BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25931_g2_i8 len=1081 path=[18629:0-209 7909:210-464 22061:465-484
8182:485-523 2004:524-547 2028:548-644 8358:645-699 22651:700-701
12476:702-722 22655:723-764 22697:765-767 22700:768-780
22713:781-784 22717:785-807 22740:808-808 16321:809-834
22788:835-836 22790:837-839 16351:840-870 16382:871-873 2834:874-884
22860:885-906 3186:907-934 22896:935-935 22900:936-939 22904:940-946
12706:947-949 12709:950-963 22922:964-980 22939:981-982
23015:983-983 23000:984-986 23003:987-990 12781:991-1015
19676:1016-1056 23122:1057-1080]

Length=1081
                                                                      Score     E

ref|XP_007208343.1|  hypothetical protein PRUPE_ppa002031mg             291   5e-88   
ref|XP_009791362.1|  PREDICTED: probable acyl-activating enzyme 1...    289   4e-87   
ref|XP_009623331.1|  PREDICTED: probable acyl-activating enzyme 1...    287   4e-87   
ref|XP_009791360.1|  PREDICTED: probable acyl-activating enzyme 1...    289   5e-87   
ref|XP_008246524.1|  PREDICTED: probable acyl-activating enzyme 1...    289   6e-87   
ref|XP_010651362.1|  PREDICTED: probable acyl-activating enzyme 1...    282   2e-86   
ref|XP_009623329.1|  PREDICTED: probable acyl-activating enzyme 1...    287   3e-86   
ref|XP_009623330.1|  PREDICTED: probable acyl-activating enzyme 1...    287   3e-86   
ref|XP_011089736.1|  PREDICTED: probable acyl-activating enzyme 1...    280   7e-86   
ref|XP_006367600.1|  PREDICTED: probable acyl-activating enzyme 1...    285   2e-85   
ref|XP_010276331.1|  PREDICTED: probable acyl-activating enzyme 1...    283   3e-85   
ref|XP_010651363.1|  PREDICTED: probable acyl-activating enzyme 1...    281   6e-85   
ref|XP_010097804.1|  putative acyl-activating enzyme 18                 281   6e-85   
ref|XP_010276330.1|  PREDICTED: probable acyl-activating enzyme 1...    283   1e-84   
ref|XP_009375617.1|  PREDICTED: probable acyl-activating enzyme 1...    283   1e-84   
ref|XP_002527076.1|  acetyl-CoA synthetase, putative                    280   2e-84   Ricinus communis
gb|KDO63048.1|  hypothetical protein CISIN_1g004821mg                   276   2e-84   
ref|XP_004294995.1|  PREDICTED: probable acyl-activating enzyme 1...    282   3e-84   
gb|KHN47969.1|  Putative acyl-activating enzyme 18, peroxisomal         281   3e-84   
ref|XP_002285701.2|  PREDICTED: probable acyl-activating enzyme 1...    282   4e-84   Vitis vinifera
gb|KEH20659.1|  acyl-activating enzyme 17, peroxisomal protein, p...    278   4e-84   
gb|EYU31686.1|  hypothetical protein MIMGU_mgv1a002873mg                279   4e-84   
emb|CBI16507.3|  unnamed protein product                                281   5e-84   
gb|EPS67365.1|  hypothetical protein M569_07409                         274   5e-84   
ref|XP_003531240.1|  PREDICTED: probable acyl-activating enzyme 1...    281   6e-84   
ref|XP_011048229.1|  PREDICTED: probable acyl-activating enzyme 1...    275   7e-84   
ref|XP_004504328.1|  PREDICTED: probable acyl-activating enzyme 1...    280   8e-84   
gb|KEH20658.1|  acyl-activating enzyme 17, peroxisomal protein, p...    280   1e-83   
gb|AET04187.2|  acyl-activating enzyme 17, peroxisomal protein, p...    280   1e-83   
gb|KCW45445.1|  hypothetical protein EUGRSUZ_L008481                    270   1e-83   
ref|XP_003629711.1|  Acetyl-coenzyme A synthetase                       281   2e-83   
ref|XP_009375604.1|  PREDICTED: probable acyl-activating enzyme 1...    280   2e-83   
ref|XP_011089734.1|  PREDICTED: probable acyl-activating enzyme 1...    280   2e-83   
ref|XP_007159408.1|  hypothetical protein PHAVU_002G235900g             279   4e-83   
gb|AGA17929.1|  CCL12                                                   278   5e-83   
ref|XP_008789133.1|  PREDICTED: probable acyl-activating enzyme 1...    274   6e-83   
ref|XP_006445649.1|  hypothetical protein CICLE_v10014404mg             274   2e-82   
ref|XP_011048228.1|  PREDICTED: probable acyl-activating enzyme 1...    274   2e-82   
gb|KDP42113.1|  hypothetical protein JCGZ_01901                         274   2e-82   
ref|XP_006580165.1|  PREDICTED: probable acyl-activating enzyme 1...    276   3e-82   
gb|KDO63047.1|  hypothetical protein CISIN_1g004821mg                   273   3e-82   
emb|CDP16784.1|  unnamed protein product                                276   3e-82   
ref|XP_007014691.1|  Acyl-activating enzyme 18                          276   4e-82   
ref|XP_006488900.1|  PREDICTED: probable acyl-activating enzyme 1...    276   6e-82   
ref|XP_003524200.1|  PREDICTED: probable acyl-activating enzyme 1...    276   6e-82   
ref|XP_010097802.1|  putative acyl-activating enzyme 18                 275   6e-82   
ref|XP_006445650.1|  hypothetical protein CICLE_v10014404mg             275   6e-82   
emb|CBI16508.3|  unnamed protein product                                275   7e-82   
ref|XP_006445651.1|  hypothetical protein CICLE_v10014404mg             273   8e-82   
ref|XP_002297640.2|  hypothetical protein POPTR_0001s04380g             275   1e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011048227.1|  PREDICTED: probable acyl-activating enzyme 1...    274   2e-81   
ref|XP_006392650.1|  hypothetical protein EUTSA_v10011267mg             274   2e-81   
ref|XP_004504307.1|  PREDICTED: probable acyl-activating enzyme 1...    271   3e-81   
ref|XP_007159439.1|  hypothetical protein PHAVU_002G237900g             274   3e-81   
ref|XP_010934528.1|  PREDICTED: probable acyl-activating enzyme 1...    273   5e-81   
ref|XP_008789114.1|  PREDICTED: probable acyl-activating enzyme 1...    273   7e-81   
ref|XP_007014692.1|  Acyl-activating enzyme 18                          273   8e-81   
ref|XP_008789122.1|  PREDICTED: probable acyl-activating enzyme 1...    273   8e-81   
ref|XP_004504308.1|  PREDICTED: probable acyl-activating enzyme 1...    270   1e-80   
gb|KEH20664.1|  acyl-activating enzyme 17, peroxisomal protein, p...    269   2e-80   
ref|XP_009396922.1|  PREDICTED: probable acyl-activating enzyme 1...    269   2e-80   
ref|XP_009396923.1|  PREDICTED: probable acyl-activating enzyme 1...    269   2e-80   
ref|XP_010040155.1|  PREDICTED: LOW QUALITY PROTEIN: probable acy...    272   2e-80   
gb|KEH20665.1|  acyl-activating enzyme 17, peroxisomal protein, p...    269   2e-80   
gb|KHG25218.1|  putative acyl-activating enzyme 18, peroxisomal -...    271   3e-80   
gb|AET04219.2|  acyl-activating enzyme 17, peroxisomal protein, p...    271   5e-80   
ref|NP_001132777.1|  uncharacterized protein LOC100194266               262   6e-80   Zea mays [maize]
ref|XP_003629743.1|  Acetyl-coenzyme A synthetase                       271   6e-80   
ref|XP_008351636.1|  PREDICTED: probable acyl-activating enzyme 1...    270   7e-80   
gb|AFD33358.1|  acyl-activating enzyme 14                               270   7e-80   
gb|AFD33348.1|  acyl-activating enzyme 4                                270   8e-80   
ref|XP_010673496.1|  PREDICTED: probable acyl-activating enzyme 1...    263   1e-79   
ref|NP_001077723.1|  acyl-activating enzyme 18                          264   1e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KFK35590.1|  hypothetical protein AALP_AA4G011100                    269   2e-79   
ref|XP_010040496.1|  PREDICTED: probable acyl-activating enzyme 1...    268   4e-79   
ref|XP_008449826.1|  PREDICTED: probable acyl-activating enzyme 1...    265   6e-79   
gb|KGN54068.1|  hypothetical protein Csa_4G280450                       265   7e-79   
ref|XP_010032903.1|  PREDICTED: probable acyl-activating enzyme 1...    268   7e-79   
gb|AFD33357.1|  acyl-activating enzyme 13                               266   2e-78   
ref|XP_010462380.1|  PREDICTED: probable acyl-activating enzyme 1...    266   3e-78   
ref|XP_008449824.1|  PREDICTED: probable acyl-activating enzyme 1...    265   4e-78   
ref|XP_008449823.1|  PREDICTED: probable acyl-activating enzyme 1...    265   4e-78   
ref|XP_008449822.1|  PREDICTED: probable acyl-activating enzyme 1...    265   4e-78   
emb|CDP16781.1|  unnamed protein product                                265   5e-78   
ref|XP_006304735.1|  hypothetical protein CARUB_v10012089mg             265   5e-78   
ref|XP_004142169.1|  PREDICTED: probable acyl-activating enzyme 1...    265   5e-78   
ref|XP_004162004.1|  PREDICTED: probable acyl-activating enzyme 1...    265   5e-78   
ref|XP_008449821.1|  PREDICTED: probable acyl-activating enzyme 1...    265   5e-78   
ref|XP_006842784.1|  hypothetical protein AMTR_s00133p00115730          265   7e-78   
ref|XP_009147512.1|  PREDICTED: probable acyl-activating enzyme 1...    264   1e-77   
ref|XP_010552272.1|  PREDICTED: probable acyl-activating enzyme 1...    264   1e-77   
ref|XP_010501144.1|  PREDICTED: probable acyl-activating enzyme 1...    264   1e-77   
ref|XP_010552271.1|  PREDICTED: probable acyl-activating enzyme 1...    264   1e-77   
ref|XP_010673495.1|  PREDICTED: probable acyl-activating enzyme 1...    263   2e-77   
gb|ACN40312.1|  unknown                                                 263   2e-77   Picea sitchensis
ref|XP_004162003.1|  PREDICTED: probable acyl-activating enzyme 1...    263   3e-77   
ref|XP_010673494.1|  PREDICTED: probable acyl-activating enzyme 1...    263   3e-77   
ref|NP_175929.3|  acyl-activating enzyme 18                             262   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663147.1|  PREDICTED: uncharacterized protein LOC100194...    262   7e-77   
ref|XP_004981367.1|  PREDICTED: probable acyl-activating enzyme 1...    262   7e-77   
gb|KDO63043.1|  hypothetical protein CISIN_1g0048601mg                  255   1e-76   
ref|XP_010032909.1|  PREDICTED: probable acyl-activating enzyme 1...    262   1e-76   
ref|XP_010480067.1|  PREDICTED: probable acyl-activating enzyme 1...    261   1e-76   
gb|KDO63045.1|  hypothetical protein CISIN_1g0048601mg                  256   2e-76   
ref|XP_006445652.1|  hypothetical protein CICLE_v10014402mg             256   2e-76   
ref|XP_008449828.1|  PREDICTED: probable acyl-activating enzyme 1...    258   3e-76   
ref|XP_004142170.1|  PREDICTED: probable acyl-activating enzyme 1...    260   5e-76   
gb|KGN54066.1|  hypothetical protein Csa_4G280430                       260   5e-76   
gb|KDO63041.1|  hypothetical protein CISIN_1g0048601mg                  254   8e-76   
gb|KDO63040.1|  hypothetical protein CISIN_1g0048601mg                  253   2e-75   
gb|KDO63036.1|  hypothetical protein CISIN_1g0048601mg                  256   4e-75   
gb|KDO63037.1|  hypothetical protein CISIN_1g0048601mg                  255   4e-75   
gb|KDO63038.1|  hypothetical protein CISIN_1g0048601mg                  254   4e-75   
gb|KDO63039.1|  hypothetical protein CISIN_1g0048601mg                  254   4e-75   
ref|XP_006651932.1|  PREDICTED: probable acyl-activating enzyme 1...    258   6e-75   
gb|AAS07227.1|  putative acyl-activating enzyme                         254   7e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006445654.1|  hypothetical protein CICLE_v10014402mg             254   8e-75   
ref|NP_001051629.2|  Os03g0805500                                       253   9e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463701.1|  hypothetical protein SORBIDRAFT_01g004510          256   1e-74   Sorghum bicolor [broomcorn]
emb|CDY33059.1|  BnaC06g07200D                                          255   2e-74   
ref|XP_006445653.1|  hypothetical protein CICLE_v10014402mg             255   2e-74   
ref|XP_010228097.1|  PREDICTED: probable acyl-activating enzyme 1...    252   4e-74   
gb|KCW52410.1|  hypothetical protein EUGRSUZ_J018162                    244   5e-74   
emb|CDY24042.1|  BnaA06g00400D                                          254   9e-74   
gb|ABF99434.1|  acyl-activating enzyme 18, putative, expressed          253   2e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002297639.2|  hypothetical protein POPTR_0001s04370g             253   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011048226.1|  PREDICTED: probable acyl-activating enzyme 1...    251   2e-73   
ref|XP_002891829.1|  hypothetical protein ARALYDRAFT_314757             260   3e-73   
ref|XP_003564187.1|  PREDICTED: probable acyl-activating enzyme 1...    251   8e-73   
ref|XP_006445655.1|  hypothetical protein CICLE_v10014402mg             251   1e-72   
ref|XP_011048225.1|  PREDICTED: probable acyl-activating enzyme 1...    250   2e-72   
gb|AAG51574.1|AC027034_20  acetyl-CoA synthetase, putative; 45051...    255   1e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86478.1|  predicted protein                                      247   4e-71   
gb|KCW45443.1|  hypothetical protein EUGRSUZ_L00845                     243   2e-70   
ref|XP_002989779.1|  hypothetical protein SELMODRAFT_428318             244   4e-70   
gb|EMT16119.1|  Acetyl-coenzyme A synthetase                            243   5e-70   
ref|XP_002989780.1|  hypothetical protein SELMODRAFT_130287             244   5e-70   
ref|XP_002993662.1|  hypothetical protein SELMODRAFT_236785             243   8e-70   
gb|EMS50598.1|  Acetyl-coenzyme A synthetase                            242   9e-70   
emb|CDJ26643.1|  unnamed protein product                                241   2e-69   
ref|XP_010032904.1|  PREDICTED: probable acyl-activating enzyme 1...    240   7e-69   
ref|XP_001784370.1|  predicted protein                                  237   1e-67   
dbj|BAK05470.1|  predicted protein                                      234   1e-66   
gb|EMS61140.1|  Acetyl-coenzyme A synthetase                            233   8e-66   
ref|XP_001773935.1|  predicted protein                                  230   4e-65   
gb|EMT13054.1|  Acetyl-coenzyme A synthetase                            231   6e-65   
gb|EMS59872.1|  Acetyl-coenzyme A synthetase                            228   2e-64   
ref|XP_010262196.1|  PREDICTED: probable acyl-activating enzyme 1...    219   9e-62   
ref|XP_006661184.1|  PREDICTED: probable acyl-activating enzyme 1...    220   1e-61   
ref|XP_010262187.1|  PREDICTED: probable acyl-activating enzyme 1...    219   6e-61   
ref|XP_010262177.1|  PREDICTED: probable acyl-activating enzyme 1...    219   7e-61   
gb|EMT23105.1|  Acetyl-coenzyme A synthetase                            218   8e-61   
dbj|BAJ95888.1|  predicted protein                                      218   2e-60   
ref|XP_002460162.1|  hypothetical protein SORBIDRAFT_02g023690          217   4e-60   Sorghum bicolor [broomcorn]
emb|CDY02201.1|  BnaA03g39660D                                          216   7e-60   
ref|XP_009136395.1|  PREDICTED: probable acyl-activating enzyme 1...    216   7e-60   
gb|ACR34509.1|  unknown                                                 216   9e-60   Zea mays [maize]
gb|AAP03027.1|  acyl-activating enzyme 17                               214   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003576487.1|  PREDICTED: probable acyl-activating enzyme 1...    215   1e-59   
ref|XP_007037741.1|  Acyl-activating enzyme 17                          215   1e-59   
dbj|BAB09822.1|  acetyl-CoA synthetase-like protein                     214   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb|EEC84495.1|  hypothetical protein OsI_31179                          212   2e-59   Oryza sativa Indica Group [Indian rice]
ref|NP_197696.2|  acyl-activating enzyme 17                             214   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546235.1|  PREDICTED: probable acyl-activating enzyme 1...    214   2e-59   
ref|NP_001152332.1|  catalytic/ ligase                                  214   3e-59   Zea mays [maize]
ref|XP_004956718.1|  PREDICTED: probable acyl-activating enzyme 1...    214   3e-59   
gb|EMS59847.1|  Acetyl-coenzyme A synthetase                            214   3e-59   
ref|XP_009407243.1|  PREDICTED: probable acyl-activating enzyme 1...    214   4e-59   
ref|XP_010318903.1|  PREDICTED: probable acyl-activating enzyme 1...    212   7e-59   
gb|KEH38022.1|  acyl-activating enzyme 17, peroxisomal protein, p...    213   7e-59   
ref|XP_010493417.1|  PREDICTED: probable acyl-activating enzyme 1...    213   7e-59   
ref|XP_006289863.1|  hypothetical protein CARUB_v10003474mg             213   8e-59   
ref|XP_010424243.1|  PREDICTED: probable acyl-activating enzyme 1...    211   9e-59   
ref|XP_004236096.1|  PREDICTED: probable acyl-activating enzyme 1...    213   1e-58   
ref|XP_010318902.1|  PREDICTED: probable acyl-activating enzyme 1...    213   1e-58   
emb|CDY62679.1|  BnaCnng40810D                                          213   1e-58   
ref|XP_010695782.1|  PREDICTED: probable acyl-activating enzyme 1...    213   1e-58   
ref|XP_006597961.1|  PREDICTED: probable acyl-activating enzyme 1...    210   1e-58   
ref|XP_006602416.1|  PREDICTED: probable acyl-activating enzyme 1...    210   2e-58   
ref|XP_010913588.1|  PREDICTED: probable acyl-activating enzyme 1...    210   2e-58   
ref|XP_009607866.1|  PREDICTED: LOW QUALITY PROTEIN: probable acy...    213   2e-58   
ref|XP_002874109.1|  acyl-activating enzyme 17                          212   2e-58   
gb|AFD33356.1|  acyl-activating enzyme 12                               212   2e-58   
gb|KHF98232.1|  putative acyl-activating enzyme 17, peroxisomal -...    211   3e-58   
gb|EAZ44562.1|  hypothetical protein OsJ_29182                          211   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782051.1|  PREDICTED: probable acyl-activating enzyme 1...    209   4e-58   
ref|XP_006394570.1|  hypothetical protein EUTSA_v10003719mg             209   5e-58   
emb|CDY23710.1|  BnaC01g24110D                                          212   6e-58   
emb|CBI15386.3|  unnamed protein product                                209   1e-57   
ref|XP_006394571.1|  hypothetical protein EUTSA_v10003719mg             210   1e-57   
ref|XP_010454585.1|  PREDICTED: probable acyl-activating enzyme 1...    210   1e-57   
gb|KHN45999.1|  Putative acyl-activating enzyme 17, peroxisomal         209   1e-57   
ref|XP_010913587.1|  PREDICTED: probable acyl-activating enzyme 1...    210   1e-57   
ref|XP_006374381.1|  acyl-activating enzyme 17 family protein           210   1e-57   
ref|XP_006345069.1|  PREDICTED: probable acyl-activating enzyme 1...    209   2e-57   
ref|XP_006345068.1|  PREDICTED: probable acyl-activating enzyme 1...    209   2e-57   
ref|XP_011008796.1|  PREDICTED: probable acyl-activating enzyme 1...    209   2e-57   
gb|KHN28323.1|  Putative acyl-activating enzyme 17, peroxisomal         209   2e-57   
ref|XP_003546618.1|  PREDICTED: probable acyl-activating enzyme 1...    209   2e-57   
ref|XP_002512007.1|  acetyl-CoA synthetase, putative                    209   2e-57   Ricinus communis
ref|XP_002270918.1|  PREDICTED: probable acyl-activating enzyme 1...    209   2e-57   Vitis vinifera
ref|XP_010314208.1|  PREDICTED: probable acyl-activating enzyme 1...    206   2e-57   
ref|XP_003552050.2|  PREDICTED: probable acyl-activating enzyme 1...    209   2e-57   
ref|XP_004488348.1|  PREDICTED: probable acyl-activating enzyme 1...    209   3e-57   
ref|XP_004488347.1|  PREDICTED: probable acyl-activating enzyme 1...    209   3e-57   
ref|XP_008782050.1|  PREDICTED: probable acyl-activating enzyme 1...    209   3e-57   
ref|XP_010110070.1|  putative acyl-activating enzyme 17                 208   5e-57   
ref|XP_009762075.1|  PREDICTED: probable acyl-activating enzyme 1...    208   7e-57   
ref|XP_009762076.1|  PREDICTED: probable acyl-activating enzyme 1...    207   7e-57   
gb|AFD33345.1|  acyl-activating enzyme 1                                207   1e-56   
ref|XP_007210889.1|  hypothetical protein PRUPE_ppa002029mg             207   1e-56   
gb|KFK27630.1|  hypothetical protein AALP_AA8G408100                    206   2e-56   
gb|KDO65581.1|  hypothetical protein CISIN_1g004815mg                   205   2e-56   
ref|XP_006844216.1|  hypothetical protein AMTR_s00006p00266490          206   2e-56   
gb|EPS70528.1|  hypothetical protein M569_04232                         203   3e-56   
ref|XP_008244070.1|  PREDICTED: probable acyl-activating enzyme 1...    206   4e-56   
gb|KDO65580.1|  hypothetical protein CISIN_1g004815mg                   206   4e-56   
gb|KDO65579.1|  hypothetical protein CISIN_1g004815mg                   206   4e-56   
ref|XP_006494245.1|  PREDICTED: probable acyl-activating enzyme 1...    205   5e-56   
ref|XP_009337653.1|  PREDICTED: probable acyl-activating enzyme 1...    204   5e-56   
ref|XP_002978769.1|  hypothetical protein SELMODRAFT_109501             205   6e-56   
ref|XP_004252244.1|  PREDICTED: probable acyl-activating enzyme 1...    205   6e-56   
ref|XP_004299255.1|  PREDICTED: probable acyl-activating enzyme 1...    205   6e-56   
ref|XP_006345338.1|  PREDICTED: probable acyl-activating enzyme 1...    205   7e-56   
ref|XP_009787950.1|  PREDICTED: probable acyl-activating enzyme 1...    205   7e-56   
ref|XP_006440873.1|  hypothetical protein CICLE_v10019034mg             205   7e-56   
ref|XP_006440872.1|  hypothetical protein CICLE_v10019034mg             204   7e-56   
ref|XP_009337648.1|  PREDICTED: probable acyl-activating enzyme 1...    205   9e-56   
ref|XP_009610406.1|  PREDICTED: probable acyl-activating enzyme 1...    204   1e-55   
ref|XP_007138230.1|  hypothetical protein PHAVU_009G191300g             204   2e-55   
ref|XP_008393274.1|  PREDICTED: probable acyl-activating enzyme 1...    204   2e-55   
gb|KDP20059.1|  hypothetical protein JCGZ_05828                         204   2e-55   
gb|EYU38156.1|  hypothetical protein MIMGU_mgv1a002035mg                203   3e-55   
ref|XP_002984682.1|  hypothetical protein SELMODRAFT_423761             206   3e-55   
ref|XP_004138219.1|  PREDICTED: probable acyl-activating enzyme 1...    202   5e-55   
ref|WP_035139742.1|  AMP-dependent synthetase                           201   5e-55   
ref|XP_008453341.1|  PREDICTED: probable acyl-activating enzyme 1...    202   5e-55   
ref|XP_010037331.1|  PREDICTED: probable acyl-activating enzyme 1...    200   3e-54   
gb|KCW49033.1|  hypothetical protein EUGRSUZ_K02641                     200   3e-54   
ref|WP_038027236.1|  AMP-dependent synthetase                           199   5e-54   
ref|WP_020382222.1|  hypothetical protein                               198   1e-53   
ref|XP_011096943.1|  PREDICTED: probable acyl-activating enzyme 1...    197   3e-53   
ref|XP_011096944.1|  PREDICTED: probable acyl-activating enzyme 1...    197   3e-53   
ref|WP_017319530.1|  hypothetical protein                               196   8e-53   
emb|CDO98500.1|  unnamed protein product                                196   9e-53   
ref|WP_015144647.1|  acyl-CoA synthetase/AMP-acid ligase                196   1e-52   
ref|WP_019504730.1|  hypothetical protein                               195   1e-52   
ref|WP_016873373.1|  hypothetical protein                               195   1e-52   
ref|XP_001784278.1|  predicted protein                                  195   2e-52   
ref|XP_005644262.1|  acetyl-CoA synthetase-like protein                 193   8e-52   
gb|ABR26112.1|  catalytic ligase                                        184   9e-52   Oryza sativa Indica Group [Indian rice]
gb|EMT22531.1|  Acetyl-coenzyme A synthetase                            193   1e-51   
ref|WP_015155314.1|  AMP-dependent synthetase and ligase                191   5e-51   
ref|WP_015202337.1|  acetate--CoA ligase                                190   9e-51   
gb|KDD73731.1|  AMP-binding enzyme                                      189   1e-50   
ref|WP_006509596.1|  acyl-CoA synthetase/AMP-acid ligase                189   2e-50   
ref|WP_039717176.1|  AMP-dependent synthetase                           189   2e-50   
ref|WP_017743831.1|  hypothetical protein                               189   3e-50   
ref|WP_036011031.1|  AMP-dependent synthetase                           188   4e-50   
ref|WP_038083448.1|  AMP-dependent synthetase                           188   5e-50   
ref|WP_015195385.1|  Acetoacetate--CoA ligase                           187   2e-49   
ref|WP_002645583.1|  acetate--CoA ligase (acetyl-CoA synthase)          186   4e-49   
gb|EKD53626.1|  AMP-dependent synthetase and ligase                     184   2e-48   
ref|WP_026085990.1|  AMP-dependent synthetase                           181   1e-47   
gb|KFM24179.1|  Acetyl-coenzyme A synthetase                            178   1e-46   
ref|WP_007417832.1|  AMP-dependent synthetase                           177   2e-46   
ref|WP_006513568.1|  acyl-CoA synthetase/AMP-acid ligase                177   2e-46   
ref|WP_017290687.1|  hypothetical protein                               177   3e-46   
ref|WP_023070924.1|  hypothetical protein                               177   3e-46   
ref|WP_006982530.1|  AMP-dependent synthetase                           176   5e-46   
ref|XP_002946656.1|  hypothetical protein VOLCADRAFT_120325             171   2e-44   
ref|WP_038169189.1|  AMP-dependent synthetase                           170   8e-44   
gb|KCW45160.1|  hypothetical protein EUGRSUZ_L01217                     162   5e-43   
ref|XP_010040152.1|  PREDICTED: probable acyl-activating enzyme 1...    160   2e-42   
gb|KCW45442.1|  hypothetical protein EUGRSUZ_L00842                     160   3e-42   
ref|XP_008659946.1|  PREDICTED: probable acyl-activating enzyme 1...    152   2e-41   
ref|XP_008659945.1|  PREDICTED: probable acyl-activating enzyme 1...    152   2e-41   
gb|KCW45446.1|  hypothetical protein EUGRSUZ_L008502                    150   5e-40   
ref|WP_035404324.1|  hypothetical protein                               157   2e-39   
ref|XP_010552273.1|  PREDICTED: probable acyl-activating enzyme 1...    157   4e-39   
ref|XP_001697163.1|  hypothetical protein CHLREDRAFT_119897             153   4e-38   
dbj|GAL87166.1|  hypothetical protein MYP_4396                          153   6e-38   
emb|CDP20230.1|  unnamed protein product                                145   1e-37   
gb|KCW52408.1|  hypothetical protein EUGRSUZ_J018131                    150   2e-37   
ref|WP_028980739.1|  hypothetical protein                               148   4e-36   
gb|ETO20828.1|  catalytic/ ligase                                       146   4e-35   
ref|XP_003056773.1|  predicted protein                                  144   6e-35   
tpg|DAA61279.1|  TPA: hypothetical protein ZEAMMB73_087632              142   2e-34   
ref|WP_018342403.1|  hypothetical protein                               135   1e-31   
ref|XP_005846239.1|  hypothetical protein CHLNCDRAFT_58232              136   3e-31   
ref|NP_001175811.1|  Os09g0380000                                       123   5e-30   
gb|AAK49071.1|AF258279_1  acetyl-CoA synthetase                         117   2e-28   
gb|KCW52404.1|  hypothetical protein EUGRSUZ_J01810                     121   3e-28   
gb|AAK49075.1|AF258283_1  acetyl-CoA synthetase                         116   3e-28   
gb|AAK49076.1|AF258284_1  acetyl-CoA synthetase                         115   5e-28   
gb|AAK49073.1|AF258281_1  acetyl-CoA synthetase                         115   8e-28   
gb|AAK49074.1|AF258282_1  acetyl-CoA synthetase                         111   1e-26   
ref|WP_011586333.1|  acetyl-CoA synthetase                              119   4e-26   
ref|XP_010110735.1|  putative acyl-activating enzyme 17                 112   7e-25   
gb|AAK49072.1|AF258280_1  acetyl-CoA synthetase                         103   7e-24   
gb|KCW52407.1|  hypothetical protein EUGRSUZ_J018132                    103   3e-22   
ref|XP_010110732.1|  putative acyl-activating enzyme 17                 101   3e-21   
ref|XP_010552277.1|  PREDICTED: probable acyl-activating enzyme 1...  99.4    3e-19   
ref|XP_010040157.1|  PREDICTED: probable acyl-activating enzyme 1...  97.8    3e-19   
dbj|BAD26087.1|  acyl-activating enzyme 17-like protein               96.3    3e-19   
ref|XP_010552276.1|  PREDICTED: probable acyl-activating enzyme 1...  97.1    1e-18   
ref|XP_010552275.1|  PREDICTED: probable acyl-activating enzyme 1...  96.7    2e-18   
ref|XP_006340474.1|  PREDICTED: translational activator GCN1-like     72.4    8e-18   
ref|XP_010319822.1|  PREDICTED: translational activator GCN1          71.6    8e-18   
ref|WP_036759996.1|  acetate--CoA ligase                              94.0    1e-17   
ref|WP_036698691.1|  acetate--CoA ligase                              91.3    1e-16   
ref|WP_005175081.1|  acetate--CoA ligase                              90.1    2e-16   
ref|WP_015308493.1|  acyl-CoA synthetase/AMP-acid ligase              89.7    3e-16   
ref|XP_009587833.1|  PREDICTED: translational activator GCN1 isof...  70.5    6e-16   
ref|XP_009587842.1|  PREDICTED: translational activator GCN1 isof...  70.5    6e-16   
ref|XP_009775452.1|  PREDICTED: translational activator GCN1 isof...  69.3    6e-16   
ref|XP_009775453.1|  PREDICTED: translational activator GCN1 isof...  69.3    6e-16   
ref|XP_009775451.1|  PREDICTED: translational activator GCN1 isof...  69.3    7e-16   
ref|XP_009775450.1|  PREDICTED: translational activator GCN1 isof...  69.3    7e-16   
ref|WP_029363828.1|  acetate--CoA ligase                              88.2    1e-15   
ref|WP_005196911.1|  AMP-dependent synthetase                         87.4    2e-15   
ref|WP_006900895.1|  acetate--CoA ligase                              87.4    2e-15   
ref|WP_034712321.1|  AMP-dependent synthetase                         87.0    2e-15   
gb|KHN47986.1|  Putative acyl-activating enzyme 18, peroxisomal       83.2    2e-15   
ref|WP_035665153.1|  AMP-dependent synthetase                         87.0    3e-15   
gb|KCW61470.1|  hypothetical protein EUGRSUZ_H04206                   60.1    4e-15   
ref|XP_010024927.1|  PREDICTED: translational activator GCN1          60.1    4e-15   
ref|WP_009711351.1|  AMP-dependent synthetase                         86.3    4e-15   
gb|KCW61469.1|  hypothetical protein EUGRSUZ_H04206                   60.1    5e-15   
ref|WP_027935182.1|  AMP-dependent synthetase                         85.9    6e-15   
ref|WP_028777807.1|  AMP-dependent synthetase                         85.9    7e-15   
ref|WP_013873373.1|  AMP-dependent synthetase                         85.5    8e-15   
gb|EMP12238.1|  AMP-binding enzyme family protein                     85.5    9e-15   
ref|WP_022736967.1|  AMP-dependent synthetase                         85.1    1e-14   
ref|WP_026577408.1|  AMP-dependent synthetase                         85.1    1e-14   
ref|WP_008638165.1|  acetoacetyl-CoA synthase                         85.1    1e-14   
ref|WP_020171900.1|  AMP-dependent synthetase                         84.7    1e-14   
ref|WP_006372173.1|  AMP-dependent synthetase                         84.7    1e-14   
ref|WP_026641463.1|  acetate--CoA ligase                              84.7    1e-14   
ref|WP_018132992.1|  hypothetical protein                             84.7    1e-14   
gb|KDO52490.1|  hypothetical protein CISIN_1g000049mg                 60.8    2e-14   
gb|KDO52491.1|  hypothetical protein CISIN_1g000049mg                 60.8    2e-14   
ref|XP_006478976.1|  PREDICTED: LOW QUALITY PROTEIN: translationa...  60.8    2e-14   
gb|KDO52492.1|  hypothetical protein CISIN_1g000049mg                 60.8    2e-14   
gb|KDO52493.1|  hypothetical protein CISIN_1g000049mg                 60.8    2e-14   
ref|XP_006443281.1|  hypothetical protein CICLE_v10018428mg           60.8    2e-14   
gb|KDO52494.1|  hypothetical protein CISIN_1g000049mg                 60.8    2e-14   
ref|XP_006443282.1|  hypothetical protein CICLE_v10018428mg           60.5    2e-14   
ref|WP_022538629.1|  hypothetical protein                             84.3    2e-14   
ref|WP_017728711.1|  hypothetical protein                             84.0    2e-14   
ref|WP_037172729.1|  AMP-dependent synthetase                         83.6    3e-14   
ref|WP_005632351.1|  AMP-dependent synthetase                         83.6    3e-14   
ref|WP_003890284.1|  AMP-dependent synthetase                         83.6    3e-14   
ref|WP_037040214.1|  AMP-dependent synthetase                         83.2    5e-14   
gb|KDB67879.1|  AMP-binding enzyme C-terminal domain protein          82.4    6e-14   
ref|WP_026587344.1|  AMP-dependent synthetase                         82.8    7e-14   
ref|WP_004566171.1|  AMP-binding enzyme                               82.8    7e-14   
ref|WP_033465306.1|  acetate--CoA ligase                              82.8    7e-14   
gb|KDD51764.1|  putative acetoacetate-CoA ligase                      82.4    7e-14   
ref|WP_033454144.1|  acetate--CoA ligase                              82.4    7e-14   
gb|KDD42562.1|  putative acetoacetate-CoA ligase                      82.4    7e-14   
gb|KDD17931.1|  putative acetoacetate-CoA ligase                      82.4    7e-14   
gb|KAK77662.1|  putative acetoacetate-CoA ligase                      82.4    8e-14   
ref|WP_033452892.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033475290.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033469159.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033446685.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_003819286.1|  AMP-binding enzyme                               82.4    8e-14   
ref|WP_033463565.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033460428.1|  acetate--CoA ligase                              82.4    8e-14   
ref|XP_008441801.1|  PREDICTED: LOW QUALITY PROTEIN: translationa...  59.7    8e-14   
ref|WP_033450042.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033448149.1|  acetate--CoA ligase                              82.4    8e-14   
emb|CCN21386.1|  AMP-binding enzyme                                   82.4    8e-14   
ref|WP_033472193.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033471089.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033447484.1|  acetate--CoA ligase                              82.4    8e-14   
gb|KAK53768.1|  putative acetoacetate-CoA ligase                      82.4    8e-14   
ref|WP_010925893.1|  acetate--CoA ligase                              82.4    8e-14   
ref|WP_033458408.1|  acetate--CoA ligase                              82.4    8e-14   
gb|KDC68512.1|  putative acetoacetate-CoA ligase                      82.4    8e-14   
gb|KDC16524.1|  putative acetoacetate-CoA ligase                      82.4    8e-14   
gb|KDB83849.1|  putative acetoacetate-CoA ligase                      82.4    8e-14   
gb|KCV50167.1|  putative acetoacetate-CoA ligase                      82.4    8e-14   
ref|WP_015064587.1|  AMP-binding protein                              82.4    8e-14   
gb|KDC63322.1|  putative acetoacetate-CoA ligase                      82.4    8e-14   
ref|WP_006329156.1|  AMP-dependent synthetase                         82.4    9e-14   
ref|WP_033456763.1|  acetate--CoA ligase                              82.0    1e-13   
ref|WP_035499115.1|  acetate--CoA ligase                              82.0    1e-13   
gb|KCV45629.1|  putative acetoacetate-CoA ligase                      82.0    1e-13   
ref|WP_027930249.1|  AMP-dependent synthetase                         82.0    1e-13   
ref|WP_026695770.1|  AMP-dependent synthetase                         82.0    1e-13   
ref|WP_011297984.1|  acetate--CoA ligase                              81.6    2e-13   
ref|WP_036565066.1|  AMP-dependent synthetase                         81.3    2e-13   
ref|WP_018924232.1|  hypothetical protein                             81.3    2e-13   
ref|WP_010897307.1|  AMP-dependent synthetase                         81.3    2e-13   
ref|WP_011238469.1|  AMP-dependent synthetase                         81.3    2e-13   
gb|KDP23748.1|  hypothetical protein JCGZ_23581                       57.4    2e-13   
emb|CAN77483.1|  hypothetical protein VITISV_040059                   57.0    2e-13   
ref|WP_033839728.1|  acetate--CoA ligase                              81.3    2e-13   
ref|WP_033462833.1|  acetate--CoA ligase                              81.3    2e-13   
gb|KDC22539.1|  putative acetoacetate-CoA ligase                      80.9    2e-13   
ref|WP_029239177.1|  AMP-dependent synthetase                         80.9    2e-13   
ref|WP_035513924.1|  acetate--CoA ligase                              80.9    3e-13   
ref|XP_006854388.1|  hypothetical protein AMTR_s00039p00177200        58.5    3e-13   
ref|XP_002522017.1|  Translational activator GCN1, putative           58.5    3e-13   
ref|XP_011077135.1|  PREDICTED: LOW QUALITY PROTEIN: translationa...  58.5    3e-13   
gb|KHG25727.1|  Translational activator gcn1                          57.4    3e-13   
ref|XP_006577327.1|  PREDICTED: translational activator GCN1          57.4    3e-13   
gb|KHN35331.1|  Translational activator GCN1                          57.4    3e-13   
ref|XP_004155110.1|  PREDICTED: LOW QUALITY PROTEIN: translationa...  57.4    4e-13   
ref|WP_018780489.1|  AMP-dependent synthetase                         80.5    4e-13   
gb|KGN61310.1|  hypothetical protein Csa_2G079620                     57.8    4e-13   
ref|WP_011349842.1|  AMP-dependent synthetase                         80.5    4e-13   
ref|WP_000806484.1|  AMP-dependent synthetase                         80.5    4e-13   
ref|WP_010927590.1|  acetate--CoA ligase                              80.5    4e-13   
ref|WP_034641489.1|  AMP-dependent synthetase                         80.1    4e-13   
ref|XP_004152809.1|  PREDICTED: translational activator GCN1-like     57.4    4e-13   
ref|WP_037996285.1|  AMP-dependent synthetase                         80.1    5e-13   
ref|WP_012691747.1|  AMP-dependent synthetase                         80.1    5e-13   
ref|WP_036516792.1|  AMP-dependent synthetase                         80.1    5e-13   
ref|WP_038039466.1|  AMP-dependent synthetase                         80.1    5e-13   
ref|WP_013721725.1|  acetate--CoA ligase                              80.1    5e-13   
ref|WP_013519745.1|  acetate--CoA ligase                              80.1    5e-13   
ref|XP_010648947.1|  PREDICTED: translational activator GCN1          57.0    5e-13   
ref|XP_008218367.1|  PREDICTED: translational activator GCN1          55.8    6e-13   
ref|XP_011002020.1|  PREDICTED: translational activator GCN1          58.9    6e-13   
ref|WP_011350020.1|  acetate--CoA ligase                              79.7    6e-13   
ref|WP_038571211.1|  acetate--CoA ligase                              79.7    6e-13   
ref|XP_002325793.2|  hypothetical protein POPTR_0019s04090g           58.5    6e-13   
ref|WP_017186969.1|  hypothetical protein                             79.7    6e-13   
ref|XP_002325795.2|  hypothetical protein POPTR_0019s04090g           58.5    7e-13   
ref|XP_007208409.1|  hypothetical protein PRUPE_ppa000041mg           55.5    7e-13   
ref|WP_007299645.1|  AMP-dependent synthetase                         79.7    7e-13   
ref|WP_025150550.1|  AMP-dependent synthetase                         79.3    7e-13   
ref|WP_022834952.1|  AMP-dependent synthetase                         79.3    8e-13   
ref|XP_008388756.1|  PREDICTED: translational activator GCN1          53.5    8e-13   
gb|AAC62406.1|  AcsA                                                  79.3    8e-13   
ref|WP_005250868.1|  AMP-dependent synthetase                         79.3    9e-13   
ref|WP_028222513.1|  acetate--CoA ligase                              79.3    9e-13   
ref|WP_022626446.1|  AMP-dependent synthetase                         79.0    1e-12   
ref|WP_012957683.1|  AMP-dependent synthetase                         79.0    1e-12   
ref|WP_015038913.1|  AMP-binding protein                              79.0    1e-12   
ref|XP_004304787.1|  PREDICTED: translational activator GCN1-like     54.7    1e-12   
ref|WP_012094297.1|  AMP-dependent synthetase                         79.0    1e-12   
gb|AII08430.1|  AMP-dependent synthetase                              79.0    1e-12   
ref|WP_007574695.1|  AMP-dependent synthetase                         79.0    1e-12   
ref|WP_016114921.1|  acetoacetate-CoA ligase                          78.6    1e-12   
ref|WP_015245234.1|  AMP-dependent synthetase                         78.6    1e-12   
gb|KEH24611.1|  translational activator GCN1-like protein             55.8    1e-12   
gb|KHN43147.1|  Translational activator GCN1                          55.1    1e-12   
ref|XP_003626486.1|  Translational activator GCN1                     55.5    1e-12   
ref|WP_020164842.1|  AMP-dependent synthetase                         78.6    1e-12   
ref|XP_006604865.1|  PREDICTED: translational activator GCN1-like     55.1    1e-12   
gb|EWH20048.1|  AMP-dependent synthetase                              78.6    2e-12   
ref|WP_028093913.1|  AMP-dependent synthetase                         78.6    2e-12   
ref|WP_009475551.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_026590843.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_024718293.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|XP_004494756.1|  PREDICTED: LOW QUALITY PROTEIN: translationa...  53.1    2e-12   
ref|WP_035813253.1|  acetate--CoA ligase                              77.4    2e-12   
ref|WP_026579616.1|  MULTISPECIES: AMP-dependent synthetase           78.2    2e-12   
ref|WP_018987858.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|XP_010550811.1|  PREDICTED: translational activator GCN1          55.8    2e-12   
ref|WP_025810772.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_018765917.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_000806452.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_033677468.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_000806453.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_003197798.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_003207216.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_016129463.1|  acetoacetate-CoA ligase                          78.2    2e-12   
ref|WP_039072758.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_009819977.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_027818461.1|  acetate--CoA ligase                              78.2    2e-12   
ref|WP_000806501.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_000806499.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_000806467.1|  AMP-dependent synthetase                         78.2    2e-12   
ref|WP_039343238.1|  acetate--CoA ligase                              78.2    2e-12   
ref|WP_035928951.1|  acetate--CoA ligase                              77.8    2e-12   
ref|WP_038454917.1|  acetate--CoA ligase                              77.8    2e-12   
gb|KDR38511.1|  acetate--CoA ligase                                   77.8    2e-12   
ref|XP_010230739.1|  PREDICTED: translational activator GCN1 isof...  56.2    2e-12   
ref|XP_010230742.1|  PREDICTED: translational activator GCN1 isof...  56.2    2e-12   
ref|WP_018229443.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_035956452.1|  acetate--CoA ligase                              77.8    3e-12   
ref|WP_000806500.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_039224098.1|  acetate--CoA ligase                              77.8    3e-12   
ref|XP_009379727.1|  PREDICTED: translational activator GCN1          52.0    3e-12   
ref|WP_002172032.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_000806454.1|  AMP-dependent synthetase                         77.8    3e-12   
gb|KER69050.1|  acetate--CoA ligase                                   77.8    3e-12   
ref|WP_013988462.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_000806460.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_033798877.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_028288566.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_003211454.1|  AMP-dependent synthetase                         77.8    3e-12   
ref|WP_014067067.1|  AMP-dependent synthetase                         77.8    3e-12   
dbj|BAO91913.1|  AMP-dependent synthetase and ligase                  77.8    3e-12   
ref|WP_012843925.1|  AMP-dependent synthetase                         77.8    3e-12   



>ref|XP_007208343.1| hypothetical protein PRUPE_ppa002031mg [Prunus persica]
 gb|EMJ09542.1| hypothetical protein PRUPE_ppa002031mg [Prunus persica]
Length=726

 Score =   291 bits (746),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHLSP+R AAD      +Q GDV+CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  368  GDPKAIPWTHLSPIRCAADSWAHIDIQVGDVFCWPTNLGWVMGPVLLYSCFLTGATLALY  427

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVKAWK+T CMKGLDWT+I++FA+TGEASNVDDD
Sbjct  428  HGSPLGRGFGKFVQDAGVTILGTVPSLVKAWKNTQCMKGLDWTKIKLFASTGEASNVDDD  487

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWLTSRAYYKPI ECCGGTEL+S+Y+ GS LQPQAFG FS+ SM   FVI  E
Sbjct  488  LWLTSRAYYKPITECCGGTELSSSYIMGSPLQPQAFGAFSTRSMTTGFVILDE  540



>ref|XP_009791362.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Nicotiana sylvestris]
Length=729

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHLSP+R  A      DV+AGDV CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  371  GDPKAIPWTHLSPIRCGAESWANLDVRAGDVSCWPTNLGWVMGPILIYSCFLTGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CMKGLDWTRIR+FA+TGEASNVDDD
Sbjct  431  HGSPLDHGFGKFVQDAGVTILGTVPSLVKTWKSTGCMKGLDWTRIRMFASTGEASNVDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKP++ECCGGTEL+S+Y+ G+LLQPQAFGTFSSASM+  FVI  E
Sbjct  491  LWLSSRVDYKPVIECCGGTELSSSYIMGNLLQPQAFGTFSSASMSTGFVILDE  543



>ref|XP_009623331.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X3 [Nicotiana tomentosiformis]
Length=630

 Score =   287 bits (734),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHLSP+R AA      DV+AGDV CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  268  GDPKAIPWTHLSPIRCAAESWANLDVRAGDVSCWPTNLGWVMGPILIYSCFLTGATLALY  327

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST C+KGLDWTRIR+FA+TGEASNVDDD
Sbjct  328  HGSPLDHGFGKFVQDAGVTILGTVPSLVKTWKSTGCIKGLDWTRIRMFASTGEASNVDDD  387

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKP++ECCGGTEL+S+Y+ G+LLQPQAFG FSSASM+  FVI  E
Sbjct  388  LWLSSRVDYKPVIECCGGTELSSSYIMGNLLQPQAFGAFSSASMSTGFVILDE  440



>ref|XP_009791360.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009791361.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Nicotiana sylvestris]
Length=733

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHLSP+R  A      DV+AGDV CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  371  GDPKAIPWTHLSPIRCGAESWANLDVRAGDVSCWPTNLGWVMGPILIYSCFLTGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CMKGLDWTRIR+FA+TGEASNVDDD
Sbjct  431  HGSPLDHGFGKFVQDAGVTILGTVPSLVKTWKSTGCMKGLDWTRIRMFASTGEASNVDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKP++ECCGGTEL+S+Y+ G+LLQPQAFGTFSSASM+  FVI  E
Sbjct  491  LWLSSRVDYKPVIECCGGTELSSSYIMGNLLQPQAFGTFSSASMSTGFVILDE  543



>ref|XP_008246524.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Prunus 
mume]
Length=734

 Score =   289 bits (739),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 148/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHLSP+R AAD      +Q GDV+CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  376  GDPKAIPWTHLSPIRCAADSWAHVDIQVGDVFCWPTNLGWVMGPILLYSCFLTGATLALY  435

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVKAWK+T CMKGLDWT+I+ FA+TGEASNVDDD
Sbjct  436  HGSPLGRGFGKFVQDAGVTILGTVPSLVKAWKNTQCMKGLDWTKIKSFASTGEASNVDDD  495

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL SRAYYKPI ECCGGTEL+S+YV GS LQPQAFG FS+ SM   FVI  E
Sbjct  496  LWLASRAYYKPITECCGGTELSSSYVMGSPLQPQAFGAFSAKSMTTGFVILDE  548



>ref|XP_010651362.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Vitis vinifera]
Length=507

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT +SP+R++AD      +Q GDV+CWPTNLGWVMGPT++YA FLTGA L LY
Sbjct  149  GDPKAIPWTQVSPIRSSADAWAQINIQVGDVFCWPTNLGWVMGPTILYASFLTGAALALY  208

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WK+T CM+GLDWT+I+ FA+TGE SNVDDD
Sbjct  209  HGSPLDRGFGKFVQDAGVTVLGTVPSLVKTWKNTGCMEGLDWTKIKSFASTGETSNVDDD  268

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ GS+LQPQAFGTFS+A+M   FVI  E
Sbjct  269  LWLSSRAYYKPIIECCGGTELASSYIQGSVLQPQAFGTFSTAAMTTGFVILDE  321



>ref|XP_009623329.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Nicotiana tomentosiformis]
Length=736

 Score =   287 bits (735),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHLSP+R AA      DV+AGDV CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  374  GDPKAIPWTHLSPIRCAAESWANLDVRAGDVSCWPTNLGWVMGPILIYSCFLTGATLALY  433

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST C+KGLDWTRIR+FA+TGEASNVDDD
Sbjct  434  HGSPLDHGFGKFVQDAGVTILGTVPSLVKTWKSTGCIKGLDWTRIRMFASTGEASNVDDD  493

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKP++ECCGGTEL+S+Y+ G+LLQPQAFG FSSASM+  FVI  E
Sbjct  494  LWLSSRVDYKPVIECCGGTELSSSYIMGNLLQPQAFGAFSSASMSTGFVILDE  546



>ref|XP_009623330.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Nicotiana tomentosiformis]
Length=732

 Score =   287 bits (735),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHLSP+R AA      DV+AGDV CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  374  GDPKAIPWTHLSPIRCAAESWANLDVRAGDVSCWPTNLGWVMGPILIYSCFLTGATLALY  433

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST C+KGLDWTRIR+FA+TGEASNVDDD
Sbjct  434  HGSPLDHGFGKFVQDAGVTILGTVPSLVKTWKSTGCIKGLDWTRIRMFASTGEASNVDDD  493

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKP++ECCGGTEL+S+Y+ G+LLQPQAFG FSSASM+  FVI  E
Sbjct  494  LWLSSRVDYKPVIECCGGTELSSSYIMGNLLQPQAFGAFSSASMSTGFVILDE  546



>ref|XP_011089736.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Sesamum indicum]
Length=500

 Score =   280 bits (716),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 175/235 (74%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      +Q GDV+CWPTNLGWVMGP L+Y+CFL+GATL LY
Sbjct  142  GEPKAIPWTQLSPIRCAADSWAHLDIQTGDVFCWPTNLGWVMGPILLYSCFLSGATLALY  201

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVKAWK+T CM+GLDWT+I+ FA+TGEAS+VDDD
Sbjct  202  HGSPLGRGFGKFVQDAGVTLLGTVPSLVKAWKNTHCMEGLDWTQIKSFASTGEASSVDDD  261

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWL+SRA+YKP++ECCGGTELAS+Y+ G+LLQPQAFG FSSA+M+  FVI  E  V   D
Sbjct  262  LWLSSRAFYKPVLECCGGTELASSYIFGNLLQPQAFGAFSSATMSTGFVIFDENGVPYPD  321

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   +  F L   ++ R     LN+     D EE+    K +P   G Q R+
Sbjct  322  DQPCIGEVGLFPLYMGATDR----LLNA-----DHEEV--YFKGMPMYKGMQLRR  365



>ref|XP_006367600.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Solanum tuberosum]
Length=723

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAI WTHLSP+R  AD      +Q+GDV+C+PTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  365  GDPKAISWTHLSPIRCTADSWAHLDIQSGDVFCYPTNLGWVMGPVLLYSCFLTGATLALY  424

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WKST CMKGLDWTRIR+FA+TGEASNVDDD
Sbjct  425  HGSPLDHGFGKFVQDAGVTVLGTVPSLVKTWKSTGCMKGLDWTRIRMFASTGEASNVDDD  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR YYKPI+ECCGGTEL+S+Y+ G+LLQPQAFG FSSA+M+  FVI  E
Sbjct  485  LWLSSRVYYKPIIECCGGTELSSSYIIGNLLQPQAFGAFSSATMSTGFVILDE  537



>ref|XP_010276331.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Nelumbo nucifera]
Length=691

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  375  GDPKAIPWTQLSPIRSAADGWAHVNIQPGDVYCWPTNLGWVMGPILLYSCFLTGATLALY  434

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPLSR FGKFVQDAGV+ LGTVPS+VKAWK+T CM GLDWT I+ FA+TGEASNVDDD
Sbjct  435  HGSPLSRGFGKFVQDAGVTHLGTVPSIVKAWKTTRCMDGLDWTNIKSFASTGEASNVDDD  494

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA+YKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ASM   FVI
Sbjct  495  LWLSSRAFYKPVIECCGGTELASSYIQGSPLQPQAFGAFSTASMTTGFVI  544



>ref|XP_010651363.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X3 [Vitis vinifera]
Length=634

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT +SP+R++AD      +Q GDV+CWPTNLGWVMGPT++YA FLTGA L LY
Sbjct  276  GDPKAIPWTQVSPIRSSADAWAQINIQVGDVFCWPTNLGWVMGPTILYASFLTGAALALY  335

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WK+T CM+GLDWT+I+ FA+TGE SNVDDD
Sbjct  336  HGSPLDRGFGKFVQDAGVTVLGTVPSLVKTWKNTGCMEGLDWTKIKSFASTGETSNVDDD  395

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ GS+LQPQAFGTFS+A+M   FVI  E
Sbjct  396  LWLSSRAYYKPIIECCGGTELASSYIQGSVLQPQAFGTFSTAAMTTGFVILDE  448



>ref|XP_010097804.1| putative acyl-activating enzyme 18 [Morus notabilis]
 gb|EXB71431.1| putative acyl-activating enzyme 18 [Morus notabilis]
Length=626

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 149/170 (88%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+AAD      VQAGDV CWPT+LGWVMGP+++++C L+GATL LY
Sbjct  268  GEPKAIPWTQLSPIRSAADGWAHMDVQAGDVMCWPTSLGWVMGPSILFSCLLSGATLALY  327

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGT+P+LVK WKST CMKGLDWT+I+ FATTGEASNVDDD
Sbjct  328  HGSPLGRGFGKFVQDAGVTILGTIPTLVKTWKSTQCMKGLDWTKIKGFATTGEASNVDDD  387

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKPI+ECCGGTELAS Y+ GSLLQPQAFG FS+ASM   FVI
Sbjct  388  LWLSSQAYYKPIIECCGGTELASAYIEGSLLQPQAFGAFSTASMTTGFVI  437



>ref|XP_010276330.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Nelumbo nucifera]
Length=733

 Score =   283 bits (724),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  375  GDPKAIPWTQLSPIRSAADGWAHVNIQPGDVYCWPTNLGWVMGPILLYSCFLTGATLALY  434

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPLSR FGKFVQDAGV+ LGTVPS+VKAWK+T CM GLDWT I+ FA+TGEASNVDDD
Sbjct  435  HGSPLSRGFGKFVQDAGVTHLGTVPSIVKAWKTTRCMDGLDWTNIKSFASTGEASNVDDD  494

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA+YKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ASM   FVI
Sbjct  495  LWLSSRAFYKPVIECCGGTELASSYIQGSPLQPQAFGAFSTASMTTGFVI  544



>ref|XP_009375617.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Pyrus 
x bretschneideri]
Length=727

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 169/235 (72%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAADV------QAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R  AD       Q GDV+CWPTNLGWVMGP L+Y+CFLTG+TL LY
Sbjct  369  GDPKAIPWTQLSPIRAVADSWAHNDNQVGDVFCWPTNLGWVMGPILLYSCFLTGSTLALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVKAWKST CMKGLDWT+IR F +TGEAS+VDDD
Sbjct  429  HGSPLGRGFGKFVQDAGVTILGTVPSLVKAWKSTQCMKGLDWTKIRSFCSTGEASSVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWL SRAYY PI+ECCGGTELAS+Y+ GS LQPQAFG FS+ SM   FVI  E  +   +
Sbjct  489  LWLASRAYYGPIIECCGGTELASSYIMGSWLQPQAFGAFSTKSMTTGFVIFDEHGIPYPE  548

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   +  F LL  ++ R     LN+     D E++    K +P  NG Q R+
Sbjct  549  EQACVGEVGLFPLLMGATDR----LLNA-----DHEKV--YFKGMPMYNGTQLRR  592



>ref|XP_002527076.1| acetyl-CoA synthetase, putative [Ricinus communis]
 gb|EEF35320.1| acetyl-CoA synthetase, putative [Ricinus communis]
Length=625

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAI WT LSP+R+A+D      VQAGDVYCWPTNLGWVMGP L+Y+CFLTGATL L+
Sbjct  267  GEPKAIVWTQLSPIRSASDAWAHLDVQAGDVYCWPTNLGWVMGPILLYSCFLTGATLALF  326

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKF+Q+AGV+ILGTVPSLVKAWKST+CM+GLDWT+I+ F +TGEASNVDDD
Sbjct  327  HGSPLGREFGKFIQNAGVTILGTVPSLVKAWKSTNCMEGLDWTKIKSFGSTGEASNVDDD  386

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR YYKPI+ECCGGTELAS+Y+ G  LQPQAFG FS+ASM   FVI  E
Sbjct  387  LWLSSRTYYKPIIECCGGTELASSYIQGCPLQPQAFGAFSTASMTTGFVILDE  439



>gb|KDO63048.1| hypothetical protein CISIN_1g004821mg [Citrus sinensis]
Length=512

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D++ GDVYCWPTNLGWVMGP ++++ FL+GA L LY
Sbjct  153  GEPKAIPWTQLSPIRCAAEAWGHIDMKVGDVYCWPTNLGWVMGPIILFSSFLSGAALALY  212

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL RSFGKFVQD+GVS+LGTVPSLVKAWK+T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  213  HGSPLERSFGKFVQDSGVSVLGTVPSLVKAWKNTNCLQGLDWTKIRSFASTGETSNVDDD  272

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL S+AYYKPI+ECCGGTELAS+Y+ GS+LQPQAFG FS+A+M   FVI  E
Sbjct  273  LWLASKAYYKPIIECCGGTELASSYIQGSMLQPQAFGAFSTATMTTGFVILDE  325



>ref|XP_004294995.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Fragaria vesca subsp. vesca]
Length=731

 Score =   282 bits (721),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 144/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R AAD       Q GDV+CWPTNLGWVMGP L+Y+CFLTGATL L+
Sbjct  373  GDPKAIPWTQLSPIRCAADSWSHIDTQVGDVFCWPTNLGWVMGPILIYSCFLTGATLALF  432

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGVSILGTVPSLVKAWKST CMKGLDWT+I+ FA+TGEASNVDDD
Sbjct  433  HGSPLGRGFGKFVQDAGVSILGTVPSLVKAWKSTKCMKGLDWTKIKSFASTGEASNVDDD  492

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRAYYKPI ECCGGTEL+S Y+  S LQPQAFG FS+ SM   FVI
Sbjct  493  LWLSSRAYYKPIRECCGGTELSSCYIMASPLQPQAFGAFSTKSMTTGFVI  542



>gb|KHN47969.1| Putative acyl-activating enzyme 18, peroxisomal [Glycine soja]
Length=695

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPTL+Y+CFL+GATL LY
Sbjct  370  GEPKAIPWTQLSPIRSAADAWAFIDIQPGDVYCWPTNLGWVMGPTLIYSCFLSGATLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I++F +TGE SNVDDD
Sbjct  430  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKIFCSTGETSNVDDD  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTELAS+Y+ GS LQPQAFG FS+ASM    VI  E
Sbjct  490  LWLSSKSYYKPIIECCGGTELASSYIIGSPLQPQAFGAFSTASMTTGLVILDE  542



>ref|XP_002285701.2| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Vitis vinifera]
Length=756

 Score =   282 bits (721),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT +SP+R++AD      +Q GDV+CWPTNLGWVMGPT++YA FLTGA L LY
Sbjct  398  GDPKAIPWTQVSPIRSSADAWAQINIQVGDVFCWPTNLGWVMGPTILYASFLTGAALALY  457

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WK+T CM+GLDWT+I+ FA+TGE SNVDDD
Sbjct  458  HGSPLDRGFGKFVQDAGVTVLGTVPSLVKTWKNTGCMEGLDWTKIKSFASTGETSNVDDD  517

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ GS+LQPQAFGTFS+A+M   FVI  E
Sbjct  518  LWLSSRAYYKPIIECCGGTELASSYIQGSVLQPQAFGTFSTAAMTTGFVILDE  570



>gb|KEH20659.1| acyl-activating enzyme 17, peroxisomal protein, putative [Medicago 
truncatula]
Length=610

 Score =   278 bits (712),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPTL+Y+CFL+GATL LY
Sbjct  370  GDPKAIPWTQLSPIRSAADGWALIDIQPGDVYCWPTNLGWVMGPTLLYSCFLSGATLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I+ F +TGE SNVDDD
Sbjct  430  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKKFCSTGETSNVDDD  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTELAS Y+ GSLLQPQAFG FS+AS+    VI  E
Sbjct  490  LWLSSKSYYKPIIECCGGTELASCYIMGSLLQPQAFGAFSTASLTTGLVILDE  542



>gb|EYU31686.1| hypothetical protein MIMGU_mgv1a002873mg [Erythranthe guttata]
Length=629

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 6/184 (3%)
 Frame = -2

Query  744  PDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTL  583
            PD  T     S   G+PKAIPWT LSP+R AAD      V+ GDV+CWPTNLGWVMGP L
Sbjct  257  PDSVTNILFSSGTSGEPKAIPWTQLSPIRCAADSWAHLDVRVGDVFCWPTNLGWVMGPIL  316

Query  582  VYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIR  403
            +Y+ FL GATL LYHGSPLSR FGKFVQDAGV+ILGTVPSLVK WKST CM GLDWT+I+
Sbjct  317  LYSSFLAGATLALYHGSPLSRGFGKFVQDAGVTILGTVPSLVKTWKSTSCMDGLDWTKIK  376

Query  402  VFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAV  223
            +FA+TGEAS+VDDDLWL+SR YYKP++ECCGGTELAS+Y+ G+LLQPQAFGTFSSA++  
Sbjct  377  LFASTGEASSVDDDLWLSSRNYYKPVIECCGGTELASSYIYGNLLQPQAFGTFSSAAIGA  436

Query  222  DFVI  211
             FVI
Sbjct  437  GFVI  440



>emb|CBI16507.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   281 bits (719),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 150/173 (87%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT +SP+R++AD      +Q GDV+CWPTNLGWVMGPT++YA FLTGA L LY
Sbjct  369  GDPKAIPWTQVSPIRSSADAWAQINIQVGDVFCWPTNLGWVMGPTILYASFLTGAALALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WK+T CM+GLDWT+I+ FA+TGE SNVDDD
Sbjct  429  HGSPLDRGFGKFVQDAGVTVLGTVPSLVKTWKNTGCMEGLDWTKIKSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ GS+LQPQAFGTFS+A+M   FVI  E
Sbjct  489  LWLSSRAYYKPIIECCGGTELASSYIQGSVLQPQAFGTFSTAAMTTGFVILDE  541



>gb|EPS67365.1| hypothetical protein M569_07409, partial [Genlisea aurea]
Length=460

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+RTAAD      VQ GDV+CWPTNLGWVMGP ++Y CFL+GATL LY
Sbjct  284  GEPKAIPWTQLSPIRTAADAWTHQNVQTGDVFCWPTNLGWVMGPCVLYTCFLSGATLALY  343

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WKST CM G+DWT+I+ F++TGE SNVDDD
Sbjct  344  HGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKSTHCMDGIDWTKIKTFSSTGETSNVDDD  403

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA+YKPI+ECCGGTEL+S Y+ G+LLQPQAFG FSSASM    VI
Sbjct  404  LWLSSRAFYKPILECCGGTELSSAYINGNLLQPQAFGAFSSASMGSGVVI  453



>ref|XP_003531240.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Glycine max]
Length=728

 Score =   281 bits (718),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPTL+Y+CFL+GATL LY
Sbjct  370  GEPKAIPWTQLSPIRSAADAWAFIDIQPGDVYCWPTNLGWVMGPTLIYSCFLSGATLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I++F +TGE SNVDDD
Sbjct  430  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKIFCSTGETSNVDDD  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTELAS+Y+ GS LQPQAFG FS+ASM    VI  E
Sbjct  490  LWLSSKSYYKPIIECCGGTELASSYIIGSPLQPQAFGAFSTASMTTGLVILDE  542



>ref|XP_011048229.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X3 [Populus euphratica]
Length=488

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAI WTHLSP+R +       D+Q GDVYCWPTNLGWVMGP L+Y+ FL GATL L+
Sbjct  130  GDPKAIGWTHLSPIRCSEDAWAHVDIQDGDVYCWPTNLGWVMGPILLYSTFLCGATLALF  189

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPLSR FGKFVQDAGV++LGTVPS+VKAWKST+CM+GLDWT+++ F +TGEASNVDDD
Sbjct  190  HGSPLSRRFGKFVQDAGVTVLGTVPSIVKAWKSTNCMEGLDWTKLKSFCSTGEASNVDDD  249

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ G  LQPQAFG FS+ASM   FVI  E
Sbjct  250  LWLSSRAYYKPIIECCGGTELASSYIQGCPLQPQAFGAFSTASMTAGFVILDE  302



>ref|XP_004504328.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Cicer arietinum]
Length=727

 Score =   280 bits (717),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPT++Y+CFL+GATL LY
Sbjct  369  GDPKAIPWTQLSPIRSAADGWAFIDIQPGDVYCWPTNLGWVMGPTIIYSCFLSGATLALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK+T CM+GLDWT+I+ F +TGE SNVDDD
Sbjct  429  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKNTQCMEGLDWTKIKTFCSTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTEL S+Y+ GSLLQPQAFG FS+ASM    VI  E
Sbjct  489  LWLSSKSYYKPIIECCGGTELGSSYIIGSLLQPQAFGAFSTASMTTGLVILDE  541



>gb|KEH20658.1| acyl-activating enzyme 17, peroxisomal protein, putative [Medicago 
truncatula]
Length=708

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPTL+Y+CFL+GATL LY
Sbjct  370  GDPKAIPWTQLSPIRSAADGWALIDIQPGDVYCWPTNLGWVMGPTLLYSCFLSGATLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I+ F +TGE SNVDDD
Sbjct  430  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKKFCSTGETSNVDDD  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTELAS Y+ GSLLQPQAFG FS+AS+    VI  E
Sbjct  490  LWLSSKSYYKPIIECCGGTELASCYIMGSLLQPQAFGAFSTASLTTGLVILDE  542



>gb|AET04187.2| acyl-activating enzyme 17, peroxisomal protein, putative [Medicago 
truncatula]
Length=728

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPTL+Y+CFL+GATL LY
Sbjct  370  GDPKAIPWTQLSPIRSAADGWALIDIQPGDVYCWPTNLGWVMGPTLLYSCFLSGATLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I+ F +TGE SNVDDD
Sbjct  430  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKKFCSTGETSNVDDD  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTELAS Y+ GSLLQPQAFG FS+AS+    VI  E
Sbjct  490  LWLSSKSYYKPIIECCGGTELASCYIMGSLLQPQAFGAFSTASLTTGLVILDE  542



>gb|KCW45445.1| hypothetical protein EUGRSUZ_L008481, partial [Eucalyptus grandis]
Length=365

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R  AD      VQAGDV CWPTNLGWVMGP  +Y+CFL GATL LY
Sbjct  68   GEPKAIPWTQLSPIRCGADLWAHMDVQAGDVLCWPTNLGWVMGPISLYSCFLAGATLALY  127

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+IR F +TGE SNVDDD
Sbjct  128  HGSPLGRDFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIRSFGSTGETSNVDDD  187

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+++Y PI+ECCGGTELAS+Y+ G+ LQPQAFG FS+ASM   FVI
Sbjct  188  LWLSSKSFYSPIIECCGGTELASSYIQGNHLQPQAFGAFSNASMTTSFVI  237



>ref|XP_003629711.1| Acetyl-coenzyme A synthetase [Medicago truncatula]
Length=770

 Score =   281 bits (718),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPTL+Y+CFL+GATL LY
Sbjct  412  GDPKAIPWTQLSPIRSAADGWALIDIQPGDVYCWPTNLGWVMGPTLLYSCFLSGATLALY  471

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I+ F +TGE SNVDDD
Sbjct  472  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKKFCSTGETSNVDDD  531

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTELAS Y+ GSLLQPQAFG FS+AS+    VI  E
Sbjct  532  LWLSSKSYYKPIIECCGGTELASCYIMGSLLQPQAFGAFSTASLTTGLVILDE  584



>ref|XP_009375604.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Pyrus 
x bretschneideri]
Length=728

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 168/235 (71%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAADV------QAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R AAD       Q GDV+CWPTNLGWV+G  L+Y+CFLTG TL LY
Sbjct  370  GDPKAIPWTQLSPIRGAADSWAHMDNQVGDVFCWPTNLGWVLGTILLYSCFLTGTTLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WKST CMKGLDWT+IR F + GEAS+VDDD
Sbjct  430  HGSPLGRGFGKFVQDAGVTILGTVPSLVKTWKSTRCMKGLDWTKIRSFCSAGEASSVDDD  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWLTSRAYY+PI+E CGGTELAS+Y+ GSLLQPQAFG FS+ SM V FVI  E  +   +
Sbjct  490  LWLTSRAYYRPILENCGGTELASSYIMGSLLQPQAFGAFSTKSMTVGFVIFDEHGIPYPE  549

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   +  F LL         G L+ L+   D E++    K +P  NG Q R+
Sbjct  550  EQACVGEVGLFPLL--------MGALDRLLNA-DHEKV--YFKGMPMYNGTQLRR  593



>ref|XP_011089734.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Sesamum indicum]
Length=726

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 151/170 (89%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      +Q GDV+CWPTNLGWVMGP L+Y+CFL+GATL LY
Sbjct  368  GEPKAIPWTQLSPIRCAADSWAHLDIQTGDVFCWPTNLGWVMGPILLYSCFLSGATLALY  427

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVKAWK+T CM+GLDWT+I+ FA+TGEAS+VDDD
Sbjct  428  HGSPLGRGFGKFVQDAGVTLLGTVPSLVKAWKNTHCMEGLDWTQIKSFASTGEASSVDDD  487

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA+YKP++ECCGGTELAS+Y+ G+LLQPQAFG FSSA+M+  FVI
Sbjct  488  LWLSSRAFYKPVLECCGGTELASSYIFGNLLQPQAFGAFSSATMSTGFVI  537



>ref|XP_007159408.1| hypothetical protein PHAVU_002G235900g [Phaseolus vulgaris]
 gb|ESW31402.1| hypothetical protein PHAVU_002G235900g [Phaseolus vulgaris]
Length=731

 Score =   279 bits (713),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+AAD      +Q GDVYCWPTNLGWVMGPTL+Y+CFL+GATL LY
Sbjct  373  GEPKAIPWTQLSPIRSAADGWAFVDIQPGDVYCWPTNLGWVMGPTLIYSCFLSGATLALY  432

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK+T CM+GLDWT+I+ F +TGE SNVDDD
Sbjct  433  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKNTQCMEGLDWTKIKTFCSTGETSNVDDD  492

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKPI+ECCGGTELAS+Y+ GS LQPQAFGTFS+ SM    VI  E
Sbjct  493  LWLSSRSYYKPIIECCGGTELASSYLMGSPLQPQAFGTFSTPSMTTGLVILDE  545



>gb|AGA17929.1| CCL12 [Humulus lupulus]
Length=723

 Score =   278 bits (712),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAADV------QAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD       Q GDV+CWPTNLGWVMGP L+++ FL+GATL LY
Sbjct  365  GEPKAIPWTQLSPLRCAADTWAHIDAQVGDVFCWPTNLGWVMGPVLLFSSFLSGATLALY  424

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQD+GV+ILGTVPSLVKAWK+T CMKGLDWT+I+VFA+TGEASNVDDD
Sbjct  425  HGSPLGHGFGKFVQDSGVTILGTVPSLVKAWKNTQCMKGLDWTKIKVFASTGEASNVDDD  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+AYY+PI+ECCGGTELAS+Y+ GSL+QPQAFG FS+A+M V  VI  E
Sbjct  485  LWLSSQAYYQPIIECCGGTELASSYIQGSLVQPQAFGAFSTAAMTVGLVILDE  537



>ref|XP_008789133.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X3 [Phoenix dactylifera]
Length=547

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKA+PWT LSP+R AAD      VQ+GD+ CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  188  GDPKAVPWTQLSPIRCAADSWAHIDVQSGDICCWPTNLGWVMGPVLLYSCFLTGATLALY  247

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDA V+ILGTVPSLVKAWK++ CM GLDWT+IR F +TGEAS+ DDD
Sbjct  248  HGSPLGHGFGKFVQDAAVTILGTVPSLVKAWKNSKCMDGLDWTKIRAFGSTGEASDKDDD  307

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA YKPIVECCGGTELAS+Y+ GSLLQPQAFG FS+ SM+  FVI
Sbjct  308  LWLSSRASYKPIVECCGGTELASSYIQGSLLQPQAFGAFSTPSMSTGFVI  357



>ref|XP_006445649.1| hypothetical protein CICLE_v10014404mg [Citrus clementina]
 gb|ESR58889.1| hypothetical protein CICLE_v10014404mg [Citrus clementina]
Length=604

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D++ GDVYCWPTNLGWVMGP ++++ FL+GA L LY
Sbjct  369  GEPKAIPWTQLSPIRCAAEAWGHIDMKVGDVYCWPTNLGWVMGPIILFSSFLSGAALALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL RSFGKFVQD+GVS+LGTVPSLVKAWK+T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  429  HGSPLERSFGKFVQDSGVSVLGTVPSLVKAWKNTNCLQGLDWTKIRSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL S+AYYKPI+ECCGGTELAS+Y+ GS+LQPQAFG FS+A+M   FVI  E
Sbjct  489  LWLASKAYYKPIIECCGGTELASSYIQGSMLQPQAFGAFSTATMTTGFVILDE  541



>ref|XP_011048228.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Populus euphratica]
Length=626

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAI WTHLSP+R +       D+Q GDVYCWPTNLGWVMGP L+Y+ FL GATL L+
Sbjct  268  GDPKAIGWTHLSPIRCSEDAWAHVDIQDGDVYCWPTNLGWVMGPILLYSTFLCGATLALF  327

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPLSR FGKFVQDAGV++LGTVPS+VKAWKST+CM+GLDWT+++ F +TGEASNVDDD
Sbjct  328  HGSPLSRRFGKFVQDAGVTVLGTVPSIVKAWKSTNCMEGLDWTKLKSFCSTGEASNVDDD  387

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ G  LQPQAFG FS+ASM   FVI  E
Sbjct  388  LWLSSRAYYKPIIECCGGTELASSYIQGCPLQPQAFGAFSTASMTAGFVILDE  440



>gb|KDP42113.1| hypothetical protein JCGZ_01901 [Jatropha curcas]
Length=625

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 146/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAI WT LSP+R A+D      VQ GDVYCWPTNLGWVMGP L+Y+CFL+GATL L+
Sbjct  267  GEPKAIVWTQLSPIRCASDAWAHVDVQVGDVYCWPTNLGWVMGPILLYSCFLSGATLALF  326

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVKAWKST+CM+GLDWT+I+ F +TGE+SNVDDD
Sbjct  327  HGSPLGREFGKFVQDAGVTILGTVPSLVKAWKSTNCMEGLDWTKIKSFCSTGESSNVDDD  386

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKPI ECCGGTELAS+Y+ G  LQPQAFG FS+ASM    VI  E
Sbjct  387  LWLSSRSYYKPITECCGGTELASSYIQGCQLQPQAFGAFSTASMTTGLVILDE  439



>ref|XP_006580165.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
isoform X2 [Glycine max]
Length=692

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      ++ GDVYCWPTNLGWV+GPT++Y CFLTGATL LY
Sbjct  367  GDPKAIPWTQLAPIRSAADGWAAIDIKPGDVYCWPTNLGWVIGPTVLYHCFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP  R FGKFVQDAGV+ILGTVPSLVKAWKST CM+GLDWT+I+ F ++GE SNVDDD
Sbjct  427  HGSPQGRDFGKFVQDAGVTILGTVPSLVKAWKSTQCMEGLDWTKIKTFCSSGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+AYY PIVE CGGTELAS+Y+AGS LQPQAFG FS+ASM   FVI  E
Sbjct  487  LWLSSKAYYSPIVELCGGTELASSYIAGSPLQPQAFGAFSTASMTTGFVILDE  539



>gb|KDO63047.1| hypothetical protein CISIN_1g004821mg [Citrus sinensis]
Length=597

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D++ GDVYCWPTNLGWVMGP ++++ FL+GA L LY
Sbjct  369  GEPKAIPWTQLSPIRCAAEAWGHIDMKVGDVYCWPTNLGWVMGPIILFSSFLSGAALALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL RSFGKFVQD+GVS+LGTVPSLVKAWK+T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  429  HGSPLERSFGKFVQDSGVSVLGTVPSLVKAWKNTNCLQGLDWTKIRSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL S+AYYKPI+ECCGGTELAS+Y+ GS+LQPQAFG FS+A+M   FVI  E
Sbjct  489  LWLASKAYYKPIIECCGGTELASSYIQGSMLQPQAFGAFSTATMTTGFVILDE  541



>emb|CDP16784.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      VQ GDV+CWPTNLGWVMGP L+Y+CFL+G TL LY
Sbjct  384  GEPKAIPWTQHSPIRCAADAWAHIDVQEGDVFCWPTNLGWVMGPILLYSCFLSGGTLALY  443

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKF+QDAGV++LGTVPSLVK WKST CM GL+WT+IR FATTGEASN+DDD
Sbjct  444  HGSPLGRGFGKFIQDAGVTVLGTVPSLVKTWKSTGCMNGLNWTKIRTFATTGEASNIDDD  503

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+AYY PI+ECCGGTELAS+Y+ G+ LQPQAF  FSSASMA  FVI  E
Sbjct  504  LWLSSKAYYSPIIECCGGTELASSYIQGNPLQPQAFAAFSSASMATSFVILNE  556



>ref|XP_007014691.1| Acyl-activating enzyme 18 [Theobroma cacao]
 gb|EOY32310.1| Acyl-activating enzyme 18 [Theobroma cacao]
Length=734

 Score =   276 bits (706),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 148/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R +AD      ++ GDVYCWPTNLGWVMGP L++ CFL GATL LY
Sbjct  376  GEPKAIPWTQLSPIRCSADGWAHNDIKVGDVYCWPTNLGWVMGPVLLFTCFLNGATLALY  435

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK+WKST+C++GLDWT+I+ FATTGEASNVDDD
Sbjct  436  HGSPLGHGFGKFVQDAGVTVLGTVPSLVKSWKSTNCLEGLDWTKIKCFATTGEASNVDDD  495

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKP++ECCGGTEL+S Y+ GSLLQPQAFG FS+A+M   FVI  E
Sbjct  496  LWLSSKSYYKPVLECCGGTELSSAYIQGSLLQPQAFGAFSTAAMTAGFVILDE  548



>ref|XP_006488900.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Citrus sinensis]
 gb|KDO63046.1| hypothetical protein CISIN_1g004821mg [Citrus sinensis]
Length=728

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D++ GDVYCWPTNLGWVMGP ++++ FL+GA L LY
Sbjct  369  GEPKAIPWTQLSPIRCAAEAWGHIDMKVGDVYCWPTNLGWVMGPIILFSSFLSGAALALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL RSFGKFVQD+GVS+LGTVPSLVKAWK+T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  429  HGSPLERSFGKFVQDSGVSVLGTVPSLVKAWKNTNCLQGLDWTKIRSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL S+AYYKPI+ECCGGTELAS+Y+ GS+LQPQAFG FS+A+M   FVI  E
Sbjct  489  LWLASKAYYKPIIECCGGTELASSYIQGSMLQPQAFGAFSTATMTTGFVILDE  541



>ref|XP_003524200.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
isoform X1 [Glycine max]
 gb|KHN06391.1| Putative acyl-activating enzyme 18, peroxisomal [Glycine soja]
Length=725

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      ++ GDVYCWPTNLGWV+GPT++Y CFLTGATL LY
Sbjct  367  GDPKAIPWTQLAPIRSAADGWAAIDIKPGDVYCWPTNLGWVIGPTVLYHCFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP  R FGKFVQDAGV+ILGTVPSLVKAWKST CM+GLDWT+I+ F ++GE SNVDDD
Sbjct  427  HGSPQGRDFGKFVQDAGVTILGTVPSLVKAWKSTQCMEGLDWTKIKTFCSSGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+AYY PIVE CGGTELAS+Y+AGS LQPQAFG FS+ASM   FVI  E
Sbjct  487  LWLSSKAYYSPIVELCGGTELASSYIAGSPLQPQAFGAFSTASMTTGFVILDE  539



>ref|XP_010097802.1| putative acyl-activating enzyme 18 [Morus notabilis]
 gb|EXB71429.1| putative acyl-activating enzyme 18 [Morus notabilis]
Length=727

 Score =   275 bits (704),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQAGDV C PTNLGWVMGP ++++CFL+GATL LY
Sbjct  369  GEPKAIPWTQLSPIRCAADSWAHMDVQAGDVLCQPTNLGWVMGPIVLFSCFLSGATLALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WKST C++GLDWT+I+ FA+TGEASNVDDD
Sbjct  429  HGSPLGRGFGKFVQDAGVTILGTVPSLVKTWKSTKCIRGLDWTKIKSFASTGEASNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+AYYKPIVECCGGTELAS+Y+  SLLQPQAFG FS+ASM   F I  E
Sbjct  489  LWLSSQAYYKPIVECCGGTELASSYIQASLLQPQAFGAFSTASMTTGFAILDE  541



>ref|XP_006445650.1| hypothetical protein CICLE_v10014404mg [Citrus clementina]
 gb|ESR58890.1| hypothetical protein CICLE_v10014404mg [Citrus clementina]
Length=728

 Score =   275 bits (704),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D++ GDVYCWPTNLGWVMGP ++++ FL+GA L LY
Sbjct  369  GEPKAIPWTQLSPIRCAAEAWGHIDMKVGDVYCWPTNLGWVMGPIILFSSFLSGAALALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL RSFGKFVQD+GVS+LGTVPSLVKAWK+T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  429  HGSPLERSFGKFVQDSGVSVLGTVPSLVKAWKNTNCLQGLDWTKIRSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL S+AYYKPI+ECCGGTELAS+Y+ GS+LQPQAFG FS+A+M   FVI  E
Sbjct  489  LWLASKAYYKPIIECCGGTELASSYIQGSMLQPQAFGAFSTATMTTGFVILDE  541



>emb|CBI16508.3| unnamed protein product [Vitis vinifera]
Length=685

 Score =   275 bits (702),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT +SP+R+AAD      +Q GDV CWPTNLGW+MGP ++YA FLTGA L LY
Sbjct  327  GDPKAIPWTQVSPIRSAADAWAQSNIQVGDVLCWPTNLGWMMGPFIIYASFLTGAALALY  386

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WK+T CM+GLDWT+I+ FA+TGE SNVDDD
Sbjct  387  HGSPLDRGFGKFVQDAGVTILGTVPSLVKTWKNTGCMEGLDWTKIKSFASTGETSNVDDD  446

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA+YKPI+ECCGGTELAS+Y+ GS+ QPQAFG FSS +M   FVI  E
Sbjct  447  LWLSSRAHYKPIIECCGGTELASSYIQGSMFQPQAFGAFSSTAMTTGFVILDE  499



>ref|XP_006445651.1| hypothetical protein CICLE_v10014404mg [Citrus clementina]
 gb|ESR58891.1| hypothetical protein CICLE_v10014404mg [Citrus clementina]
Length=648

 Score =   273 bits (699),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D++ GDVYCWPTNLGWVMGP ++++ FL+GA L LY
Sbjct  369  GEPKAIPWTQLSPIRCAAEAWGHIDMKVGDVYCWPTNLGWVMGPIILFSSFLSGAALALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL RSFGKFVQD+GVS+LGTVPSLVKAWK+T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  429  HGSPLERSFGKFVQDSGVSVLGTVPSLVKAWKNTNCLQGLDWTKIRSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL S+AYYKPI+ECCGGTELAS+Y+ GS+LQPQAFG FS+A+M   FVI  E
Sbjct  489  LWLASKAYYKPIIECCGGTELASSYIQGSMLQPQAFGAFSTATMTTGFVILDE  541



>ref|XP_002297640.2| hypothetical protein POPTR_0001s04380g [Populus trichocarpa]
 gb|EEE82445.2| hypothetical protein POPTR_0001s04380g [Populus trichocarpa]
Length=729

 Score =   275 bits (703),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAI WTHLSP+R +       D+Q GDVYCWPTNLGWVMGP L+Y+ FL GATL L+
Sbjct  371  GDPKAIGWTHLSPIRCSQDGWAHVDIQEGDVYCWPTNLGWVMGPILLYSTFLCGATLALF  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPLSR FGKFVQDAGV++LGTVPS+VKAWKST+CM+GLDWT+++ F +TGEASNVDDD
Sbjct  431  HGSPLSRGFGKFVQDAGVTVLGTVPSIVKAWKSTNCMEGLDWTKLKSFCSTGEASNVDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ G  LQPQAFG FS+ASM   FVI  E
Sbjct  491  LWLSSRAYYKPIIECCGGTELASSYIQGCPLQPQAFGAFSTASMTTGFVILDE  543



>ref|XP_011048227.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Populus euphratica]
Length=730

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAI WTHLSP+R + D      +Q GDVYCWPTNLGWVMGP L+Y+ FL GATL L+
Sbjct  372  GDPKAIGWTHLSPIRCSEDAWAHVDIQDGDVYCWPTNLGWVMGPILLYSTFLCGATLALF  431

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPLSR FGKFVQDAGV++LGTVPS+VKAWKST+CM+GLDWT+++ F +TGEASNVDDD
Sbjct  432  HGSPLSRRFGKFVQDAGVTVLGTVPSIVKAWKSTNCMEGLDWTKLKSFCSTGEASNVDDD  491

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKPI+ECCGGTELAS+Y+ G  LQPQAFG FS+ASM   FVI  E
Sbjct  492  LWLSSRAYYKPIIECCGGTELASSYIQGCPLQPQAFGAFSTASMTAGFVILDE  544



>ref|XP_006392650.1| hypothetical protein EUTSA_v10011267mg [Eutrema salsugineum]
 gb|ESQ29936.1| hypothetical protein EUTSA_v10011267mg [Eutrema salsugineum]
Length=724

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      VQ G+ YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  364  GEPKAIPWTQLSPIRSACDGWAHLDVQVGNTYCWPTNLGWVMGPTLIFSCFLTGATLALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WK+T+CM+GLDWT+I+ FATTGEASNVDD 
Sbjct  424  HGSPLGRGFGKFVQDAGVAVLGTVPSLVKTWKTTNCMEGLDWTKIKYFATTGEASNVDDV  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  484  LWLSSKAYYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIII  533



>ref|XP_004504307.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
isoform X1 [Cicer arietinum]
Length=628

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      VQAGDVYCWPTNLGWV+GPT++Y CFL GATL LY
Sbjct  270  GDPKAIPWTQLAPIRSAADGWAAIDVQAGDVYCWPTNLGWVIGPTVLYHCFLNGATLALY  329

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP    FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I++F ++GE SNVDDD
Sbjct  330  HGSPQGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKLFCSSGETSNVDDD  389

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YY PI+E CGGTELAS+Y+AGS LQPQAFG FS+ASM    VI  E
Sbjct  390  LWLSSKSYYNPIIELCGGTELASSYIAGSPLQPQAFGAFSTASMTTGLVILDE  442



>ref|XP_007159439.1| hypothetical protein PHAVU_002G237900g [Phaseolus vulgaris]
 gb|ESW31433.1| hypothetical protein PHAVU_002G237900g [Phaseolus vulgaris]
Length=737

 Score =   274 bits (700),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAI WT L+P+R+AAD      VQAGDVYCWPTNLGWVMGPT++Y CFL GATL LY
Sbjct  379  GDPKAIAWTQLAPIRSAADGWAAIDVQAGDVYCWPTNLGWVMGPTVLYQCFLLGATLALY  438

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HG+P  R+FGKFVQDAGV+ILGTVPSLVK WK+T CM+GLDWT+I+ F +TGE SNVDDD
Sbjct  439  HGAPQGRNFGKFVQDAGVTILGTVPSLVKTWKNTKCMEGLDWTKIKTFCSTGETSNVDDD  498

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYY+PI+E CGGTELAS+Y+AGS LQPQAFG FS+ASM   FVI
Sbjct  499  LWLSSKAYYRPIIELCGGTELASSYIAGSPLQPQAFGAFSTASMTTGFVI  548



>ref|XP_010934528.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Elaeis 
guineensis]
Length=730

 Score =   273 bits (698),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R AAD      VQ+GD+ CWPTNLGWVMGP L+Y+CFL GATL LY
Sbjct  371  GDPKAIPWTQLSPIRCAADSWAHIDVQSGDICCWPTNLGWVMGPILLYSCFLAGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDA V+ILGTVPSLVK WK + CM+GLDWT+IRV ++TGEAS++DDD
Sbjct  431  HGSPLGRGFGKFVQDASVTILGTVPSLVKTWKISKCMEGLDWTKIRVLSSTGEASDIDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA YKPIVECCGGTELAS+Y+ GSLLQPQAFG FS+ SM+  FVI
Sbjct  491  LWLSSRASYKPIVECCGGTELASSYIQGSLLQPQAFGAFSTPSMSTGFVI  540



>ref|XP_008789114.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Phoenix dactylifera]
Length=731

 Score =   273 bits (697),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKA+PWT LSP+R AAD      VQ+GD+ CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  372  GDPKAVPWTQLSPIRCAADSWAHIDVQSGDICCWPTNLGWVMGPVLLYSCFLTGATLALY  431

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDA V+ILGTVPSLVKAWK++ CM GLDWT+IR F +TGEAS+ DDD
Sbjct  432  HGSPLGHGFGKFVQDAAVTILGTVPSLVKAWKNSKCMDGLDWTKIRAFGSTGEASDKDDD  491

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA YKPIVECCGGTELAS+Y+ GSLLQPQAFG FS+ SM+  FVI
Sbjct  492  LWLSSRASYKPIVECCGGTELASSYIQGSLLQPQAFGAFSTPSMSTGFVI  541



>ref|XP_007014692.1| Acyl-activating enzyme 18 [Theobroma cacao]
 gb|EOY32311.1| Acyl-activating enzyme 18 [Theobroma cacao]
Length=729

 Score =   273 bits (697),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 166/235 (71%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAI WT LSP+R ++D      +  GDVYCWPTNLGWVMGP L+++CFLTGA L LY
Sbjct  371  GEPKAITWTQLSPIRCSSDAWAHIDIGVGDVYCWPTNLGWVMGPILLFSCFLTGAALALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVKAWK+T CM+GLDWT+I+ FA+TGEASNVDDD
Sbjct  431  HGSPLGRGFGKFVQDAGVTVLGTVPSLVKAWKNTKCMEGLDWTKIKSFASTGEASNVDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWL+S++YYKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ASM    VI  E  V   D
Sbjct  491  LWLSSKSYYKPVIECCGGTELASSYIQGSQLQPQAFGAFSTASMTTGLVILDEDGVAYPD  550

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   +  F L            L +    ++ +  K   K +P  NG + R+
Sbjct  551  DKACVGEVGLFPLY-----------LGATDRLLNADHEKVYFKGMPIHNGMRLRR  594



>ref|XP_008789122.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Phoenix dactylifera]
Length=730

 Score =   273 bits (697),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKA+PWT LSP+R AAD      VQ+GD+ CWPTNLGWVMGP L+Y+CFLTGATL LY
Sbjct  371  GDPKAVPWTQLSPIRCAADSWAHIDVQSGDICCWPTNLGWVMGPVLLYSCFLTGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDA V+ILGTVPSLVKAWK++ CM GLDWT+IR F +TGEAS+ DDD
Sbjct  431  HGSPLGHGFGKFVQDAAVTILGTVPSLVKAWKNSKCMDGLDWTKIRAFGSTGEASDKDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA YKPIVECCGGTELAS+Y+ GSLLQPQAFG FS+ SM+  FVI
Sbjct  491  LWLSSRASYKPIVECCGGTELASSYIQGSLLQPQAFGAFSTPSMSTGFVI  540



>ref|XP_004504308.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
isoform X2 [Cicer arietinum]
Length=626

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      VQAGDVYCWPTNLGWV+GPT++Y CFL GATL LY
Sbjct  369  GDPKAIPWTQLAPIRSAADGWAAIDVQAGDVYCWPTNLGWVIGPTVLYHCFLNGATLALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP    FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+I++F ++GE SNVDDD
Sbjct  429  HGSPQGHGFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIKLFCSSGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YY PI+E CGGTELAS+Y+AGS LQPQAFG FS+ASM    VI  E
Sbjct  489  LWLSSKSYYNPIIELCGGTELASSYIAGSPLQPQAFGAFSTASMTTGLVILDE  541



>gb|KEH20664.1| acyl-activating enzyme 17, peroxisomal protein, putative [Medicago 
truncatula]
Length=624

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      VQ GDVYCWPTNLGWV+GPTL+Y CFL GATL LY
Sbjct  371  GDPKAIPWTQLAPIRSAADGWAAIDVQVGDVYCWPTNLGWVIGPTLLYHCFLNGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP    FGKFVQDAGV+ILGTVPSLVK+WKST CM+GLDW +I++F +TGE SNVDDD
Sbjct  431  HGSPQGHGFGKFVQDAGVTILGTVPSLVKSWKSTRCMEGLDWAKIKLFCSTGETSNVDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S++YY PI+E CGGTELAS+Y+ GS LQPQAFG FS+ASM   FVI
Sbjct  491  LWLSSKSYYNPIIELCGGTELASSYITGSPLQPQAFGAFSTASMTTGFVI  540



>ref|XP_009396922.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=627

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT +SP+R AAD      +QAGD+ CWPTNLGWVMGP ++Y+CFL GATL LY
Sbjct  268  GEPKAIPWTQISPIRCAADSWAHIDIQAGDICCWPTNLGWVMGPIILYSCFLNGATLALY  327

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDA V++LGTVPSLVK WKS+ CM+ LDWT+IR+F +TGEAS++DDD
Sbjct  328  HGSPLGRGFGKFVQDASVTMLGTVPSLVKYWKSSKCMEELDWTKIRIFGSTGEASDIDDD  387

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA Y+PI+ECCGGTELAS+Y+ GSLLQPQAF TFS+ SM+  F+I
Sbjct  388  LWLSSRASYRPIIECCGGTELASSYIQGSLLQPQAFATFSTPSMSTGFII  437



>ref|XP_009396923.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=626

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT +SP+R AAD      +QAGD+ CWPTNLGWVMGP ++Y+CFL GATL LY
Sbjct  267  GEPKAIPWTQISPIRCAADSWAHIDIQAGDICCWPTNLGWVMGPIILYSCFLNGATLALY  326

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDA V++LGTVPSLVK WKS+ CM+ LDWT+IR+F +TGEAS++DDD
Sbjct  327  HGSPLGRGFGKFVQDASVTMLGTVPSLVKYWKSSKCMEELDWTKIRIFGSTGEASDIDDD  386

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRA Y+PI+ECCGGTELAS+Y+ GSLLQPQAF TFS+ SM+  F+I
Sbjct  387  LWLSSRASYRPIIECCGGTELASSYIQGSLLQPQAFATFSTPSMSTGFII  436



>ref|XP_010040155.1| PREDICTED: LOW QUALITY PROTEIN: probable acyl-activating enzyme 
18, peroxisomal [Eucalyptus grandis]
Length=761

 Score =   272 bits (696),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R  AD      VQAGDV CWPTNLGWVMGP  +Y+CFL GATL LY
Sbjct  405  GEPKAIPWTQLSPIRCGADLWAHMDVQAGDVLCWPTNLGWVMGPISLYSCFLAGATLALY  464

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+IR F +TGE SNVDDD
Sbjct  465  HGSPLGRDFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIRSFGSTGETSNVDDD  524

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+++Y PI+ECCGGTELAS+Y+ G+ LQPQAFG FS+ASM   FVI
Sbjct  525  LWLSSKSFYSPIIECCGGTELASSYIQGNHLQPQAFGAFSNASMTTSFVI  574



>gb|KEH20665.1| acyl-activating enzyme 17, peroxisomal protein, putative [Medicago 
truncatula]
Length=635

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      VQ GDVYCWPTNLGWV+GPTL+Y CFL GATL LY
Sbjct  371  GDPKAIPWTQLAPIRSAADGWAAIDVQVGDVYCWPTNLGWVIGPTLLYHCFLNGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP    FGKFVQDAGV+ILGTVPSLVK+WKST CM+GLDW +I++F +TGE SNVDDD
Sbjct  431  HGSPQGHGFGKFVQDAGVTILGTVPSLVKSWKSTRCMEGLDWAKIKLFCSTGETSNVDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S++YY PI+E CGGTELAS+Y+ GS LQPQAFG FS+ASM   FVI
Sbjct  491  LWLSSKSYYNPIIELCGGTELASSYITGSPLQPQAFGAFSTASMTTGFVI  540



>gb|KHG25218.1| putative acyl-activating enzyme 18, peroxisomal -like protein 
[Gossypium arboreum]
Length=738

 Score =   271 bits (694),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R+ A+      V  GDVYCWPTNLGWVMGP L+++CFLTGATL LY
Sbjct  380  GEPKAIPWTQLSAIRSTAEGWAHINVGVGDVYCWPTNLGWVMGPILLFSCFLTGATLALY  439

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WK+TDC+KGLDWT+I+ FA+TGE SNVDDD
Sbjct  440  HGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKNTDCIKGLDWTKIKSFASTGETSNVDDD  499

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI+ECCGGTELAS+Y+  SL QPQAFG FS+ASM    VI  E
Sbjct  500  LWLSSKSYYKPIIECCGGTELASSYIQSSLFQPQAFGAFSTASMTTGLVILDE  552



>gb|AET04219.2| acyl-activating enzyme 17, peroxisomal protein, putative [Medicago 
truncatula]
Length=729

 Score =   271 bits (692),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      VQ GDVYCWPTNLGWV+GPTL+Y CFL GATL LY
Sbjct  371  GDPKAIPWTQLAPIRSAADGWAAIDVQVGDVYCWPTNLGWVIGPTLLYHCFLNGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP    FGKFVQDAGV+ILGTVPSLVK+WKST CM+GLDW +I++F +TGE SNVDDD
Sbjct  431  HGSPQGHGFGKFVQDAGVTILGTVPSLVKSWKSTRCMEGLDWAKIKLFCSTGETSNVDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S++YY PI+E CGGTELAS+Y+ GS LQPQAFG FS+ASM   FVI
Sbjct  491  LWLSSKSYYNPIIELCGGTELASSYITGSPLQPQAFGAFSTASMTTGFVI  540



>ref|NP_001132777.1| uncharacterized protein LOC100194266 [Zea mays]
 gb|ACF81770.1| unknown [Zea mays]
Length=403

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R A+D      V+  D+ CWPTNLGWVMGP ++Y+CFLTGATL LY
Sbjct  44   GEPKAIPWTQLSPIRCASDTWAHLDVRPCDIGCWPTNLGWVMGPIIIYSCFLTGATLALY  103

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV++LG+VPSLVK+WK+ +C +GLDWT+IRV  TTGEAS++DD+
Sbjct  104  HGSPLGRDFCKFVQDAGVTVLGSVPSLVKSWKAGNCAEGLDWTKIRVLGTTGEASDIDDN  163

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWLTSRA YKPIVECCGGTELAS+Y+ GSLL+PQAFG FS ASM+  FVI  E
Sbjct  164  LWLTSRASYKPIVECCGGTELASSYIQGSLLRPQAFGAFSGASMSTGFVILDE  216



>ref|XP_003629743.1| Acetyl-coenzyme A synthetase [Medicago truncatula]
Length=763

 Score =   271 bits (693),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT L+P+R+AAD      VQ GDVYCWPTNLGWV+GPTL+Y CFL GATL LY
Sbjct  405  GDPKAIPWTQLAPIRSAADGWAAIDVQVGDVYCWPTNLGWVIGPTLLYHCFLNGATLALY  464

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSP    FGKFVQDAGV+ILGTVPSLVK+WKST CM+GLDW +I++F +TGE SNVDDD
Sbjct  465  HGSPQGHGFGKFVQDAGVTILGTVPSLVKSWKSTRCMEGLDWAKIKLFCSTGETSNVDDD  524

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S++YY PI+E CGGTELAS+Y+ GS LQPQAFG FS+ASM   FVI
Sbjct  525  LWLSSKSYYNPIIELCGGTELASSYITGSPLQPQAFGAFSTASMTTGFVI  574



>ref|XP_008351636.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Malus 
domestica]
Length=728

 Score =   270 bits (690),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 141/170 (83%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAADV------QAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT LSP+R AAD       Q GDV+CWPTNLGWVMGP L+Y+CFLTG+TL LY
Sbjct  370  GDPKAIPWTQLSPIRCAADSWXHNDNQVGDVFCWPTNLGWVMGPILLYSCFLTGSTLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPLS  FGKFVQDA V+ILGTVPSLVKAWKST CMKGLDWT+IR F +TGEAS+VDDD
Sbjct  430  HGSPLSXGFGKFVQDARVTILGTVPSLVKAWKSTXCMKGLDWTKIRSFCSTGEASSVDDD  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL SRA Y PI+ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    VI
Sbjct  490  LWLASRAXYGPIIECCGGTELASSYIMGSXLQPQAFGAFSTKSMTTGXVI  539



>gb|AFD33358.1| acyl-activating enzyme 14 [Cannabis sativa]
Length=727

 Score =   270 bits (690),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 144/173 (83%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D+Q GDV+CWPTNLGWVMGP L+++ FL+GATL LY
Sbjct  369  GEPKAIPWTQLSPIRCAAESWAHMDMQVGDVFCWPTNLGWVMGPILIFSSFLSGATLALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ LGTVPSLVKAWK+T CM GLDWT+I+ FA+TGE SNVDDD
Sbjct  429  HGSPLGYGFGKFVQDAGVTKLGTVPSLVKAWKNTQCMNGLDWTKIKCFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKP++ECCGGTEL+S+Y+ GSLLQPQAFG FS+ SM    VI  E
Sbjct  489  LWLSSRAYYKPVIECCGGTELSSSYIQGSLLQPQAFGAFSTTSMTTSLVILDE  541



>gb|AFD33348.1| acyl-activating enzyme 4, partial [Cannabis sativa]
Length=723

 Score =   270 bits (689),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 144/173 (83%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AA      D+Q GDV+CWPTNLGWVMGP L+++ FL+GATL LY
Sbjct  366  GEPKAIPWTQLSPIRCAAESWAHMDMQVGDVFCWPTNLGWVMGPILIFSSFLSGATLALY  425

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ LGTVPSLVKAWK+T CM GLDWT+I+ FA+TGE SNVDDD
Sbjct  426  HGSPLGYGFGKFVQDAGVTKLGTVPSLVKAWKNTQCMNGLDWTKIKCFASTGETSNVDDD  485

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRAYYKP++ECCGGTEL+S+Y+ GSLLQPQAFG FS+ SM    VI  E
Sbjct  486  LWLSSRAYYKPVIECCGGTELSSSYIQGSLLQPQAFGAFSTTSMTTSLVILDE  538



>ref|XP_010673496.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=488

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKA+PWT LSP++ AAD      ++ GDV CWPTNLGWV+GP L+Y CFL GATL LY
Sbjct  130  GDPKAVPWTQLSPIQAAADSWAHMDIRVGDVMCWPTNLGWVVGPILLYGCFLNGATLALY  189

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL R FGKFVQDA V+ILGTVPSLVK WK++ CM GLDWT +RVFA++GEASNVDDD
Sbjct  190  NGSPLGRGFGKFVQDARVTILGTVPSLVKTWKNSHCMDGLDWTSLRVFASSGEASNVDDD  249

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRAYYKPI+E CGGTELA +Y+ GSLLQPQAFG FS+ +M+  FVI
Sbjct  250  LWLSSRAYYKPIIEICGGTELAGSYLQGSLLQPQAFGAFSTPTMSSGFVI  299



>ref|NP_001077723.1| acyl-activating enzyme 18 [Arabidopsis thaliana]
 gb|AEE33226.1| acyl-activating enzyme 18 [Arabidopsis thaliana]
Length=511

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      VQ G  YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  151  GEPKAIPWTQLSPIRSACDGWAHLDVQVGHTYCWPTNLGWVMGPTLMFSCFLTGATLALY  210

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL R FGKFVQDAGV++LGTVPSLVK WK T+CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  211  SGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKRTNCMEGLNWTKIKFFATTGEASNVDDV  270

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+A YKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  271  LWLSSKADYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIII  320



>gb|KFK35590.1| hypothetical protein AALP_AA4G011100 [Arabis alpina]
Length=728

 Score =   269 bits (687),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L+P+R+A D      VQ G  YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  368  GEPKAIPWTQLAPIRSACDGWAHIDVQVGSTYCWPTNLGWVMGPTLIFSCFLTGATLALY  427

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGVS+LGTVPSLVK W+ T+CM+GL+W +I+ FATTGEASNVDD 
Sbjct  428  HGSPLGRGFGKFVQDAGVSVLGTVPSLVKTWRRTNCMEGLNWAKIKYFATTGEASNVDDV  487

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  488  LWLSSKAYYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIII  537



>ref|XP_010040496.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Eucalyptus 
grandis]
 gb|KCW45162.1| hypothetical protein EUGRSUZ_L01220 [Eucalyptus grandis]
Length=738

 Score =   268 bits (686),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 141/170 (83%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R  AD      VQAG V CWPTNLGWVMGP  +Y+CFL GATL LY
Sbjct  380  GEPKAIPWTQLSPIRCGADSWAHMDVQAGVVLCWPTNLGWVMGPIALYSCFLAGATLALY  439

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WKST CM+GLDWT+IR F +TGE SNVDDD
Sbjct  440  HGSPLGRDFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLDWTKIRSFGSTGETSNVDDD  499

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+++Y PI+ECCGGTELAS+Y+ G+ LQPQAFG FS+ASM   FVI
Sbjct  500  LWLSSKSFYSPIIECCGGTELASSYIQGNHLQPQAFGAFSNASMTTGFVI  549



>ref|XP_008449826.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X5 [Cucumis melo]
 ref|XP_008449827.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X5 [Cucumis melo]
Length=624

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQAGDV+CWPTNLGW MGP  VY+  L GATL LY
Sbjct  266  GEPKAIPWTQLSPIRCAADSWAHMDVQAGDVFCWPTNLGWAMGPVSVYSSLLVGATLALY  325

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  326  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  385

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKP+ ECCGGTEL S+++ GS LQPQAFG FS+ASM   FVI  E
Sbjct  386  LWLSSRSYYKPLFECCGGTELGSSFIVGSPLQPQAFGAFSTASMTTGFVILDE  438



>gb|KGN54068.1| hypothetical protein Csa_4G280450 [Cucumis sativus]
Length=624

 Score =   265 bits (677),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 161/235 (69%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      VQ GDV+CWPTNLGW MGP  VY+ FLTGATL LY
Sbjct  266  GEPKAIPWTQRSPIRCAADSWAHMDVQPGDVFCWPTNLGWAMGPVSVYSAFLTGATLALY  325

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  326  HGSPLGYGFGKFVQDAGVTMLGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  385

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWL+SR+YYKP+ ECCGGTEL S+++ GS +QPQAFG FS+ASM   FVI  E  +   D
Sbjct  386  LWLSSRSYYKPLFECCGGTELGSSFIVGSPVQPQAFGAFSTASMTTGFVILDEHGIPSPD  445

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   I  F         P     +S +   D +E+    K +P  NG Q R+
Sbjct  446  DQPCIGEIGLF---------PTYLGASSELLNADHDEV--YFKGMPIYNGMQLRR  489



>ref|XP_010032903.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Eucalyptus grandis]
 gb|KCW52401.1| hypothetical protein EUGRSUZ_J01807 [Eucalyptus grandis]
Length=738

 Score =   268 bits (684),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R +AD      +QAGDV+CWPTNLGWV+GP ++Y+CFL GATL LY
Sbjct  380  GEPKAIPWTQLSPIRCSADSWAYINIQAGDVFCWPTNLGWVVGPIVLYSCFLAGATLALY  439

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WKST CM GLDWT+IR F + GE SNVDD+
Sbjct  440  HGSPLGRDFGKFVQDAGVTILGTVPSLVKTWKSTQCMGGLDWTKIRSFGSAGETSNVDDN  499

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+++Y P++ECCGGTELAS+Y+ G+ LQPQAFG FS+ASM   FVI
Sbjct  500  LWLSSKSFYSPVIECCGGTELASSYIQGNHLQPQAFGAFSNASMTTGFVI  549



>gb|AFD33357.1| acyl-activating enzyme 13 [Cannabis sativa]
Length=715

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 144/173 (83%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTHLSP+R ++D      ++ GDV CWPTNLGW +GP +++ CFL+GA L LY
Sbjct  357  GEPKAIPWTHLSPIRCSSDFWAYMDIKVGDVVCWPTNLGWALGPFILFTCFLSGAVLALY  416

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDA V+ LGTVPSLVK WK+T CMKGLDWT+I+ FA+TGE SNVDDD
Sbjct  417  HGSPLGRGFGKFVQDASVTKLGTVPSLVKTWKNTQCMKGLDWTKIKSFASTGETSNVDDD  476

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+AYYKP++ECCGGTELAS+Y+ GSLLQPQAFG F++A+M   FVI  E
Sbjct  477  LWLSSQAYYKPVIECCGGTELASSYIQGSLLQPQAFGAFNTATMTTSFVIIDE  529



>ref|XP_010462380.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Camelina 
sativa]
Length=728

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A      ADV+ G++YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  367  GEPKAIPWTQLSPIRSACDGWAHADVKVGNIYCWPTNLGWVMGPTLIFSCFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL R FGKFVQD+GV++LGTVPSLVK WK  +CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  427  NGSPLGRGFGKFVQDSGVTVLGTVPSLVKTWKRINCMEGLNWTKIKYFATTGEASNVDDV  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S++YYKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  487  LWLSSKSYYKPVIECCGGTELASSYLIGSPLQPQAFGAFSTPSMTTRIII  536



>ref|XP_008449824.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X4 [Cucumis melo]
Length=725

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQAGDV+CWPTNLGW MGP  VY+  L GATL LY
Sbjct  367  GEPKAIPWTQLSPIRCAADSWAHMDVQAGDVFCWPTNLGWAMGPVSVYSSLLVGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKP+ ECCGGTEL S+++ GS LQPQAFG FS+ASM   FVI  E
Sbjct  487  LWLSSRSYYKPLFECCGGTELGSSFIVGSPLQPQAFGAFSTASMTTGFVILDE  539



>ref|XP_008449823.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X3 [Cucumis melo]
Length=725

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQAGDV+CWPTNLGW MGP  VY+  L GATL LY
Sbjct  367  GEPKAIPWTQLSPIRCAADSWAHMDVQAGDVFCWPTNLGWAMGPVSVYSSLLVGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKP+ ECCGGTEL S+++ GS LQPQAFG FS+ASM   FVI  E
Sbjct  487  LWLSSRSYYKPLFECCGGTELGSSFIVGSPLQPQAFGAFSTASMTTGFVILDE  539



>ref|XP_008449822.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Cucumis melo]
 ref|XP_008449825.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Cucumis melo]
Length=725

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQAGDV+CWPTNLGW MGP  VY+  L GATL LY
Sbjct  367  GEPKAIPWTQLSPIRCAADSWAHMDVQAGDVFCWPTNLGWAMGPVSVYSSLLVGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKP+ ECCGGTEL S+++ GS LQPQAFG FS+ASM   FVI  E
Sbjct  487  LWLSSRSYYKPLFECCGGTELGSSFIVGSPLQPQAFGAFSTASMTTGFVILDE  539



>emb|CDP16781.1| unnamed protein product [Coffea canephora]
Length=741

 Score =   265 bits (678),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 159/235 (68%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R A D      VQ GDV+CWPTNLGWV GP L+Y+CFL+G TL LY
Sbjct  383  GEPKAIPWTQHSPIRAAGDTWAHIDVQEGDVFCWPTNLGWVAGPILLYSCFLSGGTLALY  442

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R  GKF+QDAGV+ILGTVPSLVK WKST CM GL+WT+IR FAT GE S++DDD
Sbjct  443  HGSPLGRGLGKFIQDAGVTILGTVPSLVKTWKSTGCMNGLNWTKIRTFATAGEVSSIDDD  502

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWL+S+AYY PI+ECCGGTELAS Y+ G+ LQPQAF  FSSASM+  F I  E  +   D
Sbjct  503  LWLSSKAYYSPIIECCGGTELASAYIQGNPLQPQAFAAFSSASMSTSFAILNENGLPYPD  562

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   +  F L          G  N L+   D EE+    K +P   G Q R+
Sbjct  563  DQACVGEVGLFPLY--------MGATNRLLNA-DHEEV--YFKGMPLYKGMQLRR  606



>ref|XP_006304735.1| hypothetical protein CARUB_v10012089mg [Capsella rubella]
 gb|EOA37633.1| hypothetical protein CARUB_v10012089mg [Capsella rubella]
Length=727

 Score =   265 bits (678),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A      ADVQ G++YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  367  GEPKAIPWTQLSPIRSACDGWAHADVQVGNIYCWPTNLGWVMGPTLIFSCFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   FGKFVQDAGV++LGTVPSLVK WK  +CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  427  NGSPLGWGFGKFVQDAGVTVLGTVPSLVKTWKRINCMEGLNWTKIKYFATTGEASNVDDV  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  487  LWLSSKAYYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIII  536



>ref|XP_004142169.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Cucumis sativus]
Length=725

 Score =   265 bits (677),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 161/235 (69%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      VQ GDV+CWPTNLGW MGP  VY+ FLTGATL LY
Sbjct  367  GEPKAIPWTQRSPIRCAADSWAHMDVQPGDVFCWPTNLGWAMGPVSVYSAFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGYGFGKFVQDAGVTMLGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWL+SR+YYKP+ ECCGGTEL S+++ GS +QPQAFG FS+ASM   FVI  E  +   D
Sbjct  487  LWLSSRSYYKPLFECCGGTELGSSFIVGSPVQPQAFGAFSTASMTTGFVILDEHGIPSPD  546

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   I  F         P     +S +   D +E+    K +P  NG Q R+
Sbjct  547  DQPCIGEIGLF---------PTYLGASSELLNADHDEV--YFKGMPIYNGMQLRR  590



>ref|XP_004162004.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Cucumis sativus]
Length=725

 Score =   265 bits (677),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 161/235 (69%), Gaps = 17/235 (7%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      VQ GDV+CWPTNLGW MGP  VY+ FLTGATL LY
Sbjct  367  GEPKAIPWTQRSPIRCAADSWAHMDVQPGDVFCWPTNLGWAMGPVSVYSAFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGYGFGKFVQDAGVTMLGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E*IVIDFD  181
            LWL+SR+YYKP+ ECCGGTEL S+++ GS +QPQAFG FS+ASM   FVI  E  +   D
Sbjct  487  LWLSSRSYYKPLFECCGGTELGSSFIVGSPVQPQAFGAFSTASMTTGFVILDEHGIPSPD  546

Query  180  MSYCKS*IPNFILLD*SSHRPRKGKLNSLVEEMDEEEIKPKIKNLPRENGKQKRK  16
               C   I  F         P     +S +   D +E+    K +P  NG Q R+
Sbjct  547  DQPCIGEIGLF---------PTYLGASSELLNADHDEV--YFKGMPIYNGMQLRR  590



>ref|XP_008449821.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Cucumis melo]
Length=746

 Score =   265 bits (678),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQAGDV+CWPTNLGW MGP  VY+  L GATL LY
Sbjct  388  GEPKAIPWTQLSPIRCAADSWAHMDVQAGDVFCWPTNLGWAMGPVSVYSSLLVGATLALY  447

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  448  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKDTRCMEGLNWTKIRYFASTGETSNVDDD  507

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKP+ ECCGGTEL S+++ GS LQPQAFG FS+ASM   FVI  E
Sbjct  508  LWLSSRSYYKPLFECCGGTELGSSFIVGSPLQPQAFGAFSTASMTTGFVILDE  560



>ref|XP_006842784.1| hypothetical protein AMTR_s00133p00115730 [Amborella trichopoda]
 gb|ERN04459.1| hypothetical protein AMTR_s00133p00115730 [Amborella trichopoda]
Length=729

 Score =   265 bits (676),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      +Q+GD++CWPTNLGWVMGP L+Y+CFL GATL LY
Sbjct  372  GEPKAIPWTQLSPIRCAADSWAHIDLQSGDIFCWPTNLGWVMGPILLYSCFLNGATLALY  431

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   F KF+QDAGV+ILGTVPSLVK WK+T C +GLDWT+I+ FA+TGEASNVDDD
Sbjct  432  HGSPLGFGFCKFIQDAGVTILGTVPSLVKFWKNTQCTEGLDWTKIKAFASTGEASNVDDD  491

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA Y+P++ECCGGTELAS+Y+ GS+LQPQA  TFS+ SM+  FVI  E
Sbjct  492  LWLSSRACYRPVIECCGGTELASSYIQGSMLQPQALATFSTPSMSTGFVILDE  544



>ref|XP_009147512.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Brassica 
rapa]
Length=723

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      V+ G+ YCWPTNLGWVMGPTL+++CFLTG TL LY
Sbjct  363  GEPKAIPWTQLSPIRSACDGWAHFDVKVGNTYCWPTNLGWVMGPTLIFSCFLTGTTLALY  422

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGTVPSLVK WK T+CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  423  HGSPLGHGFGKFVQDAGVTILGTVPSLVKTWKRTNCMEGLNWTKIKYFATTGEASNVDDV  482

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++E CGGTELAS+Y+ GS LQPQAFG FS+ +MA   +I
Sbjct  483  LWLSSKAYYKPVIEVCGGTELASSYIIGSPLQPQAFGAFSTPTMATRIII  532



>ref|XP_010552272.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Tarenaya hassleriana]
Length=732

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 144/173 (83%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A       D+Q GD YCWPTNLGWVMGPTL+++CFL GATL LY
Sbjct  373  GEPKAIPWTQLSPIRSACDGWAHVDIQPGDTYCWPTNLGWVMGPTLIFSCFLAGATLALY  432

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WKST CM+GLDW++I+ +ATTGEASNVDDD
Sbjct  433  HGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKSTKCMEGLDWSKIKSYATTGEASNVDDD  492

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LW++S++ YKP++ECCGGTEL+S+Y+ G  LQPQAFG FS+ SM    VI  E
Sbjct  493  LWISSKSGYKPVIECCGGTELSSSYIIGCPLQPQAFGAFSTPSMTTGIVILDE  545



>ref|XP_010501144.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Camelina 
sativa]
Length=724

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 144/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+       ADV+ GD+YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  364  GEPKAIPWTQLSPIRSGCDGWAHADVKVGDIYCWPTNLGWVMGPTLIFSCFLTGATLALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL R FGKFVQDAGV++LGTVPSLVK WK  +CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  424  NGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKRINCMEGLNWTKIKYFATTGEASNVDDV  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++E CGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  484  LWLSSKAYYKPVIEVCGGTELASSYLIGSPLQPQAFGAFSTPSMTTRIII  533



>ref|XP_010552271.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Tarenaya hassleriana]
Length=741

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 144/173 (83%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A       D+Q GD YCWPTNLGWVMGPTL+++CFL GATL LY
Sbjct  382  GEPKAIPWTQLSPIRSACDGWAHVDIQPGDTYCWPTNLGWVMGPTLIFSCFLAGATLALY  441

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPSLVK WKST CM+GLDW++I+ +ATTGEASNVDDD
Sbjct  442  HGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKSTKCMEGLDWSKIKSYATTGEASNVDDD  501

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LW++S++ YKP++ECCGGTEL+S+Y+ G  LQPQAFG FS+ SM    VI  E
Sbjct  502  LWISSKSGYKPVIECCGGTELSSSYIIGCPLQPQAFGAFSTPSMTTGIVILDE  554



>ref|XP_010673495.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKA+PWT LSP++ AAD      ++ GDV CWPTNLGWV+GP L+Y CFL GATL LY
Sbjct  316  GDPKAVPWTQLSPIQAAADSWAHMDIRVGDVMCWPTNLGWVVGPILLYGCFLNGATLALY  375

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL R FGKFVQDA V+ILGTVPSLVK WK++ CM GLDWT +RVFA++GEASNVDDD
Sbjct  376  NGSPLGRGFGKFVQDARVTILGTVPSLVKTWKNSHCMDGLDWTSLRVFASSGEASNVDDD  435

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRAYYKPI+E CGGTELA +Y+ GSLLQPQAFG FS+ +M+  FVI
Sbjct  436  LWLSSRAYYKPIIEICGGTELAGSYLQGSLLQPQAFGAFSTPTMSSGFVI  485



>gb|ACN40312.1| unknown [Picea sitchensis]
Length=734

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTH++ +R+ A      DV+AGD++CWPTN GW+MG  LVY+CFL+GAT  LY
Sbjct  375  GEPKAIPWTHVASIRSGAESWAHLDVKAGDIFCWPTNFGWIMGSVLVYSCFLSGATAALY  434

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV++LGTVPS+VK WKST CM+GLDW++IR F +TGEAS++DDD
Sbjct  435  HGSPLDRGFGKFVQDAGVNVLGTVPSMVKTWKSTGCMEGLDWSQIRNFGSTGEASSIDDD  494

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+A+YKP+VECCGGTEL++TY+ GSLLQPQAFG FS+ SM   FV+
Sbjct  495  LWLSSKAWYKPVVECCGGTELSATYINGSLLQPQAFGMFSTPSMTTGFVL  544



>ref|XP_004162003.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Cucumis sativus]
Length=725

 Score =   263 bits (672),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 141/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQ GDV+CWPTNLGWVMGP  VY+  L GATL LY
Sbjct  367  GEPKAIPWTQLSPIRCAADSWAHMDVQPGDVFCWPTNLGWVMGPVSVYSSLLAGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGHGFGKFVQDAGVTLLGTVPSLVKTWKDTRCMEGLNWTKIRHFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKPI E CGGTELAS+Y+ G+ LQPQAFG F++ASM  +FVI  E
Sbjct  487  LWLSSRSYYKPIFEFCGGTELASSYINGTPLQPQAFGAFTTASMTTEFVILDE  539



>ref|XP_010673494.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=733

 Score =   263 bits (672),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKA+PWT LSP++ AAD      ++ GDV CWPTNLGWV+GP L+Y CFL GATL LY
Sbjct  375  GDPKAVPWTQLSPIQAAADSWAHMDIRVGDVMCWPTNLGWVVGPILLYGCFLNGATLALY  434

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL R FGKFVQDA V+ILGTVPSLVK WK++ CM GLDWT +RVFA++GEASNVDDD
Sbjct  435  NGSPLGRGFGKFVQDARVTILGTVPSLVKTWKNSHCMDGLDWTSLRVFASSGEASNVDDD  494

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRAYYKPI+E CGGTELA +Y+ GSLLQPQAFG FS+ +M+  FVI
Sbjct  495  LWLSSRAYYKPIIEICGGTELAGSYLQGSLLQPQAFGAFSTPTMSSGFVI  544



>ref|NP_175929.3| acyl-activating enzyme 18 [Arabidopsis thaliana]
 sp|Q84P17.1|AEE18_ARATH RecName: Full=Probable acyl-activating enzyme 18, peroxisomal 
[Arabidopsis thaliana]
 gb|AAP03028.1| acyl-activating enzyme 18 [Arabidopsis thaliana]
 gb|AEE33225.1| acyl-activating enzyme 18 [Arabidopsis thaliana]
Length=727

 Score =   262 bits (670),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      VQ G  YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  367  GEPKAIPWTQLSPIRSACDGWAHLDVQVGHTYCWPTNLGWVMGPTLMFSCFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL R FGKFVQDAGV++LGTVPSLVK WK T+CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  427  SGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKRTNCMEGLNWTKIKFFATTGEASNVDDV  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+A YKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  487  LWLSSKADYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIII  536



>ref|XP_008663147.1| PREDICTED: uncharacterized protein LOC100194266 isoform X1 [Zea 
mays]
 tpg|DAA52020.1| TPA: hypothetical protein ZEAMMB73_193171 [Zea mays]
Length=729

 Score =   262 bits (670),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R A+D      V+  D+ CWPTNLGWVMGP ++Y+CFLTGATL LY
Sbjct  370  GEPKAIPWTQLSPIRCASDTWAHLDVRPCDIGCWPTNLGWVMGPIIIYSCFLTGATLALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV++LG+VPSLVK+WK+ +C +GLDWT+IRV  TTGEAS++DD+
Sbjct  430  HGSPLGRDFCKFVQDAGVTVLGSVPSLVKSWKAGNCAEGLDWTKIRVLGTTGEASDIDDN  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWLTSRA YKPIVECCGGTELAS+Y+ GSLL+PQAFG FS ASM+  FVI  E
Sbjct  490  LWLTSRASYKPIVECCGGTELASSYIQGSLLRPQAFGAFSGASMSTGFVILDE  542



>ref|XP_004981367.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Setaria italica]
Length=731

 Score =   262 bits (670),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 141/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW  LSP+R AAD      V+  D+ CWPTNLGWVMGP ++Y+CFL GATL LY
Sbjct  372  GEPKAIPWAQLSPIRCAADTWAHMDVRPEDIGCWPTNLGWVMGPIILYSCFLNGATLALY  431

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV++LGTVPSLVK+WK+ +C KGLDWT+IRV  TTGEAS++DD+
Sbjct  432  HGSPLGRDFCKFVQDAGVTVLGTVPSLVKSWKAANCAKGLDWTKIRVLGTTGEASDIDDN  491

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWLTSR  YKPIVECCGGTELAS+Y+ GSLLQPQ FG FS ASM+  FVI  E
Sbjct  492  LWLTSRTSYKPIVECCGGTELASSYIQGSLLQPQVFGAFSGASMSTGFVILDE  544



>gb|KDO63043.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
Length=461

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  279  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  338

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  339  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  398

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  399  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  451



>ref|XP_010032909.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Eucalyptus 
grandis]
Length=757

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 8/170 (5%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R +AD      VQAGDV CWPTNLGWVMGP  +Y+CFL GATL LY
Sbjct  401  GEPKAIPWTQLSPIRCSADSWAHMDVQAGDVLCWPTNLGWVMGPISLYSCFLAGATLALY  460

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R FGKFVQDAGV+ILGTVPSLVK WKST CM+GL+W  +R F +TGE SNVDDD
Sbjct  461  HGSPLGRDFGKFVQDAGVTILGTVPSLVKTWKSTQCMEGLEW--LRSFGSTGETSNVDDD  518

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+++Y PI+ECCGGTELAS+Y+ G+ LQPQAFG FS+ASM   FVI
Sbjct  519  LWLSSKSFYSPIIECCGGTELASSYIQGNHLQPQAFGAFSNASMTTGFVI  568



>ref|XP_010480067.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal [Camelina 
sativa]
Length=724

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 143/170 (84%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A       DV+ G++YCWPTNLGWVMGP L+++CFLTGATL LY
Sbjct  364  GEPKAIPWTQLSPIRSACDGWAHVDVKVGNIYCWPTNLGWVMGPNLIFSCFLTGATLALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL R FGKFVQDAGV++LGTVPSLVK WK  +CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  424  NGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKRINCMEGLNWTKIKYFATTGEASNVDDV  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++E CGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  484  LWLSSKAYYKPVIEVCGGTELASSYLIGSPLQPQAFGAFSTPSMTTRIII  533



>gb|KDO63045.1| hypothetical protein CISIN_1g0048601mg [Citrus sinensis]
Length=499

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  141  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  200

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  201  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  260

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  261  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  313



>ref|XP_006445652.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
 gb|ESR58892.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
 gb|KDO63044.1| hypothetical protein CISIN_1g0048601mg [Citrus sinensis]
Length=518

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  160  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  219

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  220  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  279

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  280  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  332



>ref|XP_008449828.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X6 [Cucumis melo]
Length=619

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R AAD      VQAGDV CWPTNLGWVMGP  VY+  L GATL LY
Sbjct  367  GEPKAIPWTQLSPIRCAADSWAHMDVQAGDVLCWPTNLGWVMGPISVYSSLLAGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WK T CM+GL+WT+IR FA+TGE SN+DDD
Sbjct  427  HGSPLGHGFGKFVQDAGVTLLGTVPSLVKTWKDTRCMEGLNWTKIRHFASTGETSNIDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S++YYKPI E CGGTEL S+Y+ G+ +QPQAFG FS+ASM  +FVI  E
Sbjct  487  LWLSSKSYYKPIFEFCGGTELGSSYITGTPVQPQAFGAFSTASMTTEFVILDE  539



>ref|XP_004142170.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Cucumis sativus]
Length=725

 Score =   260 bits (664),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      VQ GDV+CWPTNLGWVMGP  VY+  L GATL LY
Sbjct  367  GEPKAIPWTQRSPIRCAADSWAHMDVQPGDVFCWPTNLGWVMGPVSVYSSLLAGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGYGFGKFVQDAGVTLLGTVPSLVKTWKDTRCMEGLNWTKIRHFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKPI E CGGTELAS+Y+ G+ LQPQAFG F++ASM  +FVI  E
Sbjct  487  LWLSSRSYYKPIFEFCGGTELASSYINGTPLQPQAFGAFTTASMTTEFVILDE  539



>gb|KGN54066.1| hypothetical protein Csa_4G280430 [Cucumis sativus]
Length=725

 Score =   260 bits (664),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      VQ GDV+CWPTNLGWVMGP  VY+  L GATL LY
Sbjct  367  GEPKAIPWTQRSPIRCAADSWAHMDVQPGDVFCWPTNLGWVMGPVSVYSSLLAGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV++LGTVPSLVK WK T CM+GL+WT+IR FA+TGE SNVDDD
Sbjct  427  HGSPLGYGFGKFVQDAGVTLLGTVPSLVKTWKDTRCMEGLNWTKIRHFASTGETSNVDDD  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR+YYKPI E CGGTELAS+Y+ G+ LQPQAFG F++ASM  +FVI  E
Sbjct  487  LWLSSRSYYKPIFEFCGGTELASSYINGTPLQPQAFGAFTTASMTTEFVILDE  539



>gb|KDO63041.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
 gb|KDO63042.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
Length=502

 Score =   254 bits (648),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  279  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  338

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  339  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  398

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  399  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  451



>gb|KDO63040.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
Length=518

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  279  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  338

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  339  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  398

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  399  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  451



>gb|KDO63036.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
Length=637

 Score =   256 bits (653),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  279  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  338

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  339  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  398

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  399  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  451



>gb|KDO63037.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
Length=632

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  279  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  338

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  339  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  398

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  399  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  451



>gb|KDO63038.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
Length=603

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  279  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  338

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  339  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  398

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  399  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  451



>gb|KDO63039.1| hypothetical protein CISIN_1g0048601mg, partial [Citrus sinensis]
Length=570

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  279  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  338

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  339  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  398

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  399  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  451



>ref|XP_006651932.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Oryza brachyantha]
Length=760

 Score =   258 bits (658),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 144/173 (83%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW+ L P+R A+D      ++  D++CWPTNLGWVMGP L+Y+CFL+GA L LY
Sbjct  401  GEPKAIPWSQLCPIRCASDTWAHLDIRPQDIFCWPTNLGWVMGPILLYSCFLSGAALALY  460

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV++LG+VPSLVK+WK+ +  KGLDWT+IRV +TTGEAS++DDD
Sbjct  461  HGSPLGRGFCKFVQDAGVTVLGSVPSLVKSWKAGNFTKGLDWTKIRVLSTTGEASDIDDD  520

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA YKPI+ECCGGTELAS+Y+ GSLL+PQAFG FS ASM+  FVI  E
Sbjct  521  LWLSSRASYKPIIECCGGTELASSYIQGSLLRPQAFGAFSGASMSTGFVILDE  573



>gb|AAS07227.1| putative acyl-activating enzyme [Oryza sativa Japonica Group]
Length=589

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW+ LSP+R   D      +Q  D++CWPTNLGWVMGP L+Y+CFL+GATL LY
Sbjct  230  GEPKAIPWSQLSPIRCTCDTWAHLDIQPQDIFCWPTNLGWVMGPILLYSCFLSGATLALY  289

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV+ILG+VPSLVK+WK+ +  +GL WT+IRV +TTGEAS++DDD
Sbjct  290  HGSPLGRGFCKFVQDAGVTILGSVPSLVKSWKAGNFTEGLHWTKIRVLSTTGEASDIDDD  349

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA YKPI+ECCGGTELAS+Y+ GSLL+ QAFG FS ASM+  FVI  E
Sbjct  350  LWLSSRASYKPIIECCGGTELASSYIQGSLLRSQAFGAFSGASMSTGFVILDE  402



>ref|XP_006445654.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
 gb|ESR58894.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
Length=592

 Score =   254 bits (648),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  369  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  429  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  489  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  541



>ref|NP_001051629.2| Os03g0805500 [Oryza sativa Japonica Group]
 dbj|BAF13543.2| Os03g0805500, partial [Oryza sativa Japonica Group]
Length=593

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW+ LSP+R   D      +Q  D++CWPTNLGWVMGP L+Y+CFL+GATL LY
Sbjct  234  GEPKAIPWSQLSPIRCTCDTWAHLDIQPQDIFCWPTNLGWVMGPILLYSCFLSGATLALY  293

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV+ILG+VPSLVK+WK+ +  +GL WT+IRV +TTGEAS++DDD
Sbjct  294  HGSPLGRGFCKFVQDAGVTILGSVPSLVKSWKAGNFTEGLHWTKIRVLSTTGEASDIDDD  353

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA YKPI+ECCGGTELAS+Y+ GSLL+ QAFG FS ASM+  FVI  E
Sbjct  354  LWLSSRASYKPIIECCGGTELASSYIQGSLLRSQAFGAFSGASMSTGFVILDE  406



>ref|XP_002463701.1| hypothetical protein SORBIDRAFT_01g004510 [Sorghum bicolor]
 gb|EER90699.1| hypothetical protein SORBIDRAFT_01g004510 [Sorghum bicolor]
Length=731

 Score =   256 bits (654),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R A+D      V+  ++ CWPTNLGWVMGP ++Y+CFL GA L LY
Sbjct  372  GEPKAIPWTQLSPIRCASDTWAHLDVRPCEIGCWPTNLGWVMGPIIIYSCFLNGAALALY  431

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV++LG+VPSLVK+WK+ +C +GLDWT+IRV  TTGEAS++DD+
Sbjct  432  HGSPLGRDFCKFVQDAGVTVLGSVPSLVKSWKAGNCAEGLDWTKIRVLGTTGEASDIDDN  491

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWLTSRA YKPIVECCGGTELAS+Y+ GSLL+PQ FG FS ASM+  FVI  E
Sbjct  492  LWLTSRASYKPIVECCGGTELASSYIQGSLLRPQVFGAFSGASMSTGFVILDE  544



>emb|CDY33059.1| BnaC06g07200D [Brassica napus]
Length=721

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 141/170 (83%), Gaps = 8/170 (5%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      V+ G+ YCWPTNLGWVMGPTL+++CFLTG TL LY
Sbjct  363  GEPKAIPWTQLSPIRSACDGWAHFDVKVGNTYCWPTNLGWVMGPTLIFSCFLTGTTLALY  422

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKF  DAGV+ILGTVPSLVK WK T+CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  423  HGSPLGHGFGKF--DAGVTILGTVPSLVKTWKRTNCMEGLNWTKIKYFATTGEASNVDDV  480

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++E CGGTELAS+Y+ GS LQPQAFG FS+ +MA   +I
Sbjct  481  LWLSSKAYYKPVIEVCGGTELASSYIIGSPLQPQAFGAFSTPTMATRIII  530



>ref|XP_006445653.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
 ref|XP_006488898.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal-like 
[Citrus sinensis]
 gb|ESR58893.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
Length=727

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  369  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL RSFGKFVQDAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDDD
Sbjct  429  QGSPLERSFGKFVQDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  489  LWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  541



>ref|XP_010228097.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Brachypodium distachyon]
Length=589

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L P+R  AD      V+  D+ CWPTNLGWVMGP L+++CFL+GATL LY
Sbjct  230  GEPKAIPWTQLCPIRCGADTWAHLDVRPQDIGCWPTNLGWVMGPILLFSCFLSGATLALY  289

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   F KFVQDA V++LGTVPSLVKAWK+ +  KG+DWT+IRV ATTGEAS++DD+
Sbjct  290  HGSPLGHGFCKFVQDARVNMLGTVPSLVKAWKAGNLTKGIDWTKIRVLATTGEASDIDDN  349

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA YKPIVECCGGTELAS+Y+ GSLLQPQAFG FS  SM+  FVI  E
Sbjct  350  LWLSSRACYKPIVECCGGTELASSYIQGSLLQPQAFGAFSGKSMSTGFVILDE  402



>gb|KCW52410.1| hypothetical protein EUGRSUZ_J018162, partial [Eucalyptus grandis]
Length=332

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  639  AGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSL  460
            AGDV CWPTNLGWVMGP  +Y+CFL GATL LYHGSPL R FGKFVQDAGV+ILGTVPSL
Sbjct  1    AGDVLCWPTNLGWVMGPISLYSCFLAGATLALYHGSPLGRDFGKFVQDAGVTILGTVPSL  60

Query  459  VKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVA  280
            VK WKST CM+GLDWT+IR F +TGE SNVDDDLWL+S+++Y PI+ECCGGTELAS+Y+ 
Sbjct  61   VKTWKSTQCMEGLDWTKIRSFGSTGETSNVDDDLWLSSKSFYSPIIECCGGTELASSYIQ  120

Query  279  GSLLQPQAFGTFSSASMAVDFVI  211
            G+ LQPQAFG FS+ASM   FVI
Sbjct  121  GNHLQPQAFGAFSNASMMTGFVI  143



>emb|CDY24042.1| BnaA06g00400D [Brassica napus]
Length=721

 Score =   254 bits (648),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 8/170 (5%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      V+ G+ YCWPTNLGWVMGPTL+++CFLTG TL LY
Sbjct  363  GEPKAIPWTQLSPIRSACDGWAHFDVKVGNTYCWPTNLGWVMGPTLIFSCFLTGTTLALY  422

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKF  D GV+ILGTVPSLVK WK T+CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  423  HGSPLGHGFGKF--DVGVTILGTVPSLVKTWKRTNCMEGLNWTKIKYFATTGEASNVDDV  480

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++E CGGTELAS+Y+ GS LQPQAFG FS+ +MA   +I
Sbjct  481  LWLSSKAYYKPVIEVCGGTELASSYIIGSPLQPQAFGAFSTPTMATRIII  530



>gb|ABF99434.1| acyl-activating enzyme 18, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEC76371.1| hypothetical protein OsI_13972 [Oryza sativa Indica Group]
 gb|EEE60134.1| hypothetical protein OsJ_13020 [Oryza sativa Japonica Group]
Length=730

 Score =   253 bits (646),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMR------TAADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW+ LSP+R         D+Q  D++CWPTNLGWVMGP L+Y+CFL+GATL LY
Sbjct  371  GEPKAIPWSQLSPIRCTCDTWAHLDIQPQDIFCWPTNLGWVMGPILLYSCFLSGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDAGV+ILG+VPSLVK+WK+ +  +GL WT+IRV +TTGEAS++DDD
Sbjct  431  HGSPLGRGFCKFVQDAGVTILGSVPSLVKSWKAGNFTEGLHWTKIRVLSTTGEASDIDDD  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA YKPI+ECCGGTELAS+Y+ GSLL+ QAFG FS ASM+  FVI  E
Sbjct  491  LWLSSRASYKPIIECCGGTELASSYIQGSLLRSQAFGAFSGASMSTGFVILDE  543



>ref|XP_002297639.2| hypothetical protein POPTR_0001s04370g [Populus trichocarpa]
 gb|EEE82444.2| hypothetical protein POPTR_0001s04370g [Populus trichocarpa]
Length=727

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R A       D+Q GDV+C+PTNLGWV GP ++Y  FL+GAT  LY
Sbjct  369  GEPKAIPWTQLSPIRAANDGWAYVDLQVGDVFCYPTNLGWVAGPIVLYEAFLSGATFALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGT+P++VKAWKST+CMKGL+WT+IR F T GEAS+VD+ 
Sbjct  429  HGSPLGGGFGKFVQDAGVTILGTIPTMVKAWKSTNCMKGLNWTKIRSFVTAGEASDVDNV  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRAYYKPI+E CGGTELAS+Y+ G+LLQPQAFG  S+ASMA   VI
Sbjct  489  LWLSSRAYYKPIIEVCGGTELASSYLQGTLLQPQAFGALSTASMATGVVI  538



>ref|XP_011048226.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Populus euphratica]
Length=625

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 138/170 (81%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R A       D+Q GDV+C+PTNLGWV GP ++Y  FL+GAT  LY
Sbjct  267  GEPKAIPWTQLSPIRAANDGWAYVDLQVGDVFCYPTNLGWVAGPIVLYEAFLSGATFALY  326

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGT+PS+VKAWKST+CM+GL+WT+IR F T GEAS+VD  
Sbjct  327  HGSPLGGGFGKFVQDAGVTILGTIPSMVKAWKSTNCMEGLNWTKIRSFVTAGEASDVDSG  386

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRAYYKPI+E CGGTELAS+Y+ G+LLQPQA G  S+ASMA   VI
Sbjct  387  LWLSSRAYYKPIIEVCGGTELASSYLQGTLLQPQALGALSTASMATGVVI  436



>ref|XP_002891829.1| hypothetical protein ARALYDRAFT_314757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68088.1| hypothetical protein ARALYDRAFT_314757 [Arabidopsis lyrata subsp. 
lyrata]
Length=2638

 Score =   260 bits (664),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 141/170 (83%), Gaps = 8/170 (5%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      VQ G+ YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  366  GEPKAIPWTQLSPIRSACDGWAHLDVQVGNTYCWPTNLGWVMGPTLIFSCFLTGATLALY  425

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL R FGKF  DAGV +LGTVPSLVK WK T+CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  426  QGSPLGRGFGKF--DAGVMVLGTVPSLVKTWKRTNCMEGLNWTKIKYFATTGEASNVDDV  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+AYYKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  484  LWLSSKAYYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIII  533



>ref|XP_003564187.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Brachypodium distachyon]
Length=730

 Score =   251 bits (641),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L P+R  AD      V+  D+ CWPTNLGWVMGP L+++CFL+GATL LY
Sbjct  371  GEPKAIPWTQLCPIRCGADTWAHLDVRPQDIGCWPTNLGWVMGPILLFSCFLSGATLALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   F KFVQDA V++LGTVPSLVKAWK+ +  KG+DWT+IRV ATTGEAS++DD+
Sbjct  431  HGSPLGHGFCKFVQDARVNMLGTVPSLVKAWKAGNLTKGIDWTKIRVLATTGEASDIDDN  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SRA YKPIVECCGGTELAS+Y+ GSLLQPQAFG FS  SM+  FVI  E
Sbjct  491  LWLSSRACYKPIVECCGGTELASSYIQGSLLQPQAFGAFSGKSMSTGFVILDE  543



>ref|XP_006445655.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
 gb|ESR58895.1| hypothetical protein CICLE_v10014402mg [Citrus clementina]
Length=728

 Score =   251 bits (640),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 142/174 (82%), Gaps = 7/174 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAA------DVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LS +R  A      D++ GDVYCWPTNLGWVMGP ++++ FL GATL LY
Sbjct  369  GEPKAIPWTQLSSIRCTAEGWAHIDLKVGDVYCWPTNLGWVMGPVILFSSFLNGATLALY  428

Query  540  HGSPLSRSFGKFVQ-DAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDD  364
             GSPL RSFGKFVQ DAGV++LGTVPSLVKAW++T+C++GLDWT+IR FA+TGE SNVDD
Sbjct  429  QGSPLERSFGKFVQVDAGVTVLGTVPSLVKAWRNTNCLEGLDWTKIRSFASTGETSNVDD  488

Query  363  DLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            DLWL+S+A+Y  I+E CGGTEL+S Y+ GSLLQPQAFG FS+A+M    VI  E
Sbjct  489  DLWLSSKAWYNAIIESCGGTELSSAYIQGSLLQPQAFGAFSTATMTAGLVILDE  542



>ref|XP_011048225.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X1 [Populus euphratica]
Length=727

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 138/170 (81%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTA------ADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R A       D+Q GDV+C+PTNLGWV GP ++Y  FL+GAT  LY
Sbjct  369  GEPKAIPWTQLSPIRAANDGWAYVDLQVGDVFCYPTNLGWVAGPIVLYEAFLSGATFALY  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL   FGKFVQDAGV+ILGT+PS+VKAWKST+CM+GL+WT+IR F T GEAS+VD  
Sbjct  429  HGSPLGGGFGKFVQDAGVTILGTIPSMVKAWKSTNCMEGLNWTKIRSFVTAGEASDVDSG  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+SRAYYKPI+E CGGTELAS+Y+ G+LLQPQA G  S+ASMA   VI
Sbjct  489  LWLSSRAYYKPIIEVCGGTELASSYLQGTLLQPQALGALSTASMATGVVI  538



>gb|AAG51574.1|AC027034_20 acetyl-CoA synthetase, putative; 45051-31547 [Arabidopsis thaliana]
Length=2655

 Score =   255 bits (652),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 140/170 (82%), Gaps = 8/170 (5%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT LSP+R+A D      VQ G  YCWPTNLGWVMGPTL+++CFLTGATL LY
Sbjct  367  GEPKAIPWTQLSPIRSACDGWAHLDVQVGHTYCWPTNLGWVMGPTLMFSCFLTGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL R FGKF  DAGV++LGTVPSLVK WK T+CM+GL+WT+I+ FATTGEASNVDD 
Sbjct  427  SGSPLGRGFGKF--DAGVTVLGTVPSLVKTWKRTNCMEGLNWTKIKFFATTGEASNVDDV  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL+S+A YKP++ECCGGTELAS+Y+ GS LQPQAFG FS+ SM    +I
Sbjct  485  LWLSSKADYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIII  534



>dbj|BAJ86478.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=726

 Score =   247 bits (630),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 138/173 (80%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L P+R  AD      V+  D+  WPTNLGWVMGP  +++CFL GATL LY
Sbjct  367  GEPKAIPWTQLCPIRCGADTWAHLDVRPKDIGLWPTNLGWVMGPIQLFSCFLNGATLALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDA VS+LG+VPSLVK+WK+ +  +GLDWT+IRV ATTGEAS++DD+
Sbjct  427  HGSPLGRGFCKFVQDARVSVLGSVPSLVKSWKAGNLTEGLDWTKIRVLATTGEASDIDDN  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKPIVECCGGTELAS+Y+ GSLLQPQAFG FS ASM+  FVI  E
Sbjct  487  LWLSSRTCYKPIVECCGGTELASSYIQGSLLQPQAFGAFSGASMSTGFVILDE  539



>gb|KCW45443.1| hypothetical protein EUGRSUZ_L00845 [Eucalyptus grandis]
Length=611

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  639  AGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSL  460
            AGDV CWPTNLGWVMGP  +Y+CFL GATL LYHGSPL R FGKFVQDAGV+ILGTVPSL
Sbjct  382  AGDVLCWPTNLGWVMGPISLYSCFLAGATLALYHGSPLGRDFGKFVQDAGVTILGTVPSL  441

Query  459  VKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVA  280
            VK WKST CM+GLDWT+IR F +TGE SNVDDDLWL+S+++Y PI+ECCGGTELAS+Y+ 
Sbjct  442  VKTWKSTQCMEGLDWTKIRSFGSTGETSNVDDDLWLSSKSFYSPIIECCGGTELASSYIQ  501

Query  279  GSLLQPQAFGTFSSASMAVDFVI  211
            G+ LQPQAFG FS+ASM   FVI
Sbjct  502  GNHLQPQAFGAFSNASMMTGFVI  524



>ref|XP_002989779.1| hypothetical protein SELMODRAFT_428318 [Selaginella moellendorffii]
 gb|EFJ09256.1| hypothetical protein SELMODRAFT_428318 [Selaginella moellendorffii]
Length=726

 Score =   244 bits (622),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = -2

Query  699  DPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYH  538
            +PKAIPW   +PMR AAD      +QAGD+YCWPTNLGW++GP ++ AC L+GAT+ LY+
Sbjct  370  EPKAIPWNQTTPMRCAADSWAHFDLQAGDIYCWPTNLGWMVGPYIISACLLSGATMALYN  429

Query  537  GSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDL  358
            GSPL RSFG+FVQDA V+ILGTVPS+VK WK  +CM  LDW+ IR F TTGEAS++DDDL
Sbjct  430  GSPLGRSFGRFVQDARVTILGTVPSMVKTWKKVNCMDSLDWSSIRSFGTTGEASSIDDDL  489

Query  357  WLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            WL++RA+YKPI+ECCGGTEL S ++ GSLLQPQAF  FS+ S+   FV+
Sbjct  490  WLSARAWYKPILECCGGTELGSAFLHGSLLQPQAFAAFSTPSLTAAFVL  538



>gb|EMT16119.1| Acetyl-coenzyme A synthetase [Aegilops tauschii]
Length=697

 Score =   243 bits (621),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 135/173 (78%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L P+R  AD      V+  D+ C PTNLGWVMGP  +++CFL GATL LY
Sbjct  310  GEPKAIPWTQLCPIRCGADTWANLDVRPKDISCLPTNLGWVMGPIQLFSCFLNGATLALY  369

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDA VS LG+VPSLVK WK+ +  KGLDWT+IRV ATTGEAS++DD+
Sbjct  370  HGSPLGRGFCKFVQDAHVSALGSVPSLVKLWKAGNHTKGLDWTKIRVLATTGEASDIDDN  429

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKPIVECCGGTELAS+++ GSLLQPQ FG FS ASM+  FVI  E
Sbjct  430  LWLSSRTCYKPIVECCGGTELASSFIQGSLLQPQVFGAFSGASMSTGFVILDE  482



>ref|XP_002989780.1| hypothetical protein SELMODRAFT_130287 [Selaginella moellendorffii]
 gb|EFJ09257.1| hypothetical protein SELMODRAFT_130287 [Selaginella moellendorffii]
Length=732

 Score =   244 bits (622),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = -2

Query  699  DPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYH  538
            +PKAIPW   +PMR AAD      +QAGD+YCWPTNLGW++GP ++ AC L+GAT+ LY+
Sbjct  376  EPKAIPWNQTTPMRCAADSWAHFDLQAGDIYCWPTNLGWMVGPYIISACLLSGATMALYN  435

Query  537  GSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDL  358
            GSPL RSFG+FVQDA V+ILGTVPS+VK WK  +CM  LDW+ IR F TTGEAS++DDDL
Sbjct  436  GSPLGRSFGRFVQDARVTILGTVPSMVKTWKKVNCMDSLDWSSIRSFGTTGEASSIDDDL  495

Query  357  WLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            WL++RA+YKPI+ECCGGTEL S ++ GSLLQPQAF  FS+ S+   FV+
Sbjct  496  WLSARAWYKPILECCGGTELGSAFLHGSLLQPQAFAAFSTPSLTTAFVL  544



>ref|XP_002993662.1| hypothetical protein SELMODRAFT_236785 [Selaginella moellendorffii]
 gb|EFJ05251.1| hypothetical protein SELMODRAFT_236785 [Selaginella moellendorffii]
Length=732

 Score =   243 bits (620),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 135/169 (80%), Gaps = 6/169 (4%)
 Frame = -2

Query  699  DPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYH  538
            +PKAIPW   +PMR AAD      +QAGD+YCWPTNLGW+MGP L+ AC L+GAT+ LY+
Sbjct  376  EPKAIPWNQTTPMRCAADSWAHSDLQAGDIYCWPTNLGWMMGPYLISACLLSGATMALYN  435

Query  537  GSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDL  358
            GSPL RSFG+FVQDA V+ILGTVPS+VK WK  +CM  LDW+ IR F TTGEAS++DDDL
Sbjct  436  GSPLGRSFGRFVQDARVTILGTVPSMVKTWKKVNCMDSLDWSSIRSFGTTGEASSIDDDL  495

Query  357  WLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            WL++RA+YKPI+E CGGTEL S ++ GSLLQPQAF  FS+ S+   FV+
Sbjct  496  WLSARAWYKPILESCGGTELGSAFLHGSLLQPQAFAAFSTPSLTTAFVL  544



>gb|EMS50598.1| Acetyl-coenzyme A synthetase [Triticum urartu]
Length=688

 Score =   242 bits (618),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 136/173 (79%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L P+R  AD      V+  D+ C PTNLGWVMGP  +++CFL GATL LY
Sbjct  302  GEPKAIPWTQLCPIRCGADTWANLDVRPKDISCLPTNLGWVMGPIQLFSCFLNGATLALY  361

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDA VS LG+VPSLVK+WK+ +  KGLDWT+IRV ATTGEAS++DD+
Sbjct  362  HGSPLGRGFCKFVQDAHVSALGSVPSLVKSWKAGNHTKGLDWTKIRVLATTGEASDIDDN  421

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LW++SR  YKPIVECCGGTELAS+++ GSLLQPQ FG FS ASM+  FVI  E
Sbjct  422  LWISSRTCYKPIVECCGGTELASSFIQGSLLQPQVFGAFSGASMSTGFVILDE  474



>emb|CDJ26643.1| unnamed protein product [Triticum aestivum]
Length=680

 Score =   241 bits (616),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 134/173 (77%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L P+R  AD      V+  D+ C PTNLGWVMGP  ++ CFL GATL LY
Sbjct  293  GEPKAIPWTQLCPIRCGADTWANLDVRPKDISCLPTNLGWVMGPIQLFLCFLNGATLALY  352

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            HGSPL R F KFVQDA VS LG+VPSLVK WK+ +  KGLDWT+IRV ATTGEAS++DD+
Sbjct  353  HGSPLGRGFCKFVQDAHVSALGSVPSLVKLWKAGNHTKGLDWTKIRVLATTGEASDIDDN  412

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL+SR  YKPIVECCGGTELAS+++ GSLLQPQ FG FS ASM+  FVI  E
Sbjct  413  LWLSSRTCYKPIVECCGGTELASSFIQGSLLQPQVFGAFSGASMSTGFVILDE  465



>ref|XP_010032904.1| PREDICTED: probable acyl-activating enzyme 18, peroxisomal isoform 
X2 [Eucalyptus grandis]
Length=713

 Score =   240 bits (613),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  639  AGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSL  460
            AGDV+CWPTNLGWV+GP ++Y+CFL GATL LYHGSPL R FGKFVQDAGV+ILGTVPSL
Sbjct  382  AGDVFCWPTNLGWVVGPIVLYSCFLAGATLALYHGSPLGRDFGKFVQDAGVTILGTVPSL  441

Query  459  VKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVA  280
            VK WKST CM GLDWT+IR F + GE SNVDD+LWL+S+++Y P++ECCGGTELAS+Y+ 
Sbjct  442  VKTWKSTQCMGGLDWTKIRSFGSAGETSNVDDNLWLSSKSFYSPVIECCGGTELASSYIQ  501

Query  279  GSLLQPQAFGTFSSASMAVDFVI  211
            G+ LQPQAFG FS+ASM   FVI
Sbjct  502  GNHLQPQAFGAFSNASMTTGFVI  524



>ref|XP_001784370.1| predicted protein [Physcomitrella patens]
 gb|EDQ50839.1| predicted protein [Physcomitrella patens]
Length=730

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 135/170 (79%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAADV------QAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  +P+R AAD       + GD+ CWPTNLGWV+G  ++YA FL GATL L+
Sbjct  369  GEPKAIPWTQHAPLRCAADAWAHLDAREGDIICWPTNLGWVVGHLVLYAAFLNGATLALF  428

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL + FGKFVQDA +SILGTVPSLVK WK++ CM  LDW+RIR+F++TGE+S+VDDD
Sbjct  429  NGSPLDQEFGKFVQDANISILGTVPSLVKTWKTSGCMANLDWSRIRIFSSTGESSSVDDD  488

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL++R  YKP++ECCGGTEL S Y+AGSL+QPQAF TFS+  M +   I
Sbjct  489  LWLSARGGYKPVLECCGGTELGSMYLAGSLVQPQAFATFSTLGMTIKAFI  538



>dbj|BAK05470.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 135/174 (78%), Gaps = 7/174 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+ KAIPWT L P+R  AD      V+  D+ C PTNLGWVMGP  +++CFL GATL LY
Sbjct  368  GESKAIPWTQLCPIRCGADTWANLDVRPKDIGCLPTNLGWVMGPIQLFSCFLNGATLALY  427

Query  540  HGSPLSRSFGKFVQ-DAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDD  364
            HGSPL R F KFVQ DA VS LG+VPSLVK+WK+ +  KGLDWT+IRV ATTGEAS++DD
Sbjct  428  HGSPLGRGFCKFVQVDAHVSALGSVPSLVKSWKAGNHTKGLDWTKIRVLATTGEASDIDD  487

Query  363  DLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            +LWL+SR  YKPIVECCGGTELAS+++ GSLLQPQ FG FS ASM+  FVI  E
Sbjct  488  NLWLSSRTCYKPIVECCGGTELASSFIQGSLLQPQVFGAFSGASMSTGFVILDE  541



>gb|EMS61140.1| Acetyl-coenzyme A synthetase [Triticum urartu]
Length=756

 Score =   233 bits (593),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 138/200 (69%), Gaps = 33/200 (17%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT L P+R  AD      V+  D+ CWPTNLGWVMGP  +++ FL GATL LY
Sbjct  403  GEPKAIPWTQLCPIRCGADTWGHLDVRPKDIGCWPTNLGWVMGPIQLFSSFLNGATLALY  462

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRI---------------  406
            HGSPL R F KFVQDA VS+LG+VPSLVK+WK+ +  +GLDWT+I               
Sbjct  463  HGSPLGRGFCKFVQDARVSVLGSVPSLVKSWKAGNLTEGLDWTKIRQVATYTVRKHSISS  522

Query  405  ------------RVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQP  262
                        RV ATTGEAS++DD+LWL+SR  YKPIVECCGGTELAS+Y+ GSLLQP
Sbjct  523  QPRQKELQFCNCRVLATTGEASDIDDNLWLSSRTCYKPIVECCGGTELASSYIQGSLLQP  582

Query  261  QAFGTFSSASMAVDFVIC*E  202
            QAFG FS ASM+  FVI  E
Sbjct  583  QAFGAFSGASMSTGFVILDE  602



>ref|XP_001773935.1| predicted protein [Physcomitrella patens]
 gb|EDQ61283.1| predicted protein [Physcomitrella patens]
Length=729

 Score =   230 bits (587),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 135/183 (74%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAADV------QAGDVYCWPTNLGWVMGPTLV  580
            D +T     S   G+PKAIPWT  +P+R AAD       + GDV CWPTNLGW++GP +V
Sbjct  356  DSYTNILFSSGTTGEPKAIPWTQHTPLRCAADSWAHLDSRQGDVLCWPTNLGWMVGPMIV  415

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            Y+ F+ GATL LY+GSPL R FGKFVQDA V++LGTVPSLV+AWK++ CM  LDWT IR 
Sbjct  416  YSAFVNGATLALYNGSPLDRGFGKFVQDAKVTMLGTVPSLVRAWKASGCMANLDWTAIRA  475

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F ++GE S+VDDDLWL+++A YKP++ECCGGTEL + YV G+L+QPQAF  FS+  M   
Sbjct  476  FGSSGETSSVDDDLWLSAQAGYKPVLECCGGTELGAMYVGGNLVQPQAFAAFSTVGMTFR  535

Query  219  FVI  211
              I
Sbjct  536  IYI  538



>gb|EMT13054.1| Acetyl-coenzyme A synthetase [Aegilops tauschii]
Length=831

 Score =   231 bits (590),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 136/200 (68%), Gaps = 33/200 (17%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PK IPWT L P+R AAD      ++  DV  WPTNLGWVMGP  +++CFL GATL LY
Sbjct  478  GEPKVIPWTQLCPIRCAADTWAHLDLRPKDVDLWPTNLGWVMGPIQIFSCFLNGATLALY  537

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRI---------------  406
            HGSPL R F KFVQDA VS+LG+VPSLVK+WK+ +  KGLDWT+I               
Sbjct  538  HGSPLGRGFCKFVQDARVSVLGSVPSLVKSWKAGNLTKGLDWTKIRQVATYTVRKHSTSS  597

Query  405  ------------RVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQP  262
                        RV ATTGEAS++DD+LWL+SR  YKPIVECCGGTELAS+Y+ G LLQP
Sbjct  598  QAPLKKLNFYNRRVLATTGEASDIDDNLWLSSRTCYKPIVECCGGTELASSYIQGRLLQP  657

Query  261  QAFGTFSSASMAVDFVIC*E  202
            QAFG FS  SM+  FVI  E
Sbjct  658  QAFGAFSGPSMSTGFVILDE  677



>gb|EMS59872.1| Acetyl-coenzyme A synthetase [Triticum urartu]
Length=655

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 136/200 (68%), Gaps = 33/200 (17%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PK IPWT L P+R AAD      ++  DV  WPTNLGWVMGP  +++CFL GATL LY
Sbjct  282  GEPKVIPWTQLCPIRCAADTWAHLDLRPKDVDLWPTNLGWVMGPIQIFSCFLNGATLALY  341

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRI---------------  406
            HGSPL R F KFVQDA VS+LG+VPSLVK+WK+ +  +GLDWT+I               
Sbjct  342  HGSPLGRGFCKFVQDARVSVLGSVPSLVKSWKAGNLTQGLDWTKIRQVATYTVRKHSTSS  401

Query  405  ------------RVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQP  262
                        RV ATTGEAS++DD+LWL+SR  YKPIVECCGGTELAS+Y+ G LLQP
Sbjct  402  QAPLKKLNFYNRRVLATTGEASDIDDNLWLSSRTCYKPIVECCGGTELASSYIQGRLLQP  461

Query  261  QAFGTFSSASMAVDFVIC*E  202
            QAFG FS  SM+  FVI  E
Sbjct  462  QAFGAFSGPSMSTWFVILDE  481



>ref|XP_010262196.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X3 [Nelumbo nucifera]
Length=612

 Score =   219 bits (559),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 133/185 (72%), Gaps = 7/185 (4%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   G+PKAIPWTH +P++ AAD      +Q GDV  WPTNLGW+MGP LV
Sbjct  222  DAFTNILFSSGTTGEPKAIPWTHATPLKAAADAWCHMDIQKGDVVAWPTNLGWMMGPWLV  281

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+AWK+T+C  G DW+ IR 
Sbjct  282  YASLLNGASMALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKNTNCTAGFDWSSIRC  341

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F++TGEASNVD+ LWL  RA+YKP++E CGGTE+   +V+GSLLQ Q+   FS+ +M   
Sbjct  342  FSSTGEASNVDEYLWLMGRAHYKPVIEYCGGTEIGGGFVSGSLLQAQSLAAFSTPAMGCT  401

Query  219  -FVIC  208
             F++C
Sbjct  402  LFILC  406



>ref|XP_006661184.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
[Oryza brachyantha]
Length=656

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 133/186 (72%), Gaps = 7/186 (4%)
 Frame = -2

Query  747  HPDY-FTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGP  589
             P Y FT     S   G+PKAIPWTHL+P+++AAD      +Q GDV  WPTNLGW+MGP
Sbjct  282  QPAYAFTNILFSSGTTGEPKAIPWTHLTPLKSAADGWCHMDIQRGDVVAWPTNLGWMMGP  341

Query  588  TLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTR  409
             LVYA  L GA++ LY+GSP S  F KFVQDA V++LG VPS+ ++WKSTDC  G DW+ 
Sbjct  342  WLVYASLLNGASMALYNGSPNSSGFAKFVQDAKVTMLGLVPSIARSWKSTDCTAGFDWSN  401

Query  408  IRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            IR F+++GEAS+VDD LWL  RA YKP++E CGGTE+   +VAGSLLQPQA   FS+ +M
Sbjct  402  IRCFSSSGEASSVDDYLWLMGRACYKPVIEYCGGTEIGGGFVAGSLLQPQALSAFSTPAM  461

Query  228  AVDFVI  211
              +  I
Sbjct  462  GCNLFI  467



>ref|XP_010262187.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Nelumbo nucifera]
Length=742

 Score =   219 bits (558),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 133/185 (72%), Gaps = 7/185 (4%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   G+PKAIPWTH +P++ AAD      +Q GDV  WPTNLGW+MGP LV
Sbjct  354  DAFTNILFSSGTTGEPKAIPWTHATPLKAAADAWCHMDIQKGDVVAWPTNLGWMMGPWLV  413

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+AWK+T+C  G DW+ IR 
Sbjct  414  YASLLNGASMALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKNTNCTAGFDWSSIRC  473

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F++TGEASNVD+ LWL  RA+YKP++E CGGTE+   +V+GSLLQ Q+   FS+ +M   
Sbjct  474  FSSTGEASNVDEYLWLMGRAHYKPVIEYCGGTEIGGGFVSGSLLQAQSLAAFSTPAMGCT  533

Query  219  -FVIC  208
             F++C
Sbjct  534  LFILC  538



>ref|XP_010262177.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Nelumbo nucifera]
Length=744

 Score =   219 bits (558),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 133/185 (72%), Gaps = 7/185 (4%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   G+PKAIPWTH +P++ AAD      +Q GDV  WPTNLGW+MGP LV
Sbjct  354  DAFTNILFSSGTTGEPKAIPWTHATPLKAAADAWCHMDIQKGDVVAWPTNLGWMMGPWLV  413

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+AWK+T+C  G DW+ IR 
Sbjct  414  YASLLNGASMALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKNTNCTAGFDWSSIRC  473

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F++TGEASNVD+ LWL  RA+YKP++E CGGTE+   +V+GSLLQ Q+   FS+ +M   
Sbjct  474  FSSTGEASNVDEYLWLMGRAHYKPVIEYCGGTEIGGGFVSGSLLQAQSLAAFSTPAMGCT  533

Query  219  -FVIC  208
             F++C
Sbjct  534  LFILC  538



>gb|EMT23105.1| Acetyl-coenzyme A synthetase [Aegilops tauschii]
Length=657

 Score =   218 bits (554),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTHL+P++ AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  300  GEPKAIPWTHLTPLKAAADGWCHMDIRKGDVVAWPTNLGWMMGPWLVYASLLNGASMALY  359

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSP S  F KFVQDA V++LG VPS+V+ WK+TDC  G DW+ IR F++TGEAS+VDD 
Sbjct  360  NGSPNSSGFAKFVQDAKVTMLGVVPSIVRTWKNTDCTAGFDWSNIRCFSSTGEASSVDDY  419

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   ++ GSLLQPQA   FS+ +M  +  I
Sbjct  420  LWLMGRACYKPVIEYCGGTEIGGGFITGSLLQPQALSAFSTPAMGCNLFI  469



>dbj|BAJ95888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=722

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTHL+P++ AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  365  GEPKAIPWTHLTPLKAAADGWCHMDIRKGDVVAWPTNLGWMMGPWLVYASLLNGASMALY  424

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSP S  F KFVQDA V++LG VPS+V+ WKSTDC  G DW+ IR F++TGEAS+VDD 
Sbjct  425  NGSPNSSGFAKFVQDAKVTMLGVVPSIVRTWKSTDCTAGFDWSTIRCFSSTGEASSVDDY  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   ++ GSLLQPQA   FS+ +M  +  I
Sbjct  485  LWLMGRACYKPVIEYCGGTEIGGGFITGSLLQPQALSAFSTPAMGCNLFI  534



>ref|XP_002460162.1| hypothetical protein SORBIDRAFT_02g023690 [Sorghum bicolor]
 gb|EER96683.1| hypothetical protein SORBIDRAFT_02g023690 [Sorghum bicolor]
Length=722

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   G+PKAIPWTH++P++ AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  349  DAFTNILFSSGTTGEPKAIPWTHITPLKAAADGWCHMDIRKGDVVAWPTNLGWMMGPWLV  408

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSP S  F KFVQDA V++LG VPS+ + WK+TDC  GLDW+ IR 
Sbjct  409  YASLLNGASMALYNGSPNSSGFAKFVQDAKVTMLGLVPSIARTWKNTDCTAGLDWSSIRC  468

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F+++GEAS+VDD LWL  RA YKP++E CGGTE+   +V GSLLQPQA   FS+ +M  +
Sbjct  469  FSSSGEASSVDDYLWLMGRAGYKPVIEYCGGTEIGGGFVTGSLLQPQALSAFSTPAMGCN  528

Query  219  FVI  211
              I
Sbjct  529  LFI  531



>emb|CDY02201.1| BnaA03g39660D [Brassica napus]
Length=726

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT++SP+++AAD      V  GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  367  GDPKAIPWTNISPLKSAADAWCHLDVHQGDVVAWPTNLGWMMGPWLVYASLINGACMALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  427  NGSPLGPAFAKFVQDAEVTMLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL SRA+YKP++E CGGTE+  ++V GSLLQPQ+   FS+A+M     I  E
Sbjct  487  LWLMSRAHYKPVIEYCGGTEIGGSFVTGSLLQPQSLAAFSTATMGCKLFILGE  539



>ref|XP_009136395.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Brassica 
rapa]
Length=725

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT++SP+++AAD      V  GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  366  GDPKAIPWTNISPLKSAADAWCHLDVHQGDVVAWPTNLGWMMGPWLVYASLINGACMALY  425

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  426  NGSPLGPAFAKFVQDAEVTMLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  485

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL SRA+YKP++E CGGTE+  ++V GSLLQPQ+   FS+A+M     I  E
Sbjct  486  LWLMSRAHYKPVIEYCGGTEIGGSFVTGSLLQPQSLAAFSTATMGCKLFILGE  538



>gb|ACR34509.1| unknown [Zea mays]
 tpg|DAA61278.1| TPA: catalytic/ ligase [Zea mays]
Length=722

 Score =   216 bits (549),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = -2

Query  747  HPDY-FTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGP  589
             P Y FT     S   G+PKAIPWTH++P++ AAD      ++ GDV  WPTNLGW+MGP
Sbjct  346  QPAYAFTNILFSSGTTGEPKAIPWTHITPLKAAADGWCHMDIRKGDVVAWPTNLGWMMGP  405

Query  588  TLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTR  409
             LVYA  L GA++ LY+GSP S  F KFVQDA V++LG VPS+V+ WK+TDC  GLDW+ 
Sbjct  406  WLVYASLLNGASMALYNGSPNSSGFAKFVQDAKVTMLGLVPSIVRTWKNTDCTAGLDWSS  465

Query  408  IRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            IR F+++GEAS+VDD LWL  RA YKP++E CGGTE+   +V GS+LQPQA   FS+ +M
Sbjct  466  IRCFSSSGEASSVDDYLWLMGRAGYKPVIEYCGGTEIGGGFVTGSMLQPQALSAFSTPAM  525

Query  228  AVDFVI  211
              +  I
Sbjct  526  GCNLFI  531



>gb|AAP03027.1| acyl-activating enzyme 17 [Arabidopsis thaliana]
Length=658

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 130/173 (75%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      VQ GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  299  GEPKAIPWTNISPLKSAADAWCHLDVQQGDVVAWPTNLGWMMGPWLVYASLINGACMGLY  358

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA VS+LG +PS+V+ W++++   G DW+RIR F +TGEASN+D+ 
Sbjct  359  NGSPLGPTFAKFVQDAEVSVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNIDEY  418

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  ++++GSLLQPQ+   FS+A+M     I  E
Sbjct  419  LWLMGRAHYKPVIEYCGGTEIGGSFISGSLLQPQSLAAFSTAAMGCKLFILGE  471



>ref|XP_003576487.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Brachypodium 
distachyon]
Length=722

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 134/196 (68%), Gaps = 12/196 (6%)
 Frame = -2

Query  762  SKCDIHPDYFTK*FRFSYL------DGDPKAIPWTHLSPMRTAAD------VQAGDVYCW  619
            +K DI+       + FS +       G+PKAIPWTHL+P++ AAD      ++ GDV  W
Sbjct  339  TKADIYTTVEQPVYEFSNILFSSGTTGEPKAIPWTHLTPLKAAADGWCHMDIRKGDVVAW  398

Query  618  PTNLGWVMGPTLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKST  439
            PTNLGW+MGP LVYA  L GA++ LY+GSP S  F KFVQDA V++LG VPS+V+ WK+T
Sbjct  399  PTNLGWMMGPWLVYASLLNGASMALYNGSPNSSGFAKFVQDAKVTMLGVVPSIVRTWKNT  458

Query  438  DCMKGLDWTRIRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQ  259
            DC  G DW+ IR F++TGEAS+VDD LWL  RA YKP++E CGGTE+   ++ G LLQPQ
Sbjct  459  DCTAGFDWSTIRCFSSTGEASSVDDYLWLMGRACYKPVIEYCGGTEIGGGFITGCLLQPQ  518

Query  258  AFGTFSSASMAVDFVI  211
            A   FS+ +M  +  I
Sbjct  519  ALSAFSTPAMGCNLFI  534



>ref|XP_007037741.1| Acyl-activating enzyme 17 [Theobroma cacao]
 gb|EOY22242.1| Acyl-activating enzyme 17 [Theobroma cacao]
Length=726

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTH++P++ AAD      + +GD+  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  367  GEPKAIPWTHVTPLKAAADAWCHMDIHSGDIVAWPTNLGWMMGPWLVYASLLNGASMALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPLS    KFVQDA V++LG +PS+V+AWKST+C+ G DW+ IR F++TGEASNVD+ 
Sbjct  427  NGSPLSSGLAKFVQDAKVTMLGVIPSIVRAWKSTNCVAGYDWSSIRCFSSTGEASNVDEY  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V+GS LQPQ+   FS+ +M     I
Sbjct  487  LWLMGRACYKPIIEYCGGTEIGGGFVSGSFLQPQSLAAFSTPAMGCRLFI  536



>dbj|BAB09822.1| acetyl-CoA synthetase-like protein [Arabidopsis thaliana]
Length=668

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 130/173 (75%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      VQ GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  309  GEPKAIPWTNISPLKSAADAWCHLDVQRGDVVAWPTNLGWMMGPWLVYASLINGACMGLY  368

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA VS+LG +PS+V+ W++++   G DW+RIR F +TGEASN+D+ 
Sbjct  369  NGSPLGPTFAKFVQDAEVSVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNIDEY  428

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  ++++GSLLQPQ+   FS+A+M     I  E
Sbjct  429  LWLMGRAHYKPVIEYCGGTEIGGSFISGSLLQPQSLAAFSTAAMGCKLFILDE  481



>gb|EEC84495.1| hypothetical protein OsI_31179 [Oryza sativa Indica Group]
Length=544

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 7/186 (4%)
 Frame = -2

Query  747  HPDY-FTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGP  589
             P Y FT     S   G+PKAIPWTHL+P+++AAD      ++ GDV  WPTNLGW+MGP
Sbjct  170  QPAYAFTNILFSSGTTGEPKAIPWTHLTPLKSAADGWCHMDIRRGDVVAWPTNLGWMMGP  229

Query  588  TLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTR  409
             LVYA  L GA++ LY+GS  S  F KFVQDA V++LG VPS+ ++WKSTDC  G DW+ 
Sbjct  230  WLVYASLLNGASMALYNGSLNSSGFAKFVQDAKVTMLGLVPSIARSWKSTDCTAGFDWST  289

Query  408  IRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            IR F+++GEAS+VDD LWL  R  YKP++E CGGTE+   +VAGSLLQPQA   FS+ +M
Sbjct  290  IRCFSSSGEASSVDDYLWLMGRVCYKPVIEYCGGTEIGGGFVAGSLLQPQALSAFSTPAM  349

Query  228  AVDFVI  211
              +  I
Sbjct  350  GCNLFI  355



>ref|NP_197696.2| acyl-activating enzyme 17 [Arabidopsis thaliana]
 sp|F4KBF3.1|AAE17_ARATH RecName: Full=Probable acyl-activating enzyme 17, peroxisomal 
[Arabidopsis thaliana]
 gb|AED93113.1| acyl-activating enzyme 17 [Arabidopsis thaliana]
Length=721

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 130/173 (75%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      VQ GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  362  GEPKAIPWTNISPLKSAADAWCHLDVQRGDVVAWPTNLGWMMGPWLVYASLINGACMGLY  421

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA VS+LG +PS+V+ W++++   G DW+RIR F +TGEASN+D+ 
Sbjct  422  NGSPLGPTFAKFVQDAEVSVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNIDEY  481

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  ++++GSLLQPQ+   FS+A+M     I  E
Sbjct  482  LWLMGRAHYKPVIEYCGGTEIGGSFISGSLLQPQSLAAFSTAAMGCKLFILDE  534



>ref|XP_010546235.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Tarenaya 
hassleriana]
Length=721

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAI WT+ +P+++AAD      VQ  DV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  363  GEPKAIVWTNNAPLKSAADAWCHMDVQRSDVVAWPTNLGWMMGPWLVYASLMNGACMALY  422

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V+ILG +PSLV+ WK+++C  G DW+RIR F +TGEASNVD++
Sbjct  423  NGSPLGSGFAKFVQDAEVTILGVIPSLVRTWKNSNCTSGYDWSRIRCFGSTGEASNVDEN  482

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+   +V+GSLLQPQ+   FS+A+M  +  I  E
Sbjct  483  LWLMGRAHYKPVIEYCGGTEIGGGFVSGSLLQPQSLSAFSTAAMGCELFILNE  535



>ref|NP_001152332.1| catalytic/ ligase [Zea mays]
 gb|ACG47087.1| catalytic/ ligase [Zea mays]
Length=722

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = -2

Query  747  HPDY-FTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGP  589
             P Y FT     S   G+PKAIPWTH++P++ AAD      ++ GDV  WPTNLGW+MGP
Sbjct  346  QPAYAFTNILFSSGTTGEPKAIPWTHITPLKAAADGWCHMDIRKGDVVAWPTNLGWMMGP  405

Query  588  TLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTR  409
             LVYA  L GA++ LY+GSP S  F KFV+DA V++LG VPS+V+ WK+TDC  GLDW+ 
Sbjct  406  WLVYASLLNGASMALYNGSPNSSGFAKFVEDAKVTMLGLVPSIVRTWKNTDCTAGLDWSS  465

Query  408  IRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            IR F+++GEAS+VDD LWL  RA YKP++E CGGTE+   +V GS+LQPQA   FS+ +M
Sbjct  466  IRCFSSSGEASSVDDYLWLMGRAGYKPVIEYCGGTEIGGGFVTGSMLQPQALSAFSTPAM  525

Query  228  AVDFVI  211
              +  I
Sbjct  526  GCNLFI  531



>ref|XP_004956718.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
[Setaria italica]
Length=726

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 7/186 (4%)
 Frame = -2

Query  747  HPDY-FTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGP  589
             P Y FT     S   G+PKAIPWTH++P++ AAD      ++ GDV  WPTNLGW+MGP
Sbjct  350  QPAYAFTNILFSSGTTGEPKAIPWTHITPLKAAADGWCHMDIRKGDVVVWPTNLGWMMGP  409

Query  588  TLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTR  409
             LVYA  L GA++ LY+GSP S  F KFVQDA V++LG VPS+ + WK+TDC  G DW+ 
Sbjct  410  WLVYASLLNGASMALYNGSPNSSGFAKFVQDAKVTMLGLVPSIARTWKNTDCTAGFDWSA  469

Query  408  IRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            IR F+++GEAS+VDD LWL  RA YKP++E CGGTE+   +VAGSLLQPQA   FS+ +M
Sbjct  470  IRCFSSSGEASSVDDYLWLMGRACYKPVIEYCGGTEIGGGFVAGSLLQPQALSAFSTPAM  529

Query  228  AVDFVI  211
              +  I
Sbjct  530  GCNLFI  535



>gb|EMS59847.1| Acetyl-coenzyme A synthetase [Triticum urartu]
Length=673

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTHL+P++ AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  316  GEPKAIPWTHLTPLKAAADGWCHMDIRKGDVVAWPTNLGWMMGPWLVYASLLNGASMALY  375

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSP S  F KFVQDA V++LG VPS+V+ WK+TD   G DW+ IR F++TGEAS+VDD 
Sbjct  376  NGSPNSSGFAKFVQDAKVTMLGVVPSIVRTWKNTDGTAGFDWSNIRCFSSTGEASSVDDY  435

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   ++ GSLLQPQA   FS+ +M  +  I
Sbjct  436  LWLMGRACYKPVIEYCGGTEIGGGFITGSLLQPQALSAFSTPAMGCNLFI  485



>ref|XP_009407243.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Musa 
acuminata subsp. malaccensis]
Length=718

 Score =   214 bits (544),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 129/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPW H +P++ AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  349  EAFTNILFSSGTTGEPKAIPWRHATPLKAAADAWAHMDIRKGDVVAWPTNLGWMMGPWLV  408

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  + GA++ LY+G PL   F KFVQDA V++LG VPS+V+AWK+T+C  GL+W+ IR 
Sbjct  409  YASLINGASMALYNGIPLGSGFAKFVQDARVTMLGVVPSIVRAWKNTNCTMGLNWSAIRC  468

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F++TGEAS+VDD LWL  RAYYKP++E CGGTE+   +V GSLLQPQA   FS+ +M   
Sbjct  469  FSSTGEASSVDDYLWLMGRAYYKPVIEYCGGTEIGGGFVTGSLLQPQALAAFSTPAMGCK  528

Query  219  FVI  211
              I
Sbjct  529  LFI  531



>ref|XP_010318903.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X3 [Solanum lycopersicum]
Length=618

 Score =   212 bits (539),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 124/173 (72%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      +   DV  WPTNLGW+MGP L+Y+  L GAT+ LY
Sbjct  365  GEPKAIPWTASSPLRAAADGWSHLNIGKDDVVAWPTNLGWMMGPLLIYSTLLNGATMALY  424

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG VPS+V+AWKST+C  G DW+ I  FA+TGEAS VD+ 
Sbjct  425  NGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKSTNCTAGYDWSSICHFASTGEASGVDES  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+   +VAGSLLQPQ+   FS+A+M     I  E
Sbjct  485  LWLMGRAHYKPVIEICGGTEIGGGFVAGSLLQPQSLSAFSTAAMGCSLFILGE  537



>gb|KEH38022.1| acyl-activating enzyme 17, peroxisomal protein, putative [Medicago 
truncatula]
Length=726

 Score =   213 bits (543),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+++P++ AAD      V+ GDV CWPTNLGW+MGP LV
Sbjct  354  ETFTNILFSSGTTGDPKAIPWTNITPLKAAADAWCHMDVRKGDVVCWPTNLGWMMGPWLV  413

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG +PSLV++W++ +   G DW+ IR 
Sbjct  414  YASLLNGASMALYNGSPLGSGFAKFVQDAKVTMLGVIPSLVRSWRNANSTSGYDWSAIRC  473

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            FA+TGEASNVD+ LWL  RA+YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M  +
Sbjct  474  FASTGEASNVDEYLWLMGRAHYKPIIEYCGGTEIGGGFVTGSLLQAQSLAAFSTPAMCCN  533

Query  219  FVI  211
              I
Sbjct  534  LFI  536



>ref|XP_010493417.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Camelina 
sativa]
Length=722

 Score =   213 bits (543),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V  GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  362  GEPKAIPWTNISPLKSAADAWCHLDVHRGDVIAWPTNLGWMMGPWLVYASLINGACMGLY  421

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA VS+LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  422  NGSPLGPAFAKFVQDAEVSVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  481

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL SRA+YKP++E CGGTE+   ++ GSLLQPQ+   FS+A+M     I  E
Sbjct  482  LWLMSRAHYKPVIEYCGGTEIGGAFITGSLLQPQSLSAFSTAAMGCKLFILGE  534



>ref|XP_006289863.1| hypothetical protein CARUB_v10003474mg [Capsella rubella]
 gb|EOA22761.1| hypothetical protein CARUB_v10003474mg [Capsella rubella]
Length=723

 Score =   213 bits (542),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V  GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  364  GEPKAIPWTNISPLKSAADAWCHLDVHRGDVIAWPTNLGWMMGPWLVYASLINGACMGLY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  424  NGSPLGPAFAKFVQDAEVTVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  +++AGSLLQPQ+   FS+A+M     I  E
Sbjct  484  LWLMGRAHYKPVIEYCGGTEIGGSFIAGSLLQPQSLAAFSTAAMGCKLFILGE  536



>ref|XP_010424243.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal, partial 
[Camelina sativa]
Length=589

 Score =   211 bits (537),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V+ GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  229  GEPKAIPWTNISPLKSAADAWCHLDVRRGDVIAWPTNLGWMMGPWLVYASLINGACMGLY  288

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA VS LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  289  NGSPLGPAFAKFVQDAEVSALGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  348

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  +++ GSLLQPQ+   FS+A+M     I  E
Sbjct  349  LWLMGRAHYKPVIEYCGGTEIGGSFITGSLLQPQSLSAFSTAAMGCKLFILGE  401



>ref|XP_004236096.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Solanum lycopersicum]
Length=721

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 124/173 (72%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      +   DV  WPTNLGW+MGP L+Y+  L GAT+ LY
Sbjct  364  GEPKAIPWTASSPLRAAADGWSHLNIGKDDVVAWPTNLGWMMGPLLIYSTLLNGATMALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG VPS+V+AWKST+C  G DW+ I  FA+TGEAS VD+ 
Sbjct  424  NGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKSTNCTAGYDWSSICHFASTGEASGVDES  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+   +VAGSLLQPQ+   FS+A+M     I  E
Sbjct  484  LWLMGRAHYKPVIEICGGTEIGGGFVAGSLLQPQSLSAFSTAAMGCSLFILGE  536



>ref|XP_010318902.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Solanum lycopersicum]
Length=722

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 124/173 (72%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  SP+R AAD      +   DV  WPTNLGW+MGP L+Y+  L GAT+ LY
Sbjct  365  GEPKAIPWTASSPLRAAADGWSHLNIGKDDVVAWPTNLGWMMGPLLIYSTLLNGATMALY  424

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG VPS+V+AWKST+C  G DW+ I  FA+TGEAS VD+ 
Sbjct  425  NGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKSTNCTAGYDWSSICHFASTGEASGVDES  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+   +VAGSLLQPQ+   FS+A+M     I  E
Sbjct  485  LWLMGRAHYKPVIEICGGTEIGGGFVAGSLLQPQSLSAFSTAAMGCSLFILGE  537



>emb|CDY62679.1| BnaCnng40810D [Brassica napus]
Length=724

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAADV------QAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT++SP+++AAD         GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  365  GDPKAIPWTNISPLKSAADAWCHLDAHQGDVVAWPTNLGWMMGPWLVYASLINGACMALY  424

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F++TGEASN D+ 
Sbjct  425  NGSPLGPAFAKFVQDAEVTMLGVIPSIVRTWQNSNSTSGYDWSRIRCFSSTGEASNEDEY  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL SRA+YKP++E CGGTE+  ++V GSLLQPQ+   FS+A+M     I  E
Sbjct  485  LWLMSRAHYKPVIEYCGGTEIGGSFVTGSLLQPQSLAAFSTATMGCKLFILGE  537



>ref|XP_010695782.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Beta 
vulgaris subsp. vulgaris]
Length=718

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 126/177 (71%), Gaps = 6/177 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G PKAIPWTH +P++ AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  346  ESFTNILFSSGTTGKPKAIPWTHATPIKAAADAWCHMDIRKGDVVAWPTNLGWMMGPWLV  405

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YAC +  A++ LY+GSPLS  F KFVQDA V++LG VPS+V+AWKST+C  G DW+ IR 
Sbjct  406  YACLINNASIALYNGSPLSSGFSKFVQDANVTMLGVVPSIVRAWKSTNCTAGYDWSCIRC  465

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            F +TGEAS+VD+ LWL  RA YKP++E CGGTE+   ++ GSLLQPQ    FS+ +M
Sbjct  466  FGSTGEASSVDEYLWLMGRASYKPVIEICGGTEIGGGFITGSLLQPQVLAAFSTPAM  522



>ref|XP_006597961.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X2 [Glycine max]
Length=589

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+++P++ AAD      V+ GDV CWPTNLGW+MGP LV
Sbjct  217  ETFTNILFSSGTTGDPKAIPWTNITPLKAAADAWCHMDVRKGDVVCWPTNLGWMMGPWLV  276

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY GSPL   F KFVQDA V++LG +PS+V++W+ST+   G DW+ IR 
Sbjct  277  YASLLNGASMALYIGSPLGSGFAKFVQDAKVTMLGVIPSIVRSWRSTNSTSGYDWSSIRC  336

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  337  FGSTGEASNVDEYLWLMGRALYKPIIEYCGGTEIGGGFVCGSLLQAQSLAAFSTPAMCCS  396

Query  219  FVI  211
              I
Sbjct  397  LFI  399



>ref|XP_006602416.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X2 [Glycine max]
Length=589

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+++P++ AAD      V+ GDV CWPTNLGW+MGP LV
Sbjct  217  ETFTNILFSSGTTGDPKAIPWTNITPLKAAADAWCHMDVRKGDVVCWPTNLGWMMGPWLV  276

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY GSPL  +F KFVQDA V++LG +PS+V++W+ST+   G DW+ IR 
Sbjct  277  YASLLNGASVALYIGSPLGSAFAKFVQDAKVTMLGVIPSIVRSWRSTNSTSGYDWSSIRC  336

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  337  FGSTGEASNVDEYLWLMGRALYKPIIEYCGGTEIGGGFVCGSLLQAQSLAAFSTPAMCCS  396

Query  219  FVI  211
              I
Sbjct  397  LFI  399



>ref|XP_010913588.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Elaeis guineensis]
Length=588

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAI WTH++P++ AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  216  EAFTNILFSSGTTGEPKAISWTHVTPLKAAADAWSHMDIRKGDVVAWPTNLGWMMGPWLV  275

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+AWK+++C  GLDW+ IR 
Sbjct  276  YASLLNGASMALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKNSNCTAGLDWSTIRC  335

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F++TGEAS+VD+ LWL  RA+YKP++E CGGTE+   ++ GSLLQ QA   FS+ +M   
Sbjct  336  FSSTGEASSVDEYLWLMGRAHYKPVIEYCGGTEIGGGFICGSLLQSQALAAFSTPAMGCT  395

Query  219  FVI  211
              I
Sbjct  396  LFI  398



>ref|XP_009607866.1| PREDICTED: LOW QUALITY PROTEIN: probable acyl-activating enzyme 
17, peroxisomal [Nicotiana tomentosiformis]
Length=767

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 131/190 (69%), Gaps = 6/190 (3%)
 Frame = -2

Query  753  DIHPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMG  592
            ++  + FT     S   G+PKAIPWT  +P++ AAD      ++ GDV  WPTNLGW+MG
Sbjct  393  ELPAEAFTNILFSSGTTGEPKAIPWTTTTPLKAAADGWSHLNIRKGDVVAWPTNLGWMMG  452

Query  591  PTLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWT  412
            P L+Y   L GAT+ LY+GSPL   F KFVQDA V++LG VPS+V+ WKST+C+ G DW+
Sbjct  453  PFLIYCTLLNGATMALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCIAGHDWS  512

Query  411  RIRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSAS  232
             I  FA+TGEAS VD+ LWL  RA+YKP++E CGGTE+   ++AGSLLQPQ+   FS+A+
Sbjct  513  AICRFASTGEASGVDESLWLMGRAHYKPVIEICGGTEIGGGFIAGSLLQPQSLSAFSTAA  572

Query  231  MAVDFVIC*E  202
            M     I  E
Sbjct  573  MGCSLFIIGE  582



>ref|XP_002874109.1| acyl-activating enzyme 17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50368.1| acyl-activating enzyme 17 [Arabidopsis lyrata subsp. lyrata]
Length=721

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V  GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  362  GEPKAIPWTNISPLKSAADAWCHLDVHRGDVVAWPTNLGWMMGPWLVYASLINGACMALY  421

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F +TGEASN+D+ 
Sbjct  422  NGSPLGPTFAKFVQDAEVTVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNIDEY  481

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  ++++GSLLQPQ+   FS+A M     I  E
Sbjct  482  LWLMGRAHYKPVIEYCGGTEIGGSFISGSLLQPQSLAAFSTAVMGCKLFILGE  534



>gb|AFD33356.1| acyl-activating enzyme 12 [Cannabis sativa]
Length=757

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  +P + AAD      +Q GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  398  GEPKAIPWTQATPFKAAADAWCHMDIQKGDVVAWPTNLGWMMGPWLVYASLLNGASIALY  457

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WKST+C+ G DW+ IR F++TGEASN+D+ 
Sbjct  458  NGSPLGSGFAKFVQDAKVTMLGVIPSIVRTWKSTNCVAGYDWSTIRCFSSTGEASNIDEY  517

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RAYYKP++E CGGTE+   +V GSLLQ Q+   FS+ +M     I
Sbjct  518  LWLMGRAYYKPVIEYCGGTEIGGGFVTGSLLQAQSLAAFSTPAMGCSLFI  567



>gb|KHF98232.1| putative acyl-activating enzyme 17, peroxisomal -like protein 
[Gossypium arboreum]
Length=725

 Score =   211 bits (538),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT+ SP + AAD      ++ GD+  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  366  GEPKAIPWTNGSPFKAAADAWCHMDIRKGDIVAWPTNLGWMMGPWLVYASLLNGASMALY  425

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPLS  F KFVQDA V++LG +PS+V+ WKSTDC+ G DW+ IR F++TGEASNVD+ 
Sbjct  426  NGSPLSSGFSKFVQDAKVTMLGVIPSIVRTWKSTDCIAGYDWSSIRCFSSTGEASNVDEY  485

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   +V+GS LQPQ+   FS++ M     I
Sbjct  486  LWLMGRACYKPVIEYCGGTEIGGGFVSGSFLQPQSLAAFSTSVMGCRLFI  535



>gb|EAZ44562.1| hypothetical protein OsJ_29182 [Oryza sativa Japonica Group]
Length=731

 Score =   211 bits (538),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 7/186 (4%)
 Frame = -2

Query  747  HPDY-FTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGP  589
             P Y FT     S   G+PKAIPWTHL+P+++AAD      ++ GDV  WPTNLGW+MGP
Sbjct  357  QPAYAFTNILFSSGTTGEPKAIPWTHLTPLKSAADGWCHMDIRRGDVVAWPTNLGWMMGP  416

Query  588  TLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTR  409
             LVYA  L GA++ LY+GS  S  F KFVQDA V++LG VPS+ ++WKSTDC  G DW+ 
Sbjct  417  WLVYASLLNGASMALYNGSLNSSGFAKFVQDAKVTMLGLVPSIARSWKSTDCTAGFDWST  476

Query  408  IRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            IR F+++GEAS+VDD LWL  R  YKP++E CGGTE+   +VAGSLLQPQA   FS+ +M
Sbjct  477  IRCFSSSGEASSVDDYLWLMGRVCYKPVIEYCGGTEIGGGFVAGSLLQPQALSAFSTPAM  536

Query  228  AVDFVI  211
              +  I
Sbjct  537  GCNLFI  542



>ref|XP_008782051.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Phoenix dactylifera]
Length=587

 Score =   209 bits (532),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWTH +P++ AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  215  EAFTNILFSSGTTGEPKAIPWTHATPLKAAADAWSHMDIRKGDVVAWPTNLGWMMGPWLV  274

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+AWK + C  GLDW+ IR 
Sbjct  275  YATLLNGASMALYNGSPLGSGFAKFVQDAKVTMLGVVPSVVRAWKDSCCTAGLDWSTIRC  334

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F++TGEAS+VD+ LWL  RA+YKP++E CGGTE+   ++ GSLLQ QA   FS+ +M   
Sbjct  335  FSSTGEASSVDEYLWLMGRAHYKPVIEYCGGTEIGGGFICGSLLQSQALAAFSTPAMGCT  394

Query  219  FVI  211
              I
Sbjct  395  LFI  397



>ref|XP_006394570.1| hypothetical protein EUTSA_v10003719mg [Eutrema salsugineum]
 gb|ESQ31856.1| hypothetical protein EUTSA_v10003719mg [Eutrema salsugineum]
Length=599

 Score =   209 bits (532),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 127/173 (73%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V   DV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  364  GEPKAIPWTNISPLKSAADAWCHLDVHREDVIAWPTNLGWMMGPWLVYASLINGACMALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  424  NGSPLGPAFAKFVQDAEVTVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  +++ GSLLQPQ+   FS+A+M     I  E
Sbjct  484  LWLMGRAHYKPVIEYCGGTEIGGSFITGSLLQPQSLAAFSTAAMGCKLFILGE  536



>emb|CDY23710.1| BnaC01g24110D [Brassica napus]
Length=951

 Score =   212 bits (540),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V  GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  366  GEPKAIPWTNISPLKSAADAWCHMDVHQGDVVAWPTNLGWMMGPWLVYASLINGACMALY  425

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSP   +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  426  NGSPPGPAFAKFVQDAEVTMLGVIPSIVRTWQNSNSTSGFDWSRIRCFGSTGEASNVDEY  485

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL SRA+YKP++E CGGTE+  ++V GSLLQPQ+   FS+A+M     I  E
Sbjct  486  LWLMSRAHYKPVIEYCGGTEIGGSFVTGSLLQPQSLAAFSTAAMGCKLFILGE  538



>emb|CBI15386.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT+ +P++ AAD      ++ GD+  WPTNLGW+MGP LVYA  L GAT+ LY
Sbjct  303  GEPKAIPWTNATPLKAAADAWCHMDIRKGDIVAWPTNLGWMMGPWLVYASLLNGATIALY  362

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +G+PL   F KFVQDA V++LG +PS+V+ WKST+C  GLDW+ IR FA+TGEAS+VD+ 
Sbjct  363  NGAPLGSGFAKFVQDAKVTMLGVIPSIVRTWKSTNCTAGLDWSSIRCFASTGEASSVDEY  422

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+  +FS+ +M     I
Sbjct  423  LWLMGRAQYKPIIEYCGGTEIGGGFVTGSLLQAQSLASFSTPAMGCSLFI  472



>ref|XP_006394571.1| hypothetical protein EUTSA_v10003719mg [Eutrema salsugineum]
 gb|ESQ31857.1| hypothetical protein EUTSA_v10003719mg [Eutrema salsugineum]
Length=723

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 127/173 (73%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V   DV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  364  GEPKAIPWTNISPLKSAADAWCHLDVHREDVIAWPTNLGWMMGPWLVYASLINGACMALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  424  NGSPLGPAFAKFVQDAEVTVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+  +++ GSLLQPQ+   FS+A+M     I  E
Sbjct  484  LWLMGRAHYKPVIEYCGGTEIGGSFITGSLLQPQSLAAFSTAAMGCKLFILGE  536



>ref|XP_010454585.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Camelina 
sativa]
Length=722

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 127/173 (73%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT++SP+++AAD      V+ GDV  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  362  GEPKAIPWTNISPLKSAADAWCHLDVRRGDVIAWPTNLGWMMGPWLVYASLINGACMGLY  421

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F  FVQDA VS+LG +PS+V+ W++++   G DW+RIR F +TGEASNVD+ 
Sbjct  422  NGSPLGPAFANFVQDAEVSVLGVIPSIVRTWQNSNSTSGYDWSRIRCFGSTGEASNVDEY  481

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+   ++ GSLLQPQ+   FS+A+M     I  E
Sbjct  482  LWLMGRAHYKPVIEYCGGTEIGGAFITGSLLQPQSLSAFSTAAMGCKLFILGE  534



>gb|KHN45999.1| Putative acyl-activating enzyme 17, peroxisomal [Glycine soja]
Length=661

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+++P++ AAD      V+ GDV CWPTNLGW+MGP LV
Sbjct  289  ETFTNILFSSGTTGDPKAIPWTNITPLKAAADAWCHMDVRKGDVVCWPTNLGWMMGPWLV  348

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY GSPL  +F KFVQDA V++LG +PS+V++W+ST+   G DW+ IR 
Sbjct  349  YASLLNGASVALYIGSPLGSAFAKFVQDAKVTMLGVIPSIVRSWRSTNSTSGYDWSSIRC  408

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  409  FGSTGEASNVDEYLWLMGRALYKPIIEYCGGTEIGGGFVCGSLLQAQSLAAFSTPAMCCS  468

Query  219  FVI  211
              I
Sbjct  469  LFI  471



>ref|XP_010913587.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Elaeis guineensis]
Length=721

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAI WTH++P++ AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  362  GEPKAISWTHVTPLKAAADAWSHMDIRKGDVVAWPTNLGWMMGPWLVYASLLNGASMALY  421

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG VPS+V+AWK+++C  GLDW+ IR F++TGEAS+VD+ 
Sbjct  422  NGSPLGSGFAKFVQDAKVTMLGVVPSIVRAWKNSNCTAGLDWSTIRCFSSTGEASSVDEY  481

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA+YKP++E CGGTE+   ++ GSLLQ QA   FS+ +M     I
Sbjct  482  LWLMGRAHYKPVIEYCGGTEIGGGFICGSLLQSQALAAFSTPAMGCTLFI  531



>ref|XP_006374381.1| acyl-activating enzyme 17 family protein [Populus trichocarpa]
 gb|ERP52178.1| acyl-activating enzyme 17 family protein [Populus trichocarpa]
Length=730

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTHL+P + AAD      ++ GD+  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  371  GEPKAIPWTHLTPFKAAADAWCHMDIRKGDIVAWPTNLGWMMGPWLVYASLLNGASIALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WKS +   G DW+ IR FA+TGEAS+VD+ 
Sbjct  431  NGSPLGSGFAKFVQDASVTMLGVIPSIVRIWKSANSTSGYDWSAIRCFASTGEASSVDEY  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V+GSLLQPQ+   FS+ +M     I
Sbjct  491  LWLMGRAQYKPIIEYCGGTEIGGGFVSGSLLQPQSLAAFSTPAMGCSLFI  540



>ref|XP_006345069.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X2 [Solanum tuberosum]
Length=719

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 123/172 (72%), Gaps = 5/172 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD-----VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYH  538
            G+PKAIPWT  +P+R AAD     +   DV  WPTNLGW+MGP L+Y+  L GAT+ LY+
Sbjct  363  GEPKAIPWTATTPLRAAADGWSLNIGKDDVVAWPTNLGWMMGPWLIYSTLLNGATMALYN  422

Query  537  GSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDL  358
            GSPL   F KFVQDA V++LG VPS+V+AWKST+C  G DW+ I  FA+TGEAS VD+ L
Sbjct  423  GSPLGAGFAKFVQDAKVTMLGVVPSIVRAWKSTNCTAGYDWSSICHFASTGEASGVDESL  482

Query  357  WLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            WL  RA YKPI+E CGGTE+   ++AGSLLQPQ+   FS+A+M     I  E
Sbjct  483  WLMGRAQYKPIIEICGGTEIGGGFIAGSLLQPQSLSAFSTAAMGCSLFILGE  534



>ref|XP_006345068.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X1 [Solanum tuberosum]
Length=720

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 123/172 (72%), Gaps = 5/172 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD-----VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLYH  538
            G+PKAIPWT  +P+R AAD     +   DV  WPTNLGW+MGP L+Y+  L GAT+ LY+
Sbjct  364  GEPKAIPWTATTPLRAAADGWSLNIGKDDVVAWPTNLGWMMGPWLIYSTLLNGATMALYN  423

Query  537  GSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDDL  358
            GSPL   F KFVQDA V++LG VPS+V+AWKST+C  G DW+ I  FA+TGEAS VD+ L
Sbjct  424  GSPLGAGFAKFVQDAKVTMLGVVPSIVRAWKSTNCTAGYDWSSICHFASTGEASGVDESL  483

Query  357  WLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            WL  RA YKPI+E CGGTE+   ++AGSLLQPQ+   FS+A+M     I  E
Sbjct  484  WLMGRAQYKPIIEICGGTEIGGGFIAGSLLQPQSLSAFSTAAMGCSLFILGE  535



>ref|XP_011008796.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Populus 
euphratica]
Length=730

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTHL+P + AAD      ++ GD+  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  371  GEPKAIPWTHLTPFKAAADAWCHMDIRKGDIVAWPTNLGWMMGPWLVYASLLNGASIALY  430

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WKS +   G DW+ IR FA+TGEAS+VD+ 
Sbjct  431  NGSPLGSGFAKFVQDARVTMLGVIPSIVRVWKSANSTSGYDWSAIRCFASTGEASSVDEY  490

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V+GSLLQPQ+   FS+ +M     I
Sbjct  491  LWLMGRAQYKPIIEYCGGTEIGGGFVSGSLLQPQSLAAFSTPAMGCSLFI  540



>gb|KHN28323.1| Putative acyl-activating enzyme 17, peroxisomal [Glycine soja]
Length=744

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+++P++ AAD      V+ GDV CWPTNLGW+MGP LV
Sbjct  372  ETFTNILFSSGTTGDPKAIPWTNITPLKAAADAWCHMDVRKGDVVCWPTNLGWMMGPWLV  431

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY GSPL   F KFVQDA V++LG +PS+V++W+ST+   G DW+ IR 
Sbjct  432  YASLLNGASMALYIGSPLGSGFAKFVQDAKVTMLGVIPSIVRSWRSTNSTSGYDWSSIRC  491

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  492  FGSTGEASNVDEYLWLMGRALYKPIIEYCGGTEIGGGFVCGSLLQAQSLAAFSTPAMCCS  551

Query  219  FVI  211
              I
Sbjct  552  LFI  554



>ref|XP_003546618.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X1 [Glycine max]
Length=744

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+++P++ AAD      V+ GDV CWPTNLGW+MGP LV
Sbjct  372  ETFTNILFSSGTTGDPKAIPWTNITPLKAAADAWCHMDVRKGDVVCWPTNLGWMMGPWLV  431

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY GSPL   F KFVQDA V++LG +PS+V++W+ST+   G DW+ IR 
Sbjct  432  YASLLNGASMALYIGSPLGSGFAKFVQDAKVTMLGVIPSIVRSWRSTNSTSGYDWSSIRC  491

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  492  FGSTGEASNVDEYLWLMGRALYKPIIEYCGGTEIGGGFVCGSLLQAQSLAAFSTPAMCCS  551

Query  219  FVI  211
              I
Sbjct  552  LFI  554



>ref|XP_002512007.1| acetyl-CoA synthetase, putative [Ricinus communis]
 gb|EEF50676.1| acetyl-CoA synthetase, putative [Ricinus communis]
Length=722

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW + +P++ AAD      ++ GD+  WPTNLGW+MGP LVYA  L GA + LY
Sbjct  363  GEPKAIPWINATPLKAAADAWCHMDIRKGDIVAWPTNLGWMMGPWLVYASLLNGACIALY  422

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSP+   F KFVQDA V+ILG +PS+V+ WKST+C  G DW+ IR F +TGEASNVD+ 
Sbjct  423  NGSPIGSGFAKFVQDAKVTILGVIPSIVRTWKSTNCTAGYDWSAIRCFGSTGEASNVDEY  482

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA+YKPI+E CGGTE+   ++ GSLLQPQ+   FS+ +M     I
Sbjct  483  LWLMGRAHYKPIIEYCGGTEIGGAFITGSLLQPQSLAAFSTPTMGCSLFI  532



>ref|XP_002270918.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Vitis 
vinifera]
Length=726

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT+ +P++ AAD      ++ GD+  WPTNLGW+MGP LVYA  L GAT+ LY
Sbjct  367  GEPKAIPWTNATPLKAAADAWCHMDIRKGDIVAWPTNLGWMMGPWLVYASLLNGATIALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +G+PL   F KFVQDA V++LG +PS+V+ WKST+C  GLDW+ IR FA+TGEAS+VD+ 
Sbjct  427  NGAPLGSGFAKFVQDAKVTMLGVIPSIVRTWKSTNCTAGLDWSSIRCFASTGEASSVDEY  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+  +FS+ +M     I
Sbjct  487  LWLMGRAQYKPIIEYCGGTEIGGGFVTGSLLQAQSLASFSTPAMGCSLFI  536



>ref|XP_010314208.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Solanum lycopersicum]
Length=519

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 126/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   GDPKAIPWT L+P + AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  147  DAFTNILFSSGTTGDPKAIPWTLLTPFKAAADGWCHMDIKNGDVVAWPTNLGWMMGPWLV  206

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG +PS+V+ WK+ +   G DW+ IR 
Sbjct  207  YAALLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVIPSIVRTWKAKNSPDGYDWSTIRC  266

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEAS+VD+ LWL  RA YKPI+E CGGTE+  ++V+GS+LQPQ+   FS+A M   
Sbjct  267  FGSTGEASSVDEYLWLMGRAEYKPIMEYCGGTEIGGSFVSGSMLQPQSLAAFSTAVMGCS  326

Query  219  FVI  211
              I
Sbjct  327  LHI  329



>ref|XP_003552050.2| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X1 [Glycine max]
Length=744

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+++P++ AAD      V+ GDV CWPTNLGW+MGP LV
Sbjct  372  ETFTNILFSSGTTGDPKAIPWTNITPLKAAADAWCHMDVRKGDVVCWPTNLGWMMGPWLV  431

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY GSPL  +F KFVQDA V++LG +PS+V++W+ST+   G DW+ IR 
Sbjct  432  YASLLNGASVALYIGSPLGSAFAKFVQDAKVTMLGVIPSIVRSWRSTNSTSGYDWSSIRC  491

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  492  FGSTGEASNVDEYLWLMGRALYKPIIEYCGGTEIGGGFVCGSLLQAQSLAAFSTPAMCCS  551

Query  219  FVI  211
              I
Sbjct  552  LFI  554



>ref|XP_004488348.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X2 [Cicer arietinum]
Length=726

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT++SP++ AAD      V+ GDV  WPTNLGW+MGP LV
Sbjct  354  ETFTNILFSSGTTGDPKAIPWTNISPLKAAADAWCHLDVRKGDVVSWPTNLGWMMGPWLV  413

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQD+ V++LG +PSLV++W++ +   G DW+ IR 
Sbjct  414  YASLLNGASMALYNGSPLGSGFAKFVQDSKVTMLGVIPSLVRSWRNANSTSGFDWSAIRC  473

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            FA+TGEASN+D+ LWL  RA+YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  474  FASTGEASNIDEYLWLMGRAHYKPIIEYCGGTEIGGGFVTGSLLQAQSLAAFSTPAMCCS  533

Query  219  FVI  211
              I
Sbjct  534  LFI  536



>ref|XP_004488347.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X1 [Cicer arietinum]
Length=749

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT++SP++ AAD      V+ GDV  WPTNLGW+MGP LV
Sbjct  354  ETFTNILFSSGTTGDPKAIPWTNISPLKAAADAWCHLDVRKGDVVSWPTNLGWMMGPWLV  413

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQD+ V++LG +PSLV++W++ +   G DW+ IR 
Sbjct  414  YASLLNGASMALYNGSPLGSGFAKFVQDSKVTMLGVIPSLVRSWRNANSTSGFDWSAIRC  473

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            FA+TGEASN+D+ LWL  RA+YKPI+E CGGTE+   +V GSLLQ Q+   FS+ +M   
Sbjct  474  FASTGEASNIDEYLWLMGRAHYKPIIEYCGGTEIGGGFVTGSLLQAQSLAAFSTPAMCCS  533

Query  219  FVI  211
              I
Sbjct  534  LFI  536



>ref|XP_008782050.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Phoenix dactylifera]
Length=720

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTH +P++ AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  361  GEPKAIPWTHATPLKAAADAWSHMDIRKGDVVAWPTNLGWMMGPWLVYATLLNGASMALY  420

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG VPS+V+AWK + C  GLDW+ IR F++TGEAS+VD+ 
Sbjct  421  NGSPLGSGFAKFVQDAKVTMLGVVPSVVRAWKDSCCTAGLDWSTIRCFSSTGEASSVDEY  480

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA+YKP++E CGGTE+   ++ GSLLQ QA   FS+ +M     I
Sbjct  481  LWLMGRAHYKPVIEYCGGTEIGGGFICGSLLQSQALAAFSTPAMGCTLFI  530



>ref|XP_010110070.1| putative acyl-activating enzyme 17 [Morus notabilis]
 gb|EXC25137.1| putative acyl-activating enzyme 17 [Morus notabilis]
Length=727

 Score =   208 bits (530),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 124/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   GDPKAIPWT  +P + AAD      +Q GDV  WPTNLGW+MGP LV
Sbjct  354  DAFTNILFSSGTTGDPKAIPWTQATPFKAAADAWCHMDIQKGDVVAWPTNLGWMMGPWLV  413

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL  SF KF+QDA V++LG +PS+V+ WKS + + G DW+ IR 
Sbjct  414  YASLLNGASIALYNGSPLGSSFAKFIQDAKVTMLGVIPSIVRTWKSMNSVSGYDWSTIRC  473

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKP++E CGGTE+   +V GSLLQ QA   FS+ +M   
Sbjct  474  FGSTGEASNVDEYLWLMGRACYKPVIEYCGGTEIGGGFVTGSLLQAQALAAFSTPAMGCS  533

Query  219  FVI  211
              I
Sbjct  534  LFI  536



>ref|XP_009762075.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Nicotiana sylvestris]
Length=723

 Score =   208 bits (529),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 129/191 (68%), Gaps = 6/191 (3%)
 Frame = -2

Query  756  CDIHPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVM  595
             ++  + FT     S   G+PKAIPWT  +P++ AAD      +  GDV  WPTNLGW+M
Sbjct  348  VELPAEAFTNILFSSGTTGEPKAIPWTTTTPLKAAADGWSHLNIGKGDVVAWPTNLGWMM  407

Query  594  GPTLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDW  415
            GP L+Y   L GAT+ L++GSPL   F KFVQDA V++LG VPS+V+ WKST+C  G DW
Sbjct  408  GPFLIYCTLLNGATMALHNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCTAGYDW  467

Query  414  TRIRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSA  235
            + I  FA+TGEAS VD+ LWL  +A+YKP++E CGGTE+   ++AGSLLQPQ+   FS+A
Sbjct  468  SAICRFASTGEASGVDESLWLMGKAHYKPVIEICGGTEIGGGFIAGSLLQPQSLSAFSTA  527

Query  234  SMAVDFVIC*E  202
            +M     I  E
Sbjct  528  AMGCSLFIIGE  538



>ref|XP_009762076.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Nicotiana sylvestris]
Length=722

 Score =   207 bits (528),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 129/191 (68%), Gaps = 6/191 (3%)
 Frame = -2

Query  756  CDIHPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVM  595
             ++  + FT     S   G+PKAIPWT  +P++ AAD      +  GDV  WPTNLGW+M
Sbjct  347  VELPAEAFTNILFSSGTTGEPKAIPWTTTTPLKAAADGWSHLNIGKGDVVAWPTNLGWMM  406

Query  594  GPTLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDW  415
            GP L+Y   L GAT+ L++GSPL   F KFVQDA V++LG VPS+V+ WKST+C  G DW
Sbjct  407  GPFLIYCTLLNGATMALHNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCTAGYDW  466

Query  414  TRIRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSA  235
            + I  FA+TGEAS VD+ LWL  +A+YKP++E CGGTE+   ++AGSLLQPQ+   FS+A
Sbjct  467  SAICRFASTGEASGVDESLWLMGKAHYKPVIEICGGTEIGGGFIAGSLLQPQSLSAFSTA  526

Query  234  SMAVDFVIC*E  202
            +M     I  E
Sbjct  527  AMGCSLFIIGE  537



>gb|AFD33345.1| acyl-activating enzyme 1 [Cannabis sativa]
Length=720

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D +T     S   G+PKAIPWT  +P++ AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  353  DAYTNILFSSGTTGEPKAIPWTQATPLKAAADGWSHLDIRKGDVIVWPTNLGWMMGPWLV  412

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V++WKST+C+ G DW+ IR 
Sbjct  413  YASLLNGASIALYNGSPLVSGFAKFVQDAKVTMLGVVPSIVRSWKSTNCVSGYDWSTIRC  472

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F+++GEASNVD+ LWL  RA YKP++E CGGTE+   + AGS LQ Q+  +FSS  M   
Sbjct  473  FSSSGEASNVDEYLWLMGRANYKPVIEMCGGTEIGGAFSAGSFLQAQSLSSFSSQCMGCT  532

Query  219  FVI  211
              I
Sbjct  533  LYI  535



>ref|XP_007210889.1| hypothetical protein PRUPE_ppa002029mg [Prunus persica]
 gb|EMJ12088.1| hypothetical protein PRUPE_ppa002029mg [Prunus persica]
Length=726

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTH +P + AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  367  GEPKAIPWTHATPFKAAADAWCHMDIRIGDVVSWPTNLGWMMGPWLVYASLLNGASIALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WKST+ + G DW+ IR F +TGEASNVD+ 
Sbjct  427  NGSPLGSGFPKFVQDAKVTMLGVIPSIVRTWKSTNSVSGYDWSTIRCFGSTGEASNVDEY  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V+GSLLQ Q+   FS+ +M     I
Sbjct  487  LWLMGRARYKPIIEYCGGTEIGGGFVSGSLLQAQSLAAFSTPAMGCSLFI  536



>gb|KFK27630.1| hypothetical protein AALP_AA8G408100 [Arabis alpina]
Length=724

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 126/173 (73%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT+++P++ AAD      VQ GD+  WPTNLGW+MGP LVYA  + GA + LY
Sbjct  365  GDPKAIPWTNITPLKAAADAWCHLDVQRGDIVAWPTNLGWMMGPWLVYASLINGACMALY  424

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  +F KFVQDA V++LG +PS+V+ W++++   G DW++IR F +TGEASNVD+ 
Sbjct  425  NGSPLGPAFAKFVQDAEVTMLGVIPSIVRTWQNSNSTSGYDWSQIRCFGSTGEASNVDEY  484

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA+YKP++E CGGTE+   ++ GS+LQ Q+   FS+A+M     I  E
Sbjct  485  LWLMGRAHYKPVIEYCGGTEIGGGFITGSMLQTQSLAAFSTAAMGFKLFILGE  537



>gb|KDO65581.1| hypothetical protein CISIN_1g004815mg [Citrus sinensis]
Length=623

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWT+ +P + AAD      ++  D+  WPTNLGW+MGP LV
Sbjct  357  EAFTNILFSSGTTGEPKAIPWTNATPFKAAADAWCHMDIRKADIVAWPTNLGWMMGPWLV  416

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+ WKST+C+ G DW+ IR 
Sbjct  417  YASLLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCIDGYDWSSIRC  476

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKP++E CGGTE+   ++ GSLLQ Q+   FS+ +M   
Sbjct  477  FGSTGEASNVDEYLWLMGRALYKPVIEYCGGTEIGGGFITGSLLQAQSLAAFSTPAMGCK  536

Query  219  FVI  211
              I
Sbjct  537  LFI  539



>ref|XP_006844216.1| hypothetical protein AMTR_s00006p00266490 [Amborella trichopoda]
 gb|ERN05891.1| hypothetical protein AMTR_s00006p00266490 [Amborella trichopoda]
Length=729

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTH++P++ AAD      +  GD+  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  370  GEPKAIPWTHMTPIKAAADGWVHMDILKGDIVAWPTNLGWMMGPWLVYASLLNGASMALY  429

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA +++LG VPS+V+AWK ++C  GLDW+ IR F +TGEAS+ D+ 
Sbjct  430  NGSPLGYGFAKFVQDAKITMLGVVPSIVRAWKYSNCTAGLDWSSIRCFGSTGEASSADEY  489

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   +V+GSLLQ Q+   FS+ +M  +  I
Sbjct  490  LWLMGRACYKPVIEYCGGTEIGGGFVSGSLLQNQSLAAFSTPAMGCNLFI  539



>gb|EPS70528.1| hypothetical protein M569_04232, partial [Genlisea aurea]
Length=535

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPW+ L+P ++AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  359  GDPKAIPWSVLTPFKSAADGWCHMDIREGDVIAWPTNLGWMMGPWLVYASLLNGASIALY  418

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WKST+ + G DW+ IR FA+TGEASNVD+ 
Sbjct  419  NGSPLGSGFAKFVQDAKVTMLGVIPSIVRTWKSTNSVSGFDWSSIRCFASTGEASNVDEY  478

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   +V GSLLQ Q    FS+ ++     I
Sbjct  479  LWLMGRAGYKPVIEYCGGTEIGGGFVTGSLLQNQCLSAFSTPALGCSLFI  528



>ref|XP_008244070.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Prunus 
mume]
 ref|XP_008244072.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Prunus 
mume]
Length=726

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTH +P + AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  367  GEPKAIPWTHATPFKAAADAWCHMDIRIGDVVSWPTNLGWMMGPWLVYASLLNGASIALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WKST+ + G DW+ IR F +TGEASNVD+ 
Sbjct  427  NGSPLGSGFPKFVQDAKVTMLGVIPSIVRTWKSTNSVSGYDWSTIRCFGSTGEASNVDEY  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V+GSLLQ Q+   FS+ +M     I
Sbjct  487  LWLMGRACYKPIIEYCGGTEIGGGFVSGSLLQAQSLAAFSTPAMGCSLFI  536



>gb|KDO65580.1| hypothetical protein CISIN_1g004815mg [Citrus sinensis]
Length=728

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWT+ +P + AAD      ++  D+  WPTNLGW+MGP LV
Sbjct  356  EAFTNILFSSGTTGEPKAIPWTNATPFKAAADAWCHMDIRKADIVAWPTNLGWMMGPWLV  415

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+ WKST+C+ G DW+ IR 
Sbjct  416  YASLLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCIDGYDWSSIRC  475

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKP++E CGGTE+   ++ GSLLQ Q+   FS+ +M   
Sbjct  476  FGSTGEASNVDEYLWLMGRALYKPVIEYCGGTEIGGGFITGSLLQAQSLAAFSTPAMGCK  535

Query  219  FVI  211
              I
Sbjct  536  LFI  538



>gb|KDO65579.1| hypothetical protein CISIN_1g004815mg [Citrus sinensis]
Length=729

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWT+ +P + AAD      ++  D+  WPTNLGW+MGP LV
Sbjct  357  EAFTNILFSSGTTGEPKAIPWTNATPFKAAADAWCHMDIRKADIVAWPTNLGWMMGPWLV  416

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+ WKST+C+ G DW+ IR 
Sbjct  417  YASLLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCIDGYDWSSIRC  476

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKP++E CGGTE+   ++ GSLLQ Q+   FS+ +M   
Sbjct  477  FGSTGEASNVDEYLWLMGRALYKPVIEYCGGTEIGGGFITGSLLQAQSLAAFSTPAMGCK  536

Query  219  FVI  211
              I
Sbjct  537  LFI  539



>ref|XP_006494245.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X1 [Citrus sinensis]
 ref|XP_006494246.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
isoform X2 [Citrus sinensis]
Length=729

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWT+ +P + AAD      ++  D+  WPTNLGW+MGP LV
Sbjct  357  EAFTNILFSSGTTGEPKAIPWTNATPFKAAADAWCHMDIRKADIVAWPTNLGWMMGPWLV  416

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+ WKST+C+ G DW+ IR 
Sbjct  417  YASLLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCIDGYDWSSIRC  476

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKP++E CGGTE+   ++ GSLLQ Q+   FS+ +M   
Sbjct  477  FGSTGEASNVDEYLWLMGRALYKPVIEYCGGTEIGGGFITGSLLQAQSLAAFSTPAMGCK  536

Query  219  FVI  211
              I
Sbjct  537  LFI  539



>ref|XP_009337653.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Pyrus x bretschneideri]
Length=663

 Score =   204 bits (520),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 126/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT  +P + AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  291  EAFTNILFSSGTTGDPKAIPWTLATPFKAAADAWCHMDIRIGDVVAWPTNLGWMMGPWLV  350

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL  SF KFVQDA V++LG +PS+V++WKST+ + G DW+ IR 
Sbjct  351  YASLLNGASIALYNGSPLGSSFAKFVQDAKVTMLGVIPSIVRSWKSTNSVSGYDWSAIRC  410

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNV++ LWL  RA+YKPI+E CGGTE+   +V GS LQ Q+   FS+ +M   
Sbjct  411  FGSTGEASNVEEYLWLMGRAHYKPIIEYCGGTEIGGGFVTGSFLQAQSLAAFSTPAMGCS  470

Query  219  FVI  211
              I
Sbjct  471  LYI  473



>ref|XP_002978769.1| hypothetical protein SELMODRAFT_109501 [Selaginella moellendorffii]
 gb|EFJ20216.1| hypothetical protein SELMODRAFT_109501 [Selaginella moellendorffii]
Length=727

 Score =   205 bits (522),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 126/178 (71%), Gaps = 11/178 (6%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHL+P++ AAD      +++ DV  WPTNLGW+MGP LVYA  + GAT+ LY
Sbjct  366  GDPKAIPWTHLTPIKAAADGWAHQDIRSRDVVSWPTNLGWMMGPWLVYATLVNGATIALY  425

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV-----FATTGEAS  376
            +GSPL R F KFVQDA V++LG VPS+V+ WK+T C+  +D + IR        +TGEAS
Sbjct  426  NGSPLGRGFAKFVQDAKVTMLGVVPSIVRHWKTTKCLDDIDLSHIRREHPSDLCSTGEAS  485

Query  375  NVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
             VDD LWL S+A YKP++E CGGTE+   +V GSLLQPQA  +FS+ +M  D  I  E
Sbjct  486  TVDDYLWLMSKASYKPVIEYCGGTEIGGGFVTGSLLQPQALASFSTPAMGCDVFILDE  543



>ref|XP_004252244.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Solanum lycopersicum]
Length=722

 Score =   205 bits (522),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 126/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   GDPKAIPWT L+P + AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  350  DAFTNILFSSGTTGDPKAIPWTLLTPFKAAADGWCHMDIKNGDVVAWPTNLGWMMGPWLV  409

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG +PS+V+ WK+ +   G DW+ IR 
Sbjct  410  YAALLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVIPSIVRTWKAKNSPDGYDWSTIRC  469

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEAS+VD+ LWL  RA YKPI+E CGGTE+  ++V+GS+LQPQ+   FS+A M   
Sbjct  470  FGSTGEASSVDEYLWLMGRAEYKPIMEYCGGTEIGGSFVSGSMLQPQSLAAFSTAVMGCS  529

Query  219  FVI  211
              I
Sbjct  530  LHI  532



>ref|XP_004299255.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
[Fragaria vesca subsp. vesca]
Length=725

 Score =   205 bits (522),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT+ +P + AAD      ++ GD+  WPTNLGW+MGP LV
Sbjct  353  EAFTNILFSSGTTGDPKAIPWTNATPFKAAADAWCHMDIRKGDIIAWPTNLGWMMGPWLV  412

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG +PS+V+ WKST+   G DW+ IR 
Sbjct  413  YASLLNGASIALYNGSPLGPGFSKFVQDAKVTMLGVIPSIVRTWKSTNSTSGYDWSAIRC  472

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F++TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V+GS+LQ Q+  +FS+ +M   
Sbjct  473  FSSTGEASNVDEYLWLMGRAGYKPIIEYCGGTEIGGAFVSGSMLQAQSLASFSTPAMGCS  532

Query  219  FVI  211
              I
Sbjct  533  LFI  535



>ref|XP_006345338.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
[Solanum tuberosum]
Length=722

 Score =   205 bits (521),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 126/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            D FT     S   GDPKAIPWT L+P + AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  350  DAFTNILFSSGTTGDPKAIPWTLLTPFKAAADGWCHMDIKNGDVVAWPTNLGWMMGPWLV  409

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG +PS+V+ WK+ +   G DW+ IR 
Sbjct  410  YAPLLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVIPSIVRTWKAKNSPDGYDWSTIRC  469

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEAS+VD+ LWL  RA YKPI+E CGGTE+  ++V+GS+LQPQ+   FS+A M   
Sbjct  470  FGSTGEASSVDEYLWLMGRAEYKPIIEYCGGTEIGGSFVSGSMLQPQSLAAFSTAVMGCS  529

Query  219  FVI  211
              I
Sbjct  530  LHI  532



>ref|XP_009787950.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Nicotiana 
sylvestris]
Length=722

 Score =   205 bits (521),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW+ LSP ++AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  363  GEPKAIPWSLLSPFKSAADGWCHMDIKKGDVVAWPTNLGWMMGPWLVYASLLNGASIALY  422

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WK+ +   G DW+ IR F +TGEAS+VD+ 
Sbjct  423  NGSPLDSGFAKFVQDAKVTMLGVIPSIVRTWKAKNSPDGFDWSTIRCFGSTGEASSVDEY  482

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+  ++V+GSLLQPQ+   FS+A M     I
Sbjct  483  LWLMGRAEYKPIIEYCGGTEIGGSFVSGSLLQPQSLAAFSTAVMGCSLHI  532



>ref|XP_006440873.1| hypothetical protein CICLE_v10019034mg [Citrus clementina]
 gb|ESR54113.1| hypothetical protein CICLE_v10019034mg [Citrus clementina]
Length=729

 Score =   205 bits (521),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWT+ +P + AAD      ++  D+  WPTNLGW+MGP LV
Sbjct  357  EAFTNILFSSGTTGEPKAIPWTNATPFKAAADAWCHMDIRKADIVAWPTNLGWMMGPWLV  416

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+ WKST+C+ G DW+ IR 
Sbjct  417  YASLLNGASVALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCIDGYDWSSIRC  476

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKP++E CGGTE+   ++ GSLLQ Q+   FS+ +M   
Sbjct  477  FGSTGEASNVDEYLWLMGRALYKPVIEYCGGTEIGGGFITGSLLQAQSLAAFSTPAMGCK  536

Query  219  FVI  211
              I
Sbjct  537  LFI  539



>ref|XP_006440872.1| hypothetical protein CICLE_v10019034mg [Citrus clementina]
 gb|ESR54112.1| hypothetical protein CICLE_v10019034mg [Citrus clementina]
Length=701

 Score =   204 bits (520),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWT+ +P + AAD      ++  D+  WPTNLGW+MGP LV
Sbjct  357  EAFTNILFSSGTTGEPKAIPWTNATPFKAAADAWCHMDIRKADIVAWPTNLGWMMGPWLV  416

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG VPS+V+ WKST+C+ G DW+ IR 
Sbjct  417  YASLLNGASVALYNGSPLGSGFAKFVQDAKVTMLGVVPSIVRTWKSTNCIDGYDWSSIRC  476

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKP++E CGGTE+   ++ GSLLQ Q+   FS+ +M   
Sbjct  477  FGSTGEASNVDEYLWLMGRALYKPVIEYCGGTEIGGGFITGSLLQAQSLAAFSTPAMGCK  536

Query  219  FVI  211
              I
Sbjct  537  LFI  539



>ref|XP_009337648.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Pyrus x bretschneideri]
Length=728

 Score =   205 bits (521),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 126/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT  +P + AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  356  EAFTNILFSSGTTGDPKAIPWTLATPFKAAADAWCHMDIRIGDVVAWPTNLGWMMGPWLV  415

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL  SF KFVQDA V++LG +PS+V++WKST+ + G DW+ IR 
Sbjct  416  YASLLNGASIALYNGSPLGSSFAKFVQDAKVTMLGVIPSIVRSWKSTNSVSGYDWSAIRC  475

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNV++ LWL  RA+YKPI+E CGGTE+   +V GS LQ Q+   FS+ +M   
Sbjct  476  FGSTGEASNVEEYLWLMGRAHYKPIIEYCGGTEIGGGFVTGSFLQAQSLAAFSTPAMGCS  535

Query  219  FVI  211
              I
Sbjct  536  LYI  538



>ref|XP_009610406.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Nicotiana 
tomentosiformis]
Length=722

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW+ LSP + AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  363  GEPKAIPWSLLSPFKAAADGWCHMDIKKGDVVAWPTNLGWMMGPWLVYASLLNGASIALY  422

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+ WK+ +   G DW+ IR F +TGEAS+VD+ 
Sbjct  423  NGSPLGSGFAKFVQDAKVTMLGVIPSIVRTWKAKNSPDGFDWSTIRCFGSTGEASSVDEY  482

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+  ++V+GSLLQPQ+   FS+A M     I
Sbjct  483  LWLMGRAEYKPIIEYCGGTEIGGSFVSGSLLQPQSLAAFSTAVMGCSLHI  532



>ref|XP_007138230.1| hypothetical protein PHAVU_009G191300g [Phaseolus vulgaris]
 ref|XP_007138231.1| hypothetical protein PHAVU_009G191300g [Phaseolus vulgaris]
 gb|ESW10224.1| hypothetical protein PHAVU_009G191300g [Phaseolus vulgaris]
 gb|ESW10225.1| hypothetical protein PHAVU_009G191300g [Phaseolus vulgaris]
Length=726

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT+++P++ AAD      ++ GDV CWPTNLGW+MGP LVYA  L GA++ LY
Sbjct  368  GDPKAIPWTNITPLKAAADAWFHMDIRKGDVVCWPTNLGWMMGPWLVYASLLNGASMALY  427

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             GSPL   F KFVQD+ V++LG +PS+V++WKS +   G DW+ IR FA++GEASNVD+ 
Sbjct  428  VGSPLGSGFAKFVQDSKVTMLGVIPSIVRSWKSANSTSGYDWSSIRCFASSGEASNVDEY  487

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   +V GSLLQ Q    FS+ ++     I
Sbjct  488  LWLMGRALYKPVIEYCGGTEIGGGFVCGSLLQAQTVAAFSTPAIGCSLYI  537



>ref|XP_008393274.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Malus 
domestica]
Length=728

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 126/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   GDPKAIPWT  +P + AAD      ++ GDV  WPTNLGW+MGP LV
Sbjct  356  EAFTNXLFSSGTTGDPKAIPWTLATPFKAAADAWCHMDIRIGDVVAWPTNLGWMMGPWLV  415

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA++ LY+GSPL   F KFVQDA V++LG +PS+V++WKST+ + G DW+ IR 
Sbjct  416  YASLLNGASIALYNGSPLGSGFAKFVQDAKVTMLGVIPSIVRSWKSTNSVSGYDWSAIRC  475

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNV++ LWL  RA+YKPI+E CGGTE+   +V GSLL+ Q+   FS+ +M   
Sbjct  476  FGSTGEASNVEEYLWLMGRAHYKPIIEYCGGTEIGGGFVTGSLLZAQSLAAFSTPAMGCS  535

Query  219  FVI  211
              I
Sbjct  536  LYI  538



>gb|KDP20059.1| hypothetical protein JCGZ_05828 [Jatropha curcas]
Length=726

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 123/183 (67%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWT  +P + AAD      ++ GD+  WPTNLGW+MGP LV
Sbjct  354  EAFTNILFSSGTTGEPKAIPWTSATPFKAAADAWCHMDIRKGDIVAWPTNLGWMMGPWLV  413

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA + LY+GSPL  SF KFVQDA V++LG +PS+V+ WK+ +   G DW+ IR 
Sbjct  414  YASLLNGACIALYNGSPLGSSFAKFVQDAKVTMLGVIPSIVRTWKTANTTAGYDWSAIRC  473

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F +TGEASNVD+ LWL  RA YKPI+E CGGTE+   +V+GS LQPQ+   FS+ +M   
Sbjct  474  FGSTGEASNVDEHLWLMGRALYKPIIEYCGGTEIGGGFVSGSFLQPQSLAAFSTPAMGCS  533

Query  219  FVI  211
              I
Sbjct  534  LFI  536



>gb|EYU38156.1| hypothetical protein MIMGU_mgv1a002035mg [Erythranthe guttata]
Length=724

 Score =   203 bits (517),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW+  +P++ AAD      ++ GD+  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  364  GEPKAIPWSVATPLKAAADGWCHMDIRKGDIIAWPTNLGWMMGPWLVYASLLNGASIALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL  SF KFVQDA V++LG +PS+V+AWK+ +     DW+ IR FA+TGEASNVD+ 
Sbjct  424  NGSPLGSSFAKFVQDAKVTMLGVIPSIVRAWKNANSTSTYDWSAIRCFASTGEASNVDEY  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   +V GSLLQPQ+   FS+ +M     I
Sbjct  484  LWLMGRAQYKPVIEYCGGTEIGGAFVTGSLLQPQSLSAFSTPAMGCTLFI  533



>ref|XP_002984682.1| hypothetical protein SELMODRAFT_423761 [Selaginella moellendorffii]
 gb|EFJ14327.1| hypothetical protein SELMODRAFT_423761 [Selaginella moellendorffii]
Length=1233

 Score =   206 bits (525),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 126/178 (71%), Gaps = 11/178 (6%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTHL+P++ AAD      +++ DV  WPTNLGW+MGP LVYA  + GAT+ LY
Sbjct  271  GDPKAIPWTHLTPIKAAADGWAHQDIRSRDVVAWPTNLGWMMGPWLVYATLVNGATIALY  330

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV-----FATTGEAS  376
            +GSPL R F KFVQDA V++LG VPS+V+ WK+T C+  +D + IR        +TGEAS
Sbjct  331  NGSPLGRGFAKFVQDAKVTMLGVVPSIVRNWKTTKCLDDIDLSHIRREHPSDLCSTGEAS  390

Query  375  NVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
             VDD LWL S+A YKP++E CGGTE+   +V GSLLQPQA  +FS+ +M  D  I  E
Sbjct  391  TVDDYLWLMSKASYKPVIEYCGGTEIGGGFVTGSLLQPQALASFSTPAMGCDVFILDE  448



>ref|XP_004138219.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
[Cucumis sativus]
 ref|XP_004154935.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal-like 
[Cucumis sativus]
 gb|KGN63781.1| hypothetical protein Csa_1G015740 [Cucumis sativus]
Length=725

 Score =   202 bits (515),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT ++P++ AAD      +  GDV  WPTNLGW+MGP LVYA  L  A++ LY
Sbjct  367  GEPKAIPWTLVTPLKAAADAWCHMDIHKGDVVAWPTNLGWMMGPWLVYASLLNKASMALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPLS  F KF+QDA  ++LG +PS+V++WKST+C  G DW+ IR FA+TGEAS+VD+ 
Sbjct  427  NGSPLSSGFVKFIQDAKTTMLGVIPSIVRSWKSTNCTSGYDWSSIRCFASTGEASSVDEY  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V GS+LQ QA   FS+ +M     I
Sbjct  487  LWLMGRACYKPIIEYCGGTEIGGGFVTGSMLQAQALAAFSTPAMGCSLFI  536



>ref|WP_035139742.1| AMP-dependent synthetase, partial [Fischerella sp. PCC 9605]
Length=633

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 128/185 (69%), Gaps = 6/185 (3%)
 Frame = -2

Query  747  HPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPT  586
            HPD +T     S   G+PKAIPWTH +P++ A D      +  GDV  W TNLGW+MGP 
Sbjct  240  HPDAYTNILFSSGTTGEPKAIPWTHTTPIKCATDGHLHHDIHPGDVVAWHTNLGWMMGPW  299

Query  585  LVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRI  406
            L+YA  +  AT+ LY G+P  R +G+F+QDAG++ILG VPSLV  WK+T CM+GLDW+ I
Sbjct  300  LIYASLINRATIALYCGTPTDRGYGQFIQDAGINILGVVPSLVNTWKTTACMQGLDWSAI  359

Query  405  RVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMA  226
            + F++TGE S  +D L+L S A YKP++E CGGTE+   Y+ G+L+QP A  TF++ ++ 
Sbjct  360  KAFSSTGECSKPEDMLYLMSLAGYKPVIEYCGGTEIGGGYITGTLVQPCAPSTFTTPALG  419

Query  225  VDFVI  211
            +D VI
Sbjct  420  LDIVI  424



>ref|XP_008453341.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Cucumis 
melo]
Length=725

 Score =   202 bits (515),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT ++P++ AAD      +  GDV  WPTNLGW+MGP LVYA  L  A++ LY
Sbjct  367  GEPKAIPWTLVTPLKAAADAWCHMDIHKGDVVAWPTNLGWMMGPWLVYASLLNKASMALY  426

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPLS  F KF+QDA  ++LG +PS+V++WKST+C  G DW+ IR FA+TGEAS+VD+ 
Sbjct  427  NGSPLSSGFVKFIQDAKTTMLGVIPSIVRSWKSTNCTSGYDWSSIRCFASTGEASSVDEY  486

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKPI+E CGGTE+   +V GS+LQ QA   FS+ +M     I
Sbjct  487  LWLMGRACYKPIIEYCGGTEIGGGFVTGSMLQAQALAAFSTPAMGCSLFI  536



>ref|XP_010037331.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010037332.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal [Eucalyptus 
grandis]
 gb|KCW49032.1| hypothetical protein EUGRSUZ_K02641 [Eucalyptus grandis]
Length=720

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 122/183 (67%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWTH +P++ AAD      +  GDV  WPTNLGW+MGP LV
Sbjct  348  EAFTNILFSSGTTGEPKAIPWTHATPLKAAADAWCHMDIHKGDVVAWPTNLGWMMGPWLV  407

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA + LY+GSPL   F KFVQDA V++LG +PS+V+ WK++    G DW+ IR 
Sbjct  408  YASLLNGAAMALYNGSPLGPGFAKFVQDAKVTMLGVIPSIVRTWKNSKSTSGFDWSAIRC  467

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F+++GEASN D+ LWL  RA YKP++E CGGTE+   +V+GSLLQ Q+   FS+  M   
Sbjct  468  FSSSGEASNADEYLWLMGRAKYKPVIEYCGGTEIGGGFVSGSLLQAQSLAAFSTPVMGCS  527

Query  219  FVI  211
              I
Sbjct  528  LFI  530



>gb|KCW49033.1| hypothetical protein EUGRSUZ_K02641 [Eucalyptus grandis]
Length=688

 Score =   200 bits (508),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 122/183 (67%), Gaps = 6/183 (3%)
 Frame = -2

Query  741  DYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLV  580
            + FT     S   G+PKAIPWTH +P++ AAD      +  GDV  WPTNLGW+MGP LV
Sbjct  348  EAFTNILFSSGTTGEPKAIPWTHATPLKAAADAWCHMDIHKGDVVAWPTNLGWMMGPWLV  407

Query  579  YACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRV  400
            YA  L GA + LY+GSPL   F KFVQDA V++LG +PS+V+ WK++    G DW+ IR 
Sbjct  408  YASLLNGAAMALYNGSPLGPGFAKFVQDAKVTMLGVIPSIVRTWKNSKSTSGFDWSAIRC  467

Query  399  FATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVD  220
            F+++GEASN D+ LWL  RA YKP++E CGGTE+   +V+GSLLQ Q+   FS+  M   
Sbjct  468  FSSSGEASNADEYLWLMGRAKYKPVIEYCGGTEIGGGFVSGSLLQAQSLAAFSTPVMGCS  527

Query  219  FVI  211
              I
Sbjct  528  LFI  530



>ref|WP_038027236.1| AMP-dependent synthetase, partial [Synechococcus sp. PCC 7336]
Length=683

 Score =   199 bits (507),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 131/188 (70%), Gaps = 6/188 (3%)
 Frame = -2

Query  747  HPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPT  586
             PD  T     S   G+PKAIPWT  +P++ AAD      +  GD   WPTNLGW+MGP 
Sbjct  319  QPDDRTNILFSSGTTGEPKAIPWTQTTPIKCAADGFLHHDIHPGDRVAWPTNLGWMMGPW  378

Query  585  LVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRI  406
            L+YA  +  AT+ LY+G+P  R+FG+FVQDAGVS+LG VPSLVK+WK++ CM+GLDW+ I
Sbjct  379  LIYASLIDRATIALYYGAPTGRAFGQFVQDAGVSMLGVVPSLVKSWKTSGCMQGLDWSAI  438

Query  405  RVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMA  226
            +VF++TGE SN  + L+L S A Y+PIVE CGGTE+   Y+ G+L+QP A  TF++ ++ 
Sbjct  439  KVFSSTGECSNPQEMLFLMSLAGYRPIVEYCGGTEIGGGYLTGTLVQPCAPSTFTTPALG  498

Query  225  VDFVIC*E  202
            +D  +  E
Sbjct  499  LDIAVLNE  506



>ref|WP_020382222.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=676

 Score =   198 bits (503),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  +P++ A D      +Q GDV  WPTNLGW+MGP L+YA  +   T+ LY
Sbjct  333  GEPKAIPWTQTTPIKCAVDAYLHHDIQRGDVLAWPTNLGWMMGPWLIYASLVNQGTIALY  392

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
             G+   R FG+FV DA V++LG VPS+V+AWK+TDCMKGLDW  I+ F++TGE SN +D 
Sbjct  393  DGTATEREFGEFVGDARVTMLGVVPSIVRAWKNTDCMKGLDWGNIKAFSSTGECSNSEDM  452

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            L+L S A Y+PI+E CGGTE+   Y+ G+ +QP A  TF++ ++ +D VIC E
Sbjct  453  LFLMSLAGYRPIIEYCGGTEIGGGYLTGTAIQPAAPATFTTPALGLDIVICDE  505



>ref|XP_011096943.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X1 [Sesamum indicum]
Length=723

 Score =   197 bits (502),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 118/170 (69%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW   +P + AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  364  GEPKAIPWNLATPFKAAADAWCHMDIRKGDVVAWPTNLGWMMGPWLVYASLLNGASIALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+AWKS +     DW+ IR FA+TGEASNVD+ 
Sbjct  424  NGSPLGSGFAKFVQDARVTMLGVIPSIVRAWKSANTTATYDWSAIRCFASTGEASNVDEY  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   +V GSLLQ Q+   FS+ +M     I
Sbjct  484  LWLMGRARYKPVIEYCGGTEIGGGFVTGSLLQHQSLAAFSTPAMGCSLFI  533



>ref|XP_011096944.1| PREDICTED: probable acyl-activating enzyme 17, peroxisomal isoform 
X2 [Sesamum indicum]
Length=721

 Score =   197 bits (502),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 118/170 (69%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPW   +P + AAD      ++ GDV  WPTNLGW+MGP LVYA  L GA++ LY
Sbjct  364  GEPKAIPWNLATPFKAAADAWCHMDIRKGDVVAWPTNLGWMMGPWLVYASLLNGASIALY  423

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KFVQDA V++LG +PS+V+AWKS +     DW+ IR FA+TGEASNVD+ 
Sbjct  424  NGSPLGSGFAKFVQDARVTMLGVIPSIVRAWKSANTTATYDWSAIRCFASTGEASNVDEY  483

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL  RA YKP++E CGGTE+   +V GSLLQ Q+   FS+ +M     I
Sbjct  484  LWLMGRARYKPVIEYCGGTEIGGGFVTGSLLQHQSLAAFSTPAMGCSLFI  533



>ref|WP_017319530.1| hypothetical protein [cyanobacterium PCC 7702]
Length=682

 Score =   196 bits (498),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  747  HPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPT  586
            HPD +T     S     PKAIPWT  +P++ A D      +   DV  WPTNLGW+MGP 
Sbjct  320  HPDAYTNILFSSGTTAQPKAIPWTQTTPIKCACDGHLHHDIHPQDVVAWPTNLGWMMGPW  379

Query  585  LVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRI  406
            L+YA  +   T+ LY+G+P  + FGKFVQDA V+ILG VPSLVK WK+T CM+GLDW+ I
Sbjct  380  LIYATLINKGTIALYYGTPTEQGFGKFVQDARVNILGVVPSLVKTWKTTGCMQGLDWSAI  439

Query  405  RVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMA  226
            + F++TGE S+  D L+L S A YKP+VE CGGTE+   Y+ G+L+QP    TF++ ++ 
Sbjct  440  KAFSSTGECSHPQDMLFLMSLAGYKPVVEYCGGTEIGGAYITGTLVQPAIPSTFTTPAVG  499

Query  225  VDFVIC*E  202
            +D VI  E
Sbjct  500  LDVVIVDE  507



>emb|CDO98500.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   196 bits (497),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 120/173 (69%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWT  +P++ AAD      ++ GD+  WPTNLGW+MGP LVYA  L  A++ LY
Sbjct  297  GDPKAIPWTVSTPLKAAADGWCHMDIREGDIVSWPTNLGWMMGPWLVYASLLNSASMALY  356

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +GSPL   F KF+QDA V++LG +PS+V+ WK+ +     DW+ IR F +TGEAS+VD+ 
Sbjct  357  NGSPLGSGFAKFIQDAKVTMLGVIPSIVRTWKTKNSTASYDWSSIRCFGSTGEASSVDEY  416

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            LWL  RA YKP++E CGGTE+   +++GSL+QPQ    FS+A+M     I  E
Sbjct  417  LWLMGRACYKPVIEYCGGTEIGGGFISGSLVQPQCLAAFSTAAMGCSLFILGE  469



>ref|WP_015144647.1| acyl-CoA synthetase/AMP-acid ligase [Pleurocapsa minor]
 ref|YP_007081903.1| acyl-CoA synthetase/AMP-acid ligase [Pleurocapsa sp. PCC 7327]
 gb|AFY78346.1| acyl-CoA synthetase/AMP-acid ligase [Pleurocapsa sp. PCC 7327]
Length=682

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 6/173 (3%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWT  +P++ A D      ++  +V  WPTNLGW+MGP L+YA  +  AT+ LY
Sbjct  334  GEPKAIPWTQTTPIKCAVDAHLHHDIRPREVVAWPTNLGWMMGPWLIYASLVNRATIALY  393

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +G P  R FG+FVQDA V++LG VPSLV AWK+T CMKGLDW+ I+ F++TGE SN  D 
Sbjct  394  YGVPTERGFGQFVQDARVNVLGLVPSLVSAWKATACMKGLDWSAIKAFSSTGECSNPRDM  453

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVIC*E  202
            L+L S A YKPI+E CGGTE+   Y+ G+L+QP A  TFS+ ++ +D  I  E
Sbjct  454  LYLMSLAGYKPIIEYCGGTEIGGAYITGTLVQPAAPATFSTPALGLDVAILDE  506



>ref|WP_019504730.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=686

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 123/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  750  IHPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGP  589
            +HPD +T     S   G+PKAIPWTH +P++   D      +   DV  WPTNLGW+MGP
Sbjct  318  VHPDAYTNILFSSGTTGEPKAIPWTHTTPIKCGVDGYLHHDIHPPDVVAWPTNLGWMMGP  377

Query  588  TLVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTR  409
             L+YA  +  AT+ LY+G+P  R FG+FVQD  V+ILG VPSLV  WK T CM+GLDW+ 
Sbjct  378  WLIYASLINHATIALYYGTPTEREFGRFVQDGRVNILGVVPSLVNTWKVTQCMQGLDWSA  437

Query  408  IRVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASM  229
            IR F++TGE S   D L+L S A YKPI+E CGGTE+   Y+  +L+ P +  TF++ ++
Sbjct  438  IRAFSSTGECSTPQDMLFLMSLAGYKPIIEYCGGTEIGGGYLTSTLVHPCSPSTFTTPAL  497

Query  228  AVDFVIC*E  202
             +D  I  E
Sbjct  498  GLDLAIVDE  506



>ref|WP_016873373.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=681

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = -2

Query  747  HPDYFTK*FRFSYLDGDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPT  586
            HP  +T     S    +PKAIPWT  +P++ A+D      +   DV  WPTNLGW+MGP 
Sbjct  317  HPTAYTNILFSSGTTAEPKAIPWTQTTPIKCASDGHLHHDIHPQDVVAWPTNLGWMMGPW  376

Query  585  LVYACFLTGATLVLYHGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRI  406
            L+YA  +  AT+ LY+G+P  R FG+F+QDA V++LG VPSLV  WK+T CM+G DW+ I
Sbjct  377  LIYASLVNKATIALYYGAPTERGFGEFIQDARVTMLGLVPSLVSNWKTTACMQGFDWSAI  436

Query  405  RVFATTGEASNVDDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMA  226
            + F++TGE SN  D L+L S A YKPIVE CGGTE+   Y+ G+++QP    TF++ ++ 
Sbjct  437  KAFSSTGECSNPQDILFLMSLAGYKPIVEYCGGTEIGGAYITGTVVQPAIPSTFTTPALG  496

Query  225  VDFVIC*E  202
            +DFVI  E
Sbjct  497  LDFVILDE  504



>ref|XP_001784278.1| predicted protein [Physcomitrella patens]
 gb|EDQ50927.1| predicted protein [Physcomitrella patens]
Length=735

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 121/170 (71%), Gaps = 6/170 (4%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMRTAAD------VQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            GDPKAIPWTH +P++ AAD      ++  DV  WPTNLGW+MGP L+YA  L  A++ LY
Sbjct  375  GDPKAIPWTHATPIKAAADAWAHHDIRHRDVVAWPTNLGWMMGPWLIYAALLNRASIALY  434

Query  540  HGSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNVDDD  361
            +G+PL   F KFVQDA V++LG VPS+ KAW++T  + G DW  +R F+++GEASNVDD 
Sbjct  435  NGAPLGYGFAKFVQDAKVTMLGLVPSIAKAWRNTQVVHGCDWFHLRCFSSSGEASNVDDY  494

Query  360  LWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            LWL S+A YKPI+E CGGTE+   +V GS+LQPQ    FS+ +M    VI
Sbjct  495  LWLMSQAKYKPIIEYCGGTEIGGGFVTGSMLQPQTLSAFSTPAMGCKIVI  544



>ref|XP_005644262.1| acetyl-CoA synthetase-like protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19718.1| acetyl-CoA synthetase-like protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=698

 Score =   193 bits (491),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 123/173 (71%), Gaps = 9/173 (5%)
 Frame = -2

Query  702  GDPKAIPWTHLSPMR------TAADVQAGDVYCWPTNLGWVMGPTLVYACFLTGATLVLY  541
            G+PKAIPWTH++PMR         DV+ GDV  WPTNLGW+MGP L+YA  L GA + L 
Sbjct  326  GEPKAIPWTHVTPMRCGVDAWAQQDVRRGDVVAWPTNLGWMMGPWLLYAALLNGAAVALQ  385

Query  540  H---GSPLSRSFGKFVQDAGVSILGTVPSLVKAWKSTDCMKGLDWTRIRVFATTGEASNV  370
            +   GSPL+R FG FV+ A V++LG VPS+ KAW+++ CMKGL W  +R +++TGEAS  
Sbjct  386  NCVQGSPLARPFGIFVERAQVNVLGLVPSIAKAWRASGCMKGLKWASLRCYSSTGEASAP  445

Query  369  DDDLWLTSRAYYKPIVECCGGTELASTYVAGSLLQPQAFGTFSSASMAVDFVI  211
            +D  WL +R  YKP++E CGGTE+   ++AG +LQPQ+  TFS+ +M  +FV+
Sbjct  446  EDYHWLMARGGYKPVIEICGGTEIGGGFLAGCMLQPQSPSTFSTPTMGSNFVL  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2533093496640