AEW48190.1| disease resistance protein RX4 [Solanum albicans]
Length=909

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 102/148 (69%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD   GS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCYKGSRILLTTRNVEVAEYASSG  284



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score =   152 bits (385),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 164/307 (53%), Gaps = 42/307 (14%)
 Frame = -1

Query  890   KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
             +++++ LH+ +  ++  L+ SE       AM +LEA I+      E +IE  L    +A+
Sbjct  1006  REEIIELHKKVSSIEAFLKNSEKQIHNHMAMTELEARIKGFANVVEDKIEFGLREAMIAE  1065

Query  710   GSLLHITA------CLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrg  549
               +    A       L R+ + +   ++++   QQ   + +S    L D S         
Sbjct  1066  DEMQRGKAHEKLRESLQRVAKDIDRVQEESQKIQQHKGSQASTLSLLRDTSSSE------  1119

Query  548   lqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVV  369
                         +   + VSN            MVG DK  +++L++L    +    +V+
Sbjct  1120  ------------ILPNLDVSN-----------NMVGRDKEKKRMLEEL-RGGSKDELKVI  1155

Query  368   SIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT-----AA  204
              IVGMGGIGKTTLA++V+ HPSI S FD RAW T+S+EY+V+++L  LL  +        
Sbjct  1156  PIVGMGGIGKTTLAKQVFNHPSIKSRFDVRAWATISKEYNVKEILLSLLQSIINIDDKVY  1215

Query  203   SRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVG  24
             SRD +D+LA+ ++K LK +RYLIVIDDIW+  AWD  ++CFP DNNGS ILLT+R  +V 
Sbjct  1216  SRD-EDELADLLQKKLKCRRYLIVIDDIWSNKAWDDTKQCFPIDNNGSRILLTTRHTEVA  1274

Query  23    EYASSGN  3
               ASS N
Sbjct  1275  INASSSN  1281


 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 110/156 (71%), Gaps = 7/156 (4%)
 Frame = -1

Query  455   SRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
             + MVG DK  +++L++L    +    +V+ IVGMGGIGKTTLA++V+ HPSI S FD RA
Sbjct  1932  NNMVGRDKEKKRMLEEL-RGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRA  1990

Query  275   WLTVSQEYSVEQMLRCLLSCVT-----AASRDGQDQLAESVRKCLKSQRYLIVIDDIWNT  111
             W T+S+EY+V+++L  LL  +        SRD +D+LA+ ++K LK +RYLIVIDDIW+ 
Sbjct  1991  WATISKEYNVKEILLSLLQSIINIDDKVYSRD-EDELADLLQKKLKCRRYLIVIDDIWSN  2049

Query  110   TAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
              AWD  ++CFP DNNGS ILLT+R  +V   ASS N
Sbjct  2050  KAWDDTKQCFPIDNNGSRILLTTRHTEVAINASSSN  2085


 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 147/278 (53%), Gaps = 33/278 (12%)
 Frame = -1

Query  917  AQLR-EVGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIE  741
            +Q+R ++ + +++  +L + +  L+  L+K E  N V+  M DLEA+I++V    E  I+
Sbjct  116  SQMRSQICDHREEFHALSEKVSSLEIFLKKFEKSN-VSREMTDLEAQIKEVADGVEITIQ  174

Query  740  MELTTIYLAKGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgri  561
            + LT I +AK  +    A            E   D  +Q+A+      +  T +    + 
Sbjct  175  LRLTDIIMAKNEMQKKKA-----------REMLCDSLKQVAEEIDRVQKESTKIQYKAKQ  223

Query  560  rqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKG  381
                  +   SS       K+I++   KN        MVG     EK++ +L T+  +  
Sbjct  224  SLEEYFVQASSS------AKVILN--GKN-------NMVGRRDEREKMMTEL-TRGFSGV  267

Query  380  RQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT---  210
             +V+ IVGMGGIGKTTLA++V+    I SHFD RAW T+SQE++V+ +L  LL       
Sbjct  268  LKVIPIVGMGGIGKTTLAKEVFNDAFIRSHFDVRAWATISQEHNVKDILVSLLHSTKEKD  327

Query  209  -AASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWD  99
               + + + +LA+ ++K LKS+RYLIV+DD+W+  AWD
Sbjct  328  DTVNTEDESKLADMLQKSLKSRRYLIVLDDMWSDKAWD  365



>gb|AEW48192.1| disease resistance protein RGH3 [Solanum chacoense]
Length=932

 Score =   151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  143  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLATKLYTDPYIMSRFDIRAKA  200

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +   QLA+ ++K LK +RYL+VIDDIW T AWD+++
Sbjct  201  TVSQEYCVRNVLLGLLS---LTSDEPDYQLADRLQKHLKGRRYLVVIDDIWTTEAWDNIK  257

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  258  PCFPDCYNGSRILLTTRNVEVAEYASSG  285



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score =   150 bits (379),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 154/303 (51%), Gaps = 40/303 (13%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + S +Q+L  LQ  L+++          K LE  IRDV +  E R++  L ++ +A 
Sbjct  31   QQHIESTYQSLSALQVFLEEATKEAKDIETRKSLEKRIRDVVYKVEYRVDSRLRSVIVAD  90

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                   AC    +E + E EK+ D          S  + +  +       +        
Sbjct  91   CGDDRERACK-AFNEELQEVEKEVD----------SLKKEVIQIEFNKHGSKSAELATTS  139

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SS      ++  +  ++          +VG +  F  ILD+L  Q  T    V+S+VGMG
Sbjct  140  SS-----SRRYAIEQYT----------VVGMEDDFINILDRLTAQ--THDLTVISVVGMG  182

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--------  195
            GIGKTTLA+K Y+  SI   FD  AW+TVS+ Y+  Q+L   L  + + SRD        
Sbjct  183  GIGKTTLARKAYDDSSIRYRFDTHAWVTVSENYNERQVL---LDVIISISRDRTDESYET  239

Query  194  -GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
               DQLAE V K LK +R+LI+IDD+W+T AWD +QR FP+DNN S ILLT+RL  V +Y
Sbjct  240  MSTDQLAEIVYKGLKGRRFLIIIDDLWSTEAWDQMQRLFPNDNNKSRILLTTRLNYVADY  299

Query  17   ASS  9
            AS 
Sbjct  300  ASP  302



>gb|AFB17982.1| Rx-like protein, partial [Solanum tuberosum]
Length=320

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 99/148 (67%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA  
Sbjct  19   MVGRENEFEMMLDQL--ARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKA  76

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +   QLA+ ++K LK +RYL+VIDDIW   AWD ++
Sbjct  77   TVSQEYCVRNVLLGLLS---LTSDESDYQLADRLQKHLKGRRYLVVIDDIWTPEAWDDIK  133

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V E ASSG
Sbjct  134  LCFPDCYNGSRILLTTRNVEVAECASSG  161



>gb|ABY61746.1| resistance protein PSH-RGH7 [Solanum tuberosum]
Length=930

 Score =   150 bits (380),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 114/293 (39%), Positives = 155/293 (53%), Gaps = 37/293 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ +  L+ IL+KS  I  D  G +  LE EI +V +  EG ++ E   ++LA+    
Sbjct  26   PFYEKIESLRAILEKSCNIMGDHEG-LTILEVEIIEVAYTTEGMVDSESRNVFLAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +      K   + + ++ D+              + SSL 
Sbjct  85   RSRA----MWEIFFVLEQALECIDSTVKQWMAASDSMKDLKQ------------QTSSLV  128

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGI  345
             L    +          +  ++ MVG +  FE +LDQL       GR+  VVSIVGMGGI
Sbjct  129  SLPEHDV----------EQPENIMVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGI  174

Query  344  GKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVR  165
            GKTTLA K+Y  P I S FD RA  TVSQEY V  +L  LLS     S +   QLA+ ++
Sbjct  175  GKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLS---LTSDEPDYQLADRLQ  231

Query  164  KCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            K LK +RYL+VIDDIW T AWD ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  232  KHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSG  284



>gb|AEW48206.1| disease resistance protein RGH4 [Solanum fernandezianum]
Length=932

 Score =   150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 101/150 (67%), Gaps = 9/150 (6%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            MVG +  FE +LDQL       GR+  VVSIVGMGGIGKTTLA K+Y  P I S FD RA
Sbjct  142  MVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRA  197

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
              TVSQEY V  +L  LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T AWD 
Sbjct  198  KATVSQEYCVRNVLLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            ++ CFPD  NGS I LT+R  +V EYASSG
Sbjct  255  IKLCFPDCINGSRIHLTTRNVEVAEYASSG  284



>gb|AEW48208.1| disease resistance protein RGH4 [Solanum huancabambense]
Length=877

 Score =   150 bits (378),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 104/153 (68%), Gaps = 9/153 (6%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFD  285
            D+ MVG +   E +LDQL       GR+  VVSIVGMGGIGKTTLA K+Y  P I S FD
Sbjct  139  DNIMVGRENELEMMLDQL----ARGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFD  194

Query  284  KRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTA  105
             RA  TVSQEY V  +L+ LLS +   S +   QLA+ ++K LK +RYL+VIDDIW T A
Sbjct  195  IRAKATVSQEYCVRNVLQGLLSSI---SDEPDYQLADRLQKHLKGRRYLVVIDDIWTTEA  251

Query  104  WDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            WD ++ CFPD  NGS ILLT+R  +V EYASSG
Sbjct  252  WDDIKLCFPDCINGSRILLTTRNVEVAEYASSG  284



>gb|ACE79507.1| NBS-coding resistance gene analog [Nicotiana sylvestris]
Length=288

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 105/159 (66%), Gaps = 13/159 (8%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG + +F  I DQL  Q  T    VVSIVGMGGIGK+TLA+ ++ HPS++  FD 
Sbjct  12   EENTLVGMEDVFNNIRDQLFGQ--TPALNVVSIVGMGGIGKSTLARSLFNHPSVSRRFDI  69

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRDG--------QDQLAESVRKCLKSQRYLIVID  126
             +W+TVSQ Y+ ++ML   L  ++    DG        +D+L + VR+ LK +RYLIV+D
Sbjct  70   SSWVTVSQAYNAKEML---LDVLSFGILDGKAMYRNTSEDELLDQVRRKLKRKRYLIVLD  126

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            +IW   AWD V+R FPDD NGS I++T+RL +V   AS+
Sbjct  127  NIWTIEAWDEVRRSFPDDENGSRIMITTRLLEVANCASN  165



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score =   149 bits (377),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 102/153 (67%), Gaps = 9/153 (6%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHFD  285
            D+ MVG +  FE +LDQL       GR+  VVSIVGMGGIGKTTLA K+Y  P I S FD
Sbjct  139  DNIMVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFD  194

Query  284  KRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTA  105
             RA  TVSQEY V  +   LLS     S +  DQLA+ ++K LK +RYL+VIDDIW T A
Sbjct  195  IRAKATVSQEYCVRNVFLGLLS---LTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEA  251

Query  104  WDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            WD ++ CFPD  NGS ILLT+R  +V E ASSG
Sbjct  252  WDDIKLCFPDCYNGSRILLTTRNVEVAENASSG  284



>ref|XP_006352021.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=890

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 12/161 (7%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGIGKTTLAQKVYEHPSITSHF  288
            ++  MVG +  FE +  +L    T  GR+  VVSIVGMGGIGKTTLA K+Y  P I SHF
Sbjct  65   ENMNMVGDENEFEMMQGRL----TRGGRELKVVSIVGMGGIGKTTLANKIYSDPFIMSHF  120

Query  287  DKRAWLTVSQEYSVEQMLRCLLSCVTAASR----DGQD--QLAESVRKCLKSQRYLIVID  126
            D R  +TVSQEY  E +L  LLS V+  S     + QD  +LAE ++K LK +RYL+VID
Sbjct  121  DIRGNVTVSQEYCREYVLLGLLSSVSGMSSHEFYEQQDDGELAEQLQKLLKGRRYLVVID  180

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            DIW    WD +Q CFPD NNGS IL+T+R   V +YASSGN
Sbjct  181  DIWTRETWDDIQLCFPDCNNGSRILMTTRNMDVAKYASSGN  221



>gb|AEW48188.1| disease resistance protein RGH7 [Solanum albicans]
Length=912

 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 103/149 (69%), Gaps = 7/149 (5%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P+I S FD RA  
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQD-QLAESVRKCLKSQRYLIVIDDIWNTTAWDSV  93
            TVSQEY V  ++  LL  ++    DG D QLA+ ++K LK +RYL+VIDDIW T  WD +
Sbjct  200  TVSQEYCVRNVILGLLPSIS----DGSDNQLADRLQKHLKGRRYLVVIDDIWTTEVWDDI  255

Query  92   QRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            + CFPD   GS ILLT+R  +V EYASSG
Sbjct  256  KLCFPDCYKGSRILLTTRNVEVAEYASSG  284



>gb|AEW48187.1| disease resistance protein RGH5 [Solanum albicans]
Length=931

 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 103/149 (69%), Gaps = 7/149 (5%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P+I S FD RA  
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQD-QLAESVRKCLKSQRYLIVIDDIWNTTAWDSV  93
            TVSQEY V  ++  LL  ++    DG D QLA+ ++K LK +RYL+VIDDIW T  WD +
Sbjct  200  TVSQEYCVRNVILGLLPSIS----DGSDNQLADRLQKHLKGRRYLVVIDDIWTTEVWDDI  255

Query  92   QRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            + CFPD   GS ILLT+R  +V EYASSG
Sbjct  256  KLCFPDCYKGSRILLTTRNVEVAEYASSG  284



>ref|XP_006364178.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=860

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 164/308 (53%), Gaps = 45/308 (15%)
 Frame = -1

Query  893  VKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMEL-TTIYL  717
            ++Q + SL+Q+L  LQ  L+ + +       +K LE  I+DV + AE RI+  L + I L
Sbjct  31   IQQHVESLYQDLCDLQVFLENTTMEVKDIEDVKVLEKRIKDVVYKAEDRIDSSLGSIILL  90

Query  716  AKGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLV  537
              G    + AC                          + N+ L  V       ++ + ++
Sbjct  91   DNGDDDRVRAC-------------------------KAFNEELQQVEKEVCFLKKEVMVI  125

Query  536  KGSSLHHLVHKKIIVSNFSKNASKFDDSR--------MVGCDKMFEKILDQLLTQQTTKG  381
            K        +K I  S   ++A+ F  SR        +VG       IL+ +  Q  TK 
Sbjct  126  K-------FNKHIGFSKLPESATSFPSSRQSTTEEKTVVGMKDDLNTILNCINAQ--TKE  176

Query  380  RQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS  201
               +S+VGMGGIGKTTLA+KV++   I S FDK AW+T+S++Y+  QML  ++S +T  +
Sbjct  177  LIAISVVGMGGIGKTTLARKVFDDSMIRSQFDKHAWVTISEDYNKRQMLLDVVSSITGIN  236

Query  200  RD--GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKV  27
            ++    D+L E+V K LK +R+LIVIDD+W+T AW+ ++R FP+D N S I+LT+RLK V
Sbjct  237  QEIMSNDKLMETVYKGLKGRRFLIVIDDLWSTEAWNLMRRIFPNDYNKSRIILTTRLKNV  296

Query  26   GEYASSGN  3
              +ASS +
Sbjct  297  ANHASSSD  304



>gb|AEW48207.1| disease resistance protein RGH5 [Solanum fernandezianum]
Length=912

 Score =   148 bits (374),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 100/148 (68%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVG GGIGKTTLA K+Y  P I S FD RA  
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGTGGIGKTTLATKLYSDPYIMSRFDIRAKA  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  +L  LLS     S +    LA+ +RK LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVLLGLLS---LTSDEPDYHLADRLRKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NGS ILLT+R  +V EYASSG
Sbjct  257  LCFPDCYNGSRILLTTRNVEVAEYASSG  284



>ref|XP_006345285.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like, 
partial [Solanum tuberosum]
Length=873

 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 154/290 (53%), Gaps = 27/290 (9%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLLH  696
              ++ L  L+ IL+K     D   A+ +LEAEI +V ++A   ++++   +  A+     
Sbjct  26   PFYEKLKSLRAILEKPWKATDDLEALTNLEAEISEVAYSAGDMVDLKSRNVLFAQ-----  80

Query  695  ITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLHH  516
                         +A+ +   + +L  +   + + +  + +           +K      
Sbjct  81   -------------KAKNKARAFWELCCSLEQEVERIDSLMMQWLAIWNWYSKIKDLK---  124

Query  515  LVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKT  336
               K  +  +  ++A    ++ MVG +  FE +L+Q+   +  +  +VVSIVGMGGIGKT
Sbjct  125  -ARKFSLAPSIPEHAVGKPENIMVGHENEFEMMLNQVAGGE--RELEVVSIVGMGGIGKT  181

Query  335  TLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCL  156
            TLA K+Y  P I SHFD  A  TVSQEY V  +L  LL+   + S +  DQLA+ ++K L
Sbjct  182  TLATKLYRDPRIMSHFDILAKATVSQEYCVRNVLLALLA---STSEEPDDQLADQLQKRL  238

Query  155  KSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            K +RYL+VIDDIW   AWD +++CFPD NN S ILLT+R  +V  YA SG
Sbjct  239  KGKRYLVVIDDIWTKGAWDDIRQCFPDCNNRSRILLTTRNVEVAGYARSG  288



>ref|XP_009606269.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=312

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/291 (33%), Positives = 149/291 (51%), Gaps = 50/291 (17%)
 Frame = -1

Query  893  VKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLA  714
            ++++   LH  +  L+  L+  E GN V+G M DLE +I++V    E  I++ LT   + 
Sbjct  26   LREEFSGLHDKISSLEVFLKIFEKGN-VSGEMTDLEIQIKEVANAIEHTIQLRLTDSVMT  84

Query  713  KGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVK  534
               +    A            E+  D  +Q+++ +  Q+ +L                  
Sbjct  85   DDEMQKEMA-----------DERLYDSLKQVSEESLVQDSSL------------------  115

Query  533  GSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
                              K+    ++  MVG D   +K+L+ L T+  T   +V+ IVGM
Sbjct  116  -----------------GKHTPNVENMNMVGRDDQRKKLLEDL-TKGFTSESKVIPIVGM  157

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS--RDGQDQL  180
            GGIGKTTLA++VY   SI  HFD R W T+SQ+++V ++L  L+      S   +G+ +L
Sbjct  158  GGIGKTTLAREVYNDASIRLHFDVREWATISQQHNVNEILLSLVHSTKGDSFYMEGEAEL  217

Query  179  AESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKV  27
            A  ++K LK +RYLIV+DD+W + AWD ++ CFP  NNGS ILLT+R  +V
Sbjct  218  ANMLQKSLKGKRYLIVLDDMWKSEAWDDIRLCFPIQNNGSRILLTTRNAEV  268



>ref|XP_006350053.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=901

 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 155/293 (53%), Gaps = 37/293 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ L  L+ IL+KS  I  D  G +  LE EI +V +  E  ++ E   ++LA+    
Sbjct  26   PFYEKLKSLRAILEKSCNIMGDHEG-LTILEVEIAEVAYTTEDMVDSESRNVFLAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +      K   + + ++ D+              + SSL 
Sbjct  85   RSRA----MWEIFFVLEQALECIASTVKQWMAASDSMKDLKP------------QTSSLV  128

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGI  345
             L           ++A +  ++ MVG +  FE +LDQL       GR+  VVSIVGMGGI
Sbjct  129  SL----------PEHAVEQPENIMVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGI  174

Query  344  GKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVR  165
            GKTTLA K+Y  P I S FD RA  TVSQEY V  ++  LL  +   S +  DQLA+ ++
Sbjct  175  GKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSI---SDEPDDQLADRLQ  231

Query  164  KCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            K LK +RYL+VIDDIW T AWD ++ CFPD  NGS ILLT+R  +V E A SG
Sbjct  232  KHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAECARSG  284



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 165/300 (55%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL ++                  ++ M+G D   +++L+ L T+  +   +V+ IVGMG
Sbjct  139  SSLANV------------------ENNMLGRDDERKRLLEDL-TRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score =   147 bits (372),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score =   147 bits (372),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 165/300 (55%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL ++                  ++ M+G D   +++L+ L T+  +   +V+ IVGMG
Sbjct  139  SSLANV------------------ENNMLGRDDERKRLLEDL-TRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 165/300 (55%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL ++                  ++ M+G D   +++L+ L T+  +   +V+ IVGMG
Sbjct  139  SSLANV------------------ENNMLGRDDERKRLLEDL-TRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 165/300 (55%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL ++                  ++ M+G D   +++L+ L T+  +   +V+ IVGMG
Sbjct  139  SSLANV------------------ENNMLGRDDERKRLLEDL-TRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score =   147 bits (372),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score =   147 bits (372),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>gb|EYU24432.1| hypothetical protein MIMGU_mgv1a023729mg [Erythranthe guttata]
Length=860

 Score =   147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            +S+MVG D+   ++LD L  +Q++   Q++ IVGMGGIGKTTLA+  YEH  I++HFD  
Sbjct  137  NSKMVGFDEELFQLLDALTGRQSS--LQIIPIVGMGGIGKTTLARNAYEHRLISNHFDVC  194

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWD  99
            AW+T+SQEYSV+++   LLS  ++ S D Q QLA+ + + L  +RYLI++DDIW+  AW+
Sbjct  195  AWVTISQEYSVKEIFSKLLSRQSSQSADEQ-QLAQELYQSLIGRRYLIILDDIWSIDAWE  253

Query  98   SVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
             +   FPD+NNGS I+LT+RL  V  Y  S 
Sbjct  254  KMMFFFPDNNNGSRIILTTRLSNVAVYFGSS  284



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 165/300 (55%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL ++                  ++ M+G D   +++L+ L T+  +   +V+ IVGMG
Sbjct  139  SSLANV------------------ENNMLGRDDERKRLLEDL-TRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 161/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +++ ++L++ +  L+   +K E  N V+G M D EA I++V    E  I++ LT    A 
Sbjct  31   REEFLTLYEKVSSLEVCAKKFEKSN-VSGKMTDFEAHIKEVADFVELTIQLRLTESLEAY  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
              +    A            E+  D  QQ+A+      +  T +   G+       LV+ 
Sbjct  90   DEMQKEKA-----------HERLCDSLQQVAQEIDRVQKESTKIKDKGKQASNKPSLVQD  138

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            SSL          +N   N    DD R         K L + LT+  +   +V+ IVGMG
Sbjct  139  SSL----------ANVENNMLGRDDER---------KRLLEDLTRGFSGEPKVIPIVGMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQ  183
            GIGKTTLA++V++  +I SHFD R+W TVS +++V+++L  LLS     +    ++ + +
Sbjct  180  GIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPE  239

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LA+ +RK LK +RYLIV+DDIW + AWD V+ CFP +NNGS ILLT+R  +V  YA + N
Sbjct  240  LADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTEN  299



>gb|AEQ61804.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=176

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (71%), Gaps = 6/123 (5%)
 Frame = -1

Query  359  GMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS------R  198
            GMGG+GKTTLA+  Y+   I  HF  RAW+TVSQ+YS+++ML  L+  + A S      +
Sbjct  1    GMGGVGKTTLARSAYDDALIIEHFHIRAWVTVSQDYSIQEMLFTLVDSIKAFSEKFDEEK  60

Query  197  DGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
               +Q+AE V K LK +RYL+V+DD+W+T AWD V+R FPDDNNGS I++T+RL+ V  Y
Sbjct  61   HSYEQMAEHVYKNLKGRRYLVVLDDMWSTKAWDDVRRIFPDDNNGSRIMITTRLQDVAAY  120

Query  17   ASS  9
            A S
Sbjct  121  ADS  123



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 172/304 (57%), Gaps = 42/304 (14%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            ++++++L++ +  L+  L+ SE  N V+  M DLEA I++V    E  I++ LT   +A 
Sbjct  31   REEILTLNEKVSSLEVFLKNSERSN-VSEEMTDLEAWIKEVANVVEYTIQLRLTEAVMAN  89

Query  710  GSLLHITA------CLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrg  549
              +   TA       L ++ E +   +K++   QQ  K AS ++                
Sbjct  90   DEMQKETAREMFCDSLQQVAEDISRVQKESMKIQQKGKQASKKS----------------  133

Query  548  lqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVV  369
              LV+GSS      K ++  N  KN        MVG D   +++L+ L T+ ++   +V+
Sbjct  134  --LVQGSS----SAKDVL--NVKKN--------MVGRDDQRKRLLEDL-TRGSSGELKVI  176

Query  368  SIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ  189
             I+GMGGIGKTTLA++VY   SI SHFD RAW TVS  ++++++L  LL      +   +
Sbjct  177  PILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNIKEILLSLLRSRMGDTFYME  236

Query  188  DQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            D+  LA+ ++K LKS+RYLIV+DD+W++ AWD V++CFP +NN S ILLT+R   V  YA
Sbjct  237  DEAELADMLQKSLKSRRYLIVMDDMWSSKAWDDVRQCFPSENNESRILLTTRDTDVACYA  296

Query  14   SSGN  3
             + N
Sbjct  297  GTEN  300



>ref|XP_006345616.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=530

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 109/163 (67%), Gaps = 4/163 (2%)
 Frame = -1

Query  494  VSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVY  315
            +++FS    + +++ ++G +  F  I D+L++Q+      V+ I GMGGIGKTTLA+KVY
Sbjct  17   ITSFSAEKGRVEENTIIGMEDDFNTIFDRLISQRNE--LTVIPIFGMGGIGKTTLARKVY  74

Query  314  EHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--GQDQLAESVRKCLKSQRY  141
            +   I S FD+ AW+TVS EY+  QML  L+  +T ++++    DQL  +V + LK +R+
Sbjct  75   DDSYIRSRFDRHAWVTVSNEYNKRQMLLELVYSITGSNQEMMSDDQLMVNVYRGLKGRRF  134

Query  140  LIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
            LIVIDDIW+  AW  ++R FP+D+  S IL+T+RLK V +Y S
Sbjct  135  LIVIDDIWSNEAWKKMKRIFPNDDKKSRILITTRLKYVADYVS  177



>gb|ABV90190.1| NBS-LRR type disease resistance protein [Ipomoea batatas]
Length=191

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = -1

Query  368  SIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--  195
             I GMGGIGKTTLA+++Y   S  S FD RAW+T+SQ Y+  ++ + LL  +     D  
Sbjct  1    GIWGMGGIGKTTLAKRIYGDASFISRFDCRAWVTISQVYNPTKVFKALLRPLAPRVDDEN  60

Query  194  ---GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVG  24
               G ++LAE V KCLK QRY I+IDDIW+T  W  +Q+CFP+DNNGS +LLT+RLK V 
Sbjct  61   NEAGNNELAEVVYKCLKRQRYFIIIDDIWSTDVWCDLQKCFPNDNNGSRMLLTTRLKNVA  120

Query  23   EYASSG  6
              A SG
Sbjct  121  NCAGSG  126



>ref|XP_009777085.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=547

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 157/304 (52%), Gaps = 42/304 (14%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDIL-QKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLA  714
            +Q + S +Q+L  LQ  L + +E   D+   +K LE  +RDV +  E R++  L  + +A
Sbjct  31   QQHVESTYQSLCALQVFLDEATEEAKDIE-TLKRLEKRLRDVVYKVEYRVDSRLRNVIVA  89

Query  713  KGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVK  534
                    AC    +E + E EK+ D          S  + +  +              +
Sbjct  90   DCGDDRERACKA-FNEELQEVEKEVD----------SLKKEVMQIEFNK----------R  128

Query  533  GSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
            GS    L       S+  + AS  + + +VG +  F  ILD+L  Q  T    V+ +VGM
Sbjct  129  GSKSAELATTS---SSSRRYAS--EQNTVVGMEDDFNAILDRLTAQ--THELTVIPVVGM  181

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQD----  186
            GGIGKTTLA+K Y+  SI   FD  +W+TVS+ Y+  Q+L   L  + + SRD  D    
Sbjct  182  GGIGKTTLARKAYDDSSIRYRFDIHSWVTVSENYNERQVL---LDVIISISRDRTDESYE  238

Query  185  -----QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGE  21
                 QLAE V K LK +R+LI+IDD+W+T  WD +QR FP+DNN S ILLT+RL  V +
Sbjct  239  TMSINQLAEIVYKGLKGRRFLIIIDDLWSTEVWDQMQRLFPNDNNKSRILLTTRLNYVAD  298

Query  20   YASS  9
            YAS 
Sbjct  299  YASP  302



>ref|XP_009780928.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009780934.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=935

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 162/296 (55%), Gaps = 31/296 (10%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
            S ++ L  L+ I++K   I  +   A+  LEAEI +V F+AE +++     +  +K + L
Sbjct  26   SFYEKLQSLRSIMEKPCNITTEDIEALTSLEAEIVEVAFSAEVKVDSRSIKVLYSKTTTL  85

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    L ++    EK  +    + K   +     T++              KG    
Sbjct  86   RSNA----LWKLCCCLEKAVERIDSIMKQWMAIRDWYTNI--------------KG----  123

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGK  339
             L  +K  +++  + A +  ++ MVG +  FE + D+L   + +   +VVSI GMGGIGK
Sbjct  124  -LKAQKFSLASIPERAVE-PENIMVGHESEFEMMQDRL--ARGSSELEVVSITGMGGIGK  179

Query  338  TTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD--GQD--QLAES  171
            TTLA K+Y  P I S FD RA +T+SQEY    +L  LLS ++  + +   QD  QLA+ 
Sbjct  180  TTLANKLYSDPFIMSRFDIRAKVTISQEYCKRNVLLGLLSPISGRTNEYFEQDDGQLADQ  239

Query  170  VRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            ++K LK +RY I+IDDIW + AWD ++ CFP+  NGS ILLT+R  +V +YASSGN
Sbjct  240  LQKLLKGRRYFILIDDIWTSEAWDDIKLCFPEYTNGSRILLTTRNVEVAKYASSGN  295



>ref|XP_009789218.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789219.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789220.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=775

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 112/180 (62%), Gaps = 14/180 (8%)
 Frame = -1

Query  512  VHKKI-------IVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
            VHK+I        +S+FS      +++ +VG D +F  I DQL  Q  T    VVS+VGM
Sbjct  14   VHKRIKDAPATTYLSSFSSGRVLDEENTLVGMDDVFNNIRDQLFGQ--TPALNVVSVVGM  71

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR-----DGQ  189
            GGIGK+TLA+ ++ HPS++  FD  +W+TVSQ Y  ++ML  +LS  T   +       +
Sbjct  72   GGIGKSTLARSLFNHPSVSRRFDISSWVTVSQSYDAKEMLLDVLSFGTPDGKAMYRNTSE  131

Query  188  DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            D+L + VR+ LK +RYL ++DDIW   AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  132  DELLDQVRRKLKRKRYLKLLDDIWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  191



>gb|AEQ61805.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=176

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (71%), Gaps = 6/123 (5%)
 Frame = -1

Query  359  GMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS------R  198
            GMGG+GKTTLA+  Y+   I  HF  RAW+TVSQ+YS+++ML  L+  + A S      +
Sbjct  1    GMGGLGKTTLARSAYDDALIIEHFHIRAWVTVSQDYSIQEMLFTLVDSIKAFSEKFDEEK  60

Query  197  DGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
               +Q+AE V K LK +RYL+V+DD+W+T AWD V+R FPDDNNGS I++T+RL+ V  Y
Sbjct  61   HSYEQMAEHVYKNLKGRRYLVVLDDMWSTKAWDDVRRIFPDDNNGSRIMITTRLQDVAAY  120

Query  17   ASS  9
            A S
Sbjct  121  ADS  123



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 105/311 (34%), Positives = 159/311 (51%), Gaps = 43/311 (14%)
 Frame = -1

Query  902  VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAG--AMKDLEAEIRDVWFNAEGRIEMELT  729
            + E ++ + SL+  L  LQ  L+ +  G  ++   A+  LE +IRD  + AE  I++   
Sbjct  24   ISECRESVDSLYGTLSFLQSFLEDT--GKQISDQEALMFLEEKIRDAGYKAEDTIDL---  78

Query  728  TIYLAKGSLLHITACLLRLHEIVIEAEK-----QTDYYQQLAKAASSQNQTLTDVSllgr  564
                          CL R+H  V ++EK     +   Y +L +     +    +V     
Sbjct  79   --------------CLRRIH--VADSEKVQNNARCKLYDELLQIIEVMDSIQGEVMKFKN  122

Query  563  irqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDD-SRMVGCDKMFEKILDQLLTQQTT  387
             R    Q +K  S        I  S    +   +D+ + +VG +  F  I DQL  Q  T
Sbjct  123  DRHNNQQDIKDLS-------AITSSPLRSSGRVWDEENSLVGMEDDFNIIRDQLFRQ--T  173

Query  386  KGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTA  207
                VVSIVGMGGIGK+TLA+ ++ HPS++  FD  +W+TVSQ Y  ++ML  +LS  T 
Sbjct  174  PELNVVSIVGMGGIGKSTLARSLFNHPSVSPRFDISSWVTVSQAYDAKEMLLDVLSFGTP  233

Query  206  ASRD-----GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTS  42
              +       +D+L + V + LK +RYLIV+DD+W   AWD V+R FPDD NGS I++T+
Sbjct  234  GGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITT  293

Query  41   RLKKVGEYASS  9
            RL +V   A +
Sbjct  294  RLLEVANCAGN  304



>ref|XP_010320708.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=866

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 107/310 (35%), Positives = 163/310 (53%), Gaps = 58/310 (19%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQ-KSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLA  714
            KQ + S +Q+L  LQ  L+  +   ND+   +K LE +IRDV + AE R++  LT + LA
Sbjct  31   KQHVESSYQSLCTLQVFLEDTTNEANDIEN-LKILENKIRDVVYKAEDRVDSCLTNMILA  89

Query  713  KGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVK  534
                               E +++        KA  S ++ L  V               
Sbjct  90   HN-----------------EDDRE--------KACKSFDEELQQVETELDS---------  115

Query  533  GSSLHHLVHKKIIVSNFSKNASKF-----------DDSRMVGCDKMFEKILDQLLTQQTT  387
                   + K++IV  F K  SK            +++  VG  K ++ IL+ L  Q  T
Sbjct  116  -------LRKEVIVIEFHKRGSKLTEITTTSFSSTEETTYVGMKKDYKAILNCLNAQ--T  166

Query  386  KGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTA  207
            K   V+S++GMGGIGKTTLA+KV+++  I   F+K AW+T+S++Y+  QML  + S ++ 
Sbjct  167  KELIVISLIGMGGIGKTTLARKVFDNSIIRDRFEKHAWVTISEQYNKRQMLLEVASSISG  226

Query  206  ASRD--GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLK  33
             +      D+L   V + LK +R+LIVIDD+W+T AWD ++R F +DNN S I+LT+RLK
Sbjct  227  VNNQEMSNDELMVIVYRSLKGRRFLIVIDDLWSTEAWDQMRRIFQNDNNKSRIILTTRLK  286

Query  32   KVGEYASSGN  3
             V +YASS +
Sbjct  287  HVADYASSPD  296



>gb|AEW48199.1| disease resistance protein RGH6 [Solanum x edinense]
Length=913

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+   P I S FD  A +
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLCSDPYIMSRFDIHAKV  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  ++  LLS +   S + ++QLA+ ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVILGLLSSI---SDEPENQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASSG  6
             CFPD  NG  ILLT+R  +V EYASSG
Sbjct  257  LCFPDCINGRRILLTTRNVEVAEYASSG  284



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 156/311 (50%), Gaps = 47/311 (15%)
 Frame = -1

Query  902  VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAG--AMKDLEAEIRDVWFNAEGRIEMELT  729
            + E +  + SL+  L  LQD L+ +  GN +    A+K LE  IRD  + AE  I+    
Sbjct  24   ISESRGSIDSLYGTLSFLQDFLENT--GNWINDQEALKILEKNIRDAGYKAEDTID----  77

Query  728  TIYLAKGSLLHITACLLRLHEIVIEAEKQT---DYYQQLAKAASSQNQTLTDVSllgrir  558
                          CL R+H    +  +       Y +L +   + +    DV       
Sbjct  78   -------------GCLRRIHVADTDHNQNNARHKLYDELQEILEAMDSIQRDV-------  117

Query  557  qrglqLVKGSSLHHLVHKKIIVSNFSKNASKF---DDSRMVGCDKMFEKILDQLLTQQTT  387
                  +K  ++H  +      +     +S     +++ +VG + +F  I DQL  Q  T
Sbjct  118  ------MKFKNVHKRIKDVPATTYLPPRSSGRVLDEENTLVGMEDVFNNIRDQLFGQ--T  169

Query  386  KGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT-  210
                VVSIVGMGGIGK+TLA+ ++ HPS+   FD  +W+TVSQ    ++ML  +LS  T 
Sbjct  170  PALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSWVTVSQACDAKEMLLDVLSFGTP  229

Query  209  ---AASRD-GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTS  42
               A  RD  +D+L + V + LK +RYLIV+DD+W   AWD V+R FPDD NGS I++T+
Sbjct  230  GGKAMYRDMSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITT  289

Query  41   RLKKVGEYASS  9
            RL +V   A +
Sbjct  290  RLLEVANCAGN  300



>gb|EYU24351.1| hypothetical protein MIMGU_mgv1a025953mg [Erythranthe guttata]
Length=567

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 99/144 (69%), Gaps = 4/144 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D+   ++LD+L  Q++   R ++ IVGMGGIGKTTLAQ  YEH  I  HFD R W+
Sbjct  174  MVGFDEQLLQLLDKLTGQRSN--RHIIPIVGMGGIGKTTLAQNAYEHSLIVHHFDIRTWV  231

Query  269  TVSQEYSVEQMLRCLLSCVTA--ASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            T+SQ+YSV+++L  LLS +++   S D +  L + + K L  +RYLIVIDDIW   AWD+
Sbjct  232  TISQKYSVKELLLQLLSMISSDIDSEDDEQLLGQKLHKILWGRRYLIVIDDIWGVEAWDN  291

Query  95   VQRCFPDDNNGSCILLTSRLKKVG  24
            +   FP++NNGS I++T+R+  V 
Sbjct  292  LNLFFPENNNGSRIVVTTRISHVA  315



>ref|XP_004251533.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=930

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 106/157 (68%), Gaps = 13/157 (8%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGR---QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            MVG +  FE + DQL     T+G    +VVSIVGMGGIGKTTLA K+Y  P + S FDKR
Sbjct  194  MVGHENEFEMMQDQL-----TRGASDLEVVSIVGMGGIGKTTLANKIYTDPFVMSCFDKR  248

Query  278  AWLTVSQEYSVEQMLRCLLSCV---TAASRDGQD--QLAESVRKCLKSQRYLIVIDDIWN  114
            A +T+SQ+Y V  +L  LLS +   T  + + QD  QLA+ ++K LK  RYL+VIDDIW 
Sbjct  249  AKVTISQDYCVRNVLLRLLSSISGKTHQTYEEQDDGQLADQLQKLLKGPRYLVVIDDIWT  308

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            T AWD ++ CFPD N  S IL+T+R  +V EYASSG+
Sbjct  309  TGAWDDIKLCFPDCNCRSRILMTTRNMEVAEYASSGS  345



>ref|XP_010323848.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Solanum lycopersicum]
Length=684

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 159/300 (53%), Gaps = 34/300 (11%)
 Frame = -1

Query  887  QKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMEL-TTIYLAK  711
            Q + SL+Q+L  LQ  L+ + I       +K LE +I+DV + AE RI+  L + I L  
Sbjct  32   QHVESLYQDLCDLQVFLENTTIEVKDIEDVKALEEKIKDVVYKAEDRIDSSLRSIILLDN  91

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
            G      AC +  +E + + EK+  + +Q                               
Sbjct  92   GDDDREMACNV-FNEELQQVEKEVCFLKQEVMVIKFDK----------------------  128

Query  530  SSLHHLVHKKIIVSNF--SKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVG  357
                H+   K+  S    S   S  ++  +VG       IL+ +     TK   V+S+VG
Sbjct  129  ----HIGFSKLPESTTFPSSRKSTIEEKTVVGMKDDLNSILNCI--NAHTKELIVISVVG  182

Query  356  MGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDG--QDQ  183
            MGGIGKTTLA KV++   I S FDK AW+T+SQ+Y+  QML  ++S +T   ++    D+
Sbjct  183  MGGIGKTTLASKVFDDSMIRSQFDKHAWVTISQDYNKRQMLLEIVSSITGIYQENMSNDK  242

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            L ++V K LK +R+LIVIDD+W+T A D ++R FP+D+N S I+LT+RLK V +YASS +
Sbjct  243  LLDTVYKGLKGRRFLIVIDDLWSTEALDLMRRIFPNDHNKSRIILTTRLKTVADYASSPD  302



>gb|EYU21177.1| hypothetical protein MIMGU_mgv1a018978mg [Erythranthe guttata]
Length=745

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 101/151 (67%), Gaps = 4/151 (3%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            D + MVG D+   ++LD+L  QQ+   RQ++ IVGMGGIGKTTLAQ  YEH  I  HFD 
Sbjct  35   DKNTMVGFDEQLLQLLDKLTGQQS--NRQIIPIVGMGGIGKTTLAQNAYEHSLIVHHFDI  92

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAW  102
            R W+TVSQ+Y+V+Q+L  LLS     S+  +  L + + K L  +RYLIV DDIW+  AW
Sbjct  93   RTWVTVSQKYNVKQLLLQLLS--ENNSQMDEQLLGQKLHKMLWGRRYLIVTDDIWSIEAW  150

Query  101  DSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            + V R FPD+NNGS I++T+R+  V  +  S
Sbjct  151  EEVCRFFPDNNNGSRIVVTTRISNVATHFDS  181



>gb|EYU25639.1| hypothetical protein MIMGU_mgv1a022176mg, partial [Erythranthe 
guttata]
Length=432

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 100/147 (68%), Gaps = 4/147 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D+   ++LD+L  QQ+   RQV+ IVGMGGIGKTTLA+  YEH  I  HFD R W+
Sbjct  117  MVGFDEQLLRLLDKLTGQQSN--RQVIPIVGMGGIGKTTLAKNTYEHSLIMHHFDIRTWV  174

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            T+S +Y+V+++L  LLS     S+  +  L + + K L  +RYLIVIDDIW+  AW+ V 
Sbjct  175  TISPKYNVKELLLQLLS--EKNSQIDEQLLGQKLHKMLWGRRYLIVIDDIWSIEAWEEVS  232

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASS  9
            R FPD+NNGS I++T+R+  V  + +S
Sbjct  233  RFFPDNNNGSRIVVTARISNVATHFNS  259



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 100/144 (69%), Gaps = 7/144 (5%)
 Frame = -1

Query  419  ILDQLLTQQTTKGR---QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYS  249
            I ++ +  Q T+G    +V+SIVGMGGIGK+T A+K+Y  PSI S  D RAW+TVS++YS
Sbjct  150  IEEERMRDQLTRGSSELEVISIVGMGGIGKSTFARKMYSDPSIVSFHDVRAWITVSKDYS  209

Query  248  VEQMLRCLLSCVTAASRD----GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCF  81
            +  ML CLL      +++       +LAE +RK L ++RYLIV+DDIW+  AWD V+ CF
Sbjct  210  LRNMLLCLLRDAIGMTKELDKRSDGELAERLRKHLMAKRYLIVVDDIWSREAWDDVRLCF  269

Query  80   PDDNNGSCILLTSRLKKVGEYASS  9
            P++NN S ILLT+R  KV +YASS
Sbjct  270  PENNNRSRILLTTRDMKVAQYASS  293


 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR  198
            +V+SI GMGGIGK+T A+K++  PSI   FD R W+TVS++YSV +ML  LL   TA   
Sbjct  397  EVISIAGMGGIGKSTFAKKMFSDPSILEFFDVRGWITVSRDYSVRKMLLSLLQDATAVKE  456

Query  197  D----GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKK  30
            +        LA  ++K L S+RYLIV+DDIW+  AWD +++ FP+++N S ILLT+R  K
Sbjct  457  NLDNVSDGDLAGLLKKRLNSRRYLIVVDDIWSIEAWDDIRQWFPENSNTSRILLTTRDMK  516

Query  29   VGEYASS  9
            V  YASS
Sbjct  517  VARYASS  523



>gb|EYU24354.1| hypothetical protein MIMGU_mgv1a019328mg [Erythranthe guttata]
Length=815

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 101/149 (68%), Gaps = 4/149 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D+   ++LD+L  Q++   RQ++ IVGMGGIGKTTLA+  YEH  I  HFD R W+
Sbjct  109  MVGFDEQLLQLLDKLTGQRSN--RQIIPIVGMGGIGKTTLAKNSYEHSLIVHHFDIRTWV  166

Query  269  TVSQEYSVEQMLRCLLSCVTAA--SRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            T+SQ+Y+V+Q+L  LLS +++   S D +  L + + K L  +RYLIVIDDIW   AWDS
Sbjct  167  TISQKYNVKQLLLQLLSMISSEINSEDDEQLLGQKLHKILWGRRYLIVIDDIWGIEAWDS  226

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            +   FP++NNGS I+ T+R+  V  +  S
Sbjct  227  LNLFFPENNNGSRIVATTRISNVATHFDS  255



>ref|XP_009603187.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=677

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 105/313 (34%), Positives = 157/313 (50%), Gaps = 48/313 (15%)
 Frame = -1

Query  902  VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTI  723
            + E K  + SL+  L  LQ  L+ +    +   A+  LE +IRD  + AE  +++     
Sbjct  24   ISESKLLIDSLYGRLSSLQAFLEDAGKRINDQEALTILEKKIRDAVYKAEDTVDL-----  78

Query  722  YLAKGSLLHITACLLRLHEIVIEAEKQT------DYYQQLAKAASSQNQTLTDVSllgri  561
                        CL R+H   I++ +        D  QQ+ K   S  + L         
Sbjct  79   ------------CLKRIHVADIDSNQDNARRMLYDELQQIGKVMDSIQEELMKF------  120

Query  560  rqrglqLVKGSSLHHLVHKKIIVSNFSKNASKF---DDSRMVGCDKMFEKILDQLLTQQT  390
                    K  + H  +     ++ F   +S     +++  VG + +F K+L+QL+    
Sbjct  121  --------KNENQH--IKDLPAINFFPLRSSGHVVDEENAFVGMENVFNKVLNQLIGGNA  170

Query  389  TKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT  210
             +   VVS+VGMGGIGK+TLA  ++ + S+  HFD  +W+TVSQEY V +ML  +LS  T
Sbjct  171  -RELNVVSVVGMGGIGKSTLAGSIFRNTSVFYHFDVSSWVTVSQEYDVREMLLDVLSFGT  229

Query  209  AA-----SRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLT  45
             +     S    DQL E V + LK +RYLIV+DDIW+  AW+ V R FPDD NGS I+LT
Sbjct  230  PSLKAMYSNLSNDQLLEQVYRKLKGKRYLIVLDDIWSIEAWNLVIRSFPDDENGSRIMLT  289

Query  44   SRLKKVGEYASSG  6
            +RL +V   A +G
Sbjct  290  TRLSEVAISAGNG  302



>ref|XP_009589053.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009589054.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=635

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/301 (34%), Positives = 154/301 (51%), Gaps = 35/301 (12%)
 Frame = -1

Query  893  VKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLA  714
            ++Q + S  Q+L  LQ  L+ +         +K +E  IRD+ + AE R++  L  I   
Sbjct  29   IQQHLESAFQSLSSLQVFLEYTSKEIKDIETLKTIEKRIRDIVYKAEERVDSALRRII--  86

Query  713  KGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVK  534
                            I+++ +K+        +A  S N+ L  V       ++ L  ++
Sbjct  87   ----------------ILVDQQKR-------ERACKSFNEELQKVEKEVDSLRKELMEIE  123

Query  533  GSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
               + H        ++ S      +   +VG    F  ILD+L  Q  T    V+ +VGM
Sbjct  124  F--IKHGTKSAEASTSTSSKRYATEQHTVVGMKDDFNTILDRLTAQ--TDQLTVIPVVGM  179

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD------G  192
            GGIGKTTLA+KVY+  +I   FDK AW+T+SQ Y+  Q+L  L+S ++    D       
Sbjct  180  GGIGKTTLARKVYDDSTIRYRFDKHAWVTISQVYNERQILLELVSSISQDKTDESNQKMS  239

Query  191  QDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
             DQLAE V + +  +R+LIVIDD+W+T AWD +QR FP++NN S ILLT+RL  V +YAS
Sbjct  240  NDQLAEIVYRGVIGRRFLIVIDDLWSTEAWDQIQRIFPNENNRSRILLTTRLSYVADYAS  299

Query  11   S  9
             
Sbjct  300  P  300



>gb|AEW48186.1| disease resistance protein RGH2 [Solanum albicans]
Length=910

 Score =   144 bits (364),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 102/145 (70%), Gaps = 5/145 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +  FE +LDQL+  +  +  +VVSIVGMGGIGKTTLA K+Y  P I S FD RA +
Sbjct  142  MVGRENEFEMMLDQLV--RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKV  199

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQEY V  ++  LLS +   S + ++QL + ++K LK +RYL+VIDDIW T AWD ++
Sbjct  200  TVSQEYCVRNVILGLLSSI---SDEPENQLEDRLQKHLKGRRYLVVIDDIWTTEAWDDIK  256

Query  89   RCFPDDNNGSCILLTSRLKKVGEYA  15
             CFPD  NGS ILLT+R  +V EY+
Sbjct  257  LCFPDCINGSRILLTTRNVEVAEYS  281



>ref|XP_009777040.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=902

 Score =   144 bits (364),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            ++ MVG +  FE + DQL   +     +VVSIVGMGGIGKTTLA K++  P I S FD R
Sbjct  144  ENMMVGHENEFEMMQDQL--ARGASELEVVSIVGMGGIGKTTLANKIFSDPFIMSRFDIR  201

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAAS---RDGQD--QLAESVRKCLKSQRYLIVIDDIWN  114
            A +T+SQEY   + L  LLS +T  +    + QD  QL + ++K LK +RYLIV+DDIWN
Sbjct  202  AKVTISQEYCPRKGLLGLLSSITGKTDKPYEQQDDGQLKDRLQKLLKGRRYLIVVDDIWN  261

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++ CFPD NN S ILLT+R  +V EYASSG
Sbjct  262  EAAWDDIKLCFPDCNNRSRILLTTRNVEVAEYASSG  297



>ref|XP_009624115.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=902

 Score =   144 bits (364),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            ++ MVG +  FE +  QL   +     +VVSIVGMGGIGKTTLA K++  P I  HFD R
Sbjct  143  ENMMVGHENEFEMMQVQL--ARGASELEVVSIVGMGGIGKTTLANKIFSDPLIMYHFDIR  200

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAAS---RDGQD--QLAESVRKCLKSQRYLIVIDDIWN  114
            A +T+SQEY     L  LLS +T  +    + QD  QL + ++K LK +RYLIVIDDIWN
Sbjct  201  AKVTISQEYCARNGLLGLLSSITGKTDKPYEQQDDGQLKDRLQKLLKGRRYLIVIDDIWN  260

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
              AWD ++ CFPD NN S ILLT+R  KV EYASSG
Sbjct  261  EAAWDDIKLCFPDCNNRSRILLTTRNVKVAEYASSG  296



>ref|XP_009615718.1| PREDICTED: putative late blight resistance protein homolog R1B-12, 
partial [Nicotiana tomentosiformis]
Length=469

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/297 (33%), Positives = 156/297 (53%), Gaps = 34/297 (11%)
 Frame = -1

Query  893  VKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLA  714
            VK+++ S HQN+  LQ  L+  E   +    ++  E +I+D  ++AE RIE  L   Y A
Sbjct  199  VKEQIQSFHQNVSSLQAFLESLETNINDLKTIEHCEVKIKDAAYDAEYRIESVLENFYKA  258

Query  713  KGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVK  534
            +                 +  E   ++ ++L KA+ S      D +           L  
Sbjct  259  QNE--------------KVRREAYEEFCKRLQKASES-----IDSNSRKLTESMKSGLQA  299

Query  533  GSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
             SSL       +   +  +++ +  ++ MVG +   E +  +L+ + ++  R+ ++I GM
Sbjct  300  TSSL-------VQSFDLPEHSPQLGNN-MVGHENELEDVKCKLM-KISSDERETMAITGM  350

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS---RDGQD-  186
            GGIGKTT A+K+Y+ P I SHFD  AW+TVS+EY V +ML  LL C+ +     R+ +D 
Sbjct  351  GGIGKTTFARKIYDDPEIKSHFDILAWVTVSKEYCVRKMLLQLLHCIPSTEEVRREARDD  410

Query  185  -QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
             +LA  +++ L  +RYL+VIDDIW++ AWD +   FP D  GS ILLT+R   V  Y
Sbjct  411  GELAGKLKQRLWKRRYLVVIDDIWSSKAWDDISIWFP-DCKGSHILLTTRCGNVASY  466



>gb|ACE79493.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  29   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  87

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  88   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  147

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  148  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  178



>gb|ACE79487.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79494.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=256

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  32   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  90

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  91   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  150

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  151  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  181



>ref|XP_006366309.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=614

 Score =   142 bits (357),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = -1

Query  374  VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD  195
            VVSIVGMGGIGKTTLA+KVY+   +  HF  RAW+TVSQ + + +ML  +L C +  + +
Sbjct  162  VVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQLREMLLGILRCFSLVNDN  221

Query  194  ----GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKV  27
                  +QLAE V + LK +RYLI +DD+W+TTAWD V+R FPDD NGS ++LTSRL   
Sbjct  222  TYLKSTEQLAEQVYRSLKGRRYLIAMDDVWDTTAWDVVKRSFPDDKNGSRVILTSRLANA  281

Query  26   GEYASSGN  3
            G YASS +
Sbjct  282  GIYASSSS  289



>gb|ACE79491.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=257

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  33   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  91

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  92   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  151

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  152  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  182



>gb|ACE79488.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=255

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  32   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  90

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  91   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  150

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  151  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  181



>gb|ACE79492.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=250

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  29   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  87

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  88   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  147

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  148  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  178



>gb|ACE79489.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=254

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  32   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  90

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  91   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  150

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  151  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  181



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score =   144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 161/318 (51%), Gaps = 49/318 (15%)
 Frame = -1

Query  902  VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTI  723
            +G+ ++ + SL  +    Q+ L+K+ +   V G  ++LE  IR    + E  IE+ +   
Sbjct  25   IGDTRKMIESLLNSAEYFQNFLEKTYMRRQVFGNFEELERVIRIAVNDVENVIELTMHEY  84

Query  722  YLAKGSLLHITACLLRLHEIVIEAE---KQTDYYQQLAKAASSQNQTLTDVSllgrirqr  552
             L    L H +   L    +  +     ++ D+ ++      + +Q L+           
Sbjct  85   NL----LEHCSRLGLPRQPLCDDLPPLVEKIDFVKRRMMRFVTNDQDLS-----------  129

Query  551  glqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQV  372
                   S ++ L H     S+  + AS   ++ +VG +    K++ ++    ++  R++
Sbjct  130  -------SGVYLLGH-----SSSRRVASLNLENVVVGLEDDLMKVMRRVTGPPSS--REI  175

Query  371  VSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDG  192
            VSIVGMGGIGKTTLA+KVY HP + + FD   W+T+SQEY    +L C+LSC+     + 
Sbjct  176  VSIVGMGGIGKTTLAKKVYHHPEVRNRFDVHIWVTISQEYQTRDLLLCILSCIFQLKNEI  235

Query  191  Q-----------------DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNG  63
            Q                 DQL + + K LK +RYL+++DDIW+   WD + R FPDDNNG
Sbjct  236  QNETYRLVVGDEINGSSDDQLMDMIYKKLKYRRYLVIVDDIWSIGIWDLMTRFFPDDNNG  295

Query  62   SCILLTSRLKKVGEYASS  9
            S I+LTSR K+V E+A  
Sbjct  296  SRIILTSRHKEVAEHADP  313



>gb|ACE79495.1| NBS-coding resistance gene analog [Nicotiana sylvestris]
Length=249

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  28   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  86

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  87   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  146

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  147  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  177



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score =   144 bits (363),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            ++ MVG +  FE I DQ+   +  +  +VVSIVGMGGIGKTTLA ++Y  P I S FD R
Sbjct  309  ENMMVGHENEFEIIQDQI--ARGARELEVVSIVGMGGIGKTTLANRIYCDPFIVSRFDIR  366

Query  278  AWLTVSQEYSVEQMLRCLLSCV---TAASRDGQD--QLAESVRKCLKSQRYLIVIDDIWN  114
            A  T+SQE+ V  +L  LLS     T    + QD  QLA+ ++K LK +RYL+VIDDIW 
Sbjct  367  AKATLSQEHCVRNVLLRLLSSTRGKTDECYEEQDDGQLADRLQKLLKGKRYLVVIDDIWT  426

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            T AWD ++ CFPD NNG  ILLT+R  +V EYASSG
Sbjct  427  TEAWDDIKLCFPDCNNGGRILLTTRNVEVAEYASSG  462



>gb|EYU23607.1| hypothetical protein MIMGU_mgv1a019784mg [Erythranthe guttata]
Length=814

 Score =   143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            D + MVG D+   +ILD+L  Q +   RQ++ +VGMGGIGKTTLA+  YEH  I  HFD 
Sbjct  127  DKNTMVGFDEELNEILDKLTGQSSN--RQIIPVVGMGGIGKTTLAKNAYEHSLILYHFDI  184

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTT  108
            R W+T+SQ YSV  +L  LLS V+       D+  L E + K L  +RYLIV+DDIW+  
Sbjct  185  RTWVTISQNYSVRGILLQLLSRVSIEIDSETDEQLLGEKLYKMLWGRRYLIVVDDIWSIE  244

Query  107  AWDSVQRCFPDDNNGSCILLTSRLKKVG  24
            AW++V+R FPD+NNGS +++T+RL  V 
Sbjct  245  AWENVKRFFPDNNNGSRVIVTTRLSNVA  272



>ref|XP_004243493.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=858

 Score =   143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 159/300 (53%), Gaps = 34/300 (11%)
 Frame = -1

Query  887  QKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMEL-TTIYLAK  711
            Q + SL+Q+L  LQ  L+ + I       +K LE +I+DV + AE RI+  L + I L  
Sbjct  32   QHVESLYQDLCDLQVFLENTTIEVKDIEDVKALEEKIKDVVYKAEDRIDSSLRSIILLDN  91

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
            G      AC +  +E + + EK+  + +Q                               
Sbjct  92   GDDDREMACNV-FNEELQQVEKEVCFLKQEVMVIKFDK----------------------  128

Query  530  SSLHHLVHKKIIVSNF--SKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVG  357
                H+   K+  S    S   S  ++  +VG       IL+ +     TK   V+S+VG
Sbjct  129  ----HIGFSKLPESTTFPSSRKSTIEEKTVVGMKDDLNSILNCI--NAHTKELIVISVVG  182

Query  356  MGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDG--QDQ  183
            MGGIGKTTLA KV++   I S FDK AW+T+SQ+Y+  QML  ++S +T   ++    D+
Sbjct  183  MGGIGKTTLASKVFDDSMIRSQFDKHAWVTISQDYNKRQMLLEIVSSITGIYQENMSNDK  242

Query  182  LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            L ++V K LK +R+LIVIDD+W+T A D ++R FP+D+N S I+LT+RLK V +YASS +
Sbjct  243  LLDTVYKGLKGRRFLIVIDDLWSTEALDLMRRIFPNDHNKSRIILTTRLKTVADYASSPD  302



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score =   144 bits (362),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + ++VG +K    +LD L         +V  ++GM GIGKTT  +K+Y+HP +  HF  R
Sbjct  153  EGKLVGLEKDLVTMLDNLTGHPLQ--LKVFPVIGMAGIGKTTFCKKLYDHPLVMHHFYVR  210

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRD----GQDQLAESVRKCLKSQRYLIVIDDIWNT  111
            AW+T+SQ+Y V +ML  +L CVT  S++      ++L E V + LK +RYLIV+DD+W+T
Sbjct  211  AWVTISQQYEVREMLLSILCCVTYISKEIYEKRDEELREQVYRSLKGKRYLIVLDDMWDT  270

Query  110  TAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
             AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  271  EAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  302



>ref|XP_009777084.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=838

 Score =   143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 157/304 (52%), Gaps = 42/304 (14%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDIL-QKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLA  714
            +Q + S +Q+L  LQ  L + +E   D+   +K LE  +RDV +  E R++  L  + +A
Sbjct  31   QQHVESTYQSLCALQVFLDEATEEAKDIE-TLKRLEKRLRDVVYKVEYRVDSRLRNVIVA  89

Query  713  KGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVK  534
                    AC    +E + E EK+ D          S  + +  +              +
Sbjct  90   DCGDDRERACK-AFNEELQEVEKEVD----------SLKKEVMQIEFNK----------R  128

Query  533  GSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
            GS    L       S+  + AS  + + +VG +  F  ILD+L  Q  T    V+ +VGM
Sbjct  129  GSKSAELATTS---SSSRRYAS--EQNTVVGMEDDFNAILDRLTAQ--THELTVIPVVGM  181

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQD----  186
            GGIGKTTLA+K Y+  SI   FD  +W+TVS+ Y+  Q+L   L  + + SRD  D    
Sbjct  182  GGIGKTTLARKAYDDSSIRYRFDIHSWVTVSENYNERQVL---LDVIISISRDRTDESYE  238

Query  185  -----QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGE  21
                 QLAE V K LK +R+LI+IDD+W+T  WD +QR FP+DNN S ILLT+RL  V +
Sbjct  239  TMSINQLAEIVYKGLKGRRFLIIIDDLWSTEVWDQMQRLFPNDNNKSRILLTTRLNYVAD  298

Query  20   YASS  9
            YAS 
Sbjct  299  YASP  302



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = -1

Query  374  VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR-  198
            VVSIVGMGGIGKTTLA+KVY+   +  HF  RAW+TVSQ +   +ML  +L C +  +  
Sbjct  161  VVSIVGMGGIGKTTLARKVYDDIYMEHHFYVRAWITVSQMHQHREMLLGILRCFSLVNDY  220

Query  197  ---DGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKV  27
                  +QLAE V + LK +RYLI +DD+W+TTAWD V+R FPDD NGS ++LTSRL  V
Sbjct  221  TYLKSTEQLAEQVYRSLKGRRYLIAMDDVWDTTAWDVVKRSFPDDKNGSRVILTSRLANV  280

Query  26   GEYASSGN  3
            G YASSG+
Sbjct  281  GIYASSGS  288



>gb|EYU28481.1| hypothetical protein MIMGU_mgv1a018543mg [Erythranthe guttata]
Length=940

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 102/154 (66%), Gaps = 4/154 (3%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            D + MVG D+    +LD+L  Q++   RQ++ IVGMGGIGKTTLA+  YEH  I  HFD 
Sbjct  182  DKNTMVGFDEQLISLLDKLTGQRS--NRQIIPIVGMGGIGKTTLAKNAYEHSLIAHHFDI  239

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTT  108
            R W+T+SQ+Y+V+++L  LLS +++      D+  L + + K L  +RYLIVIDDIW   
Sbjct  240  RTWVTISQKYNVKELLLQLLSMISSEIDSEHDEQLLGQKLHKILWGRRYLIVIDDIWGIE  299

Query  107  AWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            AWD+V   FP++NNGS I++T+R+  V  +  S 
Sbjct  300  AWDNVNLFFPENNNGSRIVVTTRISNVATHFDSS  333



>ref|XP_006356854.1| PREDICTED: disease resistance protein RPP13-like [Solanum tuberosum]
Length=883

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 104/155 (67%), Gaps = 10/155 (6%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +D   VG  ++F+++LD+LL +++   R+V+SI GMGG+GKTTLA+ +Y  PS+ + F  
Sbjct  169  EDQLFVGFQEVFQRLLDELLKEES--HRKVLSIYGMGGLGKTTLARNLYNSPSLITTFHT  226

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRD--------GQDQLAESVRKCLKSQRYLIVID  126
            RAW++VSQ+YS+  +LR ++  +   S +         +  L   +R  LK  +YL+V+D
Sbjct  227  RAWISVSQQYSIPDLLRSIIKSIEGCSEELLKLLKEMSERDLETYLRNLLKKHKYLVVVD  286

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGE  21
            D+W+  AW+S+QR  PDDNNGS ++LT+R K+V E
Sbjct  287  DVWHREAWESLQRALPDDNNGSRVILTTRKKEVAE  321



>ref|XP_009777083.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=868

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 157/304 (52%), Gaps = 42/304 (14%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDIL-QKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLA  714
            +Q + S +Q+L  LQ  L + +E   D+   +K LE  +RDV +  E R++  L  + +A
Sbjct  31   QQHVESTYQSLCALQVFLDEATEEAKDIE-TLKRLEKRLRDVVYKVEYRVDSRLRNVIVA  89

Query  713  KGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVK  534
                    AC    +E + E EK+ D          S  + +  +              +
Sbjct  90   DCGDDRERACK-AFNEELQEVEKEVD----------SLKKEVMQIEFNK----------R  128

Query  533  GSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGM  354
            GS    L       S+  + AS  + + +VG +  F  ILD+L  Q  T    V+ +VGM
Sbjct  129  GSKSAELATTS---SSSRRYAS--EQNTVVGMEDDFNAILDRLTAQ--THELTVIPVVGM  181

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQD----  186
            GGIGKTTLA+K Y+  SI   FD  +W+TVS+ Y+  Q+L   L  + + SRD  D    
Sbjct  182  GGIGKTTLARKAYDDSSIRYRFDIHSWVTVSENYNERQVL---LDVIISISRDRTDESYE  238

Query  185  -----QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGE  21
                 QLAE V K LK +R+LI+IDD+W+T  WD +QR FP+DNN S ILLT+RL  V +
Sbjct  239  TMSINQLAEIVYKGLKGRRFLIIIDDLWSTEVWDQMQRLFPNDNNKSRILLTTRLNYVAD  298

Query  20   YASS  9
            YAS 
Sbjct  299  YASP  302



>gb|ACE79502.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=282

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG + +F  I DQL  Q  T    VVSIVGMGGIGK+TLA+ ++ HPS+   FD 
Sbjct  18   EENTLVGMEDVFNNIRDQLFGQ--TPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDI  75

Query  281  RAWLTVSQEYSVEQMLRCLLSCVT----AASRD-GQDQLAESVRKCLKSQRYLIVIDDIW  117
             +W+TVSQ    ++ML  +LS  T    A  RD  +D+L + V + LK +RYLIV+DD+W
Sbjct  76   SSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMW  135

Query  116  NTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
               AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  136  TIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  171



>gb|ACE79501.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=283

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG + +F  I DQL  Q  T    VVSIVGMGGIGK+TLA+ ++ HPS+   FD 
Sbjct  17   EENTLVGMEDVFNNIRDQLFGQ--TPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDI  74

Query  281  RAWLTVSQEYSVEQMLRCLLSCVT----AASRD-GQDQLAESVRKCLKSQRYLIVIDDIW  117
             +W+TVSQ    ++ML  +LS  T    A  RD  +D+L + V + LK +RYLIV+DD+W
Sbjct  75   SSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMW  134

Query  116  NTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
               AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  135  TIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  170



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 155/292 (53%), Gaps = 29/292 (10%)
 Frame = -1

Query  872  LHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLLHI  693
            LH+ +  L+  L+  E  N+V+G M D EA+I++V  + E  I++ LT   +    +   
Sbjct  37   LHEKVSSLEVFLKNFE-KNNVSGEMTDFEAQIKEVADDVEHTIQLRLTEAAMENNKIQKE  95

Query  692  TACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLHHL  513
             A            E   D  QQ A       +  T +   G++      LV+ SS    
Sbjct  96   KA-----------DEVLCDSLQQAANNIDRLQKESTKIQDKGKLASNKSSLVQDSS----  140

Query  512  VHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTT  333
              K I+  N  KN    DD R         K L + LT+  +   +V+ I GMGGIGKTT
Sbjct  141  STKDIL--NVKKNMMGRDDER---------KRLLEDLTRGFSSECKVIPITGMGGIGKTT  189

Query  332  LAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKC  159
            LA+ V+   SI SHFD RAW T+SQ+Y V+++L  LL      +    D+  LA+ ++K 
Sbjct  190  LAKDVFNDVSIRSHFDVRAWATISQQYDVKEILLSLLRSTMGYTFYMGDEADLADMLQKS  249

Query  158  LKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            LKS+RYLIV+DD+W++ AWD V++CFP  +NGS ILLT+R  ++  YA + N
Sbjct  250  LKSKRYLIVMDDMWSSKAWDEVKQCFPTQSNGSRILLTTRDTELACYAGTKN  301



>gb|ACE79506.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=279

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG + +F  I DQL  Q  T    VVSIVGMGGIGK+TLA+ ++ HPS+   FD 
Sbjct  17   EENTLVGMEDVFNNIRDQLFGQ--TPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDI  74

Query  281  RAWLTVSQEYSVEQMLRCLLSCVT----AASRD-GQDQLAESVRKCLKSQRYLIVIDDIW  117
             +W+TVSQ    ++ML  +LS  T    A  RD  +D+L + V + LK +RYLIV+DD+W
Sbjct  75   SSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMW  134

Query  116  NTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
               AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  135  TIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  170



>gb|ACE79503.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=285

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG + +F  I DQL  Q  T    VVSIVGMGGIGK+TLA+ ++ HPS+   FD 
Sbjct  17   EENTLVGMEDVFNNIRDQLFGQ--TPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDI  74

Query  281  RAWLTVSQEYSVEQMLRCLLSCVT----AASRD-GQDQLAESVRKCLKSQRYLIVIDDIW  117
             +W+TVSQ    ++ML  +LS  T    A  RD  +D+L + V + LK +RYLIV+DD+W
Sbjct  75   SSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMW  134

Query  116  NTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
               AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  135  TIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  170



>ref|XP_011087330.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087331.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087332.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=837

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 100/155 (65%), Gaps = 6/155 (4%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG  +   K+ D L   Q T  R+VV IVGMGGIGK+TLA+ +Y+   I SHFD RAW 
Sbjct  137  VVGITEDVNKLRDWLTNLQDTGARKVVPIVGMGGIGKSTLARHLYDDSFIISHFDTRAWS  196

Query  269  TVSQEYSVEQMLRCLLSCVTAASRD---GQ--DQLAESVRKCLKSQRYLIVIDDIWNTTA  105
            TVSQ Y+V ++L  LL CVT    D   G+  DQL   + + LK +RYLIV+DDIWN   
Sbjct  197  TVSQNYNVHKILLDLLGCVTGKPTDEMLGEEDDQLGLRLHQNLKRRRYLIVLDDIWNIEP  256

Query  104  WDSV-QRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            W+ + +R FPDD NGS I++T+R  KV +   SG+
Sbjct  257  WEHIARRYFPDDGNGSRIIVTTRESKVADDTGSGS  291



>gb|ACE79490.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D   +++L+ L T++++   +V+ I+GMGGIGKTTLA++VY   SI SHFD RAW 
Sbjct  32   MVGRDDQRKRLLEDL-TRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWA  90

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQ--LAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            TVS  ++V+++L  LL      +   +D+  LA+ ++K LKS+RYLIV+DD+W++ AWD 
Sbjct  91   TVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRYLIVMDDMWSSKAWDD  150

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            V++CFP +NN S +LLT+R   V  YA + N
Sbjct  151  VRQCFPSENNESRVLLTTRDTDVACYAGTEN  181



>gb|EYU21178.1| hypothetical protein MIMGU_mgv1a019709mg [Erythranthe guttata]
Length=889

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 100/147 (68%), Gaps = 4/147 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG ++   ++LD+L  QQ+   RQV+ IVGMGGIGKTTLA+  YEH  I  HFD R W+
Sbjct  183  MVGFEEQLLQLLDKLTGQQS--NRQVIPIVGMGGIGKTTLAKNAYEHSLIVHHFDIRTWI  240

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQ+Y+V ++L  LLS     S+  +  L + + K L ++RYLIVIDDIW+  AW+ V 
Sbjct  241  TVSQKYNVIELLLQLLS--EKNSQIDEQLLGQKLHKMLWARRYLIVIDDIWSIEAWEEVS  298

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASS  9
            R FPD+NNGS I++T+R+  V  Y  S
Sbjct  299  RFFPDNNNGSRIVVTTRISNVAIYFDS  325



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/318 (31%), Positives = 160/318 (50%), Gaps = 49/318 (15%)
 Frame = -1

Query  902  VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTI  723
            +G+ ++ + SL  + G  QD L+K+ +   V G  ++LE  IR    + E  IE+++   
Sbjct  25   IGDTRKMIESLLDSAGYFQDFLEKTYMRRQVFGNSEELERVIRIAVNDVENVIELKMHEY  84

Query  722  YLAKGSLLHITACLLR---LHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqr  552
             L K    H +   L    L + ++   ++ D+ ++      + N+ L            
Sbjct  85   NLLK----HCSRVGLPRQPLCDDLLPLVEKIDFVKRKMMRFVTLNEDLPS----------  130

Query  551  glqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQV  372
                 +   L H   +++   N         ++ +VG +    K++ +L    ++  R++
Sbjct  131  -----RDYLLGHSSSRRVASLNL--------ENVVVGLEDDLLKVMRRLTGPPSS--REI  175

Query  371  VSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDG  192
            VSI+GMGGIGKTTLA+KVY HP + + FD   W+T+SQEY    +L  +L+C+     + 
Sbjct  176  VSILGMGGIGKTTLAKKVYHHPEVRNRFDVHIWITISQEYQTRDLLLGILACIFQLKNEV  235

Query  191  Q-----------------DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNG  63
            Q                 DQL + + K LK +RYL+++DDIW+   WD + R FPDDNNG
Sbjct  236  QNETYRLAVGDEIKESSDDQLMDMIHKKLKYRRYLVIMDDIWSKGIWDLMTRIFPDDNNG  295

Query  62   SCILLTSRLKKVGEYASS  9
            S I+LTSR K+V E+A  
Sbjct  296  SRIILTSRHKEVAEHADP  313



>gb|ACE79505.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=302

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 107/172 (62%), Gaps = 8/172 (5%)
 Frame = -1

Query  509  HKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTL  330
            HKK +    S      +++ +VG + +F  I DQL  Q  T    VVSIVGMGGIGK+TL
Sbjct  23   HKKTLPPRSSGRVLD-EENTLVGMEDVFNNIRDQLFGQ--TPALNVVSIVGMGGIGKSTL  79

Query  329  AQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT----AASRD-GQDQLAESVR  165
            A+ ++ HPS+   FD  +W+TVSQ    ++ML  +LS  T    A  RD  +D+L + V 
Sbjct  80   ARSLFNHPSVYHRFDISSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVH  139

Query  164  KCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            + LK +RYLIV+DD+W   AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  140  RELKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  191



>gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata]
Length=775

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = -1

Query  473  ASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITS  294
             S  + + MVG D+   ++LD+L  Q+    RQV+ IVGMGGIGKTTLA+  YEH  I  
Sbjct  78   CSTPEKNTMVGFDEQLLRLLDKLTGQRC--DRQVIPIVGMGGIGKTTLAKNAYEHSLIVH  135

Query  293  HFDKRAWLTVSQEYSVEQMLRCLLSCVTAA--SRDGQDQLAESVRKCLKSQRYLIVIDDI  120
             FD R W+T+SQEY+V ++   LLS + +   S   +  L + + K L  +RYLIVIDDI
Sbjct  136  RFDIRTWVTISQEYNVRELFVQLLSTLISEMDSETNEQLLGQKLHKILWGRRYLIVIDDI  195

Query  119  WNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            W+  AW+ V R FPD+NNGS I++T+R+  V  Y  S
Sbjct  196  WSVEAWEEVSRFFPDNNNGSRIVVTTRISNVAIYFDS  232



>gb|ACE79504.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=274

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG + +F  I DQL  Q  T    VVSIVGMGGIGK+TLA+ ++ HPS+   FD  +W+
Sbjct  4    LVGMEDVFNNIRDQLFGQ--TPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSWV  61

Query  269  TVSQEYSVEQMLRCLLSCVT----AASRD-GQDQLAESVRKCLKSQRYLIVIDDIWNTTA  105
            TVSQ    ++ML  +LS  T    A  RD  +D+L + V + LK +RYLIV+DD+W   A
Sbjct  62   TVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMWTIEA  121

Query  104  WDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            WD V+R FPDD NGS I++T+RL +V   A +
Sbjct  122  WDQVRRSFPDDENGSRIMITTRLLEVANCAGN  153



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/300 (34%), Positives = 152/300 (51%), Gaps = 45/300 (15%)
 Frame = -1

Query  878  VSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
            +   + L  LQ  LQ+       +GA++DLE +IRD   +AE RIE++L+   LAK    
Sbjct  33   IKFFEKLSSLQAFLQQK------SGAIRDLEIQIRDFALDAEDRIEIQLSNFLLAKNRED  86

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A   +LH+ +IEA +   +  +++  +  +                       +  H
Sbjct  87   QQKAAQ-KLHQTLIEAAENAAHLLKISNESDDE----------------------SNECH  123

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGK  339
             L+   +  S       K +  RMVG    +  + +QLL    +  R+V+ IVGM GIGK
Sbjct  124  SLIPWSLDTS-LRLQPPKLE-GRMVGRRNDYLLVKNQLLY---SDQRRVILIVGMNGIGK  178

Query  338  TTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ--------  183
            TTLA  VYE  S+ SHFD RAW+T+S EY++ Q L  LL  +   + + + +        
Sbjct  179  TTLAASVYEDSSVASHFDVRAWITMSGEYTMRQTLHDLLLTLAEPNHETRKRTTLDLDDD  238

Query  182  ---LAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
               LA+ V KCLK + YLIV+D++WN   WD +Q  FP+D+NGS I+LT+     G Y S
Sbjct  239  DDLLAKQVSKCLKGKIYLIVLDNLWNNRVWDDIQGYFPNDSNGSRIVLTTTHFDQGSYTS  298



>gb|AGX27506.1| NBS-LRR class resistance protein Fy12-Ry1, partial [Sesamum indicum]
Length=616

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR  198
            + V I GMGGIGKTTLA+  Y    I  HFD RAWLTVSQ+YSV+QML  L+  +   + 
Sbjct  195  EFVPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAWLTVSQDYSVQQMLFALVDSIKPFNE  254

Query  197  --DGQ----DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRL  36
              DG+    +Q++E V K  K +RYL+V+DD+W+T AWD V+R  PDD+NGS I++T+RL
Sbjct  255  KFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDVWSTKAWDDVRRILPDDSNGSRIIITTRL  314

Query  35   KKVGEYASSGN  3
            + V  YA S +
Sbjct  315  QDVAAYADSSS  325



>gb|AGW28126.1| NBS-LRR class resistance protein Fy12-Ry12, partial [Sesamum 
indicum]
Length=499

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR  198
            + + I GMGGIGKTTLA+  Y    I  HFD RAWLTVSQ+YSV+QML  L+  +   + 
Sbjct  195  EFIPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAWLTVSQDYSVQQMLFALVDSIKPFNE  254

Query  197  --DGQ----DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRL  36
              DG+    +Q++E V K  K +RYL+V+DD+W+T AWD V+R  PDD+NGS I++T+RL
Sbjct  255  KFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDMWSTKAWDDVRRILPDDSNGSRIIITTRL  314

Query  35   KKVGEYASSGN  3
            + V  YA S +
Sbjct  315  QDVAAYADSSS  325



>gb|AEW48200.1| disease resistance protein RGH7 [Solanum x edinense]
Length=908

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 153/293 (52%), Gaps = 37/293 (13%)
 Frame = -1

Query  875  SLHQNLGLLQDILQKS-EIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAKGSLL  699
              ++ L  L+ IL+KS  I  D  G +   E EI +V +  E  ++ E   ++LA+    
Sbjct  26   PFYEKLKSLRAILEKSCNIMGDHEG-LTIFEVEIIEVAYTTEDMVDWESRNVFLAQNLEE  84

Query  698  HITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKGSSLH  519
               A    + EI    E+  +      K   + + ++ D+              + SSL 
Sbjct  85   RSRA----MWEIFFVLEQALECIDSTVKQWMATSDSMKDLKP------------QTSSLV  128

Query  518  HLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQ--VVSIVGMGGI  345
             L           ++A +  ++ MVG +  FE +LDQL       GR+  VVSIVGMGGI
Sbjct  129  SL----------PEHAVEQPENIMVGRENEFEMMLDQL----ARGGRELEVVSIVGMGGI  174

Query  344  GKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVR  165
            GKTTLA K+Y    I S FD RA  TVSQEY V  +L  LLS     S +   QLA+ ++
Sbjct  175  GKTTLATKLYSDLCIMSRFDIRAKATVSQEYCVRNVLLGLLS---LTSDEPDYQLADRLQ  231

Query  164  KCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            K LK +RYL+VIDDIW T AWD ++ C PD  NGS ILLT+R  +V EYASSG
Sbjct  232  KHLKGRRYLVVIDDIWTTEAWDDIKLCLPDCINGSRILLTTRNVEVAEYASSG  284



>gb|EYU29922.1| hypothetical protein MIMGU_mgv1a0259201mg, partial [Erythranthe 
guttata]
Length=778

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 100/149 (67%), Gaps = 2/149 (1%)
 Frame = -1

Query  455  SRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            S+MVG ++   ++LD L  +Q++   Q++ IVGMGGIGKTTLA+  YEH  I +HFD RA
Sbjct  46   SKMVGFEEELIQLLDVLTARQSS--LQIIPIVGMGGIGKTTLARNAYEHRLIVNHFDIRA  103

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            W T+SQEYS+ ++   L S   ++    + QLA+ + + L  +RYLI++DDIW+  AW+ 
Sbjct  104  WATISQEYSLTEIFSTLFSPQISSQSTDEQQLAQQLYQSLIDRRYLIILDDIWSINAWEK  163

Query  95   VQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            +   FPD+NNGS I+LT+RL  V  +  S
Sbjct  164  MMFFFPDNNNGSRIILTTRLSNVAVHFGS  192



>gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial [Erythranthe 
guttata]
Length=690

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTK--GRQVVSIVGMGGIGKTTLAQKVYEHPSITSHF  288
            + S+MVG    FE  L QL+ + T +   RQ++ IVGMGGIGKTTLA+ VYE+P I  HF
Sbjct  168  EKSKMVG----FEDDLLQLMERLTGRQPNRQIIPIVGMGGIGKTTLARNVYENPLIVQHF  223

Query  287  DKRAWLTVSQEYSVEQMLRCLLSC--VTAASRDGQD--QLAESVRKCLKSQRYLIVIDDI  120
            D   W+TVSQEYSV ++L  LLSC     +  DG+D  QL E + K L   RYLIV+DD+
Sbjct  224  DICCWVTVSQEYSVRKVLLELLSCQIKPTSEMDGKDEAQLGEQLYKSLFGMRYLIVLDDM  283

Query  119  WNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            W+  AWD + R  P++NN S +++T+RL +V  +  S
Sbjct  284  WSIDAWDKINRFLPNNNNRSQVVVTTRLLEVANHFGS  320



>ref|XP_006367915.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Solanum tuberosum]
Length=383

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 108/185 (58%), Gaps = 17/185 (9%)
 Frame = -1

Query  512  VHKKIIVSNFSKNASKFDDSR----------MVGCDKMFEKILDQLLTQQTTKGRQVVSI  363
            V KKI V+ F+   S   D+           ++G D+   KI D+L+ Q +    +VV I
Sbjct  120  VMKKIKVNKFNSKISHSRDTSSQIPMDQKDVIIGLDEDLLKIKDRLIVQSSR--LEVVPI  177

Query  362  VGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ--  189
            +GMGGIGKTTLA++VY+   I  HF  RAW  VSQE+   ++   +L  +     + +  
Sbjct  178  IGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGVVKDEVERN  237

Query  188  ---DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
               +QLAE V + LK  +YLIV+DD+W+  AW  V+R FPDD+NGS ILLT+RL  V   
Sbjct  238  STNEQLAERVYRSLKGMKYLIVLDDMWSIEAWKHVRRSFPDDHNGSRILLTTRLVDVASC  297

Query  17   ASSGN  3
            A SGN
Sbjct  298  ACSGN  302



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 12/157 (8%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGR--QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            MVG    FE  L  + T+   + R  + V I GMGGIGKTTLA+  Y+   I  HFD RA
Sbjct  176  MVG----FEDDLMAIKTRLCGESRNLEFVPIYGMGGIGKTTLARNAYDDRLIIQHFDTRA  231

Query  275  WLTVSQEYSVEQMLRCLLSCVTAAS------RDGQDQLAESVRKCLKSQRYLIVIDDIWN  114
            WLTVSQ+YS+++ML  ++  + A +      +   +++AE   K LK +RYL+V+DDIW+
Sbjct  232  WLTVSQDYSIQEMLFAIIDSINAFNETFDEKKHSYERMAEHAYKGLKGRRYLVVLDDIWS  291

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            T AWD ++R FPDDNNGS I+LT+RL+ V  YA   +
Sbjct  292  TKAWDDMRRIFPDDNNGSRIILTTRLQDVAAYADPSS  328



>ref|XP_009768089.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=842

 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 110/167 (66%), Gaps = 7/167 (4%)
 Frame = -1

Query  491  SNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYE  312
            +NFS      ++  ++G +  F  I D+L+ Q   +   +VSIVGMGG+GKTTLA++V+ 
Sbjct  100  NNFSSRDVLDEEITLIGMEDDFNDIRDRLIGQ--ARELNIVSIVGMGGMGKTTLARQVFS  157

Query  311  HPSITSHFDKRAWLTVSQEYSVEQMLRCLLSC----VTAASRD-GQDQLAESVRKCLKSQ  147
            +PS+   FD  +W+T+SQEY   ++L  +LS     VTA   D   DQL E + + LK +
Sbjct  158  NPSVLFRFDVSSWVTISQEYEAREILINVLSFGTSDVTAVYHDKSYDQLLEHLYRKLKGK  217

Query  146  RYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            RYLIV+DD+W+  AWD V+R FPDDNNGS I++T+RL +V + A +G
Sbjct  218  RYLIVMDDLWSIEAWDLVKRSFPDDNNGSRIMITTRLLEVADCAGNG  264



>gb|AAZ07910.1| NBS-LRR protein [Ipomoea batatas]
Length=132

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 82/125 (66%), Gaps = 6/125 (5%)
 Frame = -1

Query  359  GMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLL-----SCVTAASRD  195
            GMGGIGKTTLA+ VYE   I  HFD RAW+TVSQ YS++ +LR LL     S  T     
Sbjct  1    GMGGIGKTTLAKSVYEDKDIKRHFDIRAWITVSQSYSMDDLLRMLLQSIGISSTTKEQSA  60

Query  194  GQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDN-NGSCILLTSRLKKVGEY  18
            G  +L + VRK L  +RYLI IDDIW+T  WD ++ CFP +  NGS +LLT+RL  V  +
Sbjct  61   GTFELKDKVRKLLLGKRYLIAIDDIWSTQVWDDLKICFPSEKRNGSRVLLTTRLTNVATH  120

Query  17   ASSGN  3
            ASSG 
Sbjct  121  ASSGG  125



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 108/327 (33%), Positives = 169/327 (52%), Gaps = 39/327 (12%)
 Frame = -1

Query  971  LRINKLLRLPRVYGKQQLAQLREVGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKD  792
            L+ N  L LP    ++Q   L +   VK+++ S  Q +G LQ +L+  E   +    ++ 
Sbjct  17   LQSNSRLNLP---NEEQTESLHK--RVKEQIQSFRQKVGSLQALLETLEKNINDPKTIEH  71

Query  791  LEAEIRDVWFNAEGRIEMELTTIYLAKGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKA  612
             E +I+D   +AE RIE  L   Y A+                 +  E   ++ ++L KA
Sbjct  72   CEVKIKDAAHDAEYRIESVLEKFYKAQNE--------------KVSREAYEEFCKRLQKA  117

Query  611  ASSQNQTLTDVSllgrirqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDK  432
            + S      D +           L   SSL       I   +  +++ +  +S MVG + 
Sbjct  118  SES-----IDSNSRKLTESMKSGLQATSSL-------IQSFDLPEHSPQLGNS-MVGHEN  164

Query  431  MFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEY  252
              E +  +L+ + ++  R+ ++I GMGGIGKTT A+K+Y+ P I SHFD  AW+TVS+EY
Sbjct  165  ELEDVKCKLM-KISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWVTVSKEY  223

Query  251  SVEQMLRCLLSCVTAAS---RDGQD--QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQR  87
             V +ML  LL C+ +     R+ +D  +LA  +++ L  +RYL+VIDDIW++ AWD +  
Sbjct  224  CVRKMLLQLLHCIPSTEEVRREARDDGELAGKLKQRLWKRRYLVVIDDIWSSKAWDDISL  283

Query  86   CFPDDNNGSCILLTSRLKKVGEYASSG  6
             FP D  GS ILLT+R   V  YA+ G
Sbjct  284  WFP-DCKGSHILLTTRCGNVASYAAPG  309



>gb|AAM47597.1|AF513548_1 NBS/LRR resistance protein-like protein [Capsicum annuum]
Length=175

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = -1

Query  359  GMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----G  192
            GMGG+GKTTLA++VY+   +  HF  RAW+TVSQ +   +ML  +L C +  + +     
Sbjct  1    GMGGVGKTTLARQVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDNTYLKS  60

Query  191  QDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
             +QLAE V + LK +RYLI +DD+W+T+AWD V+R FPDD NGS ++LTSR+  VG YAS
Sbjct  61   TEQLAEQVYRSLKGRRYLIAMDDVWDTSAWDVVKRSFPDDKNGSRVILTSRIANVGIYAS  120

Query  11   SGN  3
            SG+
Sbjct  121  SGS  123



>gb|EYU21437.1| hypothetical protein MIMGU_mgv1a020693mg [Erythranthe guttata]
Length=916

 Score =   141 bits (356),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 106/166 (64%), Gaps = 9/166 (5%)
 Frame = -1

Query  485  FSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHP  306
            FS   +    + MVG D+   +I DQL    +    Q++ +VGMGGIGKTTLA  ++  P
Sbjct  188  FSAEVNSPRKTTMVGFDEDLMEIKDQLCGDSSK--LQIIPLVGMGGIGKTTLATNIFHDP  245

Query  305  SITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTA----ASRDGQD---QLAESVRKCLKSQ  147
             I  HF  RAW+T+SQ Y++ +++R LLS ++      SR+ +D   +LA  + K LK +
Sbjct  246  LIEYHFHIRAWITISQRYNIREIIRSLLSSISTNTDKLSRETEDREMELAVCLYKSLKGR  305

Query  146  RYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            ++LIV+DDIW+T AWD ++  FPDD NGS I+LT+RL  V  YA+S
Sbjct  306  KFLIVLDDIWSTEAWDDIKMLFPDDRNGSRIVLTTRLVDVAVYANS  351



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score =   141 bits (356),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 6/130 (5%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS-  201
            + + I GMGGIGKTTLA+  Y+   I  HF  RAW+TVSQ+YS+++ML  L+  + A S 
Sbjct  186  EFIPIYGMGGIGKTTLARSAYDDALIIEHFHIRAWVTVSQDYSIQEMLFTLVDSIKAFSE  245

Query  200  -----RDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRL  36
                 +   +Q+AE V K LK +RYL+V+DD+W+T AWD V+R FPDDNNGS I++T+RL
Sbjct  246  KFDEEKHSYEQMAEHVYKNLKGRRYLVVLDDMWSTKAWDDVRRIFPDDNNGSRIMITTRL  305

Query  35   KKVGEYASSG  6
            + V  YA S 
Sbjct  306  QDVAAYADSS  315



>gb|AGX27505.1| NBS-LRR class resistance protein Fy12-Ry1, partial [Sesamum indicum]
Length=616

 Score =   139 bits (350),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR  198
            + + I GMGGIGKTTLA+  Y    I  HFD RAWLTVSQ+YSV+QML  L+  +   + 
Sbjct  195  EFIPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAWLTVSQDYSVQQMLFALVDSIKPFNE  254

Query  197  --DGQ----DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRL  36
              DG+    +Q++E V K  K +RYL+V+DD+W+T AWD V+R  PDD+NGS I++T+RL
Sbjct  255  KFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDMWSTKAWDDVRRILPDDSNGSRIIITTRL  314

Query  35   KKVGEYASSGN  3
            + V  YA S +
Sbjct  315  QDVAAYADSSS  325



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score =   141 bits (355),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 104/181 (57%), Gaps = 16/181 (9%)
 Frame = -1

Query  506  KKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLA  327
            K  + S+F+  A + D +++VG D    K+L QL        RQV+ IVGMGGIGKTTLA
Sbjct  135  KFTMPSDFTPIAEE-DSNKLVGLDAYILKLLHQL--SGFPLDRQVIPIVGMGGIGKTTLA  191

Query  326  QKVYEHPSITSHFDKRAWLTV------SQEYSVEQMLRCLLSCVTAASRD----GQDQLA  177
            +++Y  P I  HF  RAW+T+      SQ Y V +M   LL C    + +      ++L 
Sbjct  192  ERIYNDPFIIYHFYVRAWITIPQKHLMSQPYRVREMFLGLLKCFANVTYNTSQMSNEELG  251

Query  176  ESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA---SSG  6
            E V K LK  RYL+V+DD+W T  WD + R  PDD NGS I+LTSRL  +  Y    SSG
Sbjct  252  EKVYKALKGMRYLVVLDDMWQTRDWDILTRFLPDDKNGSRIMLTSRLGDIAAYVDPTSSG  311

Query  5    N  3
            +
Sbjct  312  H  312



>ref|XP_006366837.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=618

 Score =   139 bits (349),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            +S +VG +    +I+ +L    +T  R+++ I+GMGGIGKTTLA+  Y+ P I +HFD  
Sbjct  146  ESVVVGLEDDLMRIIRRLKGSMST--REIIPILGMGGIGKTTLAKMAYDDPQIRNHFDIH  203

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRDGQD-QLAESVRKCLKSQRYLIVIDDIWNTTAW  102
             W+T+SQEY    +L  ++SC+    + G D +L + + K LK +RYL+V+DDIW+   W
Sbjct  204  VWVTISQEYQTRYLLLGVVSCIFNEIKQGTDNELMDMIYKKLKGRRYLVVMDDIWSNEVW  263

Query  101  DSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            D + R FPDD+NGS I+LTSRLK V  +A  
Sbjct  264  DLMSRTFPDDDNGSRIILTSRLKGVATHADP  294



>ref|XP_009780398.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=186

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 98/151 (65%), Gaps = 10/151 (7%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MV  ++  E +++QL+T Q  +   V+SI GM G+GKTTLA+K+Y+H +I++ FD R W 
Sbjct  1    MVDFNEEIEMLVEQLVTGQ--RQLDVISIFGMPGLGKTTLAKKLYDHEAISNRFDIRLWC  58

Query  269  TVSQEYSVEQMLR------CLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTT  108
              SQ Y    +L       C L  +T    D  D+LAE + + LK +RYLIV+DD+W++ 
Sbjct  59   CSSQSYDKRALLFELLGHICELDDITKVKSD--DELAEKLYRYLKGKRYLIVVDDVWSSN  116

Query  107  AWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            AWD ++R FPDDN GS I+LT+RL+ +  YA
Sbjct  117  AWDDIKRPFPDDNKGSRIILTTRLESIATYA  147



>gb|AEQ63709.1| NBS-LRR class resistance protein [Sesamum indicum]
Length=161

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 158/318 (50%), Gaps = 46/318 (14%)
 Frame = -1

Query  926  QQLAQLRE---VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNA  756
            +Q  QL+      E++  + SL  +L   Q+ L+ +   +   G +K+LE +IR V   A
Sbjct  14   EQFVQLQPHWISAEIRIMVDSLLVSLEYFQNFLENTSKRSQDHGHIKELERDIRTVVNEA  73

Query  755  EGRIEMELTTI-----YLAKGSLLHITACLLRLHEIV----IEAEKQTDYYQQLAKAASS  603
            E  IE+++  I      +A  +L  I   L+   ++V    I +   TD   ++      
Sbjct  74   EDVIELKIYEINQLDRTIASKALCEILPPLVEKIDLVKREVIGSSFSTD---KIHGYGDP  130

Query  602  QNQTLTDVSllgrirqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFE  423
             N+ L                        L H    V+N         ++ +VG +    
Sbjct  131  MNENL-----------------------QLGHSSRQVANLKL------ETIVVGLEDDLI  161

Query  422  KILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVE  243
            KI  +L    +T  R+VV I+GMGGIGKTTLA+K Y+   I   FD   W+TVSQEY + 
Sbjct  162  KIKRRLTGPPST--REVVPILGMGGIGKTTLAKKAYDDSEIRHRFDFHVWVTVSQEYRIR  219

Query  242  QMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNG  63
             +L  +LSC +   ++  DQL + + K LK +RYL+V+DDIW+   WD + R FPDDNNG
Sbjct  220  DLLLGVLSCTSNEIKETDDQLMDMIYKNLKRKRYLVVMDDIWSNDVWDLMTRNFPDDNNG  279

Query  62   SCILLTSRLKKVGEYASS  9
            S I+LTSRLK +  +A  
Sbjct  280  SRIILTSRLKDLAIHADP  297



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 158/318 (50%), Gaps = 46/318 (14%)
 Frame = -1

Query  926  QQLAQLRE---VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNA  756
            +Q  QL+      E++  + SL  +L   Q+ L+ +   +   G +K+LE +IR V   A
Sbjct  14   EQFVQLQPHWISAEIRIMVDSLLVSLEYFQNFLENTSKRSQDHGHIKELERDIRTVVNEA  73

Query  755  EGRIEMELTTI-----YLAKGSLLHITACLLRLHEIV----IEAEKQTDYYQQLAKAASS  603
            E  IE+++  I      +A  +L  I   L+   ++V    I +   TD   ++      
Sbjct  74   EDVIELKIYEINQLDRTIASKALCEILPPLVEKIDLVKREVIGSSFSTD---KIHGYGDP  130

Query  602  QNQTLTDVSllgrirqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFE  423
             N+ L                        L H    V+N         ++ +VG +    
Sbjct  131  MNENL-----------------------QLGHSSRQVANLKL------ETIVVGLEDDLI  161

Query  422  KILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVE  243
            KI  +L    +T  R+VV I+GMGGIGKTTLA+K Y+   I   FD   W+TVSQEY + 
Sbjct  162  KIKRRLTGPPST--REVVPILGMGGIGKTTLAKKAYDDSEIRHRFDFHVWVTVSQEYRIR  219

Query  242  QMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNG  63
             +L  +LSC +   ++  DQL + + K LK +RYL+V+DDIW+   WD + R FPDDNNG
Sbjct  220  DLLLGVLSCTSNEIKETDDQLMDMIYKNLKRKRYLVVMDDIWSNDVWDLMTRNFPDDNNG  279

Query  62   SCILLTSRLKKVGEYASS  9
            S I+LTSRLK +  +A  
Sbjct  280  SRIILTSRLKDLAIHADP  297



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG +  F  I DQL  Q  T    VVSIVGMGGIGK+TLA+ ++ HPS++  FD 
Sbjct  93   EENSLVGMEDDFNIIRDQLFRQ--TPELNVVSIVGMGGIGKSTLARSLFNHPSVSPRFDI  150

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIW  117
             +W+TVSQ Y  ++ML  +LS  T   +       +D+L + V + LK +RYLIV+DD+W
Sbjct  151  SSWVTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMW  210

Query  116  NTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
               AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  211  TIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  246



>gb|AEQ61809.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>ref|XP_009769771.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=771

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 104/154 (68%), Gaps = 3/154 (2%)
 Frame = -1

Query  482  SKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPS  303
            +K +++  +   VG +   EKI+ +LLT+   + R +VSI GM G+GKTTLA+K+++  S
Sbjct  10   AKQSTQVTEEEPVGLEDDAEKII-KLLTR-GIRERDIVSIFGMPGLGKTTLAKKIFKDSS  67

Query  302  ITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ-LAESVRKCLKSQRYLIVID  126
            I SHFD RAWLT+SQ Y V ++LR +   VT    D ++  +A+++RKCL  +RYLIV+D
Sbjct  68   IVSHFDVRAWLTISQSYDVRELLRNIYKQVTGVEYDDKESDIADTLRKCLMGKRYLIVLD  127

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVG  24
            D+W   AWD ++ CFP    G+ I+LT+RLK V 
Sbjct  128  DVWEVDAWDELRLCFPIGKQGNRIMLTTRLKHVA  161



>gb|AEQ61819.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSGVMLTSRLRDIAVHA  117



>ref|XP_011087309.1| PREDICTED: putative disease resistance protein At1g50180 isoform 
X2 [Sesamum indicum]
Length=546

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 110/333 (33%), Positives = 161/333 (48%), Gaps = 52/333 (16%)
 Frame = -1

Query  920  LAQLREVGEVKQKMVS-LHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRI  744
            L  L E  +  Q++ S L + +G L  IL      N ++  ++DLE +IRD  F A+  I
Sbjct  10   LQTLEESPQPMQQIPSHLLEKVGRLLRILDDPSRKNILS--IRDLEGKIRDASFEAQDII  67

Query  743  EMELTTIYL---------AKGSLLHITACLLRLHEIVIEAEKQTDYYQQ--------LAK  615
            E  +T   L                I + L  +  ++   E  TD+  Q        L +
Sbjct  68   ESHITADQLELSESVSSGVGSCFCDIISALQNMFPVIHLRETSTDFMDQGMNLEVRGLER  127

Query  614  AASSQNQTLTDVSl----lgrirqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRM  447
                 +  L  +S          + G     GSS       + + SN         +S +
Sbjct  128  VIDELDLILEALSKIKDGKEEAPEAGNSRAAGSS-------RFVASN---------ESGL  171

Query  446  VGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLT  267
            VG D+    + D+L     +    ++SIVGMGGIGKTTLA+ +Y    I   FD RAW+ 
Sbjct  172  VGLDEDLMHLRDRL--TGFSSNLDIISIVGMGGIGKTTLARNLYNDRLIEERFDTRAWVV  229

Query  266  VSQEYSVEQMLRCLLSCVTAASRDGQD-------QLAESVRKCLKSQRYLIVIDDIWNTT  108
            VSQ+YSV+++L  L   V +  RDG +       +L  S+ K LK +RYLIV+DD+W+T 
Sbjct  230  VSQDYSVQELLMVL---VNSTRRDGGEVDKKIVEELKVSLHKNLKGRRYLIVMDDVWDTK  286

Query  107  AWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            AWD V+R FPDDNN S I+LT+R  +V  YA+ 
Sbjct  287  AWDEVKRFFPDDNNSSRIILTTRQSEVAMYANP  319



>ref|XP_009617048.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X4 [Nicotiana tomentosiformis]
Length=740

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 14/157 (9%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG +    KI+ +L+      GR+VVSI+GM GIGKTTLA+K Y HP I + FD   W+
Sbjct  157  VVGLEDDLMKIMRRLIGPPC--GREVVSILGMAGIGKTTLAKKAYHHPEIRNRFDIHVWV  214

Query  269  TVSQEYSVEQMLRCLLSCVTAAS-------RD-----GQDQLAESVRKCLKSQRYLIVID  126
            T+SQEY +  +   +LSC+   S       RD       DQL + + K LK +RYL+V+D
Sbjct  215  TISQEYRIRDLWLSILSCIPHISETYPMDVRDEINESTDDQLMDMIYKKLKCRRYLVVMD  274

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            DIW+   WD + R FPDDNNGS I+LTSR ++V ++A
Sbjct  275  DIWSKEIWDLMTRIFPDDNNGSRIILTSRHEQVAKHA  311



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 100/154 (65%), Gaps = 8/154 (5%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG D++  +++D+L  QQ+     ++ IVGMGGIGKTTLA+ VY  P I  HFD RAW+
Sbjct  183  VVGLDELLIEVMDKLTGQQSN--LHIIPIVGMGGIGKTTLARNVYAKPLIMQHFDIRAWV  240

Query  269  TVSQEYSVEQMLRCLLSCVT------AASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTT  108
            TVSQ Y+V+++L  +L C++      + S   + +L E+V K L  +RYLIV+DDIW+  
Sbjct  241  TVSQNYNVQEILLEILLCISKEKNLESLSWMSEGELGETVHKTLWGRRYLIVLDDIWSVE  300

Query  107  AWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            AWD V   FP++  GS I++T+RL  V    S G
Sbjct  301  AWDKVNLFFPENGQGSRIMITTRLSDVASIGSHG  334



>gb|AEQ63710.1| NBS-LRR class resistance protein [Sesamum indicum]
Length=170

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>gb|AEQ61808.1| NBS-LRR class disease resistance protein [Sesamum indicum]
 gb|AEQ61812.1| NBS-LRR class disease resistance protein [Sesamum indicum]
 gb|AEQ61814.1| NBS-LRR class disease resistance protein [Sesamum indicum]
 gb|AEQ61818.1| NBS-LRR class disease resistance protein [Sesamum indicum]
 gb|AEQ61821.1| NBS-LRR class disease resistance protein [Sesamum indicum]
 gb|AEQ61822.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>gb|AEQ61810.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYGVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>gb|ACU82871.1| nucleotide binding site-leucine rich repeat protein, partial 
[Solanum lycopersicum]
 gb|ACU82894.1| nucleotide binding site-leucine rich repeat protein, partial 
[Solanum lycopersicum]
 gb|ACU82895.1| nucleotide binding site-leucine rich repeat protein, partial 
[Solanum lycopersicum]
 gb|ACU82903.1| nucleotide binding site-leucine rich repeat protein, partial 
[Solanum lycopersicum]
Length=170

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 4/121 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR----DGQD  186
            GG+GKTTLA+KVY+   +  HF  RAW+TVSQ +   +ML  +L C +  +        +
Sbjct  1    GGVGKTTLARKVYDDIYMEHHFYVRAWITVSQMHQHREMLLGILRCFSLVNDYTYLKSTE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            QLAE V + LK +RYLI +DD+W+TTAWD V+R FPDD NGS ++LTSRL  VG YASSG
Sbjct  61   QLAEQVYRSLKGRRYLIAMDDVWDTTAWDVVKRSFPDDKNGSRVILTSRLANVGIYASSG  120

Query  5    N  3
            +
Sbjct  121  S  121



>gb|AEQ61817.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>gb|ACO25629.1| NBS-coding resistance protein [Nicotiana repanda]
Length=171

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----  189
            GGIGKTTLA K+Y  P I SHFD RA  TVSQEY    +L  LLS ++  + + Q     
Sbjct  1    GGIGKTTLANKIYSDPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDD  60

Query  188  DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            DQLA+ ++K LK  RYL+VIDD W   AWD ++RCFPD NNGS IL+T+R  +V E ASS
Sbjct  61   DQLADRLQKLLKCGRYLVVIDDTWTREAWDDIKRCFPDCNNGSRILMTTRNVEVAECASS  120

Query  8    G  6
            G
Sbjct  121  G  121



>ref|XP_009773240.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana sylvestris]
Length=675

 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 117/186 (63%), Gaps = 11/186 (6%)
 Frame = -1

Query  536  KGSSLHHLVHKKI---IVSNFS-KNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVV  369
            K  SL  L++  I   +V NF   + S   D+ MVG +   E +   L+ + ++   QVV
Sbjct  44   KVGSLQALLYSLITNSVVQNFDLPHHSVQLDNNMVGHENELEDMKSTLM-ETSSDETQVV  102

Query  368  SIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVT---AASR  198
            +IVGMGGIGKTT A+++Y+   I SHFD  AW+T+S+EY V +ML  LL C+    A SR
Sbjct  103  AIVGMGGIGKTTFARRIYDDLEIKSHFDILAWVTMSKEYGVRKMLLQLLHCIPSTEAVSR  162

Query  197  DGQD--QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVG  24
            +  D  +LA+ +++ L  +RYL+VIDDIW+T AWD + + FP D+ GS  LLT+R   V 
Sbjct  163  EATDDGELADKLKQKLWKRRYLVVIDDIWSTKAWDDISQWFP-DSKGSHALLTTRCGNVA  221

Query  23   EYASSG  6
             YA+SG
Sbjct  222  SYAASG  227



>ref|XP_010327575.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=790

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 154/297 (52%), Gaps = 31/297 (10%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            +Q + SL+QNL  LQ  L  +   +     +K +E  IRDV   AE +++  L  I LA 
Sbjct  30   QQYVQSLYQNLSALQLFLDNTTTKD--IETLKLVEKRIRDVICKAEDKVDSSLRNIILA-  86

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                                    D  ++   AA    + L  V       ++ + +V+ 
Sbjct  87   ------------------------DCGEKREGAAKFFEEELLKVEKDVDSLRKEVMVVEF  122

Query  530  SSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMG  351
            S  H     ++  +  S   S  +++ +VG +  F  I D++  Q  T    V+ I  MG
Sbjct  123  SK-HGRKCAELATTPSSPEKSTIEENTIVGMEDDFNIIFDRVTAQ--TDELTVIPIFDMG  179

Query  350  GIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-GQDQLAE  174
             IGKTTLA+K+Y+   I S FDK AW+T+S+EY+  QML  + S +T ++++   DQL E
Sbjct  180  SIGKTTLARKIYDDSYIRSRFDKHAWVTISEEYNQRQMLLEVASSITESNQEMSDDQLME  239

Query  173  SVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
             V + LK +R+LIVIDDIW+T AWD +Q   P+D+N S ILLT+RLK V +Y +  +
Sbjct  240  FVYRGLKGRRFLIVIDDIWSTEAWDLMQTICPNDDNKSRILLTTRLKYVADYVNCPD  296



>gb|AEQ61820.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDMAVHA  117



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 99/159 (62%), Gaps = 14/159 (9%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG +    KI+ +L+      GR+VVSI+GM GIGKTTLA+K Y HP I + FD   W+
Sbjct  141  VVGLEDDLMKIMRRLIGPPC--GREVVSILGMAGIGKTTLAKKAYHHPEIRNRFDIHVWV  198

Query  269  TVSQEYSVEQMLRCLLSCVTAAS-------RD-----GQDQLAESVRKCLKSQRYLIVID  126
            T+SQEY +  +   +LSC+   S       RD       DQL + + K LK +RYL+V+D
Sbjct  199  TISQEYRIRDLWLSILSCIPHISETYPMDVRDEINESTDDQLMDMIYKKLKCRRYLVVMD  258

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            DIW+   WD + R FPDDNNGS I+LTSR ++V ++A  
Sbjct  259  DIWSKEIWDLMTRIFPDDNNGSRIILTSRHEQVAKHADP  297



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 14/157 (9%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG +    KI+ +L+      GR+VVSI+GM GIGKTTLA+K Y HP I + FD   W+
Sbjct  157  VVGLEDDLMKIMRRLIGPPC--GREVVSILGMAGIGKTTLAKKAYHHPEIRNRFDIHVWV  214

Query  269  TVSQEYSVEQMLRCLLSCVTAAS-------RD-----GQDQLAESVRKCLKSQRYLIVID  126
            T+SQEY +  +   +LSC+   S       RD       DQL + + K LK +RYL+V+D
Sbjct  215  TISQEYRIRDLWLSILSCIPHISETYPMDVRDEINESTDDQLMDMIYKKLKCRRYLVVMD  274

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            DIW+   WD + R FPDDNNGS I+LTSR ++V ++A
Sbjct  275  DIWSKEIWDLMTRIFPDDNNGSRIILTSRHEQVAKHA  311



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score =   139 bits (349),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 14/157 (9%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG +    KI+ +L+      GR+VVSI+GM GIGKTTLA+K Y HP I + FD   W+
Sbjct  157  VVGLEDDLMKIMRRLIGPPC--GREVVSILGMAGIGKTTLAKKAYHHPEIRNRFDIHVWV  214

Query  269  TVSQEYSVEQMLRCLLSCVTAAS-------RD-----GQDQLAESVRKCLKSQRYLIVID  126
            T+SQEY +  +   +LSC+   S       RD       DQL + + K LK +RYL+V+D
Sbjct  215  TISQEYRIRDLWLSILSCIPHISETYPMDVRDEINESTDDQLMDMIYKKLKCRRYLVVMD  274

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            DIW+   WD + R FPDDNNGS I+LTSR ++V ++A
Sbjct  275  DIWSKEIWDLMTRIFPDDNNGSRIILTSRHEQVAKHA  311



>ref|XP_011077104.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=898

 Score =   139 bits (349),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR  198
            + + I GMGGIGKTTLA+  Y    I  HFD RAWLTVSQ+YSV+QML  L+  +   + 
Sbjct  195  EFIPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAWLTVSQDYSVQQMLFALVDSIKPFNE  254

Query  197  --DGQ----DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRL  36
              DG+    +Q++E V K  K +RYL+V+DD+W+T AWD V+R  PDD+NGS I++T+RL
Sbjct  255  KFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDMWSTKAWDDVRRILPDDSNGSRIIITTRL  314

Query  35   KKVGEYASSGN  3
            + V  YA S +
Sbjct  315  QDVAAYADSSS  325



>ref|XP_009763644.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=353

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 106/319 (33%), Positives = 164/319 (51%), Gaps = 38/319 (12%)
 Frame = -1

Query  944  PRVYGKQQLAQLREVGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVW  765
            PR  GK+    L+E  +VK+++ SL Q +G LQ +L+  E  ND    +K  E  I+   
Sbjct  26   PR-RGKEGTESLQE--KVKEQIQSLRQKVGSLQALLESLEKNND-HEVVKRCEGNIKVAA  81

Query  764  FNAEGRIEMELTTIYLAKGSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLT  585
             +AE RIE     I  AK   +   A            EK     Q+ +++  S+ + LT
Sbjct  82   HDAEYRIESVWEKILKAKNEKIQREA-----------YEKFCTRLQEASESIDSKCRKLT  130

Query  584  DVSllgrirqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFEKILDQL  405
            +         +    V  S +           +  +++ +  +  MVG +   E I  +L
Sbjct  131  E-------NMKSNLQVTNSLVQSF--------DLPEHSPQLGNC-MVGHENELEDIKCKL  174

Query  404  LTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCL  225
            + + ++  R+ ++I GMGGIGKTT A+K+Y+ P I SHFD  AW T S+EY V +ML  L
Sbjct  175  M-KISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWATASKEYCVRKMLLQL  233

Query  224  LSCVTAAS---RDGQD--QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGS  60
            L C+ +     R+ +D  +L+  +++ L  +RYL+VIDDIW++ AWD +   FP D  GS
Sbjct  234  LHCIPSTEEVRREARDDGELSGKLKQRLWKRRYLVVIDDIWSSKAWDEISLWFP-DCKGS  292

Query  59   CILLTSRLKKVGEYASSGN  3
             ILLT+R   V  YA+  N
Sbjct  293  HILLTTRCGNVASYAAPEN  311



>gb|AEQ61815.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S +      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISEEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score =   138 bits (348),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR  198
            +V+SIVGMGGIGK+T A K++  PSI S FD R W+TVS  YS+ +ML  LL     A++
Sbjct  175  EVISIVGMGGIGKSTFANKMFSDPSILSFFDVRGWITVSMNYSLRKMLLTLLQDTVGAAK  234

Query  197  DGQD----QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKK  30
            +  +    +LA+ ++K LK +RYLIV+DD+W+  AWD V+ CFP++NN S ILLT+R  K
Sbjct  235  ELDEKTDGELADHLQKSLKGRRYLIVVDDMWSREAWDDVRLCFPENNNRSRILLTTRDMK  294

Query  29   VGEYASS  9
            V +YASS
Sbjct  295  VAQYASS  301



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score =   138 bits (348),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = -1

Query  374  VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD  195
            VVSIVGMGGIGKTTLA+KVY+   +  HF  RAW+TVSQ +   +ML  +L C +  + +
Sbjct  161  VVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDN  220

Query  194  GQ----DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKV  27
                  +QLAE V + LK +RYLI +DD+W+T AWD V+R FPD+ NGS ++LTSRL  V
Sbjct  221  TYQKNIEQLAEQVYRSLKGRRYLIGMDDVWDTNAWDVVKRSFPDEKNGSRVILTSRLANV  280

Query  26   GEYASSGN  3
            G YASSG+
Sbjct  281  GIYASSGS  288



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score =   138 bits (348),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = -1

Query  377  QVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR  198
            +V+SIVGMGGIGK+T A K++  PSI S FD R W+TVS  YS+ +ML  LL     A++
Sbjct  175  EVISIVGMGGIGKSTFANKMFSDPSILSFFDVRGWITVSMNYSLRKMLLTLLQDTVGAAK  234

Query  197  DGQD----QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKK  30
            +  +    +LA+ ++K LK +RYLIV+DD+W+  AWD V+ CFP++NN S ILLT+R  K
Sbjct  235  ELDEKTDGELADHLQKSLKGRRYLIVVDDMWSREAWDDVRLCFPENNNRSRILLTTRDMK  294

Query  29   VGEYASS  9
            V +YASS
Sbjct  295  VAQYASS  301



>ref|XP_006367920.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X5 [Solanum tuberosum]
Length=476

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 110/185 (59%), Gaps = 17/185 (9%)
 Frame = -1

Query  512  VHKKIIVSNFSKNASKFDDSR----------MVGCDKMFEKILDQLLTQQTTKGRQVVSI  363
            V KKI V+ F+   S   D+           +VG D+   +I D+L+ Q +    +VV I
Sbjct  116  VMKKIKVNKFNSKISHSRDTSSQIPLDQKDIIVGLDEDLLRIKDRLIVQSSR--LEVVPI  173

Query  362  VGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ--  189
            +GMGGIGKTTLA++VY+   I  HF  RAW  VSQE+   ++   +L  + A + + +  
Sbjct  174  IGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGAVNDEVERN  233

Query  188  ---DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
               +QLAE V + LK ++YLIV+DD+W+  AW  V+R FPDD+NGS I+LT+RL  V   
Sbjct  234  STNEQLAERVYRSLKGRKYLIVLDDMWSIEAWQHVRRSFPDDHNGSRIVLTTRLADVASC  293

Query  17   ASSGN  3
            A S N
Sbjct  294  ACSVN  298



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = -1

Query  374  VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD  195
            VVSIVGMGGIGKTTLA+KVY+   +  HF  RAW+TVSQ +   +ML  +L C +  + +
Sbjct  161  VVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDN  220

Query  194  GQ----DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKV  27
                  +QLAE V + LK +RYLI +DD+W+T AWD V+R FPD+ NGS ++LTSRL  V
Sbjct  221  TYQKNIEQLAEQVYRSLKGRRYLIGMDDVWDTNAWDVVKRSFPDEKNGSRVILTSRLANV  280

Query  26   GEYASSGN  3
            G YASSG+
Sbjct  281  GIYASSGS  288



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = -1

Query  374  VVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD  195
            VVSIVGMGGIGKTTLA+KVY+   +  HF  RAW+TVSQ +   +ML  +L C +  + +
Sbjct  161  VVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDN  220

Query  194  GQ----DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKV  27
                  +QLAE V + LK +RYLI +DD+W+T AWD V+R FPD+ NGS ++LTSRL  V
Sbjct  221  TYQKNIEQLAEQVYRSLKGRRYLIGMDDVWDTNAWDVVKRSFPDEKNGSRVILTSRLANV  280

Query  26   GEYASSGN  3
            G YASSG+
Sbjct  281  GIYASSGS  288



>gb|EYU23518.1| hypothetical protein MIMGU_mgv1a019595mg [Erythranthe guttata]
Length=901

 Score =   138 bits (348),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 99/147 (67%), Gaps = 4/147 (3%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG ++   ++LD+L  QQ+   RQV+ IVGMGGIGKTTLAQ  YE P I  HFD R W+
Sbjct  153  MVGFEEHLFQLLDKLTVQQS--NRQVIPIVGMGGIGKTTLAQNAYEDPLIVQHFDIRTWV  210

Query  269  TVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            TVSQ+Y+V+Q+L  LLS    +    +  L + + K L  +RYLIVIDDIW+  AW+ V 
Sbjct  211  TVSQKYNVKQLLLQLLS--RQSCETDEHLLGQELHKMLWGRRYLIVIDDIWSIEAWEEVS  268

Query  89   RCFPDDNNGSCILLTSRLKKVGEYASS  9
            R FPD+NNGS I++T+R+  V  +  S
Sbjct  269  RFFPDNNNGSRIVMTTRISNVATHFDS  295



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score =   138 bits (347),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 102/171 (60%), Gaps = 24/171 (14%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG D    KI DQL         ++++IVGM GIGK+TLA+ VY+ P I  HF  RAW+
Sbjct  152  VVGLDNDLVKIKDQL--TGLPYNLEILTIVGMAGIGKSTLAKIVYDDPLIVYHFYVRAWI  209

Query  269  TVSQEYSVEQMLRCLLSCVTAAS-----------------RDGQDQL-----AESVRKCL  156
            TVSQEY V+ +L  L+  V   +                 +DG +QL     AE + + L
Sbjct  210  TVSQEYEVKNILIGLIRSVAQLTDDISAKYDDSEQHYKVLKDGINQLSDQKLAEQLYRSL  269

Query  155  KSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            K +RYLI++DDIW  TAWD V+R FPDD NGS I+LTSRL +V  Y +SG+
Sbjct  270  KGKRYLIIMDDIWCNTAWDDVKRSFPDDKNGSRIILTSRLTEVALYVNSGS  320



>gb|AEQ61811.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V +ML  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREMLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVG  24
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ + 
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIA  114



>ref|XP_011083930.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
 gb|AGW23830.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27501.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27503.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 103/164 (63%), Gaps = 7/164 (4%)
 Frame = -1

Query  482  SKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPS  303
            S   +  D ++MVG D+   ++  +L  + +T   Q++SIVGMGGIGKTTLA  ++    
Sbjct  144  SSGGAPNDGNKMVGFDEDLLELKARLCGESST--LQIISIVGMGGIGKTTLATNIFNDSL  201

Query  302  ITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTA-----ASRDGQDQLAESVRKCLKSQRYL  138
            +  HF  R W TVSQ+Y + Q+L  L++ +T       S    ++LAE V K LK + YL
Sbjct  202  VVYHFHIRVWTTVSQDYHLRQVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKGRTYL  261

Query  137  IVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            IV+DD+W+T  WD V+R FPDDNNGS +L+T+RL  V  YASS 
Sbjct  262  IVMDDMWSTKTWDDVRRFFPDDNNGSRVLITTRLPDVVVYASSS  305



>ref|XP_009777473.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009777474.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009777475.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009777476.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1253

 Score =   138 bits (348),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 104/157 (66%), Gaps = 4/157 (3%)
 Frame = -1

Query  479  KNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSI  300
            ++++  +D  +VG +   ++I+  L+  Q T G  V+ IVGMGG GKTT A+K+Y    I
Sbjct  523  QHSNPMNDEEIVGFENDMKRIIRHLI--QGTNGLDVIPIVGMGGQGKTTCARKLYNDDII  580

Query  299  TSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ--DQLAESVRKCLKSQRYLIVID  126
             SHFD RAW  +SQ Y+  ++L+ LL  VT    +G   D LA+ +RKCL  +RYLIV+D
Sbjct  581  VSHFDVRAWCIISQTYNRSELLQELLRQVTNYKDEGDKDDVLADKLRKCLMGKRYLIVLD  640

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            D+W+  AWD ++  FP+  NGS +++T+RL+KVG+Y 
Sbjct  641  DMWDFMAWDELRLSFPNAENGSRMIVTTRLEKVGDYV  677



>ref|XP_006367916.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006367917.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006367918.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006367919.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X4 [Solanum tuberosum]
Length=493

 Score =   135 bits (339),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 110/185 (59%), Gaps = 17/185 (9%)
 Frame = -1

Query  512  VHKKIIVSNFSKNASKFDDSR----------MVGCDKMFEKILDQLLTQQTTKGRQVVSI  363
            V KKI V+ F+   S   D+           +VG D+   +I D+L+ Q +    +VV I
Sbjct  116  VMKKIKVNKFNSKISHSRDTSSQIPLDQKDIIVGLDEDLLRIKDRLIVQSSR--LEVVPI  173

Query  362  VGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQ--  189
            +GMGGIGKTTLA++VY+   I  HF  RAW  VSQE+   ++   +L  + A + + +  
Sbjct  174  IGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGAVNDEVERN  233

Query  188  ---DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEY  18
               +QLAE V + LK ++YLIV+DD+W+  AW  V+R FPDD+NGS I+LT+RL  V   
Sbjct  234  STNEQLAERVYRSLKGRKYLIVLDDMWSIEAWQHVRRSFPDDHNGSRIVLTTRLADVASC  293

Query  17   ASSGN  3
            A S N
Sbjct  294  ACSVN  298



>ref|XP_009794810.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=345

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 98/150 (65%), Gaps = 6/150 (4%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG +   E + DQL    +    +V+SIVGMGGIGK+T A+K++  PSI S FD R W+
Sbjct  124  MVGYNIEQELMRDQLRGHSSQ--LEVISIVGMGGIGKSTFAKKMFSDPSIMSFFDVRGWI  181

Query  269  TVSQEYSVEQMLRCLLSCVTAA----SRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAW  102
            TVS++YS+ ++L  LL           +   D LA+ ++K LK +RYLIV+DDIW+  AW
Sbjct  182  TVSKDYSLRRILLGLLQDAIGVKEMLDKVSDDALADRLQKSLKGRRYLIVVDDIWSREAW  241

Query  101  DSVQRCFPDDNNGSCILLTSRLKKVGEYAS  12
            D ++ CFP+ +N S ILLT+R  KV +YAS
Sbjct  242  DGIRLCFPEYSNKSRILLTTRDMKVAQYAS  271



>gb|ACU82904.1| nucleotide binding site-leucine rich repeat protein, partial 
[Solanum lycopersicum]
Length=170

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 4/121 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR----DGQD  186
            GG+GKTTLA+KVY+   +  HF  RAW+TVSQ +    ML  +L C +  +        +
Sbjct  1    GGVGKTTLARKVYDDIYMEHHFYVRAWITVSQMHQHRGMLLGILRCFSLVNDYTYLKSTE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            QLAE V + LK +RYLI +DD+W+TTAWD V+R FPDD NGS ++LTSRL  VG YASSG
Sbjct  61   QLAEQVYRSLKGRRYLIAMDDVWDTTAWDVVKRSFPDDKNGSRVILTSRLANVGIYASSG  120

Query  5    N  3
            +
Sbjct  121  S  121



>gb|ACU82877.1| nucleotide binding site-leucine rich repeat protein, partial 
[Solanum lycopersicum]
Length=170

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 4/121 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASR----DGQD  186
            GG+GKTTLA++VY+   +  HF  RAW+TVSQ +   +ML  +L C +  +        +
Sbjct  1    GGVGKTTLAREVYDDIYMEHHFYVRAWITVSQMHQHREMLLGILRCFSLVNDYTYLKSTE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            QLAE V + LK +RYLI +DD+W+TTAWD V+R FPDD NGS ++LTSRL  VG YASSG
Sbjct  61   QLAEQVYRSLKGRRYLIAMDDVWDTTAWDVVKRSFPDDKNGSRVILTSRLANVGIYASSG  120

Query  5    N  3
            +
Sbjct  121  S  121



>gb|ACE79443.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79444.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF21989.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=272

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 104/161 (65%), Gaps = 8/161 (5%)
 Frame = -1

Query  476  NASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSIT  297
            +AS F++  MVG +   EK+L QL +  T    +V+S+ GMGGIGK+T A+K++ HPS+ 
Sbjct  26   HASTFEND-MVGYNFEQEKMLSQLTSGSTQ--MEVISVTGMGGIGKSTFAKKLFSHPSVL  82

Query  296  SHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ-----LAESVRKCLKSQRYLIV  132
            S FD   W+TVS++YS  +ML  LL        +  D+     LA  +++ L S+RYLIV
Sbjct  83   SFFDICGWVTVSEDYSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  131  IDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            +DDIW+  AWD ++ C PDD+  S +LLT+R  +V +YASS
Sbjct  143  VDDIWSKKAWDDIRLCLPDDDKRSRVLLTTRDVEVAQYASS  183



>gb|EYU23534.1| hypothetical protein MIMGU_mgv1a023257mg, partial [Erythranthe 
guttata]
Length=913

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 100/152 (66%), Gaps = 4/152 (3%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            D + MVG D+   ++LD+L  Q++   RQ++ IVGMGGIGKTTLAQ  YEH  I  HFD 
Sbjct  177  DKNTMVGFDEQLTRLLDKLTGQRS--NRQIIPIVGMGGIGKTTLAQNAYEHSLILHHFDI  234

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAW  102
            R W+TVSQ+Y+V+Q+L  LLS    +    +  L + + K L  +RYLIVIDDIW+  AW
Sbjct  235  RTWVTVSQKYNVKQLLLQLLS--RQSCETDEHLLGQELHKMLWGRRYLIVIDDIWSIEAW  292

Query  101  DSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            D V   FPD+NNGS I++T+R+  V  +  S 
Sbjct  293  DKVSGFFPDNNNGSRIVVTTRISNVATHFDSS  324



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -1

Query  428  FEKILDQLLTQQT--TKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQE  255
            FE  L+++ T+ T  +  R +VSIVGMGGIGKTTLA++ Y+   I  HFD RAW+TVSQE
Sbjct  27   FESDLEEMRTRLTGASSKRDIVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRAWVTVSQE  86

Query  254  YSVEQMLRCLLSCVTAASRDGQD----QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQR  87
            YS+ Q+L  LL      +    D    +LA+ + K L  +RYLIV+DDIW+T  WD+V+R
Sbjct  87   YSLRQVLVGLLDSAKILTEKMYDKTEEELADCLYKGLVGRRYLIVMDDIWDTQIWDAVRR  146

Query  86   CFPDDNNGSCILLTSRLKKVGEYASS  9
             FP+D N S ILLT+RL  V  YA S
Sbjct  147  FFPNDCNRSRILLTTRLSDVALYADS  172



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 154/318 (48%), Gaps = 46/318 (14%)
 Frame = -1

Query  926  QQLAQLRE---VGEVKQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNA  756
            +QL QL+      E +    SL  +L   Q+ L+ +   +   G +K+LE  IR V   A
Sbjct  14   EQLVQLQPHWISAETRIMANSLLVSLEYFQNFLENTSKRSQDHGQIKELERYIRTVVNEA  73

Query  755  EGRIEMELTTI-----YLAKGSLLHITACLLR----LHEIVIEAEKQTDYYQQLAKAASS  603
            E  IE+++  I      +A  +L  I    +     L   V+E+   TD   ++      
Sbjct  74   EDVIELKIYEINQLDRMMASKALYEILPPFVEKIDLLKREVMESSFSTD---KIHGYGDP  130

Query  602  QNQTLTDVSllgrirqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRMVGCDKMFE  423
             N+ L                        L H    V+N +       ++ +VG +    
Sbjct  131  MNENL-----------------------QLGHSSRQVANLNL------ETIVVGLEDDLM  161

Query  422  KILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVE  243
             I  +L    +T  R++V I+GMGGIGKTTLA+K Y+   I   FD   W+TVSQEY + 
Sbjct  162  IIKRRLTGPPST--REIVPILGMGGIGKTTLAKKAYDDSEIRHRFDVHVWVTVSQEYRIR  219

Query  242  QMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNG  63
             +L  +LSC +   ++  DQL + + K L  +RYL+V+DDIW+   WD + R FPDDNNG
Sbjct  220  DLLLGVLSCTSNEVKETDDQLMDMIYKNLNRKRYLVVMDDIWSNDVWDLMTRTFPDDNNG  279

Query  62   SCILLTSRLKKVGEYASS  9
            S I+LTSRLK +  +A  
Sbjct  280  SRIILTSRLKDLAIHADP  297



>ref|XP_009761982.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=741

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG +  F+ I DQL  Q  T    VVSIVGMG IGK+TLA+ ++ HPS++  FD 
Sbjct  42   EENTLVGMEDDFKIIRDQLFGQ--TPELNVVSIVGMGSIGKSTLAKSLFNHPSVSRRFDI  99

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIW  117
             +W+TVSQ Y  ++ML  +LS  T   +       +D+L + V + LK +RYLIV+DD+W
Sbjct  100  SSWVTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMW  159

Query  116  NTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
               AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  160  TIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  195



>gb|AEQ61816.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=170

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQD  186
            GG+GKTT  +K+Y+HP +  HF  RAW+T+SQ+Y V ++L  +L CVT  S++      +
Sbjct  1    GGVGKTTFCKKLYDHPLVMHHFYVRAWVTISQQYEVREVLLSILCCVTYISKEIYEKRDE  60

Query  185  QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYA  15
            +L E V + LK +RYLIV+DD+W+T AWD ++R FPDD NGS ++LTSRL+ +  +A
Sbjct  61   ELREQVYRSLKGKRYLIVLDDMWDTEAWDDLKRTFPDDKNGSRVMLTSRLRDIAVHA  117



>gb|ACE79400.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 97/156 (62%), Gaps = 17/156 (11%)
 Frame = -1

Query  458  DSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKR  279
            + +MVG +  FE + DQL   +  +  +VVSIVGMGGIGKTTLA K+Y  P I SHFD R
Sbjct  31   EDKMVGLENEFEMMQDQL--ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIR  88

Query  278  AWLTVSQEYSVEQMLRCLLSCVTAASRDGQ-----DQLAESVRKCLKSQRYLIVIDDIWN  114
            A  TVSQEY    +L  LLS ++  + + Q     DQLA+ ++K LK  R          
Sbjct  89   AKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCAR----------  138

Query  113  TTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            + AWD ++RCFPD NNGS IL+T+R  +V E ASSG
Sbjct  139  SPAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSG  174



>ref|XP_011087308.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=774

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 110/333 (33%), Positives = 161/333 (48%), Gaps = 52/333 (16%)
 Frame = -1

Query  920  LAQLREVGEVKQKMVS-LHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRI  744
            L  L E  +  Q++ S L + +G L  IL      N ++  ++DLE +IRD  F A+  I
Sbjct  10   LQTLEESPQPMQQIPSHLLEKVGRLLRILDDPSRKNILS--IRDLEGKIRDASFEAQDII  67

Query  743  EMELTTIYL---------AKGSLLHITACLLRLHEIVIEAEKQTDYYQQ--------LAK  615
            E  +T   L                I + L  +  ++   E  TD+  Q        L +
Sbjct  68   ESHITADQLELSESVSSGVGSCFCDIISALQNMFPVIHLRETSTDFMDQGMNLEVRGLER  127

Query  614  AASSQNQTLTDVSl----lgrirqrglqLVKGSSLHHLVHKKIIVSNFSKNASKFDDSRM  447
                 +  L  +S          + G     GSS       + + SN         +S +
Sbjct  128  VIDELDLILEALSKIKDGKEEAPEAGNSRAAGSS-------RFVASN---------ESGL  171

Query  446  VGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLT  267
            VG D+    + D+L     +    ++SIVGMGGIGKTTLA+ +Y    I   FD RAW+ 
Sbjct  172  VGLDEDLMHLRDRL--TGFSSNLDIISIVGMGGIGKTTLARNLYNDRLIEERFDTRAWVV  229

Query  266  VSQEYSVEQMLRCLLSCVTAASRDGQD-------QLAESVRKCLKSQRYLIVIDDIWNTT  108
            VSQ+YSV+++L  L   V +  RDG +       +L  S+ K LK +RYLIV+DD+W+T 
Sbjct  230  VSQDYSVQELLMVL---VNSTRRDGGEVDKKIVEELKVSLHKNLKGRRYLIVMDDVWDTK  286

Query  107  AWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            AWD V+R FPDDNN S I+LT+R  +V  YA+ 
Sbjct  287  AWDEVKRFFPDDNNSSRIILTTRQSEVAMYANP  319



>ref|XP_009761980.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=766

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = -1

Query  461  DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDK  282
            +++ +VG +  F+ I DQL  Q  T    VVSIVGMG IGK+TLA+ ++ HPS++  FD 
Sbjct  42   EENTLVGMEDDFKIIRDQLFGQ--TPELNVVSIVGMGSIGKSTLAKSLFNHPSVSRRFDI  99

Query  281  RAWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQDQLAESVRKCLKSQRYLIVIDDIW  117
             +W+TVSQ Y  ++ML  +LS  T   +       +D+L + V + LK +RYLIV+DD+W
Sbjct  100  SSWVTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMW  159

Query  116  NTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
               AWD V+R FPDD NGS I++T+RL +V   A +
Sbjct  160  TIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN  195



>gb|AGW28125.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 103/164 (63%), Gaps = 7/164 (4%)
 Frame = -1

Query  482  SKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPS  303
            S   +  D ++MVG D+   ++  +L  + +T   Q++SIVGMGGIGKTTLA  ++    
Sbjct  144  SSGGAPNDGNKMVGFDEDLLELKARLCGESST--LQIISIVGMGGIGKTTLATNIFNDSL  201

Query  302  ITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTA-----ASRDGQDQLAESVRKCLKSQRYL  138
            +  HF  R W TVSQ+Y + Q+L  L++ +T       S    ++LAE V K LK + YL
Sbjct  202  VVYHFHIRVWTTVSQDYHLRQVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKGRTYL  261

Query  137  IVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            IV+DD+W+T  WD V+R FPDDNNGS +L+T+RL  V  YASS 
Sbjct  262  IVMDDMWSTKTWDDVRRFFPDDNNGSRVLITTRLLDVVVYASSS  305



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 105/165 (64%), Gaps = 8/165 (5%)
 Frame = -1

Query  485  FSKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHP  306
            FS N ++ ++  +VG D   + I D+L+T  +    ++V+IVGMGGIGKTTLA++V++  
Sbjct  87   FSPNPNQRNE--VVGLDDDCQSIFDRLITVPSRL--EIVAIVGMGGIGKTTLARRVFDDL  142

Query  305  SITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAAS----RDGQDQLAESVRKCLKSQRYL  138
            S   +F  RAW TVSQ +    +L  LL   T  +    R   ++LA+ + + LK +RYL
Sbjct  143  STVYNFHVRAWATVSQVFRQRDVLLALLRSTTHVTDEIYRKNNEELAQDLYRSLKGKRYL  202

Query  137  IVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            IV+DDIWNT AWD V+ CFPDD N S +L+T+RL KV  Y +  +
Sbjct  203  IVLDDIWNTLAWDDVKLCFPDDENASRLLVTTRLSKVAHYVNPNS  247



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -1

Query  428  FEKILDQLLTQQT--TKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQE  255
            FE  L+++ T+ T  +  R +VSIVGMGGIGKTTLA++ Y+   I  HFD RAW+TVSQE
Sbjct  229  FESDLEEMRTRLTGASSKRDIVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRAWVTVSQE  288

Query  254  YSVEQMLRCLLSCVTAASRDGQD----QLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQR  87
            YS+ Q+L  LL      +    D    +LA+ + K L  +RYLIV+DDIW+T  WD+V+R
Sbjct  289  YSLRQVLIGLLDSAKILTEKMYDKREEELADCLYKGLVGRRYLIVMDDIWDTQIWDAVRR  348

Query  86   CFPDDNNGSCILLTSRLKKVGEYASS  9
             FP+D NGS ILLT+RL  V   A S
Sbjct  349  FFPNDCNGSRILLTTRLSDVALCADS  374



>gb|ACE79436.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 104/161 (65%), Gaps = 8/161 (5%)
 Frame = -1

Query  476  NASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSIT  297
            +AS F++  MVG +   EK+L QL +  T    +V+S+ GMGG+GK+T A+K++ HPS+ 
Sbjct  26   HASTFEND-MVGYNFEQEKMLSQLTSGSTQ--MEVISVTGMGGVGKSTFAKKLFSHPSVL  82

Query  296  SHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ-----LAESVRKCLKSQRYLIV  132
            S FD   W+TVS++YS  +ML  LL        +  D+     LA  +++ L S+RYLIV
Sbjct  83   SFFDICGWVTVSEDYSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  131  IDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            +DDIW+  AWD ++ C PDD+  S +LLT+R  +V +YASS
Sbjct  143  VDDIWSKKAWDDIRLCLPDDDKRSRVLLTTRDVEVAQYASS  183



>gb|EYU29928.1| hypothetical protein MIMGU_mgv1a001694mg [Erythranthe guttata]
Length=772

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 104/150 (69%), Gaps = 4/150 (3%)
 Frame = -1

Query  455  SRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            + MVG D+   ++LD L  +Q++   Q++ IVGMGGIGKTTLA+  YEH  I + FD RA
Sbjct  138  TTMVGLDEELIQLLDALTGRQSS--LQIIPIVGMGGIGKTTLARNAYEHGLIVNRFDIRA  195

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            W T+SQEYSV+++   LLS  ++ S + Q QL++ + + L  +RYLI++DDIW+  AW+ 
Sbjct  196  WATISQEYSVKEIFSELLSRESSESANEQ-QLSQELYQSLIGRRYLIILDDIWSIDAWEK  254

Query  95   VQRCFPDDNNGSCILLTSRLKKVG-EYASS  9
            +   FPD+NNGS I++T+RL  V  ++ SS
Sbjct  255  MMFFFPDNNNGSRIIITTRLSNVAVQFGSS  284



>ref|XP_011090484.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=757

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 135/281 (48%), Gaps = 30/281 (11%)
 Frame = -1

Query  794  DLEAEIRDVWFNAEGRIEMELTTIYLAK----GSLLHITACLLRLHEIVIEAEKQTDYYQ  627
            DLEA+IRD    A+  +E  ++  +  K    G    + + L  +    +   +  DY  
Sbjct  53   DLEAQIRDASHEAQDMVESHISAQFPCKSEDGGMFRKMISSLQDMFSFALYPRQTFDYTH  112

Query  626  Q---------LAKAASSQNQTLTDVSllgrirqrglqLVKGSSLHHLVHKKIIVSNFSKN  474
            Q           K     +  L  +S +   R+      + SS          V+   + 
Sbjct  113  QDFDLEFRGCFEKVIDEFDSILEALSKIKDGREEEASRTRNSSF---ASSSTFVAGVKRE  169

Query  473  ASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITS  294
                D   M          + + LT   +K   ++SIVGMGGIGKTTLA+ +Y    I  
Sbjct  170  PVGLDQDLMC---------MKEWLTASLSK-LDIISIVGMGGIGKTTLARNLYSDSLIEY  219

Query  293  HFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD----GQDQLAESVRKCLKSQRYLIVID  126
            +FD RAW+ +SQ+Y    M R L+ C    + +      ++LAE + K LK +RYL+V+D
Sbjct  220  YFDIRAWVVLSQDYDARLMFRSLVCCTGEPNGELNHKSIEELAERLYKNLKGRRYLVVMD  279

Query  125  DIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
            D+W+T  WD V+R FPDDNNGS I+LTSR  +V  YA+S N
Sbjct  280  DVWDTKVWDDVKRFFPDDNNGSRIILTSRQSEVAIYANSSN  320



>ref|XP_009761661.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=770

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 97/142 (68%), Gaps = 3/142 (2%)
 Frame = -1

Query  446  VGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLT  267
            VG +   +KI+ +LLT+   + R VVSI GM G+GKTTLA+K+++  S+ SHFD RAW+T
Sbjct  25   VGLEDDADKII-KLLTR-GIRERDVVSIFGMPGLGKTTLAKKIFKDSSVVSHFDVRAWVT  82

Query  266  VSQEYSVEQMLRCLLSCVTAASR-DGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQ  90
            +SQ Y V ++LR +   VT     DG+  +A+ +RKCL  +RYLIV+DD+W   AWD ++
Sbjct  83   ISQSYDVRELLRNIYKQVTGVKYDDGESDIADVLRKCLMGKRYLIVLDDVWEVDAWDELR  142

Query  89   RCFPDDNNGSCILLTSRLKKVG  24
             CFP    G+ I+LT+RLK V 
Sbjct  143  LCFPIGKQGNRIMLTTRLKHVA  164



>ref|XP_009598609.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Nicotiana tomentosiformis]
Length=610

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 96/143 (67%), Gaps = 4/143 (3%)
 Frame = -1

Query  446  VGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWLT  267
            VG +   E+I+ +LLT+   + R +VSI GM G+GKTTLA+K+++  SI SHFD RAWLT
Sbjct  25   VGLEDDAEEII-KLLTR-GIRERDIVSIFGMPGLGKTTLAKKIFKDSSIVSHFDIRAWLT  82

Query  266  VSQEYSVEQMLRCLLSCVTAASRDG--QDQLAESVRKCLKSQRYLIVIDDIWNTTAWDSV  93
            +SQ Y V ++LR +   V     +G  +  +A+ +RKCL  +RYLIV+DD+W   AWD +
Sbjct  83   ISQSYDVRELLRNIYKQVAGVKYNGDKESDIADMLRKCLMGKRYLIVLDDVWEVEAWDEL  142

Query  92   QRCFPDDNNGSCILLTSRLKKVG  24
            + CFP    GS I+LT+RLK V 
Sbjct  143  RLCFPIGKQGSRIMLTTRLKHVA  165



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 158/303 (52%), Gaps = 36/303 (12%)
 Frame = -1

Query  890  KQKMVSLHQNLGLLQDILQKSEIGNDVAGAMKDLEAEIRDVWFNAEGRIEMELTTIYLAK  711
            ++++ +L + +  L+  ++  E  N+V G M D E E+R+V   AE  I++ LT   L +
Sbjct  31   REELCALREKVSSLEVFVKNFE-KNNVFGEMTDFEVEVREVASAAEYTIQLRLTGTVLGE  89

Query  710  GSLLHITACLLRLHEIVIEAEKQTDYYQQLAKAASSQNQTLTDVSllgrirqrglqLVKG  531
                                        Q  KA     Q+L  V+       +    ++ 
Sbjct  90   NK-------------------------SQKKKARRRFRQSLQQVAEDMDHIWKESTKIQD  124

Query  530  SSLHHLVHKKIIVSNFSKNASKF--DDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVG  357
                  V K+ +V +FS + +      + MVG D   +++L+ L T+  +   +V+ IVG
Sbjct  125  KGKQ--VSKESLVHDFSSSTNDILKVKNNMVGRDDQRKQLLEDL-TRSYSGEPKVIPIVG  181

Query  356  MGGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLL-SCVTAASR---DGQ  189
            MGGIGKTTLA++VY   SI   FD  AW T+SQ+++ +++L  LL S +    R    G+
Sbjct  182  MGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGE  241

Query  188  DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFP-DDNNGSCILLTSRLKKVGEYAS  12
             +LA+ ++K LK +RYLIV+DDIW+   WD V+RCFP +DN GS ILLT+R  +V  YA 
Sbjct  242  AELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTRNDEVACYAG  301

Query  11   SGN  3
              N
Sbjct  302  VEN  304



>gb|AGW23829.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
 gb|AGX27502.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
Length=768

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 7/164 (4%)
 Frame = -1

Query  482  SKNASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPS  303
            S   +  D ++MVG D+   ++  +L  + +T   Q++SIVGMGGIGKTTLA  ++    
Sbjct  144  SSGGAPNDGNKMVGFDEDILELKARLCGESST--LQIISIVGMGGIGKTTLATNIFNDSL  201

Query  302  ITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTA-----ASRDGQDQLAESVRKCLKSQRYL  138
            +  HF  R W TVSQ Y + Q+L  L++ +T       S    ++LAE V K LK + YL
Sbjct  202  VVYHFHIRVWTTVSQNYHLRQVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKGRTYL  261

Query  137  IVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            IV+DD+W+T  WD V+R FPDD+NGS +L+T+RL  V  YASS 
Sbjct  262  IVMDDMWSTKTWDDVRRFFPDDHNGSRVLITTRLSDVAVYASSS  305



>gb|EYU25697.1| hypothetical protein MIMGU_mgv1a026211mg, partial [Erythranthe 
guttata]
Length=479

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = -1

Query  455  SRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRA  276
            ++MVG ++   ++LD L  +Q++   Q++ IVGMGGIGKTTLA+  YE   I +HFD  A
Sbjct  138  TKMVGFEEELIQLLDALTGRQSS--LQIIPIVGMGGIGKTTLARNAYESRLIVNHFDICA  195

Query  275  WLTVSQEYSVEQMLRCLLSCVTAASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAWDS  96
            W T+SQEYS++++   LLS     S + Q QL++ + + L  +RYLI++DDIW+  AW+ 
Sbjct  196  WATISQEYSLKEIFSKLLSPENGQSANEQ-QLSQKLYQSLIGRRYLIILDDIWSIDAWEK  254

Query  95   VQRCFPDDNNGSCILLTSRLKKV-GEYASS  9
            +   FPD+NNGS I+LT+RL  V G + SS
Sbjct  255  MMIFFPDNNNGSRIILTTRLSNVAGHFGSS  284



>emb|CDP00688.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            +VG D     IL+ L       G ++V+I GMGGIGKTTLA+K +  P I  HF  RAW+
Sbjct  311  VVGLDAELTTILEGL---TGLPGLEIVTISGMGGIGKTTLARKAFNDPYIVYHFYCRAWI  367

Query  269  TVSQEYSVEQMLRCLLSCVTAAS----RDGQDQLAESVRKCLKSQRYLIVIDDIWNTTAW  102
            TVSQ Y V  +L  LLS +  ++         QLAE+V + LK  RY+IV+DD+W+  AW
Sbjct  368  TVSQVYQVRDLLLGLLSSIARSTDKMVEKSNAQLAEAVYRSLKGMRYMIVMDDMWSIDAW  427

Query  101  DSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            + V+RCFPDD NGS I++T+R  ++    S 
Sbjct  428  NDVKRCFPDDKNGSRIVVTTRFMELATNVSP  458



>gb|ACE79452.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 104/161 (65%), Gaps = 8/161 (5%)
 Frame = -1

Query  476  NASKFDDSRMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSIT  297
            +AS F++  MVG +   EK+L QL +  T    +V+S+ GMGGIGK+T A+K++ HPS+ 
Sbjct  26   HASTFEND-MVGYNFEQEKMLCQLTSGSTQ--MEVISVTGMGGIGKSTFAKKLFSHPSVL  82

Query  296  SHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRDGQDQ-----LAESVRKCLKSQRYLIV  132
            S FD   W+TVS++YS  +ML  LL        +  D+     LA  +++ L S+RYLIV
Sbjct  83   SFFDICGWVTVSEDYSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  131  IDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            +DDIW+  AWD ++ C PDD+  S +LLT+R  +V +YASS
Sbjct  143  VDDIWSKKAWDDIRLCLPDDDKRSRVLLTTRDVEVAQYASS  183



>gb|EPS64025.1| hypothetical protein M569_10756, partial [Genlisea aurea]
Length=237

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 93/152 (61%), Gaps = 6/152 (4%)
 Frame = -1

Query  452  RMVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAW  273
            ++VG D    K+ D + +   ++   ++ IVGMGGIGKTTLA+ V+++PS+   FD R W
Sbjct  3    KLVGLDDYIRKLKDDIFS--VSRELVIIPIVGMGGIGKTTLARAVFDYPSVARRFDIRRW  60

Query  272  LTVSQEYSVEQMLRCLLSCVTAASRDGQD--QLAESVRKCLKSQRYLIVIDDIWNTTAWD  99
            LT+SQ  ++   L  LL     A  D  D   L+  V K LK +RYLI +DDIW+  AWD
Sbjct  61   LTISQNCNLRATLLSLLD--DKAHYDAMDLVDLSVEVHKMLKKRRYLIAVDDIWSLNAWD  118

Query  98   SVQRCFPDDNNGSCILLTSRLKKVGEYASSGN  3
             ++R  PDD NGS ILLT+R  +V  YA S N
Sbjct  119  DIKRSLPDDLNGSRILLTTRDYEVANYAISSN  150



>gb|ACO25631.1| NBS-coding resistance protein [Nicotiana repanda]
Length=171

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 80/121 (66%), Gaps = 5/121 (4%)
 Frame = -1

Query  353  GGIGKTTLAQKVYEHPSITSHFDKRAWLTVSQEYSVEQMLRCLLSCVTAASRD-----GQ  189
            GGIGKTTLA K+Y  P I SHF  RA  TVSQEY    +L  LLS ++    +       
Sbjct  1    GGIGKTTLANKIYSDPFIMSHFGIRAKATVSQEYCARYVLLRLLSSISGKIEEFHEHQDD  60

Query  188  DQLAESVRKCLKSQRYLIVIDDIWNTTAWDSVQRCFPDDNNGSCILLTSRLKKVGEYASS  9
            DQLA+ ++K LK  RYL+VIDDIW   AWD ++RCFPD NNGS IL+T+R  +V E ASS
Sbjct  61   DQLADRLQKLLKCGRYLVVIDDIWTREAWDGIKRCFPDSNNGSRILMTTRNVEVAECASS  120

Query  8    G  6
            G
Sbjct  121  G  121



>gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythranthe guttata]
Length=852

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 8/154 (5%)
 Frame = -1

Query  449  MVGCDKMFEKILDQLLTQQTTKGRQVVSIVGMGGIGKTTLAQKVYEHPSITSHFDKRAWL  270
            MVG D +  +++D+L  QQ+     ++ IVGMGGIGKTTLA+ VY  P I  HFD RAW+
Sbjct  141  MVGFDDLLIEVMDKLTGQQS--NLWIIPIVGMGGIGKTTLARNVYAKPLIMQHFDIRAWV  198

Query  269  TVSQEYSVEQMLRCLLSCVT------AASRDGQDQLAESVRKCLKSQRYLIVIDDIWNTT  108
            TVSQ Y+VE +L  +L C++      + S   + +L E + K L  +RYLIV+DDIW+  
Sbjct  199  TVSQNYNVEDILIEILLCISKDESLESLSAKSEGELGERIHKTLWGRRYLIVLDDIWSAE  258

Query  107  AWDSVQRCFPDDNNGSCILLTSRLKKVGEYASSG  6
            AWD V   FP++   S I++T+RL  V    S G
Sbjct  259  AWDKVNLFFPENGQRSRIMMTTRLSDVASIGSHG  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2749030255886