BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25920_g5_i1 len=1897 path=[8193:0-423 8614:424-429 6595:430-507
8695:508-521 8709:522-549 8737:550-776 8964:777-844 9031:845-972
5039:973-1012 9198:1013-1246 9432:1247-1274 24141:1275-1280
9466:1281-1722 9907:1723-1772 4407:1773-1896]

Length=1897
                                                                      Score     E

sp|Q9MB14.2|PPO2_IPOBA  RecName: Full=Polyphenol oxidase II, chlo...    731   0.0      Ipomoea batatas [batate]
dbj|BAA92317.1|  polyphenol oxidase I                                   731   0.0      Ipomoea batatas [batate]
emb|CAC83609.1|  catechol oxidase                                       717   0.0      Ipomoea batatas [batate]
gb|AAW78869.1|  polyphenol oxidase                                      719   0.0      Ipomoea batatas [batate]
sp|Q9ZP19.1|PPO1_IPOBA  RecName: Full=Polyphenol oxidase I, chlor...    715   0.0      Ipomoea batatas [batate]
emb|CAC83610.1|  catechol oxidase                                       711   0.0      Ipomoea batatas [batate]
emb|CAC29040.1|  catechol oxidase                                       709   0.0      Ipomoea batatas [batate]
pdb|1BT1|A  Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet...    565   0.0      
emb|CDP06093.1|  unnamed protein product                                565   0.0      
ref|XP_007025701.1|  Uncharacterized protein TCM_029921                 558   0.0      
ref|XP_007025702.1|  Uncharacterized protein TCM_029922                 546   0.0      
ref|XP_010100574.1|  Polyphenol oxidase                                 543   0.0      
emb|CDO99592.1|  unnamed protein product                                542   0.0      
ref|XP_010052352.1|  PREDICTED: polyphenol oxidase, chloroplastic...    542   0.0      
emb|CDP22269.1|  unnamed protein product                                529   5e-180   
gb|AII22011.1|  polyphenol oxidase-9                                    534   1e-179   
gb|ACM43505.1|  polyphenoloxidase                                       533   4e-179   Camellia nitidissima
ref|XP_008383785.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    533   4e-179   
gb|AEG78292.1|  polyphenol oxidase                                      533   4e-179   
dbj|BAB64530.1|  polyphenol oxidase                                     533   6e-179   Pyrus pyrifolia [sha li]
gb|ABY84850.1|  polyphenol oxidase                                      528   2e-178   Cydonia oblonga [wen po]
gb|AFO55217.1|  chloroplast polyphenol oxidase I                        531   3e-178   
emb|CBZ41490.1|  polyphenol oxidase precursor (chloroplast)             530   8e-178   
gb|AEE61322.1|  polyphenol oxidase I                                    530   9e-178   
ref|XP_008224998.1|  PREDICTED: polyphenol oxidase, chloroplastic       528   2e-177   
gb|ABS88291.1|  polyphenol oxidase                                      528   4e-177   Pyrus x bretschneideri [bai li]
gb|AFL03159.1|  polyphenol oxidase                                      528   7e-177   
gb|KDP20931.1|  hypothetical protein JCGZ_21402                         527   1e-176   
ref|XP_007211392.1|  hypothetical protein PRUPE_ppa003257mg             526   1e-176   
ref|XP_004293526.1|  PREDICTED: polyphenol oxidase, chloroplastic...    526   2e-176   
gb|AEL95440.1|  polyphenol oxidase                                      526   2e-176   
gb|AHF20575.1|  polyphenol oxidase                                      526   5e-176   
gb|AII22006.1|  polyphenol oxidase-4                                    525   5e-176   
ref|XP_011047843.1|  PREDICTED: polyphenol oxidase, chloroplastic...    525   7e-176   
gb|ADR78836.1|  polyphenol oxidase                                      525   8e-176   
emb|CBZ41492.1|  polyphenol oxidase precursor (chloroplast)             524   1e-175   
gb|AEY78528.1|  polyphenol oxidase                                      523   9e-175   
dbj|BAA21676.1|  polyphenol oxidase                                     521   2e-174   Malus domestica [apple tree]
ref|XP_002316632.1|  hypothetical protein POPTR_0011s04710g             521   2e-174   Populus trichocarpa [western balsam poplar]
ref|XP_010686568.1|  PREDICTED: polyphenol oxidase, chloroplastic...    522   2e-174   
gb|AAW65103.1|  polyphenol oxidase                                      521   2e-174   Prunus salicina var. cordata
ref|XP_004293528.1|  PREDICTED: polyphenol oxidase, chloroplastic...    522   2e-174   
ref|XP_010100570.1|  Polyphenol oxidase                                 520   4e-174   
gb|AAU12257.1|  polyphenol oxidase                                      520   9e-174   Populus trichocarpa x Populus deltoides
ref|XP_010926766.1|  PREDICTED: polyphenol oxidase, chloroplastic...    519   1e-173   
ref|XP_010910928.1|  PREDICTED: polyphenol oxidase, chloroplastic...    518   6e-173   
ref|XP_002519016.1|  Polyphenol oxidase, chloroplast precursor, p...    516   2e-172   Ricinus communis
ref|XP_010647098.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    516   2e-172   
ref|XP_004146644.1|  PREDICTED: polyphenol oxidase, chloroplastic...    515   2e-172   
emb|CAN61652.1|  hypothetical protein VITISV_006012                     516   3e-172   Vitis vinifera
ref|XP_010245321.1|  PREDICTED: polyphenol oxidase, chloroplastic...    516   3e-172   
emb|CAQ76694.1|  polyphenol oxidase (chloroplast)                       515   4e-172   Taraxacum officinale [dandelion]
dbj|BAO79387.1|  polyphenol_oxidase                                     514   1e-171   
ref|XP_008442274.1|  PREDICTED: polyphenol oxidase, chloroplastic...    513   3e-171   
gb|AHC98007.1|  PPO                                                     511   1e-170   
gb|KDO75857.1|  hypothetical protein CISIN_1g042556mg                   511   1e-170   
ref|XP_010039984.1|  PREDICTED: polyphenol oxidase, chloroplastic...    511   3e-170   
ref|XP_006468218.1|  PREDICTED: polyphenol oxidase, chloroplastic...    510   4e-170   
ref|XP_011096441.1|  PREDICTED: aureusidin synthase-like                509   5e-170   
ref|XP_008778193.1|  PREDICTED: polyphenol oxidase, chloroplastic...    509   9e-170   
ref|XP_006449291.1|  hypothetical protein CICLE_v10014693mg             509   1e-169   
gb|AAK29782.1|AF261957_1  polyphenol oxidase                            509   2e-169   Ananas comosus
gb|AAO16863.1|  polyphenol oxidase                                      506   3e-169   Ananas comosus
gb|ADC92563.1|  polyphenol oxidase                                      508   5e-169   
dbj|BAA21677.1|  polyphenol oxidase                                     507   6e-169   Malus domestica [apple tree]
gb|ADI44162.1|  polyphenol oxidase 1                                    506   2e-168   
ref|XP_006370127.1|  hypothetical protein POPTR_0001s39940g             505   3e-168   
ref|XP_010054349.1|  PREDICTED: polyphenol oxidase, chloroplastic...    505   3e-168   
ref|XP_009408264.1|  PREDICTED: polyphenol oxidase, chloroplastic...    504   5e-168   
gb|EYU27938.1|  hypothetical protein MIMGU_mgv1a003402mg                504   5e-168   
ref|XP_011002749.1|  PREDICTED: polyphenol oxidase, chloroplastic...    503   1e-167   
dbj|BAM15848.1|  hypothetical protein                                   504   1e-167   
ref|XP_006370118.1|  hypothetical protein POPTR_0001s39660g             503   2e-167   
gb|AAO16865.1|  polyphenol oxidase                                      503   2e-167   Ananas comosus
gb|KCW76289.1|  hypothetical protein EUGRSUZ_D00659                     505   3e-167   
ref|XP_008779317.1|  PREDICTED: polyphenol oxidase, chloroplastic...    503   3e-167   
ref|XP_010910924.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    501   3e-167   
gb|AEQ30073.1|  polyphenol oxidase                                      502   7e-167   
gb|AGU01537.1|  polyphenol oxidase                                      503   7e-167   
ref|XP_006370120.1|  hypothetical protein POPTR_0001s39680g             500   3e-166   
ref|XP_006370115.1|  hypothetical protein POPTR_0001s39630g             499   4e-166   
ref|XP_010242012.1|  PREDICTED: polyphenol oxidase, chloroplastic...    499   9e-166   
gb|ACF17425.1|  polyphenol oxidase                                      499   1e-165   Camellia sinensis [black tea]
gb|ACN38060.1|  polyphenol oxidase                                      499   1e-165   Camellia sinensis [black tea]
gb|ABR10907.1|  polyphenol oxidase                                      499   1e-165   Camellia sinensis [black tea]
gb|AAU12256.1|  polyphenol oxidase                                      498   1e-165   Populus trichocarpa x Populus deltoides
gb|ADI44161.1|  polyphenol oxidase 2                                    498   4e-165   
gb|ABR24120.1|  polyphenol oxidase                                      498   5e-165   Camellia sinensis [black tea]
ref|XP_004303397.1|  PREDICTED: polyphenol oxidase, chloroplastic...    498   5e-165   
ref|XP_003545882.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    497   5e-165   
gb|AHH92831.1|  polyphenol oxidase                                      497   5e-165   
ref|XP_008346980.1|  PREDICTED: polyphenol oxidase, chloroplastic...    495   6e-165   
ref|XP_011014565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    496   6e-165   
ref|XP_008366047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    497   7e-165   
gb|ACN86310.1|  polyphenol oxidase                                      497   7e-165   Juglans regia
gb|ABF19601.1|  polyphenol oxidase                                      497   8e-165   Camellia ptilophylla
gb|ABR57236.1|  polyphenol oxidase                                      497   9e-165   Camellia sinensis [black tea]
gb|KHN08551.1|  Polyphenol oxidase A1, chloroplastic                    496   1e-164   
gb|ABF19602.1|  polyphenol oxidase                                      496   2e-164   Camellia sinensis var. assamica [Assam tea]
gb|ACR82078.1|  polyphenol oxidase                                      496   2e-164   Camellia sinensis [black tea]
ref|XP_004485748.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    496   2e-164   
gb|ACJ04908.1|  polyphenol oxidase                                      495   3e-164   Camellia sinensis [black tea]
ref|XP_003541740.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    496   3e-164   
ref|XP_009414395.1|  PREDICTED: polyphenol oxidase, chloroplastic...    495   4e-164   
ref|XP_008349220.1|  PREDICTED: polyphenol oxidase, chloroplastic...    496   4e-164   
gb|AII22007.1|  polyphenol oxidase-5                                    495   5e-164   
ref|XP_003593515.1|  Polyphenol oxidase                                 495   5e-164   
gb|AFC36521.1|  polyphenol oxidase                                      495   5e-164   
gb|ABR57235.1|  polyphenol oxidase                                      493   2e-163   Camellia sinensis [black tea]
dbj|BAM15849.1|  hypothetical protein                                   493   5e-163   
ref|XP_007025703.1|  Larreatricin hydroxylase                           492   5e-163   
sp|Q06215.1|PPO_VICFA  RecName: Full=Polyphenol oxidase A1, chlor...    492   8e-163   Vicia faba [broad bean]
ref|XP_008349252.1|  PREDICTED: polyphenol oxidase, chloroplastic...    489   1e-162   
ref|XP_006370125.1|  hypothetical protein POPTR_0001s39920g             490   1e-162   
ref|XP_006370117.1|  hypothetical protein POPTR_0001s39650g             488   3e-162   
ref|XP_007025706.1|  Larreatricin hydroxylase isoform 1                 490   3e-162   
ref|XP_003522849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    489   1e-161   
gb|ACJ04909.1|  polyphenol oxidase                                      489   1e-161   
sp|P43311.1|PPO_VITVI  RecName: Full=Polyphenol oxidase, chloropl...    488   3e-161   Vitis vinifera
ref|XP_003526194.1|  PREDICTED: polyphenol oxidase, chloroplastic...    487   6e-161   
gb|KHN46528.1|  Polyphenol oxidase A1, chloroplastic                    487   6e-161   
ref|XP_008371334.1|  PREDICTED: polyphenol oxidase, chloroplastic...    487   7e-161   
dbj|BAO79386.1|  polyphenol_oxidase                                     487   9e-161   
gb|ADF59059.2|  polyphenol oxidase V                                    487   9e-161   
gb|ABX09994.1|  chloroplast polyphenol oxidase                          485   3e-160   Taraxacum officinale [dandelion]
ref|XP_007159290.1|  hypothetical protein PHAVU_002G225600g             485   3e-160   
ref|XP_008371333.1|  PREDICTED: polyphenol oxidase, chloroplastic...    485   4e-160   
gb|AGC54425.1|  polyphenol oxidase 1                                    485   5e-160   
gb|KHN46329.1|  Polyphenol oxidase A1, chloroplastic                    484   1e-159   
gb|ADP89908.1|  polyphenol oxidase                                      479   2e-159   
ref|XP_011083298.1|  PREDICTED: polyphenol oxidase I, chloroplast...    482   2e-159   
gb|AAP33165.1|  polyphenol oxidase                                      483   4e-159   Medicago sativa [alfalfa]
gb|ABK62804.1|  polyphenol oxidase                                      481   4e-159   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006594327.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    484   4e-159   
ref|XP_008364152.1|  PREDICTED: polyphenol oxidase, chloroplastic...    481   6e-159   
gb|AAG21983.1|AF263611_1  polyphenol oxidase PPO1                       480   6e-159   Populus trichocarpa x Populus deltoides
ref|NP_001268045.1|  polyphenol oxidase, chloroplastic                  481   9e-159   
ref|XP_008364151.1|  PREDICTED: polyphenol oxidase, chloroplastic...    480   1e-158   
gb|AFO55218.1|  chloroplast polyphenol oxidase II                       480   2e-158   
ref|XP_002316852.1|  hypothetical protein POPTR_0011s10950g             479   3e-158   Populus trichocarpa [western balsam poplar]
gb|AAT75166.1|  polyphenol oxidase                                      479   5e-158   Camellia sinensis [black tea]
gb|ADG85002.1|  polyphenol oxidase                                      479   5e-158   
ref|XP_008371330.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    479   5e-158   
ref|XP_008225030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    479   6e-158   
gb|AAK53414.1|AF368291_1  polyphenol oxidase                            478   9e-158   Populus tremuloides
gb|ABI96948.1|  putative polyphenol oxidase                             473   9e-158   Sorbus californica
ref|XP_006347083.1|  PREDICTED: polyphenol oxidase, chloroplastic...    479   1e-157   
gb|ACB12084.1|  polyphenol oxidase                                      478   1e-157   Triticum dicoccoides [wild emmer wheat]
gb|ABK62801.1|  polyphenol oxidase                                      477   2e-157   Triticum aestivum [Canadian hard winter wheat]
gb|ABI96926.1|  putative polyphenol oxidase                             473   2e-157   Cercocarpus betuloides
gb|ABI96930.1|  putative polyphenol oxidase                             472   2e-157   Crataegus monogyna
gb|AEY79824.1|  polyphenol oxidase                                      477   3e-157   
emb|CAN62983.1|  hypothetical protein VITISV_035472                     478   3e-157   Vitis vinifera
ref|XP_004232833.2|  PREDICTED: polyphenol oxidase, chloroplastic...    478   3e-157   
ref|XP_009407067.1|  PREDICTED: polyphenol oxidase, chloroplastic...    476   4e-157   
ref|XP_010100566.1|  Polyphenol oxidase                                 476   5e-157   
gb|ABI96935.1|  putative polyphenol oxidase                             471   7e-157   Heteromeles arbutifolia
sp|Q6UIL3.1|LAHY_LARTR  RecName: Full=(+)-larreatricin hydroxylas...    476   1e-156   Larrea tridentata
gb|ACB12081.1|  polyphenol oxidase                                      475   1e-156   Triticum urartu
gb|ABI96928.1|  putative polyphenol oxidase                             471   1e-156   Chamaebatia foliolosa
ref|XP_007214660.1|  hypothetical protein PRUPE_ppa003171mg             475   2e-156   
gb|ABK62802.1|  polyphenol oxidase                                      474   2e-156   Triticum aestivum [Canadian hard winter wheat]
gb|ABI96934.1|  putative polyphenol oxidase                             470   2e-156   Gillenia trifoliata [Bowman's root]
gb|ABI96927.1|  putative polyphenol oxidase                             469   4e-156   Chaenomeles speciosa [boke]
gb|ACB12082.1|  polyphenol oxidase                                      474   4e-156   Triticum monococcum subsp. aegilopoides [wild einkorn]
gb|AEY79826.1|  polyphenol oxidase                                      473   6e-156   
dbj|BAH36897.1|  polyphenol oxidase                                     473   6e-156   Triticum aestivum [Canadian hard winter wheat]
gb|AAK56323.1|AF380300_1  polyphenol oxidase 2 precursor                473   7e-156   Malus domestica [apple tree]
gb|EYU26238.1|  hypothetical protein MIMGU_mgv1a025156mg                473   9e-156   
gb|EYU26236.1|  hypothetical protein MIMGU_mgv1a027162mg                473   1e-155   
gb|ACB12083.1|  polyphenol oxidase                                      473   1e-155   Triticum monococcum [einkorn wheat]
gb|ABK62803.1|  polyphenol oxidase                                      473   1e-155   Triticum aestivum [Canadian hard winter wheat]
gb|ACB12086.1|  polyphenol oxidase                                      472   2e-155   Aegilops tauschii
gb|ABI96933.1|  putative polyphenol oxidase                             467   3e-155   Gillenia stipulata [American-ipecac]
gb|ABI96939.1|  putative polyphenol oxidase                             467   4e-155   Neillia thyrsiflora
gb|AAC28935.1|  polyphenol oxidase precursor                            472   4e-155   Prunus armeniaca
ref|XP_009334541.1|  PREDICTED: polyphenol oxidase, chloroplastic...    472   5e-155   
ref|XP_008225003.1|  PREDICTED: polyphenol oxidase, chloroplastic...    471   5e-155   
gb|AAS00454.1|  polyphenol oxidase                                      469   6e-155   Triticum aestivum [Canadian hard winter wheat]
gb|ABI96932.1|  putative polyphenol oxidase                             466   7e-155   Fallugia paradoxa
gb|ABI96946.1|  putative polyphenol oxidase                             466   9e-155   Pyrus communis subsp. caucasica
gb|AFO55219.1|  chloroplast polyphenol oxidase III                      471   1e-154   
ref|XP_009334704.1|  PREDICTED: polyphenol oxidase, chloroplastic...    471   1e-154   
gb|ABI96937.1|  putative polyphenol oxidase                             465   2e-154   Kageneckia oblonga
gb|ADF59058.2|  polyphenol oxidase IV                                   469   3e-154   
ref|XP_010100567.1|  Polyphenol oxidase                                 469   4e-154   
gb|ABI96951.1|  putative polyphenol oxidase                             464   4e-154   Vauquelinia californica
gb|AEM45934.1|  polyphenol oxidase                                      468   5e-154   
ref|XP_004293563.1|  PREDICTED: polyphenol oxidase, chloroplastic...    469   5e-154   
gb|EPS59410.1|  polyphenoloxidase                                       468   6e-154   
ref|XP_009334438.1|  PREDICTED: polyphenol oxidase, chloroplastic...    468   7e-154   
gb|AED02598.1|  polyphenol oxidase                                      468   7e-154   
gb|AEM45933.1|  polyphenol oxidase                                      467   1e-153   
ref|XP_008225000.1|  PREDICTED: polyphenol oxidase, chloroplastic...    468   1e-153   
dbj|BAM15846.1|  hypothetical protein                                   468   2e-153   
ref|XP_011016645.1|  PREDICTED: polyphenol oxidase, chloroplastic...    466   2e-153   
gb|AEM45935.1|  polyphenol oxidase                                      466   3e-153   
gb|ABI96945.1|  putative polyphenol oxidase                             462   3e-153   Prunus mexicana [Mexican plum]
ref|XP_011098121.1|  PREDICTED: polyphenol oxidase I, chloroplast...    466   5e-153   
ref|XP_008371328.1|  PREDICTED: polyphenol oxidase, chloroplastic...    465   1e-152   
gb|ABI96941.1|  putative polyphenol oxidase                             460   1e-152   Physocarpus capitatus
ref|XP_010686567.1|  PREDICTED: polyphenol oxidase, chloroplastic...    465   1e-152   
ref|XP_008224999.1|  PREDICTED: polyphenol oxidase, chloroplastic...    465   2e-152   
gb|AAW58109.2|  polyphenol oxidase                                      465   2e-152   Prunus salicina var. cordata
ref|XP_011082867.1|  PREDICTED: polyphenol oxidase I, chloroplast...    464   2e-152   
ref|XP_008371327.1|  PREDICTED: polyphenol oxidase, chloroplastic...    464   2e-152   
ref|XP_009773173.1|  PREDICTED: polyphenol oxidase, chloroplastic...    465   2e-152   
ref|XP_008225002.1|  PREDICTED: polyphenol oxidase I, chloroplast...    465   2e-152   
gb|ACM09905.1|  polyphenol oxidase 1/4                                  465   3e-152   Trifolium pratense [peavine clover]
ref|XP_009610962.1|  PREDICTED: polyphenol oxidase, chloroplastic...    465   3e-152   
ref|XP_007211389.1|  hypothetical protein PRUPE_ppa003190mg             464   4e-152   
gb|ABI96944.1|  putative polyphenol oxidase                             458   7e-152   Prunus dulcis [sweet almond]
gb|AAK13244.1|  polyphenol oxidase                                      464   7e-152   Trifolium pratense [peavine clover]
dbj|BAA08234.1|  polyphenol oxidase                                     463   8e-152   Phytolacca americana [common pokeberry]
gb|AAK13242.1|  polyphenol oxidase                                      463   1e-151   Trifolium pratense [peavine clover]
ref|XP_007148200.1|  hypothetical protein PHAVU_006G188500g             462   2e-151   
gb|AEM45931.1|  polyphenol oxidase                                      461   2e-151   
gb|ABI96942.1|  putative polyphenol oxidase                             457   2e-151   Dasiphora fruticosa
gb|AEM45936.1|  polyphenol oxidase                                      461   2e-151   
gb|ABA62017.1|  polyphenol oxidase                                      461   3e-151   
gb|AEY79825.1|  polyphenol oxidase                                      460   3e-151   
gb|AHZ59731.1|  copper-containing polyphenol oxidase                    460   4e-151   
emb|CDP06099.1|  unnamed protein product                                461   4e-151   
dbj|BAH36895.1|  polyphenol oxidase                                     459   6e-151   Triticum aestivum [Canadian hard winter wheat]
gb|ABI96929.1|  putative polyphenol oxidase                             455   1e-150   Chamaebatiaria millefolium
gb|EYU34166.1|  hypothetical protein MIMGU_mgv1a003279mg                460   2e-150   
ref|XP_010686566.1|  PREDICTED: polyphenol oxidase, chloroplastic...    460   2e-150   
ref|XP_010686565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    460   2e-150   
gb|ABI96938.1|  putative polyphenol oxidase                             454   3e-150   Lyonothamnus floribundus
ref|XP_009782447.1|  PREDICTED: polyphenol oxidase, chloroplastic...    458   1e-149   
gb|EYU34161.1|  hypothetical protein MIMGU_mgv1a003495mg                457   1e-149   
ref|XP_011082866.1|  PREDICTED: polyphenol oxidase I, chloroplast...    456   2e-149   
gb|ABI96950.1|  putative polyphenol oxidase                             452   3e-149   Spiraea densiflora
ref|XP_003593517.1|  Polyphenol oxidase A1                              457   3e-149   
ref|XP_008345876.1|  PREDICTED: polyphenol oxidase, chloroplastic...    456   5e-149   
gb|ABM68052.1|  polyphenol oxidase                                      456   6e-149   Trifolium pratense [peavine clover]
gb|ABI96925.1|  putative polyphenol oxidase                             450   1e-148   Adenostoma fasciculatum [chamise]
gb|ABM68051.1|  polyphenol oxidase                                      456   1e-148   Trifolium pratense [peavine clover]
gb|AFH00996.1|  polyphenol oxidase II                                   455   1e-148   
gb|ABI96949.1|  putative polyphenol oxidase                             450   2e-148   Spiraea cantoniensis
gb|AHX26182.1|  polyphenol oxidase                                      453   2e-148   
gb|ABI96940.1|  putative polyphenol oxidase                             449   2e-148   Oemleria cerasiformis [Oregon plum]
ref|XP_009628381.1|  PREDICTED: polyphenol oxidase E, chloroplast...    454   3e-148   
gb|ABI96931.1|  putative polyphenol oxidase                             449   3e-148   Exochorda racemosa
gb|ABI96943.1|  putative polyphenol oxidase                             449   3e-148   Prinsepia sinensis
gb|ABI96936.1|  putative polyphenol oxidase                             449   5e-148   Holodiscus microphyllus
sp|Q9FRX6.1|AS1_ANTMA  RecName: Full=Aureusidin synthase; Short=A...    452   5e-148   Antirrhinum majus [garden snapdragon]
ref|XP_009603530.1|  PREDICTED: polyphenol oxidase E, chloroplast...    453   6e-148   
ref|XP_011098120.1|  PREDICTED: polyphenol oxidase I, chloroplast...    453   6e-148   
dbj|BAJ10872.1|  polyphenol oxidase                                     452   7e-148   
dbj|BAK03848.1|  predicted protein                                      452   7e-148   
gb|AES87890.2|  polyphenoloxidase                                       454   7e-148   
gb|AGC55012.1|  polyphenoloxidase                                       452   2e-147   
ref|XP_010686675.1|  PREDICTED: polyphenol oxidase, chloroplastic...    451   4e-147   
ref|XP_008663490.1|  PREDICTED: polyphenol oxidase, chloroplastic...    448   1e-146   
gb|ABN13632.1|  polyphenol oxidase                                      447   2e-146   Doritis pulcherrima x Phalaenopsis hybrid cultivar
ref|XP_010100568.1|  Polyphenol oxidase                                 448   7e-146   
ref|XP_007025704.1|  Larreatricin hydroxylase                           445   1e-145   
gb|EYU26237.1|  hypothetical protein MIMGU_mgv1a026995mg                446   2e-145   
ref|XP_010227274.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    445   1e-144   
ref|XP_009773174.1|  PREDICTED: polyphenol oxidase, chloroplastic...    445   3e-144   
ref|XP_008236801.1|  PREDICTED: polyphenol oxidase, chloroplastic...    442   4e-144   
ref|XP_011098119.1|  PREDICTED: polyphenol oxidase I, chloroplast...    443   5e-144   
gb|EYU34165.1|  hypothetical protein MIMGU_mgv1a003246mg                443   8e-144   
ref|XP_006365391.1|  PREDICTED: polyphenol oxidase E, chloroplast...    443   9e-144   
dbj|BAA08235.1|  polyphenol oxidase                                     437   2e-143   Phytolacca americana [common pokeberry]
emb|CCA94610.1|  polyphenol oxidase precursor (chloroplast)             441   3e-143   
ref|XP_003567197.1|  PREDICTED: polyphenol oxidase I, chloroplast...    440   9e-143   
emb|CBZ41491.1|  polyphenol oxidase precursor (chloroplast)             440   1e-142   
ref|XP_002446944.1|  hypothetical protein SORBIDRAFT_06g025570          439   1e-142   Sorghum bicolor [broomcorn]
sp|Q08307.1|PPOE_SOLLC  RecName: Full=Polyphenol oxidase E, chlor...    439   1e-142   Solanum lycopersicum
gb|AHX26181.1|  polyphenol oxidase                                      438   2e-142   
ref|XP_010325653.1|  PREDICTED: polyphenol oxidase E, chloroplastic     438   3e-142   
gb|ABI96947.1|  putative polyphenol oxidase                             433   5e-142   Rhodotypos scandens [jetbead]
ref|XP_007211883.1|  hypothetical protein PRUPE_ppa003608mg             437   7e-142   
dbj|BAJ10871.1|  polyphenol oxidase                                     437   9e-142   
gb|AHX26180.1|  polyphenol oxidase                                      435   2e-141   
dbj|BAP82256.1|  polyphenol oxidase                                     435   3e-141   
gb|AFW59500.1|  putative polyphenol oxidase family protein              437   4e-141   
gb|AAK13243.1|  polyphenol oxidase                                      436   5e-141   
emb|CCD61123.1|  polyphenol oxidase precursor (chloroplast)             436   8e-141   
dbj|BAP82254.1|  polyphenol oxidase                                     434   9e-141   
dbj|BAP82255.1|  polyphenol oxidase                                     434   1e-140   
ref|XP_011082856.1|  PREDICTED: polyphenol oxidase I, chloroplast...    433   2e-140   
ref|XP_002458623.1|  hypothetical protein SORBIDRAFT_03g036870          434   2e-140   
ref|XP_004246033.1|  PREDICTED: polyphenol oxidase F, chloroplastic     434   2e-140   
ref|XP_004972211.1|  PREDICTED: polyphenol oxidase, chloroplastic...    434   3e-140   
ref|XP_009408745.1|  PREDICTED: polyphenol oxidase, chloroplastic...    431   3e-140   
sp|Q06355.1|PPOB_SOLTU  RecName: Full=Catechol oxidase B, chlorop...    433   3e-140   
ref|XP_006370128.1|  hypothetical protein POPTR_0001s39950g             431   1e-139   
ref|XP_002446945.1|  hypothetical protein SORBIDRAFT_06g025580          430   1e-139   
gb|ABG23097.1|  polyphenol oxidase                                      430   3e-139   
gb|ABG23077.1|  polyphenol oxidase                                      430   3e-139   
dbj|BAP82257.1|  polyphenol oxidase                                     430   3e-139   
gb|ABG23059.1|  polyphenol oxidase                                      430   3e-139   
gb|ABG23092.1|  polyphenol oxidase                                      430   3e-139   
ref|XP_006355239.1|  PREDICTED: catechol oxidase B, chloroplastic       430   4e-139   
gb|ABG23093.1|  polyphenol oxidase                                      430   4e-139   
gb|ABG23065.1|  polyphenol oxidase                                      430   4e-139   
gb|ACS15326.1|  polyphenol oxidase                                      429   5e-139   
gb|ABG23086.1|  polyphenol oxidase                                      430   5e-139   
ref|XP_009767375.1|  PREDICTED: polyphenol oxidase E, chloroplast...    430   5e-139   
gb|ACS15337.1|  polyphenol oxidase                                      429   5e-139   
gb|ACS15330.1|  polyphenol oxidase                                      429   5e-139   
gb|ABG23057.1|  polyphenol oxidase                                      430   5e-139   
gb|EPS57764.1|  polyphenol oxidase                                      428   5e-139   
gb|AAA02877.1|  propolyphenol oxidase                                   430   6e-139   
gb|ABG23098.1|  polyphenol oxidase                                      429   7e-139   
ref|XP_010100571.1|  Polyphenol oxidase                                 428   9e-139   
gb|ABG23062.1|  polyphenol oxidase                                      429   1e-138   
gb|ABG23085.1|  polyphenol oxidase                                      429   1e-138   
gb|ABG23083.1|  polyphenol oxidase                                      429   1e-138   
gb|ACS15319.1|  polyphenol oxidase                                      428   1e-138   
gb|ABG23084.1|  polyphenol oxidase                                      429   1e-138   
emb|CAA73103.1|  polyphenol oxidase                                     429   2e-138   
sp|Q08296.1|PPOF_SOLLC  RecName: Full=Polyphenol oxidase F, chlor...    429   2e-138   
gb|AAB22610.1|  polyphenoloxidase                                       428   2e-138   
gb|ABG23070.1|  polyphenol oxidase                                      427   4e-138   
emb|CAH66802.1|  H0215F08.13                                            427   4e-138   
gb|ABG23075.1|  polyphenol oxidase                                      427   4e-138   
ref|XP_004246041.1|  PREDICTED: polyphenol oxidase E, chloroplast...    428   4e-138   
ref|NP_001053932.1|  Os04g0624500                                       427   5e-138   
gb|ABG23073.1|  polyphenol oxidase                                      427   8e-138   
gb|ABG23042.1|  polyphenol oxidase                                      426   1e-137   
ref|XP_009590067.1|  PREDICTED: polyphenol oxidase E, chloroplast...    426   3e-137   
emb|CAE03510.2|  OSJNBa0053K19.18                                       424   4e-137   
gb|ABG23081.1|  polyphenol oxidase                                      425   5e-137   
gb|ABG23045.1|  polyphenol oxidase                                      424   6e-137   
gb|ABG23047.1|  polyphenol oxidase                                      424   6e-137   
gb|ABG23061.1|  polyphenol oxidase                                      424   8e-137   
gb|ABG23067.1|  polyphenol oxidase                                      424   1e-136   
gb|ABG23066.1|  polyphenol oxidase                                      423   2e-136   
ref|XP_011082857.1|  PREDICTED: polyphenol oxidase I, chloroplast...    423   3e-136   
gb|ABG23072.1|  polyphenol oxidase                                      422   3e-136   
gb|ABE96885.1|  polyphenol oxidase                                      420   4e-136   
pdb|2P3X|A  Chain A, Crystal Structure Of Grenache (Vitis Vinifer...    414   4e-136   
dbj|BAH36896.1|  polyphenol oxidase                                     421   4e-136   
gb|ABG23060.1|  polyphenol oxidase                                      422   5e-136   
gb|AGK83468.1|  polyphenol oxidase                                      422   5e-136   
ref|XP_011013403.1|  PREDICTED: polyphenol oxidase, chloroplastic...    422   5e-136   
ref|XP_003552355.1|  PREDICTED: polyphenol oxidase, chloroplastic...    422   6e-136   
gb|ABG23087.1|  polyphenol oxidase                                      422   7e-136   
gb|ABG23090.1|  polyphenol oxidase                                      421   1e-135   
gb|AEO00529.1|  polyphenol oxidase                                      420   3e-135   
gb|ACB12087.1|  truncated polyphenol oxidase                            416   3e-135   
gb|KHN46328.1|  Polyphenol oxidase A1, chloroplastic                    421   4e-135   
ref|XP_007139960.1|  hypothetical protein PHAVU_008G073200g             420   5e-135   
dbj|BAP82258.1|  polyphenol oxidase                                     419   1e-134   
ref|XP_008674942.1|  PREDICTED: polyphenol oxidase, chloroplastic...    419   1e-134   
gb|EEC78048.1|  hypothetical protein OsI_17489                          418   2e-134   
gb|AFS28698.1|  putative polyphenol oxidase                             414   2e-134   
gb|AFS28697.1|  putative polyphenol oxidase                             414   2e-134   
ref|XP_009791071.1|  PREDICTED: polyphenol oxidase E, chloroplast...    418   3e-134   
gb|EYU34163.1|  hypothetical protein MIMGU_mgv1a003224mg                418   3e-134   
ref|XP_003529305.2|  PREDICTED: polyphenol oxidase A1, chloroplastic    418   6e-134   
ref|NP_001149552.1|  polyphenol oxidase II                              413   7e-134   
gb|ADY18410.1|  chloroplast polyphenol oxidase precursor                416   8e-134   
ref|XP_009624738.1|  PREDICTED: polyphenol oxidase E, chloroplast...    417   9e-134   
ref|XP_009588337.1|  PREDICTED: polyphenol oxidase E, chloroplast...    415   4e-133   
gb|KHN03175.1|  Polyphenol oxidase, chloroplastic                       412   3e-132   
ref|XP_003551647.1|  PREDICTED: polyphenol oxidase, chloroplastic       413   3e-132   
ref|XP_003605693.1|  Polyphenol oxidase A1                              407   5e-132   
ref|XP_010100565.1|  Polyphenol oxidase                                 412   5e-132   
ref|XP_008383783.1|  PREDICTED: polyphenol oxidase I, chloroplast...    410   2e-131   
gb|EYU34157.1|  hypothetical protein MIMGU_mgv1a003435mg                410   2e-131   
ref|XP_009771442.1|  PREDICTED: polyphenol oxidase E, chloroplast...    410   3e-131   
gb|EYU34162.1|  hypothetical protein MIMGU_mgv1a005754mg                405   8e-131   
ref|XP_008225001.1|  PREDICTED: polyphenol oxidase I, chloroplast...    409   2e-130   
gb|AII22009.1|  polyphenol oxidase-7                                    407   6e-130   
gb|AAA85122.1|  polyphenol oxidase                                      406   1e-129   
gb|AGK88243.1|  polyphenol oxidase                                      405   2e-129   
gb|ACJ70698.1|  polyphenol oxidase                                      405   2e-129   
gb|ADY18412.1|  chloroplast polyphenol oxidase precursor                405   2e-129   
ref|XP_007214570.1|  hypothetical protein PRUPE_ppa019877mg             405   7e-129   
gb|EMT09670.1|  Polyphenol oxidase, chloroplastic                       397   1e-128   
ref|XP_011076536.1|  PREDICTED: polyphenol oxidase I, chloroplast...    404   1e-128   
ref|XP_006653782.1|  PREDICTED: polyphenol oxidase, chloroplastic...    400   3e-128   
ref|XP_006370119.1|  hypothetical protein POPTR_0001s39670g             396   3e-128   
ref|XP_010686564.1|  PREDICTED: polyphenol oxidase, chloroplastic...    402   6e-128   
gb|ACN78382.1|  polyphenol oxidase                                      396   2e-127   
gb|AAT06525.1|  polyphenol oxidase                                      393   5e-127   
ref|XP_003528444.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    394   2e-125   
ref|XP_009616674.1|  PREDICTED: polyphenol oxidase E, chloroplast...    395   3e-125   
ref|XP_006365382.1|  PREDICTED: polyphenol oxidase B, chloroplast...    394   8e-125   
gb|EEC71623.1|  hypothetical protein OsI_04042                          391   2e-124   
ref|XP_004246032.1|  PREDICTED: polyphenol oxidase B, chloroplastic     392   2e-124   
emb|CCD61124.1|  polyphenol oxidase precursor (chloroplast)             391   1e-123   
gb|KHN08552.1|  Polyphenol oxidase A1, chloroplastic                    389   1e-123   
gb|ADY18411.1|  chloroplast polyphenol oxidase precursor                390   1e-123   
ref|XP_003541548.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    390   2e-123   
gb|AII22005.1|  polyphenol oxidase-3                                    391   2e-123   
gb|AII22008.1|  polyphenol oxidase-6                                    390   3e-123   
gb|ACT22523.1|  chloroplast polyphenol oxidase precursor                390   3e-123   
ref|XP_002458568.1|  hypothetical protein SORBIDRAFT_03g035850          389   7e-123   
gb|AHN09736.1|  aurone synthase                                         389   7e-123   
ref|XP_006646401.1|  PREDICTED: polyphenol oxidase, chloroplastic...    387   2e-122   
gb|AFJ79639.1|  chloroplast polyphenol oxidase                          386   5e-122   
gb|AFJ79643.1|  chloroplast polyphenol oxidase                          386   6e-122   
gb|AFJ79641.1|  chloroplast polyphenol oxidase                          386   7e-122   
ref|XP_004246030.1|  PREDICTED: polyphenol oxidase D, chloroplastic     385   8e-122   
ref|XP_010680714.1|  PREDICTED: polyphenol oxidase, chloroplastic...    386   9e-122   
gb|ACS15320.1|  polyphenol oxidase                                      378   5e-121   
ref|XP_011098100.1|  PREDICTED: polyphenol oxidase I, chloroplast...    383   8e-121   
gb|AFJ79640.1|  chloroplast polyphenol oxidase                          382   1e-120   
gb|ACS15325.1|  polyphenol oxidase                                      377   2e-120   
gb|AII22010.1|  polyphenol oxidase-8                                    382   4e-120   
ref|XP_006365383.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    381   1e-119   
gb|KHN03178.1|  Polyphenol oxidase II, chloroplastic                    373   1e-119   
emb|CCD61126.1|  polyphenol oxidase precursor (chloroplast)             381   2e-119   
ref|XP_009352971.1|  PREDICTED: polyphenol oxidase, chloroplastic...    374   2e-119   
emb|CAH66801.1|  H0215F08.12                                            376   3e-119   
ref|XP_006377743.1|  hypothetical protein POPTR_0011s10940g             373   5e-119   
ref|XP_004246029.2|  PREDICTED: polyphenol oxidase A, chloroplast...    379   5e-119   
dbj|BAB89047.1|  putative polyphenol oxidase                            377   6e-119   
emb|CCD61125.1|  polyphenol oxidase precursor (chloroplast)             378   2e-118   
gb|AAC69365.1|  polyphenol oxidase                                      369   6e-118   
gb|EMT06707.1|  Polyphenol oxidase A1, chloroplastic                    375   6e-118   
ref|XP_002438681.1|  hypothetical protein SORBIDRAFT_10g024220          375   9e-118   
ref|XP_006644832.1|  PREDICTED: polyphenol oxidase, chloroplastic...    375   1e-117   
emb|CDM84541.1|  unnamed protein product                                373   1e-117   
emb|CDP06098.1|  unnamed protein product                                374   2e-117   
ref|XP_007025707.1|  Larreatricin hydroxylase isoform 2                 368   3e-117   
gb|AAA85121.1|  polyphenol oxidase                                      374   3e-117   
ref|XP_006595376.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    375   4e-117   
gb|ADG56700.1|  chloroplast polyphenol oxidase precursor                374   6e-117   
gb|KHN07285.1|  Polyphenol oxidase A1, chloroplastic                    372   6e-117   
ref|NP_001147867.1|  polyphenol oxidase precursor                       372   1e-116   
gb|AFW87458.1|  putative polyphenol oxidase family protein              370   3e-116   
dbj|BAJ90144.1|  predicted protein                                      370   4e-116   
gb|ADY18409.1|  chloroplast polyphenol oxidase precursor                370   7e-116   
gb|EMS49817.1|  Polyphenol oxidase, chloroplastic                       369   1e-115   
sp|Q08306.2|PPOD_SOLLC  RecName: Full=Polyphenol oxidase D, chlor...    369   2e-115   
ref|XP_003567194.1|  PREDICTED: polyphenol oxidase I, chloroplast...    369   2e-115   
gb|EEC78047.1|  hypothetical protein OsI_17486                          366   2e-115   
ref|XP_007033808.1|  Uncharacterized protein TCM_019921                 364   6e-115   
sp|Q08303.2|PPOA_SOLLC  RecName: Full=Polyphenol oxidase A, chlor...    367   6e-114   
ref|XP_010680713.1|  PREDICTED: polyphenol oxidase, chloroplastic...    365   1e-113   
ref|XP_004965883.1|  PREDICTED: aureusidin synthase-like                364   2e-113   
pir||S34786  catechol oxidase (EC 1.10.3.1) precursor - potato (f...    363   4e-113
sp|Q08305.1|PPOC_SOLLC  RecName: Full=Polyphenol oxidase C, chlor...    363   8e-113   
ref|XP_003564367.2|  PREDICTED: polyphenol oxidase I, chloroplast...    362   1e-112   
ref|XP_002990241.1|  hypothetical protein SELMODRAFT_185154             361   1e-112   
gb|ADF59060.1|  polyphenol oxidase 6 precursor                          362   2e-112   
gb|AFH00998.1|  polyphenol oxidase III                                  362   2e-112   
ref|XP_004246037.1|  PREDICTED: polyphenol oxidase B, chloroplast...    360   5e-112   
dbj|BAM15847.1|  hypothetical protein                                   360   1e-111   
gb|ABG23091.1|  polyphenol oxidase                                      357   5e-111   
ref|XP_002961891.1|  hypothetical protein SELMODRAFT_164684             357   6e-111   
gb|ABG23046.1|  polyphenol oxidase                                      357   6e-111   
gb|ABG23096.1|  polyphenol oxidase                                      353   1e-109   
ref|XP_010099507.1|  Polyphenol oxidase                                 350   2e-109   
gb|AGT28745.1|  aurone synthase                                         354   2e-109   
ref|XP_010645091.1|  PREDICTED: aureusidin synthase-like                352   4e-109   
ref|XP_010680712.1|  PREDICTED: polyphenol oxidase, chloroplastic...    352   6e-109   
gb|AGT28746.1|  aurone synthase                                         352   1e-108   
ref|XP_010263628.1|  PREDICTED: aureusidin synthase-like                351   1e-108   
ref|XP_010110269.1|  Polyphenol oxidase                                 349   2e-108   
gb|AFJ79642.1|  chloroplast polyphenol oxidase                          350   4e-108   
gb|ACR61398.1|  polyphenol oxidase                                      350   5e-108   
dbj|BAM15845.1|  hypothetical protein                                   350   8e-108   
ref|XP_010099505.1|  Polyphenol oxidase                                 345   1e-107   
ref|XP_010254790.1|  PREDICTED: aureusidin synthase-like                348   3e-107   
gb|AFN53703.1|  putative phenol oxidase                                 343   4e-107   
gb|ABJ90144.1|  polyphenol oxidase                                      347   9e-107   
ref|XP_004295273.1|  PREDICTED: polyphenol oxidase, chloroplastic...    343   1e-105   
ref|XP_006583806.1|  PREDICTED: polyphenol oxidase II, chloroplas...    343   1e-105   
ref|XP_004292030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    340   9e-105   
ref|XP_007042162.1|  Uncharacterized protein isoform 4                  339   1e-104   
ref|XP_008809956.1|  PREDICTED: polyphenol oxidase I, chloroplast...    340   2e-104   
ref|XP_010921586.1|  PREDICTED: polyphenol oxidase, chloroplastic...    340   2e-104   
ref|XP_007042160.1|  Uncharacterized protein isoform 2                  339   2e-104   
ref|XP_006370123.1|  hypothetical protein POPTR_0001s39900g             333   3e-104   
ref|XP_006583805.1|  PREDICTED: polyphenol oxidase II, chloroplas...    340   3e-104   
ref|XP_007042159.1|  Uncharacterized protein isoform 1                  339   7e-104   
ref|XP_010910148.1|  PREDICTED: polyphenol oxidase, chloroplastic...    337   5e-103   
gb|ACJ76786.1|  tyrosinase polyphenol oxidase                           337   6e-103   
gb|ACB45128.1|  polyphenol oxidase                                      326   2e-102   
ref|XP_006583808.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    335   3e-102   
ref|XP_002980542.1|  hypothetical protein SELMODRAFT_178281             334   4e-102   
ref|XP_002306113.2|  hypothetical protein POPTR_0004s16380g             333   9e-102   
ref|XP_002976938.1|  hypothetical protein SELMODRAFT_175858             333   1e-101   
emb|CCE45701.1|  polyphenol oxidase precursor (chloroplast)             333   3e-101   
ref|XP_002976812.1|  hypothetical protein SELMODRAFT_175861             332   3e-101   
ref|XP_002980680.1|  hypothetical protein SELMODRAFT_178277             331   9e-101   
ref|XP_011037508.1|  PREDICTED: aureusidin synthase-like                329   4e-100   
ref|XP_006384507.1|  hypothetical protein POPTR_0004s16380g             328   6e-100   
gb|AEH41425.1|  polyphenol oxidase-like protein                         328   7e-100   
ref|XP_002974314.1|  hypothetical protein SELMODRAFT_101213             327   4e-99    
ref|XP_009388016.1|  PREDICTED: polyphenol oxidase, chloroplastic...    323   1e-97    
ref|XP_002970835.1|  hypothetical protein SELMODRAFT_94153              321   2e-97    
ref|XP_009388329.1|  PREDICTED: polyphenol oxidase, chloroplastic...    322   2e-97    
sp|P43310.1|PPO_SPIOL  RecName: Full=Polyphenol oxidase, chloropl...    323   2e-97    
emb|CAA62377.1|  polyphenol oxidase                                     323   3e-97    
ref|XP_002969567.1|  hypothetical protein SELMODRAFT_170754             320   8e-97    
emb|CBI37659.3|  unnamed protein product                                318   9e-97    
gb|AAK29783.1|  polyphenol oxidase                                      311   3e-96    
gb|ACR61399.1|  polyphenol oxidase                                      317   4e-96    
gb|AAW58110.1|  polyphenol oxidase                                      305   7e-96    
ref|XP_008446626.1|  PREDICTED: polyphenol oxidase I, chloroplast...    321   2e-95    
ref|XP_010110268.1|  Polyphenol oxidase A1                              315   3e-95    



>sp|Q9MB14.2|PPO2_IPOBA RecName: Full=Polyphenol oxidase II, chloroplastic; Short=PPO-II; 
AltName: Full=Catechol oxidase II; Flags: Precursor [Ipomoea 
batatas]
Length=588

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/587 (67%), Positives = 463/587 (79%), Gaps = 9/587 (2%)
 Frame = -1

Query  1891  YTAQKETPMASLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS-KI  1715
             +T    T  A  +P    ++     P+P  S +HI T        KV CNA +G    K+
Sbjct  4     FTTSPCTSAAPKTPKSLSSSATISSPLPKPSQIHIAT-AKRTHHFKVSCNAPNGDSQPKL  62

Query  1714  DRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGR  1544
             DRRDV+LGLGGL GAA+L     A A PI APE+SKCVVPP DLP  A VDNCCPP A  
Sbjct  63    DRRDVLLGLGGLAGAASLINNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDNCCPPLATN  122

Query  1543  YLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYC  1364
              + Y++P  SP+ M++RPA+HR+D +Y  KF KA+ +MK LPADDPR+F QQA VHCAYC
Sbjct  123   VIPYKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYC  182

Query  1363  NGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMV  1184
             NG Y Q  +PD EIQVHNSWLFFPFHRWYLYF+ERILGKLI DPTFGLPFWNWD PAGM+
Sbjct  183   NGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGML  242

Query  1183  FPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAG  1004
              P    ++N  LYDENRNQSHL P ++DLGY G DT+ TD ERI+NNLALMYK M TNAG
Sbjct  243   IPQYFRNQNSPLYDENRNQSHL-PLVMDLGYAGTDTDVTDQERISNNLALMYKSMVTNAG  301

Query  1003  TAELFLGKPYRSGDKK-NPGAGSMENSPHVPIHRWVGD--PRRKNGEDMGNFYSAGRDIS  833
             TAELFLGKPY++GD   N G GS+EN PH P+HRWVGD  PR +NGEDMGNFYSAGRDI 
Sbjct  302   TAELFLGKPYKAGDDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDIL  361

Query  832   FYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQM  653
             FYCHH+NVDRMWTIWQQLGG+GR+R+FTD+DW++A+F+FY+EN Q VRVRVGD ++NQ++
Sbjct  362   FYCHHSNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKL  421

Query  652   GYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtke  473
             GYKYEF NLPW+NSKP+P  ++  LA RS AP+V  VFP+TLD+VV+VKVPRPKK+R+KE
Sbjct  422   GYKYEFTNLPWLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKE  481

Query  472   ekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKI  293
             EKE EEEIL I+GIEV  +QY KFDVYLNDEDEP+ G +KAE+AGSFAHLPH+    +KI
Sbjct  482   EKEAEEEILEIQGIEVAIDQYAKFDVYLNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKI  541

Query  292   RTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             RTSLSLGLNE +EDLGAEDDD VLVTLAP VGGGVVT++NIKI YGS
Sbjct  542   RTSLSLGLNEPLEDLGAEDDDAVLVTLAPKVGGGVVTVENIKIVYGS  588



>dbj|BAA92317.1| polyphenol oxidase I [Ipomoea batatas]
Length=588

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/587 (67%), Positives = 463/587 (79%), Gaps = 9/587 (2%)
 Frame = -1

Query  1891  YTAQKETPMASLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS-KI  1715
             +T    T  A  +P    ++     P+P  S +HI T        KV CNA +G    K+
Sbjct  4     FTTSPCTSAAPKTPKSLSSSATISSPLPKPSQIHIAT-AKRTHHFKVSCNAPNGDSQPKL  62

Query  1714  DRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGR  1544
             DRRDV+LGLGGL GAA+L     A A PI APE+SKCVVPP DLP  A VDNCCPP A  
Sbjct  63    DRRDVLLGLGGLAGAASLINNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDNCCPPLATN  122

Query  1543  YLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYC  1364
              + Y++P  SP+ M++RPA+HR+D +Y  KF KA+ +MK LPADDPR+F QQA VHCAYC
Sbjct  123   VIPYKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYC  182

Query  1363  NGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMV  1184
             NG Y Q  +PD EIQVHNSWLFFPFHRWYLYF+ERILGKLI DPTFGLPFWNWD PAGM+
Sbjct  183   NGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGML  242

Query  1183  FPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAG  1004
              P    ++N  LYDENRNQSHL P ++DLGY G DT+ TD ERI+NNLALMYK M TNAG
Sbjct  243   IPQYFRNQNSPLYDENRNQSHL-PLVMDLGYAGTDTDVTDQERISNNLALMYKSMVTNAG  301

Query  1003  TAELFLGKPYRSGDKK-NPGAGSMENSPHVPIHRWVGD--PRRKNGEDMGNFYSAGRDIS  833
             TAELFLGKPY++GD   N G GS+EN PH P+HRWVGD  PR +NGEDMGNFYSAGRDI 
Sbjct  302   TAELFLGKPYKAGDDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDIL  361

Query  832   FYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQM  653
             FYCHH+NVDRMWTIWQQLGG+GR+R+FTD+DW++A+F+FY+EN Q VRVRVGD ++NQ++
Sbjct  362   FYCHHSNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKL  421

Query  652   GYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtke  473
             GYKYEF NLPW+NSKP+P  ++  LA RS AP+V  VFP+TLD+VV+VKVPRPKK+R+KE
Sbjct  422   GYKYEFTNLPWLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKE  481

Query  472   ekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKI  293
             EKE EEEIL IEGIEV  +QY KFDVYLNDEDEP+ G +KAE+AGSFAHLPH+    +KI
Sbjct  482   EKEAEEEILEIEGIEVAIDQYAKFDVYLNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKI  541

Query  292   RTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             RTSLSLGLNE +EDLGAEDDD VLVTLAP VGGGVVT++NIKI YGS
Sbjct  542   RTSLSLGLNEPLEDLGAEDDDAVLVTLAPKVGGGVVTVENIKIVYGS  588



>emb|CAC83609.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/498 (71%), Positives = 418/498 (84%), Gaps = 2/498 (0%)
 Frame = -1

Query  1645  GPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGK  1466
              PI+APE+SKCVVPP DLP GA VDNCCPP A   +DY++P  +  TM+VRPA H +D  
Sbjct  1     APIQAPEISKCVVPPADLPPGAVVDNCCPPVASNIVDYKIPVVT--TMKVRPAAHTMDKD  58

Query  1465  YKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFH  1286
                KFA+AV++M+ALP DDPR+F QQA VHCAYCNG YDQV FPD EIQVHNSWLFFPFH
Sbjct  59    AIAKFARAVDLMRALPGDDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFH  118

Query  1285  RWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTI  1106
             RWYLYF+ERILGKLI DP+FGLPFWNWD P GMV P  LND   SLYD NRNQSHLPP +
Sbjct  119   RWYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPPVV  178

Query  1105  VDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             VDLGY G DT+ TD +RIT+NLALMYKQM TNAGTAELFLGK YR+GD  +PGAGS+E S
Sbjct  179   VDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIETS  238

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
             PH+PIHRWVGDPR  N EDMGNFYSAGRDI+FYCHH+NVDRMW IWQQL G+ RKR++TD
Sbjct  239   PHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWAIWQQLAGKPRKRDYTD  298

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRS  566
             +DW+NA+FLFY+EN Q V+VR+GD ++NQ+MGYKY    LPW++SKPVP  ++   A +S
Sbjct  299   SDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGGYASKS  358

Query  565   AAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLN  386
              AP+VA+VFPVTLD+VV+VKV RPKK+R+ EEKE EEEILLIEG+EV+ ++Y KFDVYLN
Sbjct  359   KAPFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIEGVEVEIDKYAKFDVYLN  418

Query  385   DEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             D D+P GG DKAE+AGS AHLPH+ K ++KIRT+LSLGLNE +EDLGAEDDDT+LV LAP
Sbjct  419   DSDDPSGGKDKAEYAGSSAHLPHKHKGMKKIRTTLSLGLNEPLEDLGAEDDDTILVALAP  478

Query  205   NVGGGVVTIDNIKIEYGS  152
              VGGGVV++DNIK+ YGS
Sbjct  479   KVGGGVVSVDNIKVVYGS  496



>gb|AAW78869.1| polyphenol oxidase [Ipomoea batatas]
Length=588

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/577 (67%), Positives = 457/577 (79%), Gaps = 13/577 (2%)
 Frame = -1

Query  1849  PRAPANLFSR----RPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS-KIDRRDVIlglg  1685
             P+ P +L S      P+P  S +HI T        KV CNA +G    K+DRRDV+LGLG
Sbjct  14    PKTPKSLASSATISSPLPKPSQIHIAT-AKRTHHFKVSCNAPNGDSQPKLDRRDVLLGLG  72

Query  1684  glygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFS  1514
             GL GAA+L     A A PI APE+SKCVVPP DLP  A VD+CCPP A   +  ++P  S
Sbjct  73    GLAGAASLINNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDSCCPPLATNVIPSKVPKTS  132

Query  1513  PATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFP  1334
             P+ M++RPA+HR+D +Y  KF KA+ +MK LPADDPR+F QQA VHCAYCNG Y Q  +P
Sbjct  133   PSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYP  192

Query  1333  DIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNV  1154
             D EIQVHNSWLFFPFHRWYLYF+ERILGKLI DPTFGLPFWNWD PAGM+ P    ++N 
Sbjct  193   DKEIQVHNSWLFFPFHRWYLYFYERILGKLINDPTFGLPFWNWDTPAGMLIPQYFRNQNS  252

Query  1153  SLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPY  974
              LYDENR QSHL P ++DLGY G DT+ TD ERI+NNLALMYK M TNAGTAELFLGKPY
Sbjct  253   PLYDENRLQSHL-PLVMDLGYAGTDTDVTDDERISNNLALMYKSMVTNAGTAELFLGKPY  311

Query  973   RSGDKK-NPGAGSMENSPHVPIHRWVGD--PRRKNGEDMGNFYSAGRDISFYCHHANVDR  803
             ++GD   N G GS+EN PH P+HRWVGD  PR +NGEDMGNFYSAGRDI FYCHH+NVDR
Sbjct  312   KAGDDPVNKGGGSIENIPHTPVHRWVGDVQPRTQNGEDMGNFYSAGRDILFYCHHSNVDR  371

Query  802   MWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLP  623
             MWTIWQQLGG+GR+R+FTD+DW++A+F+FY+EN Q  RVRVGD ++NQ++GYKYEF NLP
Sbjct  372   MWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAYRVRVGDALDNQKLGYKYEFTNLP  431

Query  622   WINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeill  443
             W+NSKP+P  ++  LA RS AP+V  VFP+TLD+VV+VKVPRPKK+R+KEEKE EEEIL 
Sbjct  432   WLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILE  491

Query  442   iegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNE  263
             IEGIEV  +QY KFDVYLNDEDEP+ G +KAE+AGSFAHLPH+    +KIRTSLSLGLNE
Sbjct  492   IEGIEVAIDQYAKFDVYLNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNE  551

Query  262   AMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              +EDLGAEDDD VLVTLAP VGGG VT++NIKI YGS
Sbjct  552   PLEDLGAEDDDAVLVTLAPKVGGGDVTVENIKIVYGS  588



>sp|Q9ZP19.1|PPO1_IPOBA RecName: Full=Polyphenol oxidase I, chloroplastic; Short=PPO-I; 
AltName: Full=Catechol oxidase I [Ipomoea batatas]
 emb|CAA06855.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/498 (73%), Positives = 422/498 (85%), Gaps = 2/498 (0%)
 Frame = -1

Query  1645  GPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGK  1466
              PI+APE+SKCVVPP DLP GA VDNCCPP A   +DY+LP+ +  TM+VRPA H +D  
Sbjct  1     APIQAPEISKCVVPPADLPPGAVVDNCCPPVASNIVDYKLPAVT--TMKVRPAAHTMDKD  58

Query  1465  YKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFH  1286
                KFAKAVE+MKALPADDPR+F QQA VHCAYCNG YDQV FPD EIQVHNSWLFFPFH
Sbjct  59    AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFH  118

Query  1285  RWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTI  1106
             RWYLYF+ERILGKLI DP+FGLPFWNWD P GMV P  LND   SLYD NRNQSHLPP +
Sbjct  119   RWYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPPVV  178

Query  1105  VDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             VDLGY G DT+ TD +RIT+NLALMYKQM TNAGTAELFLGK YR+GD  +PGAGS+E S
Sbjct  179   VDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIETS  238

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
             PH+PIHRWVGDPR  N EDMGNFYSAGRDI+FYCHH+NVDRMWTIWQQL G+ RKR++TD
Sbjct  239   PHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAGKPRKRDYTD  298

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRS  566
             +DW+NA+FLFY+EN Q V+VR+GD ++NQ+MGYKY    LPW++SKPVP  ++   A +S
Sbjct  299   SDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGGYASKS  358

Query  565   AAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLN  386
              AP+VA+VFPVTLD+VV+VKV RPKK+R+ EEKE EEEILLI GIEV+ ++Y KFDVYLN
Sbjct  359   KAPFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIVGIEVEIDKYAKFDVYLN  418

Query  385   DEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             D D+P GG DKAE+AGSFAHLPH+ K ++KIRT+LSLGLNE +EDLGAEDDDT+LVTLAP
Sbjct  419   DSDDPSGGKDKAEYAGSFAHLPHKHKGMKKIRTTLSLGLNEPLEDLGAEDDDTILVTLAP  478

Query  205   NVGGGVVTIDNIKIEYGS  152
              VGGGVV++DN+K+ YGS
Sbjct  479   KVGGGVVSVDNVKVVYGS  496



>emb|CAC83610.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/500 (72%), Positives = 419/500 (84%), Gaps = 4/500 (1%)
 Frame = -1

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKY  1463
             PI APE+SKCVVPP DLP  A VDNCCPP A   + Y++P  SP+ M++RPA+HR+D +Y
Sbjct  2     PIHAPEISKCVVPPKDLPPDAIVDNCCPPLATNVIPYKVPKTSPSAMKIRPAIHRMDKEY  61

Query  1462  KEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHR  1283
               KF KA+ +MK LPADDPR+F QQA VHCAYCNG Y Q  +PD EIQVHNSWLFFPFHR
Sbjct  62    IAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  121

Query  1282  WYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIV  1103
             WYLYF+ERILGKLI DPTFGLPFWNWD PAGM+ P    ++N  LYDENRNQSHL P ++
Sbjct  122   WYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYFRNQNSPLYDENRNQSHL-PLVM  180

Query  1102  DLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKK-NPGAGSMENS  926
             DLGY G DT+ TD ERI+NNLALMYK M TNAGTAELFLGKPY++GD   N G GS+EN 
Sbjct  181   DLGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIENI  240

Query  925   PHVPIHRWVGD--PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             PH P+HRWVGD  PR +NGEDMGNFYSAGRDI FYCHH+NVDRMWTIWQQLGG+GR+R+F
Sbjct  241   PHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRDF  300

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW++A+F+FY+EN Q VRVRVGD ++NQ++GYKYEF NLPW+NSKP+P  ++  LA 
Sbjct  301   TDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLAA  360

Query  571   RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVY  392
             RS AP+V  VFP+TLD+VV+VKVPRPKK+R+KEEKE EEEIL I+GIEV  +QY KFDVY
Sbjct  361   RSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQGIEVAIDQYAKFDVY  420

Query  391   LNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTL  212
             LNDEDEP+ G +KAE+AGSFAHLPH+    +KIRTSLSLGLNE +EDLGAEDDD VLVTL
Sbjct  421   LNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNEPLEDLGAEDDDPVLVTL  480

Query  211   APNVGGGVVTIDNIKIEYGS  152
             AP VGGGVVT++NIKI YGS
Sbjct  481   APKVGGGVVTVENIKIVYGS  500



>emb|CAC29040.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/500 (71%), Positives = 418/500 (84%), Gaps = 4/500 (1%)
 Frame = -1

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKY  1463
             PI APE+SKCVVPP DLP  A VDNCCPP A   + Y++P  SP+ M++RPA+HR+D +Y
Sbjct  2     PIHAPEISKCVVPPKDLPPDAIVDNCCPPLATNVIPYKVPRTSPSAMKIRPAIHRMDKEY  61

Query  1462  KEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHR  1283
               KF KA+ +MK LPADDPR+F QQA VHCAYCNG Y Q  +PD EIQVHNSWLFFPFHR
Sbjct  62    IAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHR  121

Query  1282  WYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIV  1103
             WYLYF+ERILGKLI DPTFGLPFWNWD PAGM+ P    ++N  LYDENRNQSHL P ++
Sbjct  122   WYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYFRNQNSPLYDENRNQSHL-PLVM  180

Query  1102  DLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKK-NPGAGSMENS  926
             DLGY G D + TD ERI+NNLALMYK M TNAGTAELFLGKPY++GD   N G GS+EN 
Sbjct  181   DLGYAGTDNDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIENI  240

Query  925   PHVPIHRWVGD--PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             PH P+HRWVGD  PR +NGEDMGNFYSAGRDI FYCHH+NVDRMWTIWQQLGG+GR+R+F
Sbjct  241   PHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRDF  300

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW++A+F+FY+EN Q VRVRVGD ++NQ++GYKYEF NLPW+NSKP+P  ++  LA 
Sbjct  301   TDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLAA  360

Query  571   RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVY  392
             RS AP+V  VFP+TLD+VV+VKVPRPKK+R+KEEKE EEEIL I+GIEV  +QY KFDVY
Sbjct  361   RSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQGIEVAIDQYAKFDVY  420

Query  391   LNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTL  212
             LNDEDEP+ G +KAE+AGSFAHLPH+    +KIRTSLSLGLNE +EDLGAEDDD VLVTL
Sbjct  421   LNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNEPLEDLGAEDDDAVLVTL  480

Query  211   APNVGGGVVTIDNIKIEYGS  152
             AP VGGGVVT++NIKI YGS
Sbjct  481   APKVGGGVVTVENIKIVYGS  500



>pdb|1BT1|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT1|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT2|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT2|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT3|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BUG|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
 pdb|1BUG|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
Length=345

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/347 (74%), Positives = 292/347 (84%), Gaps = 2/347 (1%)
 Frame = -1

Query  1645  GPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGK  1466
              PI+APE+SKCVVPP DLP GA VDNCCPP A   +DY+LP+ +  TM+VRPA H +D  
Sbjct  1     APIQAPEISKCVVPPADLPPGAVVDNCCPPVASNIVDYKLPAVT--TMKVRPAAHTMDKD  58

Query  1465  YKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFH  1286
                KFAKAVE+MKALPADDPR+F QQA VHCAYCNG YDQV FPD EIQVHNSWLFFPFH
Sbjct  59    AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFH  118

Query  1285  RWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTI  1106
             RWYLYF+ERILGKLI DP+FGLPFWNWD P GMV P  LND   SLYD NRNQSHLPP +
Sbjct  119   RWYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPPVV  178

Query  1105  VDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             VDLGY G DT+ TD +RIT+NLALMYKQM TNAGTAELFLGK YR+GD  +PGAGS+E S
Sbjct  179   VDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIETS  238

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
             PH+PIHRWVGDPR  N EDMGNFYSAGRDI+FYCHH+NVDRMWTIWQQL G+ RKR++TD
Sbjct  239   PHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAGKPRKRDYTD  298

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKP  605
             +DW+NA+FLFY+EN Q V+VR+GD ++NQ+MGYKY    LPW++SKP
Sbjct  299   SDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKP  345



>emb|CDP06093.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/546 (60%), Positives = 402/546 (74%), Gaps = 16/546 (3%)
 Frame = -1

Query  1765  RRLKVLC--NAAHGGDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPP  1601
             R+  V C  N +H     +DRRDV+LGLGGLYGA+NL     AMA PI APE+SKC  PP
Sbjct  41    RQFTVSCKNNESHEQVDNLDRRDVLLGLGGLYGASNLIINPFAMAAPIAAPEISKCG-PP  99

Query  1600  TDLPAGADV-DNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKA  1424
              DLP GA V DNCCPP  G+ +DY+LP   P   R RPA H +   Y EK  KAVE+MKA
Sbjct  100   ADLPPGAVVTDNCCPPVPGKVIDYKLPP-PPKVNRFRPAAHLVKKDYIEKLNKAVELMKA  158

Query  1423  LPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKL  1244
             LPADDPR+FTQQA VHCAYCNGAY Q G  D EI VH SWLFFPFHRWYLYF+ERILGKL
Sbjct  159   LPADDPRNFTQQANVHCAYCNGAYVQPG-SDQEISVHYSWLFFPFHRWYLYFYERILGKL  217

Query  1243  IRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATD  1064
             I DP+FGLPFWNWD   GM  PSI  D++ +LY+ENRNQSHLPPT+VDLGY G D +AT 
Sbjct  218   IGDPSFGLPFWNWDNIGGMTIPSIFMDQSSALYNENRNQSHLPPTVVDLGYNGTDRDATC  277

Query  1063  LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKN--PGAGSMENSPHVPIHRWVGDP  890
              ERI NNLA+MY+QM +NA T   F GK YR+GD+ N   GAGS+E SPH+P+HRWVGDP
Sbjct  278   TERIENNLAIMYRQMVSNATTGRDFFGKEYRAGDQPNAFAGAGSIEASPHIPLHRWVGDP  337

Query  889   RRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYN  710
             R+ NGED+GNFYSAGRD+ FY HHANVDRMWTIWQQLG  G+++   D DW+N+SF+FY+
Sbjct  338   RQPNGEDLGNFYSAGRDVLFYSHHANVDRMWTIWQQLG--GKRKEVPDPDWLNSSFIFYD  395

Query  709   ENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVT  530
             ENAQPVRV+V D   N +MGY YE  ++PW+ +KPVP+ R+ ++A  S AP    VFP  
Sbjct  396   ENAQPVRVKVRDSFSNDRMGYIYEKVDIPWLKNKPVPRVRKSRVAFTSGAPPADKVFPGP  455

Query  529   LDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKA  350
             L+++V+V V RPK +R+K +KE EEE L++ GIE   ++Y KFDV++NDED+    + K+
Sbjct  456   LNKIVKVLVKRPKLSRSKRQKEEEEERLVVYGIEFSMDKYVKFDVFINDEDDNPNDFAKS  515

Query  349   EFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNI  170
             E+ GSFA+LPH+ K+  K +T+ +  L E +EDL  EDDD +LVTL PN     +TID I
Sbjct  516   EYVGSFANLPHKVKSGMKAKTTQTFELTEILEDLDVEDDDALLVTLVPNTA---LTIDGI  572

Query  169   KIEYGS  152
             KIE  +
Sbjct  573   KIEVAT  578



>ref|XP_007025701.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
 gb|EOY28323.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
Length=618

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/538 (55%), Positives = 390/538 (72%), Gaps = 23/538 (4%)
 Frame = -1

Query  1723  SKIDRRDVIlglgg---lygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPT  1553
             +K DRRDV++GLGG       +    ++A PI APE+ KC     +LP GAD  NCCPP 
Sbjct  85    NKFDRRDVLIGLGGLYGAASLSQDQFSLAAPISAPELEKC--GNAELPEGADPTNCCPPV  142

Query  1552  AGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHC  1373
             + + LD++ PS S + +RVRPA H +D  Y  K+++A+E+MKALPADDPR+F QQA VHC
Sbjct  143   SRKILDFKPPS-SNSPLRVRPAAHLVDDAYIAKYSRAIELMKALPADDPRNFMQQANVHC  201

Query  1372  AYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPA  1193
             AYC+GAYDQVGFPD+E+QVHNSWLFFPFHR+YLYFFE+ILGKLI DPTF LPFWNWD PA
Sbjct  202   AYCDGAYDQVGFPDLELQVHNSWLFFPFHRYYLYFFEKILGKLIDDPTFALPFWNWDSPA  261

Query  1192  GMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFT  1013
             GM  P++  +    LY+E RN+SH PPT+VDL Y G D   T  +++T+NL +MY+QM +
Sbjct  262   GMKMPAMYGNTKSPLYNELRNRSHYPPTLVDLDYNGTDETTTTRDQLTSNLRIMYRQMVS  321

Query  1012  NAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDIS  833
             N  TA LFLG P+R+GD+   G GS+EN PH P+H W GD  + NGEDMG FYSA RD  
Sbjct  322   NGKTARLFLGGPFRAGDEPYQGFGSVENVPHGPVHVWCGDNTQPNGEDMGTFYSAARDPI  381

Query  832   FYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQM  653
             FY HH+NVDRMW +W+ LG   ++++FTD DW+NASFLFY+ENA  VRV+V DC++N+ +
Sbjct  382   FYAHHSNVDRMWAVWKTLG--KKRKDFTDPDWLNASFLFYDENANLVRVKVRDCLDNRSL  439

Query  652   GYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV-------------FPVTLDrvvr  512
             GY Y+  ++PW+ +KP P+  R+K+A  S  P +A               FP+ LD++V 
Sbjct  440   GYVYQDVDIPWLKTKPTPRKLRKKVA--SGGPGIALAAEINKKKVIASNQFPIVLDKIVS  497

Query  511   vkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             V VPRPKK+R+K+EKE EEEIL+I+ IE+  + + KFDVY+NDED+   G D  EFAGSF
Sbjct  498   VDVPRPKKSRSKKEKEDEEEILVIDQIELDGDSFAKFDVYVNDEDDLTIGPDNTEFAGSF  557

Query  331   AHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
              ++PH+ K  +K+RT L LGL + +EDLGAEDDD+V+VTL P  G G V I +IKIE+
Sbjct  558   VNVPHKHKGGKKMRTCLRLGLTDLLEDLGAEDDDSVVVTLVPKYGKGNVKIGSIKIEF  615



>ref|XP_007025702.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
 gb|EOY28324.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
Length=600

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/604 (51%), Positives = 413/604 (68%), Gaps = 39/604 (6%)
 Frame = -1

Query  1867  MASLSPPRAPAN------LFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGD------  1724
             MASL PP + A         +   +P  S L I      N   + +   A  GD      
Sbjct  1     MASLLPPSSTATNGASPISVTTSFLPKTSQLCIAGKRRRNFVSRAVSCKATNGDQNPSPS  60

Query  1723  ---------SKIDRRDVIlglgglygaanlpaAMA--GPIEAPEVSKCVVPPTDLPAGAD  1577
                      +K DRRDV++GLGGLYGA +L   +A   P+  P+V+KC     DLPAGA 
Sbjct  61    TKNVEECSLNKFDRRDVLVGLGGLYGATSLNGPLAFAAPVSPPDVTKC--GKADLPAGAK  118

Query  1576  VDNCCPPTAGRYLDYQL-PSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRS  1400
               NCCPP + + LD++L PS SP   R+RPA+H +D +Y  KF++A+E+MKALP DDPRS
Sbjct  119   PVNCCPPPSTKILDFKLRPSNSPP--RIRPAVHLVDKEYLAKFSRALELMKALPEDDPRS  176

Query  1399  FTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGL  1220
             FTQQA VHCAYC+GAY Q+GFPD+++QVHNSWLFFPFHR+YLYFFE+ILGKLI DPTF +
Sbjct  177   FTQQANVHCAYCDGAYHQIGFPDLDLQVHNSWLFFPFHRYYLYFFEKILGKLIDDPTFAI  236

Query  1219  PFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNL  1040
             PFWNWD PAGM  P+I  + N  LYDENRN +H PPT++DL + G +  ++  ++I++NL
Sbjct  237   PFWNWDSPAGMQMPAIYANPNSPLYDENRNPNHQPPTLLDLDFNGTEESSSTRDQISSNL  296

Query  1039  ALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGN  860
              +MY+QM +N  TA+LFLG  YR+GD+ +PGAGS+EN PH PIH W GD R+ N EDMGN
Sbjct  297   NVMYRQMVSNGKTAKLFLGNAYRAGDQPDPGAGSLENIPHGPIHIWCGDNRQPNLEDMGN  356

Query  859   FYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRV  680
             FYSAGRD  FY HH+NVDRMW++W+ LG  G++ +FTD+DW+++ FLFY+ENA  VRV+V
Sbjct  357   FYSAGRDPIFYAHHSNVDRMWSVWKTLG--GKRTDFTDSDWLDSGFLFYDENANLVRVKV  414

Query  679   GDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV---------FPVTL  527
              DC++ ++MGY Y+  ++PW+ +KP P+    K+A      + A           FP+ L
Sbjct  415   RDCLDTRKMGYDYQKVDIPWLRAKPTPRRIASKVARALGVAHAAETKKKVLSDVQFPLVL  474

Query  526   DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAE  347
             + VV ++V RPKK+R+K EKE EEE+L+IE IE   +Q  KFDVY+NDED+   G D  E
Sbjct  475   NNVVSLEVSRPKKSRSKAEKEEEEEVLVIENIEFDRDQLVKFDVYINDEDDTTIGPDNTE  534

Query  346   FAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIK  167
             FAGSF ++PH+ ++  K+ T L LGL + +E+LGAEDDD V+VTL P  G G+  I  +K
Sbjct  535   FAGSFINVPHKHRHGNKMTTCLRLGLTDLLEELGAEDDDGVVVTLVPKSGKGLAKIGGVK  594

Query  166   IEYG  155
             I++ 
Sbjct  595   IDFA  598



>ref|XP_010100574.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82817.1| Polyphenol oxidase [Morus notabilis]
Length=601

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/542 (53%), Positives = 390/542 (72%), Gaps = 19/542 (4%)
 Frame = -1

Query  1741  AAHGGDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVD  1571
             A+   + K+DRR+V+LGLG L G A L A   A A PI AP++S+C     D P+G D  
Sbjct  67    ASKTSNPKLDRRNVLLGLGSLGGLAGLRADPFAFAAPISAPDISQCGA--ADFPSGVDPV  124

Query  1570  NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQ  1391
             NCCPP + + +D++LP+ SP  +RVRP  H +D  Y  KF +A E+MKALP  DPRSF Q
Sbjct  125   NCCPPVSAQIVDFKLPA-SPGKLRVRPPAHAVDSAYTAKFKRAFELMKALPDSDPRSFKQ  183

Query  1390  QAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFW  1211
             QA +HCAYC+GAY+Q+GFPD++IQVHNSWLFFPFHRWYLYFFERILGKLI DP+F +PFW
Sbjct  184   QASIHCAYCDGAYEQIGFPDLDIQVHNSWLFFPFHRWYLYFFERILGKLIDDPSFAMPFW  243

Query  1210  NWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALM  1031
             NWD PAGM  P+I  DR   LYD+ RN+SH PP++VDL + G+D   ++  +I +NL +M
Sbjct  244   NWDAPAGMQIPAIYADRRSPLYDQFRNKSHQPPSLVDLDFNGRDESISNQAQIQSNLTIM  303

Query  1030  YKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYS  851
             Y+QM +N+ +A +F+G+ YR+GD+ +PG GS EN PH  +H W GD  +  GEDMGNFYS
Sbjct  304   YRQMVSNSRSARIFMGESYRAGDETDPGPGSFENIPHGSVHTWTGDNTQPYGEDMGNFYS  363

Query  850   AGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDC  671
             AGRD  F+ HH+N+DRMW +W+ LG  G++++FTD DW++ASFLFY+EN+Q VRV+V D 
Sbjct  364   AGRDPIFFAHHSNIDRMWNVWKTLG--GKRQDFTDPDWLDASFLFYDENSQLVRVKVRDS  421

Query  670   VENQQMGYKYEFANLPWINSKPVPKPRR---------RKLALRSAAPYVATVFPVTLDrv  518
             ++++++GY Y+   LPW+N++  P+PRR          ++ +  A  Y    FP+TLD+ 
Sbjct  422   LDSRKLGYTYQDIELPWLNTR--PRPRRVVDKVKRAFARIGVARADEYPTANFPLTLDKP  479

Query  517   vrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAG  338
             V+  V RPKK+R+K+EK+  +E+L+I+GIE   N   KFDV++NDED+   G DK+EFAG
Sbjct  480   VKTLVSRPKKSRSKKEKDEADEVLVIQGIEFDRNVPIKFDVFINDEDDALTGPDKSEFAG  539

Query  337   SFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             SF  +PHR K+  K+ T L L + E +EDL AE+D+ V+VTL P VG G V+I  +KIE+
Sbjct  540   SFVSVPHRHKSKTKMNTGLRLDITELLEDLDAEEDENVVVTLVPKVGIGHVSIGGLKIEF  599

Query  157   GS  152
              S
Sbjct  600   VS  601



>emb|CDO99592.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/555 (55%), Positives = 400/555 (72%), Gaps = 17/555 (3%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPE  1625
              HI T    N   KV C A +G +    RR+V++GLGGLYGAA+L A   A+A PI+AP+
Sbjct  29    FHISTTKKRNHHFKVSCQATNG-ERNASRRNVLIGLGGLYGAASLAADPFALAAPIQAPD  87

Query  1624  VSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAK  1445
             VSKC   P DLP+GA   NCCPP A   +D++LP+ S  T+RVRPA H +D  Y  KF +
Sbjct  88    VSKC--GPADLPSGATPTNCCPPPATTIVDFKLPAPS-NTLRVRPAAHLVDEAYIAKFQR  144

Query  1444  AVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFF  1265
             AV++MKALP DDPRSF QQA VHCAYC+GAYDQVGFP++E+QVHNSWLF PFHR+YLYF+
Sbjct  145   AVQLMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPNLELQVHNSWLFLPFHRYYLYFY  204

Query  1264  ERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQG  1085
             ERILGKLI DPTF +PFWNWD   GM  P I  D    LYD  R+ SH PPT++DL + G
Sbjct  205   ERILGKLINDPTFAMPFWNWDAQGGMRLPDIYTDPTSPLYDTLRDGSHQPPTMIDLDFNG  264

Query  1084  KDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHR  905
              D+  +D ++++ N  +MY+QM +N+ T  LF G PYR+GD  +PGAG +EN PH P+H 
Sbjct  265   TDSNISDSQQLSQNYTIMYRQMVSNSRTPRLFFGSPYRAGDDPDPGAGQLENIPHGPVHV  324

Query  904   WVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINAS  725
             W GD  + N EDMGNFYSAGRD  FY HH+N+DRMWT+W+ LG  GR+++ TD DW+NAS
Sbjct  325   WTGDRTQPNLEDMGNFYSAGRDPIFYAHHSNIDRMWTLWKTLG--GRRQDITDTDWLNAS  382

Query  724   FLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-----RKLALRSAA  560
             F+FY+ENAQ VRVRV DC++  ++GY Y+  + PW+NS+P P+  +     +KL + +AA
Sbjct  383   FVFYDENAQMVRVRVRDCLDTTKLGYSYQTVDTPWLNSRPTPRLTKVARKIKKLVVANAA  442

Query  559   PYVAT---VFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
              +  +   +FP  LD++++V V RPKK R+K+EK+ +EEIL+IE IEV+ + + KFD+Y+
Sbjct  443   DHSHSPTDIFPAKLDKIIKVMVKRPKKKRSKKEKDEKEEILVIEKIEVERDAFAKFDIYI  502

Query  388   NDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLA  209
             NDED+P    +  EFAGSF ++PH+ K+ +KI+T L+L L E +EDL AEDD+ V+VTL 
Sbjct  503   NDEDDPKSTPENTEFAGSFVNVPHKHKHGKKIKTHLNLSLTEILEDLDAEDDEHVMVTLV  562

Query  208   PNVGGGVVTIDNIKI  164
             P VG   VTI  IKI
Sbjct  563   PRVGCDAVTIGGIKI  577



>ref|XP_010052352.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW76288.1| hypothetical protein EUGRSUZ_D00657 [Eucalyptus grandis]
Length=601

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/553 (55%), Positives = 395/553 (71%), Gaps = 21/553 (4%)
 Frame = -1

Query  1765  RRLKVLCNAAHGGDS-------KIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSK  1616
             RR  + C A    DS       K DRR+V++GLGG YGA  L +   A+A PI AP+++K
Sbjct  51    RRSTISCKAPSNDDSEQNPLSAKFDRRNVLIGLGGFYGAVGLRSDPFALADPISAPDLTK  110

Query  1615  CVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVE  1436
             C     DLPAGA   NCCPP   + LD++LPS S + +RVRPA H  D  Y  K+AKA+E
Sbjct  111   C--GKADLPAGAKATNCCPPPTTKILDFKLPS-SNSPLRVRPAAHLADKDYIAKYAKAIE  167

Query  1435  MMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERI  1256
             +MKALPADDPRSF QQA VHCAYC+GA+ QVGFP++E+QVHNSWLFFPFHR+YLYF+E+I
Sbjct  168   LMKALPADDPRSFMQQANVHCAYCDGAHHQVGFPNLELQVHNSWLFFPFHRYYLYFYEKI  227

Query  1255  LGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDT  1076
             LG LI DPTF LP+WNWD P GM  P++  D    LYD NRN  H PP +VDL Y G+D 
Sbjct  228   LGSLIGDPTFALPYWNWDAPDGMKMPALFADPKSPLYDANRNPKHAPPMLVDLDYNGEDP  287

Query  1075  EATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVG  896
               ++ +++++NL +MY+QM +N  +A+LFLG  YR+GD  +PGAGS+EN PH P+H W G
Sbjct  288   TTSNQDQLSSNLTIMYRQMVSNGKSAKLFLGSDYRAGDDADPGAGSLENIPHGPVHVWCG  347

Query  895   DPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLF  716
             D R+ N EDMGNFYSA RD  F+ HH+NVDRMWT+W+ LGG  R+ +FTD DW+NA+FLF
Sbjct  348   DNRQPNLEDMGNFYSAARDPIFFSHHSNVDRMWTVWKTLGG-SRRIDFTDPDWLNAAFLF  406

Query  715   YNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA-----LRSAA--P  557
             Y+ENAQ VRV+V DC+E   +GY Y+  ++PW+ SKP P+   +K+A     +  AA  P
Sbjct  407   YDENAQAVRVKVKDCLETTNLGYVYQDVDIPWLKSKPTPRKTAKKVAKAFGKVAHAAEIP  466

Query  556   YVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDED  377
                  FPV LD+VVR  V RPK+ R+K+EKE EEE+L+IEGIE + + + KFDVY+NDE 
Sbjct  467   RPIVQFPVKLDKVVRTLVKRPKQKRSKKEKEEEEEVLVIEGIEFERDAFVKFDVYINDEH  526

Query  376   EPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVG  197
             +     D+ EFAGSF ++PH+ K+ +K++T L LG+ + +EDL  EDDD +LVTLAP   
Sbjct  527   DSLSSPDQTEFAGSFVNVPHKHKHHKKMKTRLRLGITDLLEDLVCEDDDEILVTLAPKYA  586

Query  196   GGVVTIDNIKIEY  158
             G  VT+ NIKIE+
Sbjct  587   GEQVTVGNIKIEF  599



>emb|CDP22269.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   529 bits (1363),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 266/427 (62%), Positives = 332/427 (78%), Gaps = 4/427 (1%)
 Frame = -1

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             MKALPADDPR+FTQQA VHCAYCNGAY Q G  D EIQVHNSWLFFPFHRWYLYF+ERIL
Sbjct  1     MKALPADDPRNFTQQANVHCAYCNGAYIQSG-SDQEIQVHNSWLFFPFHRWYLYFYERIL  59

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             GKLI DP+FGLPFWNWD   GM  PSI  D++ +LY++NRNQSHLPPT+VDLGY G DT+
Sbjct  60    GKLIGDPSFGLPFWNWDNIGGMTLPSIFQDQSSALYNQNRNQSHLPPTVVDLGYNGTDTD  119

Query  1072  ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGD  893
             ATD+ERI NNLA+MY+QM TN+ TA+ F GK YR+GD  +PGAGS+E  PH+PIHRWVGD
Sbjct  120   ATDIERIKNNLAIMYRQMVTNSTTAKDFFGKEYRAGDAPSPGAGSIEAIPHIPIHRWVGD  179

Query  892   PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFY  713
             PR+ NGEDMGNFYSAGRDI FY HHANVDRMWTIWQQLG  G+++   D DW+N+SF+FY
Sbjct  180   PRQPNGEDMGNFYSAGRDIVFYSHHANVDRMWTIWQQLG--GKRKEVPDPDWLNSSFIFY  237

Query  712   NENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPV  533
             +ENAQPV V+VGDC  N +MGY Y+  ++PW+ +KPV +  + ++A  S AP    VFP 
Sbjct  238   DENAQPVCVKVGDCFSNDKMGYIYQKVDIPWVKNKPVARVTKSRVAFTSGAPQADKVFPG  297

Query  532   TLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
              L++ V+V V RPK +R+K++KE EEE L++ GIE   ++Y KFDV++NDED+    + K
Sbjct  298   PLNKTVKVLVKRPKLSRSKKQKEEEEERLVVSGIEFSMDKYVKFDVFINDEDDNPNDFAK  357

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
             +E+ GSFAHLPH+ K   K++T+ +  L E +EDL  E+DD +LVTL P      +TID+
Sbjct  358   SEYVGSFAHLPHKVKGDMKVKTTQTFELTEILEDLDVEEDDALLVTLVPK-SKTALTIDS  416

Query  172   IKIEYGS  152
             IKIE  +
Sbjct  417   IKIEVAA  423



>gb|AII22011.1| polyphenol oxidase-9 [Gossypium hirsutum]
Length=567

 Score =   534 bits (1375),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 285/579 (49%), Positives = 380/579 (66%), Gaps = 23/579 (4%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS----KIDRRDV  1700
             MA++SP    + L      P  S   I+          + C A +G       K DRRDV
Sbjct  1     MATISPSITSSFL------PKKSKYSIIKNPKFKNPKSIPCKAINGEQEHPKHKFDRRDV  54

Query  1699  -IlglgglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLP  1523
              I   G  YGAA+L  AMA PI APE+ KC     D+P G    +CCPP + R LD++ P
Sbjct  55    LIGLGGLYYGAASLNDAMAAPISAPEMEKCGR--ADVPEGVQTTDCCPPVSKRILDFK-P  111

Query  1522  SFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQV  1343
              FS + +RVRPA H +D +Y  K++KA+E+MKALP DDPRSF QQA VHCAYC GAYDQV
Sbjct  112   PFSNSPVRVRPAAHLVDDEYIRKYSKAIELMKALPHDDPRSFMQQANVHCAYCEGAYDQV  171

Query  1342  GFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILND  1163
             GFP++E+QVHNSWLFFPFHR+YLYFFERILG LI DPTFGLPFWNWD PAGM  P +  D
Sbjct  172   GFPNLELQVHNSWLFFPFHRYYLYFFERILGHLIDDPTFGLPFWNWDSPAGMWMPDMFMD  231

Query  1162  RNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDL--ERITNNLALMYKQMFTNAGTAELF  989
              N SLYD+ RN  H PPT+VDL Y G+D   T +  +++ +NL++MY+QM +NA T  LF
Sbjct  232   TNSSLYDKFRNSRHYPPTMVDLDYNGEDEHETKMNKDQVKSNLSIMYRQMVSNAKTPRLF  291

Query  988   LGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANV  809
             LG P+R+GD+   G+GS+EN PH P+H W GD ++ NGEDMG FYSA RD  FY HH+NV
Sbjct  292   LGGPFRAGDEPYQGSGSIENVPHGPVHVWCGDDKQPNGEDMGTFYSAARDPIFYAHHSNV  351

Query  808   DRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFAN  629
             DRMW++W+ +    RK +F D DW+NASFLFY+ENA  VRV+V DC++++ +GY Y+F +
Sbjct  352   DRMWSVWKTIENINRK-DFDDPDWLNASFLFYDENANLVRVKVRDCLDHRNLGYVYQFVD  410

Query  628   LPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeei  449
             LPW+  KP P    RKL  ++ AP         +            +    + ++ E+E 
Sbjct  411   LPWLKEKPTP----RKLTKKNKAPPPPVSSTEFVLDKPVRVNVERPRKSRSKTEKEEKEE  466

Query  448   lliegiEVQANQYTKFDVYLNDEDEPDG--GYDKAEFAGSFAHLPHRQKNVEKIRTSLSL  275
             +L+  IE++ + + KFDVY+NDED+     G +  EFAGS+ ++P++ K  + ++T L L
Sbjct  467   ILVIDIELKGDLFVKFDVYVNDEDDAGSNIGSENTEFAGSYVNVPNKHKQGKTLKTRLRL  526

Query  274   GLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             GL + +EDLGA+DDD ++VTL P  G G + I  IKIE+
Sbjct  527   GLTDLLEDLGADDDDGIVVTLVPKYGKGNIKISGIKIEF  565



>gb|ACM43505.1| polyphenoloxidase [Camellia nitidissima]
Length=595

 Score =   533 bits (1374),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 297/533 (56%), Positives = 393/533 (74%), Gaps = 16/533 (3%)
 Frame = -1

Query  1720  KIDRRDVIlglgglygaanlpaAMA--GPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAG  1547
             K+DRR+V+LGLGG   A  L   +A   P+ AP+++KC     DLPAGA   NCCPP A 
Sbjct  69    KLDRRNVLLGLGGYSAATILANPLAFAAPVTAPDLAKCGA--ADLPAGAKPTNCCPPKAT  126

Query  1546  RYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAY  1367
             + +D++ P  +  +MRVRPA H  D +Y  KF+KA+ +MKALP DDPRSF QQA VHCAY
Sbjct  127   KIIDFKFPQSN--SMRVRPAAHLADAEYIAKFSKALALMKALPEDDPRSFKQQANVHCAY  184

Query  1366  CNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGM  1187
             C+GAY QVGFP++++QVHNSWLFFPFHR+YL+FFERILG LI DP+F +PFWNWD P GM
Sbjct  185   CDGAYHQVGFPELDLQVHNSWLFFPFHRYYLHFFERILGSLIGDPSFAIPFWNWDSPNGM  244

Query  1186  VFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNA  1007
               P++  D N  LYD  R+  H PPT+VDL Y G D   TD ++ ++NL +MY+QM +++
Sbjct  245   QMPAMYADPNSPLYDVLRDAKHQPPTLVDLDYNGSDPTTTDAQQKSSNLNVMYRQMVSSS  304

Query  1006  GTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFY  827
              +A LFLG PYR+GD+ +PGAGS+EN PH P+H W GD  + N EDMGNFYSAGRD  FY
Sbjct  305   KSARLFLGSPYRAGDEPDPGAGSLENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDSIFY  364

Query  826   CHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGY  647
              HHANVDRMW+IW+ LG  G++++FTD DW+NA F+FY+ENAQ VRV+V DC++++++GY
Sbjct  365   GHHANVDRMWSIWKTLG--GKRQDFTDPDWLNAGFVFYDENAQLVRVKVKDCLDSRKLGY  422

Query  646   KYEFANLPWINSKPVPKPRR--RKL-----ALRSAAPYVAT-VFPVTLDrvvrvkvprpk  491
              Y+  ++PW+N++P P+  +  RK+     A+ +  P  A  VFP  LD+ VRV VPRPK
Sbjct  423   VYQDVDIPWLNTRPAPRVSKLSRKINKAGVAMAADTPSTAAEVFPKKLDKAVRVMVPRPK  482

Query  490   knrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQ  311
             K+R+K+EK+ EEEIL+IEGIEV  + + KFDV++NDE E   G +  EFAGSF ++PH+ 
Sbjct  483   KSRSKKEKDDEEEILVIEGIEVDRDVFVKFDVFINDEHEVVIGPNDTEFAGSFVNVPHKH  542

Query  310   KNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             K+ +KI+T L LG+ E +E+LGAEDDD VLVTL P  G G VTI  +KIE+ S
Sbjct  543   KHGKKIKTILRLGITELLEELGAEDDDGVLVTLVPKNGAGAVTIGGVKIEFDS  595



>ref|XP_008383785.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
 sp|P43309.1|PPO_MALDO RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Malus domestica]
 gb|AAA69902.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   533 bits (1374),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 302/592 (51%), Positives = 399/592 (67%), Gaps = 38/592 (6%)
 Frame = -1

Query  1855  SPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG-----GDSKIDRRDVIlg  1691
             +P   P + FS+     +S + +LT    +   KV C A +        SK+DRR+V+LG
Sbjct  16    NPATKPLSPFSQ----NNSQVSLLTKPKRSFARKVSCKATNNDQNDQAQSKLDRRNVLLG  71

Query  1690  lgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPS  1520
             LGGLYG A +     A A PI  P+VSKC   P DLP GA   NCCPP + + +D++LP+
Sbjct  72    LGGLYGVAGMGTDPFAFAKPIAPPDVSKC--GPADLPQGAVPTNCCPPPSTKIIDFKLPA  129

Query  1519  FSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVG  1340
               PA +R+RP  H +D  Y++K+ KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQVG
Sbjct  130   --PAKLRIRPPAHAVDQAYRDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVG  187

Query  1339  FPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDR  1160
             FP++E+Q+HNSWLFFPFHR+YLYFFE+ILGKLI DPTF LPFWNWD PAGM  P+I  D 
Sbjct  188   FPELELQIHNSWLFFPFHRYYLYFFEKILGKLINDPTFALPFWNWDSPAGMPLPAIYADP  247

Query  1159  NVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGK  980
                LYD+ R+ +H PPT+VDL Y G +   +    I  NL +MY+QM +N+  A+LF G 
Sbjct  248   KSPLYDKLRSANHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGN  307

Query  979   PYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRM  800
             PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDRM
Sbjct  308   PYRAGDEPDPGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRM  367

Query  799   WTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPW  620
             W+IW+ LG  G++ + TD+DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW
Sbjct  368   WSIWKTLG--GKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPW  425

Query  619   INSKPVPKPRRRKLALRSAAPYV---------------ATVFPVTLDrvvrvkvpr-pkk  488
             ++SKP   PRR K+AL   A  +                T FP++L   +   V R  +K
Sbjct  426   LSSKPT--PRRAKVALSKVAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQK  483

Query  487   nrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQK  308
              R+K+ KE EEEIL+IEGIE   +   KFDVY+ND D+   G DK EFAGSF  +PH  K
Sbjct  484   KRSKKAKEDEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHSHK  543

Query  307   NVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             + +K+ T L LGL + +E++ AEDDD+V+VTL P  G   V I  IKIE+ S
Sbjct  544   HKKKMNTILRLGLTDLLEEIEAEDDDSVVVTLVPKFGA--VKIGGIKIEFAS  593



>gb|AEG78292.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   533 bits (1373),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 304/607 (50%), Positives = 399/607 (66%), Gaps = 49/607 (8%)
 Frame = -1

Query  1867  MASLS-----------PPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG---  1730
             MASLS           P   P + FS+     +S + +LT    +   KV C A +    
Sbjct  1     MASLSPPVVTTPTVPNPATKPFSPFSQ----NNSQVSLLTKPKRSFARKVSCKATNNDQN  56

Query  1729  --GDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNC  1565
                 SK+DRR+V+LGLGGLYG A +     A A PI  P+VSKC     DLP GA+  NC
Sbjct  57    DQAQSKLDRRNVLLGLGGLYGVAGMGTDPFAFAKPIAPPDVSKC--GSADLPQGAEATNC  114

Query  1564  CPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQA  1385
             CPP A + +D++LP+  PA +R+RP  H +D  Y++KF KA+E+MKALP DDPRSF QQA
Sbjct  115   CPPPATKIIDFKLPA--PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQA  172

Query  1384  KVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNW  1205
              VHCAYC+GAYDQ GFP++E+QVHNSWLFFPFHR+YLYFFE++LGKLI DPTF +PFWNW
Sbjct  173   AVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRYYLYFFEKMLGKLINDPTFAMPFWNW  232

Query  1204  DIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYK  1025
             D PAGM  P+I  D    LYD+ R+  H PPT++DL Y G +   +    I  NL +MY+
Sbjct  233   DSPAGMPLPAIYADPKSPLYDKFRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYR  292

Query  1024  QMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAG  845
             QM +N+  A+LF G PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSAG
Sbjct  293   QMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAG  352

Query  844   RDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVE  665
             RD  FY HH+NVDRMW+IW+ LG  G++ +  D DW+++ FLFYNENA+ VRV+V DC+E
Sbjct  353   RDPVFYAHHSNVDRMWSIWKTLG--GKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLE  410

Query  664   NQQMGYKYEFANLPWINSKPVPKPRRRKLAL---------------RSAAPYVATVFPVT  530
              + +GY Y+  ++PW++SKP   PRR K+AL                S+     T FP++
Sbjct  411   TKNLGYVYQDVDIPWLSSKPT--PRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPIS  468

Query  529   LDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
             L   +   V R  +K R+K+ +  EEEIL+IEGIE   +   KFDV++ND D+   G DK
Sbjct  469   LGSKISTVVKRPKQKKRSKKGQRDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDK  528

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
              EFAGSF  +PHR K+ +KI T L LGL + +E++ AEDDD+V+VTL P  G   V I  
Sbjct  529   TEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYGA--VNIGG  586

Query  172   IKIEYGS  152
             IKIE+ S
Sbjct  587   IKIEFAS  593



>dbj|BAB64530.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   533 bits (1372),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 302/592 (51%), Positives = 396/592 (67%), Gaps = 38/592 (6%)
 Frame = -1

Query  1855  SPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG-----GDSKIDRRDVIlg  1691
             +P   P + FS+     +S + +LT    +   KV C A +        SK+DRR+V+LG
Sbjct  16    NPATKPFSPFSQ----NNSQVSLLTKPKRSFARKVSCKATNNDQNDQAQSKLDRRNVLLG  71

Query  1690  lgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPS  1520
             LGGLYG A +     A A PI  P+VSKC     DLP GA+  NCCPP A + +D++LP+
Sbjct  72    LGGLYGVAGMGTDPFAFAKPIAPPDVSKC--GSADLPQGAEATNCCPPPATKIIDFKLPA  129

Query  1519  FSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVG  1340
               PA +R+RP  H +D  Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ G
Sbjct  130   --PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAG  187

Query  1339  FPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDR  1160
             FP++E+QVHNSWLFFPFHR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D 
Sbjct  188   FPELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADP  247

Query  1159  NVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGK  980
                LYD+ R+  H PPT++DL Y G +   +    I  NL +MY+QM +N+  A+LF G 
Sbjct  248   KSPLYDKFRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGN  307

Query  979   PYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRM  800
             PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRM
Sbjct  308   PYRAGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRM  367

Query  799   WTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPW  620
             W+IW+ LG  G++ +  D DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW
Sbjct  368   WSIWKTLG--GKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPW  425

Query  619   INSKPVPKPRRRKLAL---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkk  488
             ++SKP   PRR K+AL                S+     T FP++L   +   V R  +K
Sbjct  426   LSSKPT--PRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQK  483

Query  487   nrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQK  308
              R+K+ KE EEEIL+IEGIE   +   KFDV++ND D+   G DK EFAGSF  +PHR K
Sbjct  484   KRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHK  543

Query  307   NVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             + +KI T L LGL + +E++ AEDDD+V+VTL P  G   V I  IKIE+ S
Sbjct  544   HKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYGA--VNIGGIKIEFAS  593



>gb|ABY84850.1| polyphenol oxidase [Cydonia oblonga]
Length=504

 Score =   528 bits (1361),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 360/512 (70%), Gaps = 26/512 (5%)
 Frame = -1

Query  1639  IEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYK  1460
             I  P+VSKC     DLP GA+V NCCPP A + +D++LP+  PA +RVRP  H +D  Y+
Sbjct  3     IAPPDVSKC--GSADLPPGAEVTNCCPPPATKIIDFKLPA--PAKLRVRPPAHAVDKAYR  58

Query  1459  EKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRW  1280
             +KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFPFHR+
Sbjct  59    DKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRY  118

Query  1279  YLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVD  1100
             YLYFFE+ILGKLI DPTF +PFWNWD P GM  P+I  D    LYD+ R+  H PPT++D
Sbjct  119   YLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPTIYTDPKSPLYDKFRSAKHQPPTLID  178

Query  1099  LGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPH  920
             L Y G +   +    I  NL +MY+QM +N+  A+LF G PYR+GD+ +PG GS+E +PH
Sbjct  179   LDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEGTPH  238

Query  919   VPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDAD  740
              P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + TD+D
Sbjct  239   GPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLG--GKRTDLTDSD  296

Query  739   WINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALR---  569
             W+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP   PRR K+AL    
Sbjct  297   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPT--PRRAKVALSKIA  354

Query  568   -----------SAAPYVA-TVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiE  428
                        S++  VA T FP++L   +   V R  +K R+K+ KE EEEIL+IEGIE
Sbjct  355   KKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKAKEDEEEILVIEGIE  414

Query  427   VQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDL  248
                +   KFDV++ND D+   G DK EFAGSF  +PHR K+ +KI T L LGL + +E++
Sbjct  415   FDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEEI  474

Query  247   GAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              AEDDD+V+VTL P  G   V I  IKIE+ S
Sbjct  475   EAEDDDSVVVTLVPKYGA--VKIGGIKIEFAS  504



>gb|AFO55217.1| chloroplast polyphenol oxidase I [Eriobotrya japonica]
Length=593

 Score =   531 bits (1368),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 297/575 (52%), Positives = 388/575 (67%), Gaps = 34/575 (6%)
 Frame = -1

Query  1804  HSHLHILTPVVLNRRLKVLCNAAHG-----GDSKIDRRDVIlglgglygaanlpa---AM  1649
             +S + +LT    +   KV C A +        SK+DRR+V+LGLGG+YG A +     A 
Sbjct  29    NSQVSLLTKPKRSFARKVSCKATNNDQNDQAQSKLDRRNVLLGLGGIYGVAGMGTDPFAF  88

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P+VSKC     DLP GA+  NCCPP A + +D++LP+  PA +R+RP  H +D 
Sbjct  89    AKPIAPPDVSKC--GSADLPPGAEATNCCPPPATKIIDFKLPA--PAKLRIRPPAHAVDQ  144

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFPF
Sbjct  145   AYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPF  204

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  +    LYD+ R+  H PPT
Sbjct  205   HRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYANPKSPLYDKFRSAKHQPPT  264

Query  1108  IVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMEN  929
             +VDL Y G +   +    I  NL +MY+QM +N+  A LF G PYR+GD+ +PG GS+E 
Sbjct  265   LVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNARLFFGNPYRAGDEPDPGGGSIEG  324

Query  928   SPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFT  749
             +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW IW+ LG  G++ + T
Sbjct  325   TPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWNIWKTLG--GKRTDLT  382

Query  748   DADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL-  572
             D+DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP   PRR K+AL 
Sbjct  383   DSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYGYQDVDIPWLSSKPT--PRRAKVALS  440

Query  571   --------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeillie  437
                            S+     T FP++L   +   V R  +K R+K+ KE EEEIL+IE
Sbjct  441   KIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKAKEDEEEILVIE  500

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAM  257
             GIE   +   KFDV++ND D+   G DK EFAGSF  +PHR K+ +KI T L LGL + +
Sbjct  501   GIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLL  560

Query  256   EDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              ++ AEDDD+V+VTL P  G   V I  IKIE+ S
Sbjct  561   GEIEAEDDDSVVVTLVPKYGA--VKIGGIKIEFAS  593



>emb|CBZ41490.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=601

 Score =   530 bits (1366),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 275/509 (54%), Positives = 366/509 (72%), Gaps = 16/509 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI AP+V+KC   P DLP GA   NCCPP+  + LD++LPS S  T+R+RPA H +D
Sbjct  96    FADPIMAPDVTKC--GPPDLPKGAIRTNCCPPSTTKILDFKLPSPS-NTLRIRPAAHLVD  152

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  KF KA+++MKALP DDPRSF  QA VHCAYC+GAYD  GF D+++QVH SWLF P
Sbjct  153   KDYITKFNKAIKLMKALPNDDPRSFKNQADVHCAYCDGAYDHFGFQDLDLQVHASWLFLP  212

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+Y+YFFE+I GKLI DPTF +PFWNWD P GM  P I  ++  SLYD  R+  H PP
Sbjct  213   FHRYYIYFFEKICGKLINDPTFAIPFWNWDAPDGMTIPDIYTNKKSSLYDALRDAKHQPP  272

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             ++VDL Y G D      ++ + NL ++Y+QM +++ TA LF+G PYR+GD+ NPGAGS+E
Sbjct  273   SLVDLDYNGIDENLNPSKQTSTNLKILYRQMVSSSKTASLFMGNPYRAGDEANPGAGSIE  332

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N PH P+H W GD  ++NGE MGNFYSA RD  FY HHAN+DRMW+IW+ LG  GR+++F
Sbjct  333   NIPHDPVHIWTGDRSQRNGEHMGNFYSAARDPIFYAHHANIDRMWSIWKTLG--GRRKDF  390

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKP----RRR  584
             TD DW+++SF FY+ENA  VRV+V DC++++ +GY Y+   +PW+ +KP  K     R+ 
Sbjct  391   TDKDWLDSSFSFYDENADLVRVKVRDCLDSKNLGYVYQDVKIPWLKTKPSSKSEKSRRKA  450

Query  583   KLALRSAA------PYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +   R  A      P+   VFP +LD+V++V VPRPKK+R K++KE EEEIL++EGIEV+
Sbjct  451   EHHKRDVARADEHIPFAKDVFPASLDKVIKVLVPRPKKSRNKKQKEEEEEILVVEGIEVK  510

Query  421   ANQYTKFDVYLNDEDEP-DGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLG  245
             ++ + KFDV++NDED+      DK EFAGSF ++PH  K+ + ++T L LG++E +EDLG
Sbjct  511   SDLFVKFDVFVNDEDDGVRATADKTEFAGSFVNVPHNHKHGKNVKTRLRLGISELLEDLG  570

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             AEDDD VLVTL P   GG V+I  IKIE+
Sbjct  571   AEDDDNVLVTLVPKTKGGEVSIKRIKIEH  599



>gb|AEE61322.1| polyphenol oxidase I [Pyrus x bretschneideri]
 gb|AEE61323.1| polyphenol oxidase I precursor [Pyrus x bretschneideri]
Length=593

 Score =   530 bits (1365),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 301/592 (51%), Positives = 395/592 (67%), Gaps = 38/592 (6%)
 Frame = -1

Query  1855  SPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG-----GDSKIDRRDVIlg  1691
             +P   P + FS+     +S + +LT    +   KV C A +        SK+DRR+V+LG
Sbjct  16    NPATKPFSPFSQ----NNSQVSLLTKPKRSFARKVSCKATNNDQNDQAQSKLDRRNVLLG  71

Query  1690  lgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPS  1520
             LGGLYG A +     A A PI  P+VSKC     DLP GA+  NCCPP A + +D++LP+
Sbjct  72    LGGLYGVAGMGTDPFAFAKPIAPPDVSKC--GSADLPQGAEATNCCPPPATKIIDFKLPA  129

Query  1519  FSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVG  1340
               PA +R+RP  H +D  Y++KF KA+ +MKALP DDPRSF QQA VHCAYC+GAYDQ G
Sbjct  130   --PAKLRIRPPAHAVDKAYRDKFYKAMGLMKALPDDDPRSFKQQAAVHCAYCDGAYDQAG  187

Query  1339  FPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDR  1160
             FP++E+QVHNSWLFFPFHR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D 
Sbjct  188   FPELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADP  247

Query  1159  NVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGK  980
                LYD+ R+  H PPT++DL Y G +   +    I  NL +MY+QM +N+  A+LF G 
Sbjct  248   KSPLYDKFRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGN  307

Query  979   PYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRM  800
             PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRM
Sbjct  308   PYRAGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRM  367

Query  799   WTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPW  620
             W+IW+ LG  G++ +  D DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW
Sbjct  368   WSIWKTLG--GKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPW  425

Query  619   INSKPVPKPRRRKLAL---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkk  488
             ++SKP   PRR K+AL                S+     T FP++L   +   V R  +K
Sbjct  426   LSSKPT--PRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQK  483

Query  487   nrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQK  308
              R+K+ KE EEEIL+IEGIE   +   KFDV++ND D+   G DK EFAGSF  +PHR K
Sbjct  484   KRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHK  543

Query  307   NVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             + +KI T L LGL + +E++ AEDDD+V+VTL P  G   V I  IKIE+ S
Sbjct  544   HKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYGA--VNIGGIKIEFAS  593



>ref|XP_008224998.1| PREDICTED: polyphenol oxidase, chloroplastic [Prunus mume]
Length=589

 Score =   528 bits (1361),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 303/599 (51%), Positives = 398/599 (66%), Gaps = 37/599 (6%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIP---THSHLHILTPVVLNRRLKVLCNAAHG------GDSKI  1715
             MASLSPP A     ++   P     S + +L+    +   +V C A +         +K+
Sbjct  1     MASLSPPLAVPTTSTKPLSPFTQNSSQVSLLSKPKRSFSPRVSCKAKNSDNQNDQAQTKL  60

Query  1714  DRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGR  1544
             DRR+V+LGLGGLYG A L     A A P+  P++SKC     DLP GA   NCCPP A +
Sbjct  61    DRRNVLLGLGGLYGVAGLGTDPFAFAKPVTPPDLSKCGA--ADLPTGATPTNCCPPPATK  118

Query  1543  YLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYC  1364
              +D++LP+  P  +RVRPA H +D  Y EK++KA+E+MKALP DDPRSF QQA VHCAYC
Sbjct  119   IIDFKLPA--PGKLRVRPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYC  176

Query  1363  NGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMV  1184
             +GAYDQ GFPD+E+Q+HNSWLFFPFHR+YLYF+E+ILGKLI DPTF LPFWNWD PAGM 
Sbjct  177   DGAYDQAGFPDLELQIHNSWLFFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQ  236

Query  1183  FPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAG  1004
              P++  +    LYD+ R  SH PPT++DL Y G D + ++  +I  NL +MY+QM +NA 
Sbjct  237   LPALFANPKSPLYDKFRAASHQPPTLIDLDYNGTDEKVSNETQINANLKIMYRQMVSNAK  296

Query  1003  TAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYC  824
               +LF G PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSA RD  F+ 
Sbjct  297   NPQLFFGNPYRAGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFS  356

Query  823   HHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYK  644
             HH+NVDRMW+IW+ LG  G++ + + +DW+++ FLFYNENA+ VRV+V D +E++ +GY 
Sbjct  357   HHSNVDRMWSIWKTLG--GKRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYV  414

Query  643   YEFANLPWINSKPVPKPRRRKLAL-------------RSAAPYVA-TVFPVTLDrvvrvk  506
             Y+   +PW+ SKP   PRR KLAL              S+   VA   FP+ L+  +   
Sbjct  415   YQEVEIPWLQSKPT--PRRAKLALSKIKKKLGVAHAAESSTQIVAGRAFPINLETKISTV  472

Query  505   v-prpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             V    +K R K+EKE EEEIL+IEGIE   +   KFDVY+ND D+   G DK EFAGSF 
Sbjct  473   VPRPKQKKRNKKEKEEEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFV  532

Query  328   HLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              +PHR K+ +KI T L LGL + +EDL AEDD++V+VTL P  G   V I  +KIE+ S
Sbjct  533   SVPHRHKHKKKINTILRLGLTDLLEDLDAEDDESVVVTLVPKYGA--VKIGGVKIEFAS  589



>gb|ABS88291.1| polyphenol oxidase [Pyrus x bretschneideri]
 gb|ACI15854.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   528 bits (1360),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 305/607 (50%), Positives = 397/607 (65%), Gaps = 49/607 (8%)
 Frame = -1

Query  1867  MASLSPP-----------RAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG---  1730
             M SLSPP             P + FS+     +S + +LT    +   KV C A +    
Sbjct  1     MTSLSPPVVTNPTVPNPATKPFSPFSQ----NNSQVSLLTKPKRSFARKVSCKATNNDQN  56

Query  1729  --GDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNC  1565
                 SK+DRR+V+LGLGGLYG A +     A A PI  P+VSKC     DLP GA+  NC
Sbjct  57    DQAQSKLDRRNVLLGLGGLYGVAGMGTDPFAFAKPIAPPDVSKCGS--ADLPPGAEATNC  114

Query  1564  CPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQA  1385
             CPP A + +D++LP+  PA +R+RP  H +D  Y++KF KA+E+MKALP DDPRSF QQA
Sbjct  115   CPPPATKIIDFKLPA--PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQA  172

Query  1384  KVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNW  1205
              VHCAYC+GAYDQ GFP++E+QVH+SWLFFPFHR+YLYFFE+ILGKLI DPTF +PFWNW
Sbjct  173   AVHCAYCDGAYDQAGFPELELQVHDSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNW  232

Query  1204  DIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYK  1025
             D PAGM  P+I  D    LYD+ R+  H PPT++DL Y   +   +    I  NL +MY+
Sbjct  233   DSPAGMPLPAIYADPKTPLYDKFRSAKHQPPTLIDLDYNRTEDNVSTETTINANLKIMYR  292

Query  1024  QMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAG  845
             QM +N+  A+LF G PYR+GD  NPG GS+E +PH  +H W GD  + N EDMGNFYSAG
Sbjct  293   QMVSNSKNAQLFFGNPYRAGDGPNPGGGSIEGTPHGSVHLWTGDNTQPNFEDMGNFYSAG  352

Query  844   RDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVE  665
             RD  FY HH+NVDRMW+IW+ LG  G++ +  D DW+++ FLFYNENA+ VRV+V DC+E
Sbjct  353   RDPVFYAHHSNVDRMWSIWKTLG--GKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLE  410

Query  664   NQQMGYKYEFANLPWINSKPVPKPRRRKLAL---------------RSAAPYVATVFPVT  530
              + +GY Y+  ++PW++SKP   PRR K+AL                S+     T FP++
Sbjct  411   TKNLGYAYQDVDIPWLSSKPT--PRRAKVALGKIAKKLGVAHATVASSSKVVAGTEFPIS  468

Query  529   LDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
             L   +   V R  +K R+K+ KE EEEIL+IEGIE   +   KFDV++ND D+   G DK
Sbjct  469   LGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDK  528

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
              EFAGSF  +PHR K+ +KI T L LGL + +E++ AEDDD+V+VTL P  G   V I  
Sbjct  529   TEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYGA--VNIGG  586

Query  172   IKIEYGS  152
             IKIE+ S
Sbjct  587   IKIEFAS  593



>gb|AFL03159.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   528 bits (1359),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 305/607 (50%), Positives = 397/607 (65%), Gaps = 49/607 (8%)
 Frame = -1

Query  1867  MASLSPP-----------RAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG---  1730
             M SLSPP             P + FS+     +S + +LT    +   KV C A +    
Sbjct  1     MTSLSPPLVTNPTVPNPATKPFSPFSQ----NNSQVSLLTKPKRSFARKVSCKATNNDQN  56

Query  1729  --GDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNC  1565
                 SK+DRR+V+LGLGGLYG A +     A A PI  P+VSKC     DLP GA+  NC
Sbjct  57    DQAQSKLDRRNVLLGLGGLYGVAGMGTDPFAFAKPIAPPDVSKCGS--ADLPPGAEATNC  114

Query  1564  CPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQA  1385
             CPP A + +D++LP+  PA +R+RP  H +D  Y++KF KA+E+MKALP DDPRSF QQA
Sbjct  115   CPPPATKIIDFKLPA--PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQA  172

Query  1384  KVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNW  1205
              VHCAYC+GAYDQ GFP++E+QVH+SWLFFPFHR+YLYFFE+ILGKLI DPTF +PFWNW
Sbjct  173   AVHCAYCDGAYDQAGFPELELQVHDSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNW  232

Query  1204  DIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYK  1025
             D PAGM  P+I  D    LYD+ R+  H PPT++DL Y   +   +    I  NL +MY+
Sbjct  233   DSPAGMPLPAIYADPKTPLYDKFRSAKHQPPTLIDLDYNRTEDNVSTETTINANLKIMYR  292

Query  1024  QMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAG  845
             QM +N+  A+LF G PYR+GD  NPG GS+E +PH  +H W GD  + N EDMGNFYSAG
Sbjct  293   QMVSNSKNAQLFFGNPYRAGDGPNPGGGSIEGTPHGSVHLWTGDNTQPNFEDMGNFYSAG  352

Query  844   RDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVE  665
             RD  FY HH+NVDRMW+IW+ LG  G++ +  D DW+++ FLFYNENA+ VRV+V DC+E
Sbjct  353   RDPVFYAHHSNVDRMWSIWRTLG--GKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLE  410

Query  664   NQQMGYKYEFANLPWINSKPVPKPRRRKLAL---------------RSAAPYVATVFPVT  530
              + +GY Y+  ++PW++SKP   PRR K+AL                S+     T FP++
Sbjct  411   TKNLGYAYQDVDIPWLSSKPT--PRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPIS  468

Query  529   LDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
             L   +   V R  +K R+K+ KE EEEIL+IEGIE   +   KFDV++ND D+   G DK
Sbjct  469   LGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDK  528

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
              EFAGSF  +PHR K+ +KI T L LGL + +E++ AEDDD+V+VTL P  G   V I  
Sbjct  529   TEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEEIEAEDDDSVVVTLVPKYGA--VNIGG  586

Query  172   IKIEYGS  152
             IKIE+ S
Sbjct  587   IKIEFAS  593



>gb|KDP20931.1| hypothetical protein JCGZ_21402 [Jatropha curcas]
Length=592

 Score =   527 bits (1357),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 292/553 (53%), Positives = 386/553 (70%), Gaps = 21/553 (4%)
 Frame = -1

Query  1762  RLKVLCNAAHGGDSK-IDRRDVIlglgglygaanlp---aAMAGPIEAPEVSKCVVPPTD  1595
             RL + C A +        RRD+++GLGGLYGA  +    +A+A P+ AP+++KC     D
Sbjct  42    RLPISCKATNADQQNPTTRRDILIGLGGLYGATTIGNDPSALAKPVAAPDLTKC--GKAD  99

Query  1594  LPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPA  1415
             LPA A   NCCPP + + LD++LPS S   +R+RPA H  D  Y  K++KA+E+MKALP 
Sbjct  100   LPANALPTNCCPPPSTKILDFKLPS-SNNPLRIRPAAHLADDAYVAKYSKAIELMKALPD  158

Query  1414  DDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRD  1235
             DDPRSF QQA VHCAYC+GAY QVGFPD+++Q+HNSWLFFPFHR+YLYF+E+ILGKLI D
Sbjct  159   DDPRSFKQQASVHCAYCDGAYHQVGFPDLDLQIHNSWLFFPFHRYYLYFYEKILGKLIDD  218

Query  1234  PTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLER  1055
             P F LPFWNWD PAGM  P +      +LYD+ R++SH PPT++DL Y G ++  ++ E+
Sbjct  219   PNFALPFWNWDSPAGMQIPKMFVSPKSALYDQYRHKSHQPPTLIDLDYSGTESSYSNQEQ  278

Query  1054  ITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNG  875
             +++NL +MY+QM +N  TA+LF G  YRSGD+ +PGAGS+EN PH P+H W GD  + N 
Sbjct  279   LSSNLTIMYRQMVSNGKTAKLFFGNAYRSGDEPDPGAGSIENIPHGPVHLWTGDSTQPNK  338

Query  874   EDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQP  695
             EDMGNFYSAGRD  F+ HHANVDRMWT+W+ LGG  R    TD DW+NA FLFY+ENA  
Sbjct  339   EDMGNFYSAGRDPIFFAHHANVDRMWTLWKTLGGSKRTE-ITDTDWLNAEFLFYDENANL  397

Query  694   VRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL--ALRSAAPYVA---------  548
             VRV+V D ++ +++GY Y+   +PW+ SKP P+   +K+  AL       A         
Sbjct  398   VRVKVKDSIDYKKLGYGYQDVEVPWLKSKPTPRKVIKKIVKALHHGQEAKAAENNQNLTP  457

Query  547   -TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEP  371
              + FP+ L++V RV V RPKK+R+K+EKE EEE+LL++GIE       KFDVY+NDED+ 
Sbjct  458   ISSFPLVLEKVTRVLVKRPKKSRSKKEKEEEEEVLLVDGIEFARESAVKFDVYINDEDDS  517

Query  370   DGGY-DKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGG  194
                  DK+EFAGSF  +PH   +  K++T L LGL + +EDLGAEDDD VLVTL P  G 
Sbjct  518   TSTKPDKSEFAGSFVSVPHTHSHGTKMKTCLRLGLTDLLEDLGAEDDDEVLVTLVPRYGI  577

Query  193   GVVTIDNIKIEYG  155
             G+V ID IK+++ 
Sbjct  578   GLVKIDAIKVDFA  590



>ref|XP_007211392.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
 gb|EMJ12591.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
Length=589

 Score =   526 bits (1356),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 298/599 (50%), Positives = 397/599 (66%), Gaps = 37/599 (6%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIP---THSHLHILTPVVLNRRLKVLCNAAHG------GDSKI  1715
             MASLSPP A     ++   P     S + +L+    +   +V C A +         +K+
Sbjct  1     MASLSPPPAIPTTSTKPLSPFTQNSSQVSLLSKPKRSFSPRVSCKAKNSDNQNDQAQTKL  60

Query  1714  DRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGR  1544
             DRR+V+LGLGGLYG A L     A A P+  P++SKC     DLP GA   NCCPP A +
Sbjct  61    DRRNVLLGLGGLYGVAGLGTDPFAFAKPVNPPDLSKCGA--ADLPTGATPTNCCPPPATK  118

Query  1543  YLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYC  1364
              +D++LP+  P  +R+RPA H +D  Y EK++KA+E+MKALP DDPRSF QQA VHCAYC
Sbjct  119   IIDFKLPA--PGKLRIRPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYC  176

Query  1363  NGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMV  1184
             +GAYDQ GFPD+E+Q+HNSWLFFPFHR+YLYF+E+ILGKLI DPTF LPFWNWD PAGM 
Sbjct  177   DGAYDQAGFPDLELQIHNSWLFFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQ  236

Query  1183  FPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAG  1004
              P++  +    LYD+ R  SH PPT++DL Y G D + ++  +I  NL +MY+QM +NA 
Sbjct  237   LPALFANPKSPLYDKFRAASHQPPTLIDLDYNGTDEKVSNETQINANLKIMYRQMVSNAK  296

Query  1003  TAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYC  824
               +LF G PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSA RD  F+ 
Sbjct  297   NPQLFFGNPYRAGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNLEDMGNFYSAARDPIFFS  356

Query  823   HHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYK  644
             HH+NVDRMW+IW+ LG  G++ + + +DW+++ FLFYNENA+ VRV+V D +E++ +GY 
Sbjct  357   HHSNVDRMWSIWKTLG--GKRTDISHSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYV  414

Query  643   YEFANLPWINSKPVPKPRRRKLALRSAAPYVAT--------------VFPVTLDrvvrvk  506
             Y+  ++PW+ SKP   PRR KLA+   A  +                 FP+ L+  +   
Sbjct  415   YQEVDIPWLQSKPT--PRRAKLAVSKIAKKLGVAHAAESSTKIVAGRAFPINLETKISTV  472

Query  505   v-prpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             V    +K R K+EKE EEEIL+IEGIE   +   KFDVY+ND D+   G DK EFAGSF 
Sbjct  473   VPRPKQKKRNKKEKEEEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFV  532

Query  328   HLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              +PHR K+ +KI T L LGL + +ED+ AEDD++V+VTL P  G   V I  +KIE+ S
Sbjct  533   SVPHRHKHKKKINTILRLGLTDLLEDIDAEDDESVVVTLVPKYGA--VKIGGVKIEFAS  589



>ref|XP_004293526.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   526 bits (1356),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 361/513 (70%), Gaps = 19/513 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP G    +CCPPT  + +D++LPS  P  +RVRPA H +D
Sbjct  88    FAKPVAPPDVSKCGA--ADLPNGVAPTDCCPPTPSKIIDFKLPS--PTPLRVRPAAHAVD  143

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+E+MKALP DDPRSF  QA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  144   DAYIAKYTKAMELMKALPDDDPRSFKNQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  203

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERILGKLI DPTF LPFWNWD PAGM  P++  +    LYD+ R  +H PP
Sbjct  204   FHRYYLYFYERILGKLINDPTFALPFWNWDNPAGMQLPALFANPKSPLYDQFRAAAHQPP  263

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL + G +   ++  +I +NL++MY+QM +NA  A+LF G PYR+GD+ +PG GS+E
Sbjct  264   TLIDLDFNGTEDNTSNTTQINSNLSIMYRQMVSNAKNAQLFFGNPYRAGDEPDPGGGSIE  323

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDRMW+IW+ L  +   ++ 
Sbjct  324   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAPKN--KDI  381

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-----  587
             TD+DW+++ FLFY+ENA  VRV+V DC+E++ +GY Y+  ++PW+NSKP P+  +     
Sbjct  382   TDSDWLDSGFLFYDENANMVRVKVRDCLESKNLGYVYQDVDIPWLNSKPTPRRSKVAFSN  441

Query  586   --RKLALRSAAPYVATV-----FPVTLDrvvrvkv-prpkknrtkeekeleeeilliegi  431
               +KL + +AA   A V     FP+TL R + V V    +K R+K+EKE EEEIL+IEGI
Sbjct  442   IAKKLGVANAAGSKAKVVKITDFPLTLSRKISVAVPRPKQKKRSKKEKEDEEEILVIEGI  501

Query  430   EVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMED  251
             E   +   KFDVY+NDED+   G DK+EFAGSF  +PHR K+ +KI T L LGL + +ED
Sbjct  502   EFDRDVAVKFDVYINDEDDLPSGPDKSEFAGSFVSVPHRHKHTKKINTVLRLGLTDLLED  561

Query  250   LGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             L AEDD+TV+VTL P      V I  IKIE+ S
Sbjct  562   LDAEDDETVVVTLIPRYAADKVKIGGIKIEFAS  594



>gb|AEL95440.1| polyphenol oxidase [Populus euphratica]
Length=590

 Score =   526 bits (1355),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 275/513 (54%), Positives = 362/513 (71%), Gaps = 20/513 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPT-AGRYLDYQLPSFSPATMRVRPALHRL  1475
              A P+ AP++SKC     DLP G +  NCCPP  + + LD++ PS S A +RVRPA H  
Sbjct  80    FAAPVSAPDISKCSR--ADLPTGVNETNCCPPVPSTKILDFKRPS-SNAPLRVRPAAHLA  136

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             D  Y  K++KA+E+MKALP DDPRSF QQA VHCAYCNGAYDQVGFP+++IQVHNSWLFF
Sbjct  137   DKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNSWLFF  196

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHR+YLYF+E+ILGKLI DPTF LPFWNWD P GM  P++  D N  LYD  RN++H P
Sbjct  197   PFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPNSPLYDSLRNKNHQP  256

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             PT++DL + G DT  ++ E+I++NL +MY+QM +N  T  LF G  YR+GD+  P AG +
Sbjct  257   PTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYRAGDEPGPEAGPI  316

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSA RD  F+CHH+NVDRMW++W+ LG  GR+ +
Sbjct  317   ENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG--GRRTD  374

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA  575
              TD DW+NASF FY+ENA PVRV+V DC++ +++GY Y+   +PW+ S+P P+   +K+A
Sbjct  375   LTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPRRSAKKVA  434

Query  574   L--------------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
                            ++ A    T FP+ L+RV+ VKV RPKK+R+K+EKE EEE+L+I+
Sbjct  435   SNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDEEELLVIQ  494

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAM  257
             G+E    +  KFDVY+NDED+     DK EFAGSF ++PH+ K+ +KI T   L L + +
Sbjct  495   GLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKINTCFRLALTDLL  554

Query  256   EDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             EDL  E DD+V+VTL P  G G+  I  IKIE+
Sbjct  555   EDLDVEGDDSVIVTLVPRYGEGLAKIGGIKIEF  587



>gb|AHF20575.1| polyphenol oxidase [Hevea brasiliensis]
Length=600

 Score =   526 bits (1354),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 280/510 (55%), Positives = 366/510 (72%), Gaps = 18/510 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADV-DNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL  1475
              A PI  PE +KC     DLP  A    NCCPPT+ + LD++LPS S + +R+RPA H  
Sbjct  92    FAKPISTPEPTKCG--KADLPNYAKPPTNCCPPTSTKILDFKLPS-SQSPLRIRPAAHLA  148

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             D  Y  K++KAV++MKALP DDPRSF QQAKVHCAYCNGAYDQVGFPD++IQVHNSWLFF
Sbjct  149   DDAYIAKYSKAVKLMKALPEDDPRSFMQQAKVHCAYCNGAYDQVGFPDLQIQVHNSWLFF  208

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHR+YLYF E+ILGKLI DPTF LP+WNWD P GM  P++  +    LYD+ RN++H P
Sbjct  209   PFHRYYLYFHEKILGKLIDDPTFALPYWNWDSPKGMQLPALYANPKSPLYDQYRNKNHQP  268

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             PTIVDL Y   +    + E I++NL +MY+QM +N  TA+LFLG PYR+GD+ +PGAGS+
Sbjct  269   PTIVDLDYNATEGPTPEQETISSNLTIMYRQMISNGKTAKLFLGSPYRAGDEPDPGAGSI  328

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  ++N E+MGNFYSAGRD  FY HH+NVDRMWTIW+ LG  G++  
Sbjct  329   ENIPHNPLHVWTGDNFQRNLENMGNFYSAGRDPIFYAHHSNVDRMWTIWKTLG--GKRTE  386

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA  575
             FTD DW++A+FL Y+ENA  VRV+V DC++++++ Y Y+   +PW+ S+P P+   +K+A
Sbjct  387   FTDPDWLDAAFLLYDENANLVRVKVRDCIDHKKLRYAYQEVEIPWLKSRPTPRRLIKKMA  446

Query  574   --------LRSAAPYV----ATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegi  431
                     +  AA          FP+ LD+V+R  V RPKK+R+K+EKE EEEIL+I GI
Sbjct  447   KVFHHHDQVAQAAETQNLTPTNSFPLKLDKVIRTMVSRPKKSRSKKEKEEEEEILVINGI  506

Query  430   EVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMED  251
             E + +   KFDVY+NDE +   G +K+EFAGSF ++PH  K+ +K++T L LG+ + +ED
Sbjct  507   EFERDAVVKFDVYVNDEHDSPSGPNKSEFAGSFVNVPHAHKHGKKMKTCLRLGITDLLED  566

Query  250   LGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             LGAEDDD V+V L P +G G V I  IKIE
Sbjct  567   LGAEDDDNVVVALVPRIGKGQVRIGGIKIE  596



>gb|AII22006.1| polyphenol oxidase-4 [Gossypium hirsutum]
Length=584

 Score =   525 bits (1352),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 287/545 (53%), Positives = 392/545 (72%), Gaps = 17/545 (3%)
 Frame = -1

Query  1753  VLCNAAHGGD-SKIDRRDVIlglgglygaanlpaAMA--GPIEAPEVSKCVVPPTDLPAG  1583
             V C A +G D +K DRRD++LGLGGLYG ++L  ++A   P+  P+ + C  P  DLP G
Sbjct  43    VSCKATNGDDQNKFDRRDILLGLGGLYGVSSLNDSLAFAKPVTGPDFTHCGRP--DLPIG  100

Query  1582  ADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPR  1403
             A   NCCPP + + +D+ LP  S A ++ RPA H ++  Y  KF+KA+E+MKALPA DPR
Sbjct  101   AANINCCPPPSTKIVDFVLPP-SNAPLQTRPAAHLVNDDYLAKFSKAIELMKALPASDPR  159

Query  1402  SFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFG  1223
             SF QQA VHCAYC+GAY Q+GFPD+++QVHNSWLFFPFHR+YLYFFE+ILGKLI DPTF 
Sbjct  160   SFMQQANVHCAYCDGAYHQLGFPDLDLQVHNSWLFFPFHRFYLYFFEKILGKLIDDPTFA  219

Query  1222  LPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNN  1043
             +PFWNWD PAGM  P+I  + N  LYD+ RN  H PPT++DL Y G D   +  ++I++N
Sbjct  220   MPFWNWDSPAGMQMPAIYANPNSPLYDKLRNARHKPPTLLDLDYNGVDETLSSKDQISSN  279

Query  1042  LALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMG  863
             L +MY+QM +N  TA+LFLG  YR+G++ +PGAGS+EN PH  +H W GD  ++N E+MG
Sbjct  280   LNVMYRQMVSNGKTAKLFLGNAYRAGEEPDPGAGSLENIPHGLVHIWCGDNTQQNFENMG  339

Query  862   NFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVR  683
             NFYSAGRD  FY HH+NVDRMW++W+ LG  G++ +FTD+DW++++FLFY+ENA  VRV+
Sbjct  340   NFYSAGRDPIFYAHHSNVDRMWSVWKTLG--GKRTDFTDSDWLDSAFLFYDENANLVRVK  397

Query  682   VGDCVENQQMGYKYEFANLPWINSKPVPK----PRRRKLALRSAAPYVATV-----FPVT  530
             V DC++ +++ Y+Y+   +PW+ +KP PK      +R L + +AA     V     FP+ 
Sbjct  398   VRDCLDTKKLRYEYQNVEIPWLKTKPTPKRVISKVKRALGVANAAETKKMVVRNFKFPLV  457

Query  529   LDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKA  350
             LD +V ++V RPKK+R+++E+E EEE+L+IE IE   +Q  KFDVY+NDED+   G D  
Sbjct  458   LDDIVSLEVARPKKSRSRKEEEEEEEVLVIENIEFDRHQVVKFDVYINDEDDTVIGPDNT  517

Query  349   EFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNI  170
             EFAGSF ++PH+ K+ +K+ T L LGL   +E+L AEDDD V+VTL P  G G+  I  I
Sbjct  518   EFAGSFVNVPHKHKHGKKMATFLRLGLTYLLEELDAEDDDGVVVTLVPKFGKGLAKIGGI  577

Query  169   KIEYG  155
             KIE+ 
Sbjct  578   KIEFA  582



>ref|XP_011047843.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=590

 Score =   525 bits (1352),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 362/513 (71%), Gaps = 20/513 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPT-AGRYLDYQLPSFSPATMRVRPALHRL  1475
              A P+ AP++SKC     DLP G +  NCCPP  + + LD++ PS S A +RVRPA H  
Sbjct  80    FAAPVSAPDISKCSR--ADLPTGVNETNCCPPVPSTKILDFKRPS-SNAPLRVRPAAHLA  136

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             +  Y  K++KA+E+MKALP DDPRSF QQA VHCAYCNGAYDQVGFP+++IQVHNSWLFF
Sbjct  137   NKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNSWLFF  196

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHR+YLYF+E+ILGKLI DPTF LPFWNWD P GM  P++  D N  LYD  RN++H P
Sbjct  197   PFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPNSPLYDSLRNKNHQP  256

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             PT++DL + G DT  ++ E+I++NL +MY+QM +N  T  LF G  YR+GD+  P AG +
Sbjct  257   PTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYRAGDEPGPEAGPI  316

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSA RD  F+CHH+NVDRMW++W+ LG  GR+ +
Sbjct  317   ENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG--GRRTD  374

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA  575
              TD DW+NASF FY+ENA PVRV+V DC++ +++GY Y+   +PW+ S+P P+   +K+A
Sbjct  375   LTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPRRSAKKVA  434

Query  574   L--------------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
                            ++ A    T FP+ L+RV+ VKV RPKK+R+K+EKE EEE+L+I+
Sbjct  435   SNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDEEELLVIQ  494

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAM  257
             G+E    +  KFDVY+NDED+     DK EFAGSF ++PH+ K+ +KI T   L L + +
Sbjct  495   GLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKINTCFRLALTDLL  554

Query  256   EDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             EDL  E DD+V+VTL P  G G+  I  IKIE+
Sbjct  555   EDLDVEGDDSVIVTLVPRYGEGLAKIGGIKIEF  587



>gb|ADR78836.1| polyphenol oxidase [Ziziphus jujuba]
Length=594

 Score =   525 bits (1352),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 287/561 (51%), Positives = 390/561 (70%), Gaps = 26/561 (5%)
 Frame = -1

Query  1771  LNR--RLKVLCNAAHGGDS---KIDRRDVIlglgg---lygaanlpaAMAGPIEAPEVSK  1616
             LNR  + +V C A  G  S   K DRR+V++GLGG   + G  +   ++A P+  P++S 
Sbjct  39    LNRLSKRRVSCKATKGDQSPLGKFDRRNVLIGLGGLYGVNGLGSNSFSIAAPVAPPDLSN  98

Query  1615  CVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVE  1436
             C   P DLP+GA   +CCPP + + +D++LP  S   +RVRPA H +D  Y EK++KA+ 
Sbjct  99    C--GPPDLPSGAKPTDCCPPKSDKIIDFKLPPQS-NQLRVRPAAHVVDKNYIEKYSKAIA  155

Query  1435  MMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERI  1256
             +MKALP DDPR+FTQQA +HCAYC+ AYDQVGFPD+E+QVHN WLFFP HR+YLYF+E+I
Sbjct  156   LMKALPEDDPRNFTQQANIHCAYCDAAYDQVGFPDLELQVHNCWLFFPCHRYYLYFYEKI  215

Query  1255  LGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDT  1076
             LGKLI DPTF LPFWNWD P GM  P++  +    LYD  RN  H PPT++DL Y G D 
Sbjct  216   LGKLINDPTFALPFWNWDSPPGMQLPALYANLKSPLYDTLRNAGHQPPTLLDLDYNGTDE  275

Query  1075  EATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVG  896
               T  +++T+NL +MY+Q+ +N    +LF G  +RSG++ +PGAGS+EN P+ P+H W G
Sbjct  276   TTTKRDQLTSNLTIMYRQVVSNGKNPKLFFGGAFRSGEEPDPGAGSIENIPYGPVHLWSG  335

Query  895   DPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLF  716
             D  + N E+MGNFYSA RD  F+ HH+NVDRMWTIW+ LG  G++++ TD DW+NA FLF
Sbjct  336   DNTQPNLENMGNFYSAARDPMFFAHHSNVDRMWTIWKTLG--GKRKDITDPDWLNAGFLF  393

Query  715   YNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--------RKLALRSAA  560
             Y+EN Q VRV+V DC++ +++GY Y+  ++PW+ ++P P+  +        R L +  AA
Sbjct  394   YDENKQLVRVKVRDCLDEKKLGYVYQDVDIPWLKTRPTPRKSKLSKVASAVRALGVAQAA  453

Query  559   PYVATV----FPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDV  395
                 TV    FPV LD V+R  V R  KK R+K+EKE EEE+L+I+GIE   +   KFDV
Sbjct  454   VSKKTVTTTDFPVILDSVIRTVVDRPKKKRRSKQEKEEEEEVLVIDGIEFDRDLPVKFDV  513

Query  394   YLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVT  215
             Y+NDED+   G DK+EFAGSF  +P +QKN +K++T L LGL + +EDL AEDDD+V+VT
Sbjct  514   YVNDEDDLPSGPDKSEFAGSFVSVPRKQKNQKKLKTCLRLGLTDLLEDLEAEDDDSVVVT  573

Query  214   LAPNVGGGVVTIDNIKIEYGS  152
             L P  G G+V+I  +KIE+ S
Sbjct  574   LVPRTGKGLVSIGELKIEFAS  594



>emb|CBZ41492.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=593

 Score =   524 bits (1350),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 271/536 (51%), Positives = 365/536 (68%), Gaps = 14/536 (3%)
 Frame = -1

Query  1735  HGGDSKIDRRDVIlglgglygaanl----paAMAGPIEAPEVSKCVVPPTDLPAGADVDN  1568
             H    KIDRR+V+LGLG L GA         A A PI AP+++ C   P   P G    N
Sbjct  64    HANSGKIDRRNVLLGLGTLSGATATFGPNSLAFADPIMAPDITLC--GPATFPEGVATTN  121

Query  1567  CCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQ  1388
             CCPP+  + LD+++PS    T+RVRPA H ++  Y  K+ K V++MKALP DDPR+F QQ
Sbjct  122   CCPPSTTKILDFKVPS-QANTLRVRPAAHLVNKDYIAKYNKVVQLMKALPEDDPRNFMQQ  180

Query  1387  AKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWN  1208
             A VHCAYC+G YDQ+GF D+E QVH SWLF+PFHR+YLYFFE+I GKLI DP F +PFWN
Sbjct  181   ASVHCAYCDGTYDQLGFQDLEFQVHASWLFYPFHRYYLYFFEKICGKLIDDPNFTIPFWN  240

Query  1207  WDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMY  1028
             WD P GM  P I  ++N SLYD  R+  H PP++VDL Y G D   +  ++ + NL +MY
Sbjct  241   WDAPDGMTIPYIYTNKNSSLYDSLRDAKHQPPSLVDLDYNGVDRNLSPSKQTSTNLNIMY  300

Query  1027  KQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSA  848
             +QM   + T  LFLG PYR+GD  +PG G MEN PH P+H W GD  + N EDMGNFYSA
Sbjct  301   RQMVMASKTTSLFLGSPYRAGDDPSPGGGIMENVPHTPVHNWTGDRSQPNVEDMGNFYSA  360

Query  847   GRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCV  668
             GRD  FY HHANVDRMW+IW+ L   G ++++TD DW+++ FLFY+ENA  VRV+V DC+
Sbjct  361   GRDPIFYAHHANVDRMWSIWKSL--VGERKDYTDTDWLDSLFLFYDENADLVRVKVRDCL  418

Query  667   ENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvk----vp  500
             +++ +GY Y+  ++PW+NSKP P+ ++R  A ++   +   VFP +LD++++V       
Sbjct  419   DSKNLGYVYQDVDIPWLNSKPYPRLKKRLRAYKNVL-FAKDVFPGSLDKLIKVMVPRPKK  477

Query  499   rpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLP  320
                +     ++  EEEIL+IEGIEV+ +++ KFDV +N++DE     DK EFAGSF ++P
Sbjct  478   LRSQEENGHDEVEEEEILVIEGIEVKMDKFVKFDVLVNEDDEKKATADKTEFAGSFVNIP  537

Query  319   HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             H+ K  + ++T L LG++E ++DLGAEDD  VLVTL P   GG + ID IKIEYG+
Sbjct  538   HKHKPGKNMKTRLRLGISELLKDLGAEDDKNVLVTLVPKTKGGEIRIDEIKIEYGN  593



>gb|AEY78528.1| polyphenol oxidase [Canarium album]
Length=606

 Score =   523 bits (1346),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 292/548 (53%), Positives = 390/548 (71%), Gaps = 20/548 (4%)
 Frame = -1

Query  1756  KVLCNAAHGGDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPA  1586
             K   N      +K DRRDV++GLGG  G A+L +   A+A P+ AP+++KC     +LPA
Sbjct  61    KFSSNDGQTSLNKFDRRDVLVGLGGFCGFASLSSDPFAVAAPVSAPDLAKC--GKANLPA  118

Query  1585  GADVDNCCPPTAGRYLDYQL-PSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADD  1409
             GA   NCCPPT+ + L ++L PS +P  +R+RPA H +D  Y  K+++A+E+MKALPADD
Sbjct  119   GAKQTNCCPPTSKKILGFKLHPSNAP--LRIRPAAHLVDDAYIAKYSRAIELMKALPADD  176

Query  1408  PRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPT  1229
             PR F QQA VHCAYC+GAYDQ+GFP++E+QVHNSWLFFPFHR+YLYF+E+ILGKLI DPT
Sbjct  177   PRGFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPFHRYYLYFYEKILGKLIEDPT  236

Query  1228  FGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERIT  1049
             F LPFWNWD P GM  P++  +    LYD  RN SH PPT+VDL Y   D   T+ ++++
Sbjct  237   FALPFWNWDSPPGMQMPAMYANPKSPLYDNFRNASHQPPTLVDLDYNRTDETTTNKDQLS  296

Query  1048  NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGED  869
             +NL +MY+QM +N  TA+LF G  YR+GD+ +PG GS+EN PH P+H W GD  + N ED
Sbjct  297   SNLKIMYRQMVSNGKTAKLFFGNAYRAGDEPDPGLGSIENIPHGPVHLWCGDKTQPNLED  356

Query  868   MGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVR  689
             MGNFYSA RD  FY HH+N+DRMWTIW+ LGG+ RK  FTD DW++A FLFY+ENA  VR
Sbjct  357   MGNFYSAARDPIFYSHHSNIDRMWTIWKTLGGKKRKE-FTDPDWLDAGFLFYDENANLVR  415

Query  688   VRVGDCVENQQMGYKYEFANLPWINSKPVPKPR-----RRKLALRSAAP------YVATV  542
             V+V DC++N+++GY Y+  ++PW+N+KP P+ R     R    +  AA          + 
Sbjct  416   VKVRDCLDNKKLGYDYQKVDIPWLNTKPTPRKRIVNKVRSTFGVAHAAETRRIQLTARSQ  475

Query  541   FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGG  362
             FP+ LD+ +   VPRPKK+R+K+EKE EEE+L+IEGI+ + +   KFDVY+NDE +   G
Sbjct  476   FPLVLDKTMSTLVPRPKKSRSKKEKEEEEEVLVIEGIDFERDAQVKFDVYINDEHDVPSG  535

Query  361   YDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
              D  EFAGSF ++PH+ K+ +KI+T L LGL + +EDL AEDDD+V+VTL P  G G+  
Sbjct  536   PDDTEFAGSFVNVPHKHKHGKKIKTCLRLGLTDLIEDLEAEDDDSVVVTLVPRYGKGLAR  595

Query  181   IDNIKIEY  158
             I  IKIE+
Sbjct  596   IGGIKIEF  603



>dbj|BAA21676.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   521 bits (1343),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 302/605 (50%), Positives = 401/605 (66%), Gaps = 45/605 (7%)
 Frame = -1

Query  1867  MASLSPP-----------RAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG---  1730
             M SLSPP             P + FS+     +S + +LT    +   +V CNA +    
Sbjct  1     MTSLSPPVVTTPTAPNPDTKPLSPFSQ----NNSQVSLLTKPKRSLGREVSCNATNNDQF  56

Query  1729  --GDSKIDRRDVIlglgglygaanlpaAMAG---PIEAPEVSKCVVPPTDLPAGADVDNC  1565
                 SK+DRR+V+LGLGGLYG A +     G    I  P+VSKC   P DLP GA   NC
Sbjct  57    DQAQSKLDRRNVLLGLGGLYGVAGMVTDPRGFGKSIAPPDVSKCG--PGDLPQGAVPTNC  114

Query  1564  CPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQA  1385
             CPP + + +D++LP+  PA +R+RP  H +D  Y++K+ KA+E+MKALP DD RSF QQ 
Sbjct  115   CPPPSTKIIDFKLPA--PANLRIRPPAHAVDQAYRDKYYKAMELMKALPDDDSRSFKQQG  172

Query  1384  KVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNW  1205
              VHCAYC+GAYDQVGFP++E+Q+HNSWLFFPFHR+YLYF E+ILG LI DPTF LPFWNW
Sbjct  173   AVHCAYCDGAYDQVGFPELELQLHNSWLFFPFHRYYLYFCEKILGNLINDPTFALPFWNW  232

Query  1204  DIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYK  1025
             D PAGM  P+I  D    LYD+ R+  H PPT+VDL Y G +   +    I  NL +MY+
Sbjct  233   DSPAGMPLPAIYADPKSPLYDKLRSAKHQPPTLVDLDYNGTEDNVSKETTINANLKIMYR  292

Query  1024  QMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAG  845
             QM +N+  A+LF G PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSAG
Sbjct  293   QMVSNSKNAKLFFGNPYRAGDEPDPGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAG  352

Query  844   RDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVE  665
             RD  F+ HH+NVDRMW+IW+ LG  G++ + TD+DW+++ FLFYNENA+ VRV+V DC+E
Sbjct  353   RDPIFFAHHSNVDRMWSIWKTLG--GKRADLTDSDWLDSGFLFYNENAELVRVKVRDCLE  410

Query  664   NQQMGYKYEFANLPWINSKPVPK-------PRRRKL-----ALRSAAPYVA-TVFPVTLD  524
              + +GY Y+  ++PW++SKP P+       P  +KL     A+ S++  VA T FP+ L 
Sbjct  411   TKHLGYVYQDVDIPWLSSKPTPRRAEVALSPIAKKLGVAHPAVASSSKVVAGTEFPINLG  470

Query  523   rvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAE  347
               +   V R  +K R+K+ KE EEEIL+IEGIE   +   KFDVY+ND D+   G DK E
Sbjct  471   SKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGPDKTE  530

Query  346   FAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIK  167
             FAGSF  +PH  K+ +K+ T+L LGL + +E++ AEDDD+V+VTL P  G   V I  IK
Sbjct  531   FAGSFVSVPHSHKHKKKMNTTLRLGLTDLLEEIEAEDDDSVVVTLVPKFGA--VKIGGIK  588

Query  166   IEYGS  152
             IE+ S
Sbjct  589   IEFAS  593



>ref|XP_002316632.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
 gb|EEE97244.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
Length=590

 Score =   521 bits (1342),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 271/513 (53%), Positives = 359/513 (70%), Gaps = 20/513 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPT-AGRYLDYQLPSFSPATMRVRPALHRL  1475
              A P+ AP++SKC     DLP GA+  NCCPP  + + LD++ P  S A +RVRPA H  
Sbjct  80    FAAPVSAPDISKCGR--ADLPTGANETNCCPPVPSTKILDFKRPP-SNAPLRVRPAAHLA  136

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             D  Y  K+ KA+E+MKALP DDPRSF QQA VHCAYCNGAYDQVGFP++EIQVHNSWLFF
Sbjct  137   DKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNSWLFF  196

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHR+YLYF+E+ILGKLI DPTF LPFWNWD P GM  P++  D N  LYD  RN++H P
Sbjct  197   PFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPNSPLYDSLRNKNHQP  256

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             PT++DL + G DT  ++ E++++NL +MY+QM +N  T  LF G  YR+GD+  P  G +
Sbjct  257   PTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYRAGDEPGPEPGPI  316

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSA RD  F+CHH+NVDRMW++W+ LG  GR+ +
Sbjct  317   ENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG--GRRTD  374

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA  575
              TD DW+NASF FY+ENA PVRV+V DC++++ +GY Y+   +PW+ S+P P+   +K+A
Sbjct  375   LTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPRRSAKKVA  434

Query  574   L--------------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
                            +  A    T FP+ L++V+ VKV RPKK+R+K+EKE EEE+L+I+
Sbjct  435   SNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDEEELLVIQ  494

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAM  257
             G+E    +  KFDVY+NDED+     DK EFAGSF ++PH+ K+ +K+ T   L L + +
Sbjct  495   GLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKMTTCFRLALTDLL  554

Query  256   EDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             EDL  E DD+++VTL P  G G+  I  IKIE+
Sbjct  555   EDLDVEGDDSLIVTLVPRYGKGLAKIGGIKIEF  587



>ref|XP_010686568.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   522 bits (1344),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 290/585 (50%), Positives = 390/585 (67%), Gaps = 39/585 (7%)
 Frame = -1

Query  1813  IPTHSHLHILTPVVLNRRLKVLCNAAHGGDSK-----------IDRRDVIlglgglygaa  1667
             IP  S L I   +      K+ CN A   D             +DRR++++GLGGLYGAA
Sbjct  27    IPKTSQLSISRRLARRPTRKISCNVAKNDDQNPKTNHERSNNMLDRRNMLIGLGGLYGAA  86

Query  1666  nlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMR  1499
                    A++A P++ P  + C     DLP+ A   NCCPP A   +D+ LP  +P T+R
Sbjct  87    TTLGGGPASLAAPVQTPNPTACGA--ADLPSNAQGLNCCPPRATNIVDFVLPP-TPNTLR  143

Query  1498  VRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQ  1319
             VRP  H +D +Y++KF +A+ +MKALP+ DPRSFTQQA VHCAYCNG+Y  VGFP++++Q
Sbjct  144   VRPPAHLVDDQYRQKFNRAISLMKALPSTDPRSFTQQANVHCAYCNGSYSPVGFPNLDLQ  203

Query  1318  VHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDE  1139
             VHNSWLF+PFHRWYLYFFERILG LI DPTF +PFWNWD PAGMV P++  D N  LYD 
Sbjct  204   VHNSWLFYPFHRWYLYFFERILGTLINDPTFAIPFWNWDTPAGMVMPALYTDPNSPLYDS  263

Query  1138  NRNQSHLPPTIVDLGYQGKDT-EATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGD  962
              R+++H PP ++DL Y   D  + ++ + I+ NL LMY+QM TN+ TA LFLG+PYR+G 
Sbjct  264   VRDRAHQPPKVLDLNYDLTDANDLSNQQMISANLTLMYRQMVTNSSTARLFLGQPYRAGT  323

Query  961   KKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQ  782
             + NPG GS+EN PH  +H W GD  + N EDMGNFYSA RD  FY HHAN+DRMW+IW+ 
Sbjct  324   RPNPGGGSVENVPHGTVHVWTGDRNQPNFEDMGNFYSAARDPLFYAHHANIDRMWSIWKT  383

Query  781   LGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPV  602
             LG  G +++FT+ DW++ASF+FY+ENAQ VRVRV DC+   ++GY Y+  +LPW N++P+
Sbjct  384   LG--GNRQDFTETDWLDASFIFYDENAQAVRVRVRDCLNTARLGYNYQNVDLPWRNAQPL  441

Query  601   PKPRRRKLALRSAAPYVATV----------FPVTLDrvvrvkvprpkknrtkeekeleee  452
                R  +++  S+ P  A            FP  L++ +R  V RPKK+R+K EK+ EEE
Sbjct  442   ---RTSRVSSISSTPQAANAMESKTTTTVKFPRPLNKSIRTNVARPKKSRSKSEKDREEE  498

Query  451   illiegiEVQANQYTKFDVYLNDEDE-PDGGYD-KAEFAGSFAHLPHRQKNVE---KIRT  287
              L+IE   ++ ++Y KFDVY+NDED+ P      KAE+AGSF ++PHR K  E   K+ T
Sbjct  499   ELVIEVDVLRHDKYAKFDVYINDEDDVPSKKMQVKAEYAGSFVNVPHRHKQGEDKHKLTT  558

Query  286   SLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             +  +GL E +++LGA+DDD + V L P  G   V I N+KIEY S
Sbjct  559   TFRVGLTELIQELGADDDDGITVNLVPRAGKDNVVIKNVKIEYDS  603



>gb|AAW65103.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=589

 Score =   521 bits (1342),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 295/597 (49%), Positives = 396/597 (66%), Gaps = 33/597 (6%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIP---THSHLHILTPVVLNRRLKVLCNAAHG------GDSKI  1715
             MASLS P A     ++   P     S + +L+    +   +V C A +         +K+
Sbjct  1     MASLSSPLAIPTTSTKPLSPFTQNSSQVSLLSKPKRSFSPRVSCKAKNSDNQNDQAQTKL  60

Query  1714  DRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGR  1544
             DRR+V+LGLGGLYG A L     A A P+  P++SKC     DLP GA   NCCPP A +
Sbjct  61    DRRNVLLGLGGLYGVAGLGTDPFAFAKPVNPPDLSKCGA--ADLPTGATPTNCCPPLATK  118

Query  1543  YLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYC  1364
              +D++LP+  P  +RVRPA H +D  Y EK++KA+E+MKALP DDPRSF QQA VHCAYC
Sbjct  119   IIDFKLPA--PGKLRVRPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYC  176

Query  1363  NGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMV  1184
             +GAYDQ GFPD+E+Q+HNSWLFFPFHR+ LYF+E+ILGKLI DPTF LPFWNWD PAGM 
Sbjct  177   DGAYDQAGFPDLELQIHNSWLFFPFHRYCLYFYEKILGKLINDPTFALPFWNWDSPAGMQ  236

Query  1183  FPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAG  1004
              P++  +    LYD+ R  SH PPT++DL Y G D + ++  +I  NL +MY+QM +NA 
Sbjct  237   LPALFANPKSPLYDKFRAASHQPPTLIDLDYNGTDEKVSNETQINANLKIMYRQMVSNAK  296

Query  1003  TAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYC  824
               +LF G PYR+GD+ +PG GS+E +PH P+H W GD  + N EDMGNFYSA RD  F+ 
Sbjct  297   NPQLFFGNPYRAGDEPDPGGGSIEGTPHGPVHLWTGDNTQSNFEDMGNFYSAARDPIFFS  356

Query  823   HHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYK  644
             HH+NVDRMW+IW+ LG  G++ + + +DW+++ FLFYNENA+ VRV+V D +E++ +GY 
Sbjct  357   HHSNVDRMWSIWKTLG--GKRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYV  414

Query  643   YEFANLPWINSKPVPK-------PRRRKLALRSAAPYVATV-----FPVTLDrvvrvkv-  503
             Y+  ++PW+ SKP P+         ++KL +  AA     +     FP+ L+  +   V 
Sbjct  415   YQEVDIPWLQSKPTPRRAKLELSKIKKKLGVAQAAESSTKIVAGRAFPINLETKISTVVP  474

Query  502   prpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHL  323
                +K R K+EKE EEEIL+IEGIE   +   KFDVY+ND D+   G DK EFAGSF  +
Sbjct  475   RPKQKKRNKKEKEEEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSV  534

Query  322   PHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             PHR K+ +KI T L LGL + +ED+ AEDD++V+VTL P  G   V I  +KIE+ S
Sbjct  535   PHRHKHKKKINTILRLGLTDLLEDIEAEDDESVVVTLVPKYGA--VKIGGVKIEFAS  589



>ref|XP_004293528.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=607

 Score =   522 bits (1344),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/519 (49%), Positives = 347/519 (67%), Gaps = 30/519 (6%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA   +CCPP A +  D+QLP  S   +RVRPA H +D
Sbjct  98    FAKPVAPPDVSKCGA--ADLPTGAQKTDCCPPVAKKIFDFQLPPQS--KLRVRPAAHAVD  153

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSF QQA +HCAYC+GAYDQ GFPD+E+Q+H SWLFFP
Sbjct  154   KAYIEKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHGSWLFFP  213

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERILGKLI DP+F LPFWNWD PAGM  P +  +    LYD+ RN +H PP
Sbjct  214   FHRYYLYFYERILGKLINDPSFALPFWNWDAPAGMQLPGMFANPKSPLYDKFRNANHQPP  273

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              ++DL Y  KD   +D  +I  NL +MY+QM +NA   +LF G PYR+GD+ +PG G++E
Sbjct  274   KLIDLNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYRAGDEPSPGGGAIE  333

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDR+WT+W+ LG  G++ +F
Sbjct  334   TTPHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWTVWKTLG--GKREDF  391

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL--  578
             TD+DW+++ FLFY+ENA  VRV+V DC++++++GY Y+  ++PW + KP P+  +  +  
Sbjct  392   TDSDWLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWTSHKPTPRRVKDVIKK  451

Query  577   ------------ALRSAAPYVATV-FPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
                         A  ++   VA   FP++L      K+        ++++  +E+    E
Sbjct  452   FGHKLHGHGVAHAAETSTKVVAGAHFPISL----ASKISIAVARPQQKKRSQKEKDHEEE  507

Query  436   giEVQANQY-----TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLG  272
              + +Q  ++      KFDVY+NDED+   G DK+EFAGSF  +PHR K+ +KI T L LG
Sbjct  508   VLVIQGIEFDRDVGVKFDVYVNDEDDLPSGPDKSEFAGSFVSVPHRHKHTKKINTVLRLG  567

Query  271   LNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYG  155
             L + +EDL AEDD+T++VTL P  G   V I  IKIE+ 
Sbjct  568   LTDLLEDLDAEDDETIVVTLIPRYGAEHVKIGGIKIEFA  606



>ref|XP_010100570.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82813.1| Polyphenol oxidase [Morus notabilis]
Length=592

 Score =   520 bits (1340),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 267/515 (52%), Positives = 363/515 (70%), Gaps = 27/515 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P++SKC   P D P GA   NCCPP + + +DY+LP  S   +RVRPA H +D
Sbjct  86    LANPVAPPDLSKCG--PADFPPGATPTNCCPPISSKIIDYKLPPVS--KLRVRPATHTVD  141

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ +AV++MK LP  DPRSF+QQ+ +HCAYC+G+YDQVGFP++E+QVH SWLFFP
Sbjct  142   EAYIAKYNRAVQLMKDLPDSDPRSFSQQSDIHCAYCDGSYDQVGFPNLELQVHESWLFFP  201

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+ERILGKLI DPTF LPFWNWD P GM FP++  +    LYD+ R+ +H PP
Sbjct  202   FHRWYLYFYERILGKLIDDPTFALPFWNWDSPPGMQFPALYANAKSPLYDKLRDANHQPP  261

Query  1111  TIVDLGYQGKD----TEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGA  944
               VDL Y   D    T + D++ ++ NL +MY+Q+  N   A LFLG+PYR GD  +PG 
Sbjct  262   VTVDLDYSKADAGVPTTSKDVQ-VSANLKIMYRQIIANGKNARLFLGEPYREGDDPSPGP  320

Query  943   GSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGR  764
             GS+EN PH P+H W GD  + N E+MGNFYSA RD  F+ HH+N+DR+W++W+ LG  G+
Sbjct  321   GSLENVPHGPVHLWTGDSTQPNFENMGNFYSAARDPIFFSHHSNIDRLWSVWKTLG--GK  378

Query  763   KRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRR  584
             + +FTD DW+N+ FLFY+EN Q VRVRVGDC++++++GY Y+  ++PW+ +KP P   +R
Sbjct  379   RNDFTDPDWLNSGFLFYDENKQLVRVRVGDCLDSKKLGYVYQDVDIPWLQTKPTPLRTKR  438

Query  583   KLALRSAAPYVATV-------------FPVTLDrvvrvkvprpkknrtkeekeleeeill  443
              +A RS++  V                FP+ LD+V+   V RPKK+R+K EK+ EEE+L+
Sbjct  439   AVA-RSSSTLVGAALAADTKKTTTRVKFPIKLDKVISTVVSRPKKSRSKNEKDDEEEVLV  497

Query  442   iegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNE  263
             IEGIE   N   KFDVY+NDEDE   G + +EFAGSF ++PH++K   K RT+L LG+ +
Sbjct  498   IEGIEFDRNNPVKFDVYVNDEDE--SGPENSEFAGSFVNVPHKKKGDNKTRTNLRLGITD  555

Query  262   AMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
              +E+L AEDDD+V+VTL P  G G+VTI  IKI++
Sbjct  556   LLEELEAEDDDSVVVTLVPKFGKGLVTISGIKIDF  590



>gb|AAU12257.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=590

 Score =   520 bits (1338),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 270/513 (53%), Positives = 359/513 (70%), Gaps = 20/513 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPT-AGRYLDYQLPSFSPATMRVRPALHRL  1475
              A P+ AP++SKC     DLP GA+  NCCPP  + + LD++ P  S A +RVRPA H  
Sbjct  80    FAAPVSAPDISKCGR--ADLPTGANETNCCPPVPSTKILDFKRPP-SNAPLRVRPAAHLA  136

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             D  Y  K+ KA+E+MKALP DDPRSF QQA VHCAYCNGAYDQVGFP++EIQVHNSWLFF
Sbjct  137   DKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNSWLFF  196

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHR+YLYF+E+ILGKLI DPTF LPFWNWD P GM  P++  D +  LYD  RN++H P
Sbjct  197   PFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPHSPLYDSLRNKNHQP  256

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             PT++DL + G DT  ++ E++++NL +MY+QM +N  T  LF G  YR+GD+  P  G +
Sbjct  257   PTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYRAGDEPGPEPGPI  316

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSA RD  F+CHH+NVDRMW++W+ LG  GR+ +
Sbjct  317   ENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLG--GRRTD  374

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA  575
              TD DW+NASF FY+ENA PVRV+V DC++++ +GY Y+   +PW+ S+P P+   +K+A
Sbjct  375   LTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPRRSAKKVA  434

Query  574   L--------------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
                            +  A    T FP+ L++V+ VKV RPKK+R+K+EKE EEE+L+I+
Sbjct  435   SNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDEEELLVIQ  494

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAM  257
             G+E    +  KFDVY+NDED+     DK EFAGSF ++PH+ K+ +K+ T   L L + +
Sbjct  495   GLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKMTTCFRLALTDLL  554

Query  256   EDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             EDL  E DD+++VTL P  G G+  I  IKIE+
Sbjct  555   EDLDVEGDDSLIVTLVPRYGKGLAKIGGIKIEF  587



>ref|XP_010926766.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=592

 Score =   519 bits (1337),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 285/569 (50%), Positives = 381/569 (67%), Gaps = 21/569 (4%)
 Frame = -1

Query  1822  RRPIP-----THSHLHILTPVVLNRRLKVL-CNAAHGGDSKIDRRDVIlglg----glyg  1673
             RR +P     +H H  I      N   K +    A G   K+DRRD+++GLG       G
Sbjct  29    RRRVPLSSKKSHVHPRISCKATRNEHEKPMPTTEAIGSSGKLDRRDMLIGLGGLYGAATG  88

Query  1672  aanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVR  1493
                   A+  PIEAP+VSKC   P DLP+GA   +CCPP+  + +D++LP  S   +R+R
Sbjct  89    LGVNRKALGLPIEAPDVSKC--GPADLPSGATPTDCCPPSTSKIIDFKLPPRSDP-LRIR  145

Query  1492  PALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVH  1313
              A H +D +Y  K+AKAVE+MKALPADDPR+FTQQA VHCAYC+G+YDQ+GFPDIE+QVH
Sbjct  146   SAAHLVDSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIELQVH  205

Query  1312  NSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENR  1133
             NSW+FFP+HR+YLYF E+ILGKLI D TF LPFWNWD PAGM  PSI  D + SLY++ R
Sbjct  206   NSWIFFPWHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGMQMPSIYTDPSSSLYNKLR  265

Query  1132  NQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKN  953
             +  H PP ++DL + G+D   T  ++I  NL +MY+Q+ TN  TA+LF+G PYR+GD+ N
Sbjct  266   DAKHQPPYLIDLDFNGQDPSFTYDQQIDYNLKIMYRQVITNGKTAQLFMGSPYRAGDQPN  325

Query  952   PGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGG  773
             PGAGS+EN PH  +H W GD  + NGEDMG  YSA RD  FY HH+NVDRMW +W+ LG 
Sbjct  326   PGAGSLENVPHGTVHVWTGDRNQPNGEDMGTLYSAARDAIFYAHHSNVDRMWNVWKMLG-  384

Query  772   RGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK-  596
              G+ ++F D DW+N+SFLFY+ENA  VRV+V +C++ Q + Y Y+   +PW+ ++P PK 
Sbjct  385   -GKHKDFEDKDWLNSSFLFYDENADLVRVKVKNCLDTQGLRYTYQDVEIPWLKTRPTPKG  443

Query  595   PRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN  416
                 K   RS        FPVTLD  V   V RPK +R+++EKE EEE+L++EGIE   +
Sbjct  444   TAAAKKGARSLRAVTEATFPVTLDSSVSATVRRPKVSRSRKEKEDEEEVLVVEGIEFDRD  503

Query  415   QYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR---QKNVEKIRTSLSLGLNEAMEDLG  245
              + KF VY+N  +E        EFAGSF ++PH+    K  +K+RT+L LG+ + +EDLG
Sbjct  504   MFIKFAVYINTPEEDGVDPGSTEFAGSFVNVPHKNSHSKKEKKVRTALRLGITDLLEDLG  563

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             AE DD+VLVTL P    G V +  +++E+
Sbjct  564   AEADDSVLVTLVPR--KGKVKVGGLRLEF  590



>ref|XP_010910928.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=594

 Score =   518 bits (1333),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 274/535 (51%), Positives = 366/535 (68%), Gaps = 13/535 (2%)
 Frame = -1

Query  1738  AHGGDSKIDRRDVIl----glgglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVD  1571
             A G   K+DRRD+++      G   G      A+  PIEAP++SKC   P DLP+GA   
Sbjct  63    AIGSSGKLDRRDMLIGLGGLYGAAAGLGVNRKALGLPIEAPDISKC--GPADLPSGATPT  120

Query  1570  NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQ  1391
             +CCPP   + +D++LP  S   +R+RPA H +D +Y  K+AKAVE+MKALPADDPR+FTQ
Sbjct  121   DCCPPFTSKIIDFKLPPRS-DPLRIRPAAHLVDSEYLAKYAKAVELMKALPADDPRNFTQ  179

Query  1390  QAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFW  1211
             QA VHCAYC+G+YDQ+GFPDIEIQVHNSW+FFP+HR+YLYF E+ILGKLI D TF LPFW
Sbjct  180   QANVHCAYCDGSYDQIGFPDIEIQVHNSWIFFPWHRFYLYFHEKILGKLIGDETFALPFW  239

Query  1210  NWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALM  1031
             NWD PAGM  PSI  D + SLYD+ R+  H PP ++DL + G+D   T  ++I +NL +M
Sbjct  240   NWDAPAGMRMPSIYTDPSSSLYDKLRDAKHQPPYLIDLDFNGRDPSFTQAQQIDHNLNIM  299

Query  1030  YKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYS  851
             Y+Q+  N  TA+LF+G PY +GD+ NPG GS+EN PH  +H W GD  + NGEDMG  YS
Sbjct  300   YRQVIANGKTAQLFMGSPYHAGDQPNPGGGSLENVPHGTVHVWTGDRNQPNGEDMGTLYS  359

Query  850   AGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDC  671
             A RD  F+ HH+NVDRMW +W+ LG  G+ ++F D DW+N SFLFY+ENA  VRV++ DC
Sbjct  360   AARDPIFFAHHSNVDRMWYVWKMLG--GKHKDFEDKDWLNTSFLFYDENADLVRVKIKDC  417

Query  670   VENQQMGYKYEFANLPWINSKPVPKPR-RRKLALRSAAPYVATVFPVTLDrvvrvkvprp  494
             ++ Q + Y Y+   +PW+ ++P PK     K   RS        FPVTL+  V   V RP
Sbjct  418   LDTQWLRYTYQDVEIPWLKARPTPKGTVAAKKGARSLRAVTEAAFPVTLESSVSATVRRP  477

Query  493   kknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR  314
             K +R+ +EK+ EEE+L++EGIE   + + KFDVY+N  +E       +EFAGSF ++PH+
Sbjct  478   KVSRSSKEKKDEEEVLVVEGIEFDRDMFIKFDVYINTPEEEGVDPGSSEFAGSFVNVPHK  537

Query  313   Q---KNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                 K  +K+RT+L LG+ E +EDLGAE DD+VLVTL P  G G   +  ++IE+
Sbjct  538   HNHSKKEKKLRTALRLGITELLEDLGAEADDSVLVTLVPRKGKGKAKVGGLRIEF  592



>ref|XP_002519016.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF43227.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
Length=589

 Score =   516 bits (1329),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 274/512 (54%), Positives = 364/512 (71%), Gaps = 18/512 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+ AP+++KC     DLP+ A   NCCPP + + LD++LPS S + +R+RPA H +D
Sbjct  79    FAKPVSAPDLTKC--GKADLPSSAKPTNCCPPPSTKILDFKLPS-SNSPLRIRPAAHVVD  135

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K++KA+E+MKALP DDPRSF QQA VHCAYC+GAY QVG PD+++QVHNSWLFFP
Sbjct  136   DAYLAKYSKAIELMKALPDDDPRSFMQQANVHCAYCDGAYHQVGLPDLDLQVHNSWLFFP  195

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR++LYF E+ILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD+ RN++H PP
Sbjct  196   FHRYFLYFHEKILGKLIDDPTFALPFWNWDSPAGMQLPAIYVDPKSPLYDQFRNKNHQPP  255

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL Y G +   +  E +++NL +MY+QM +N  TA LF G  YR+GD+ +PGAGS+E
Sbjct  256   TLVDLDYNGSENPTSKQELLSSNLTIMYRQMVSNGKTARLFHGSAYRAGDEADPGAGSIE  315

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N PH P+H W GD  + N EDMGNFYSA RD  F+ HH+NVDRMWTIW+ LGG  R   F
Sbjct  316   NIPHGPVHVWCGDNTQPNLEDMGNFYSAARDPIFFAHHSNVDRMWTIWKTLGGNKRTE-F  374

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD DW++A F+FY+ENA PVRV+V DC++ +++GY Y+  ++PW+ S+P  +   +K+A 
Sbjct  375   TDPDWLDAEFIFYDENANPVRVKVRDCIDTKKLGYIYQDVDIPWLKSRPKSRRLIKKVAN  434

Query  571   R-----SAAPYVA--------TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegi  431
             +       A + A        T FP+ LD+V+     RPKK+R+K+EKE EEE+LLI+ I
Sbjct  435   KVFHHDGQAAHAAETLNLPPITAFPLVLDKVISTVAKRPKKSRSKKEKEEEEEVLLIDAI  494

Query  430   EVQANQYTKFDVYLNDE-DEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAME  254
             E + N   KFDVY+NDE D      D +EFAGSF ++PH+ K+ +K++T L LGL + +E
Sbjct  495   EFERNALVKFDVYVNDEHDSTSARPDNSEFAGSFVNIPHKHKHGKKMKTCLRLGLTDLLE  554

Query  253   DLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             D+GAEDDDTV+VTL P  G G+V I  I I+Y
Sbjct  555   DMGAEDDDTVVVTLVPRYGKGLVKIGGIMIDY  586



>ref|XP_010647098.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Vitis vinifera]
Length=601

 Score =   516 bits (1330),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 299/609 (49%), Positives = 411/609 (67%), Gaps = 45/609 (7%)
 Frame = -1

Query  1867  MASLSPP--RAPANLFSRRPIPTHSHLHILTPVVLNR-----RLKVLCNAAHGGD-----  1724
             MASLSPP      N+ S +P P   H      +V  R     R  V CNA +G +     
Sbjct  1     MASLSPPATTTTTNISSLQPSPLF-HKASQVSLVGKRNPRFVRRVVSCNATNGDERSTSS  59

Query  1723  --------SKIDRRDVIlglgglygaanlpaAMAGP----IEAPEVSKCVVPPTDLPAGA  1580
                      K+DRR+V+LGLGGLYG + L AA        I  P++S+C     DLPAGA
Sbjct  60    SKSGESPLGKLDRRNVLLGLGGLYGVSGLGAADPFAFAAPISPPDLSECGA--ADLPAGA  117

Query  1579  DVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRS  1400
                NCCPP + + +D++LP  + +  R+RPA H    +Y  K+ KA+E+MKALP DDPRS
Sbjct  118   QPTNCCPPVSSKIIDFKLPPKN-SPFRIRPAAHLASKEYIAKYKKAIELMKALPDDDPRS  176

Query  1399  FTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGL  1220
             F QQA VHCAYCNGAY QVGFPD+++QVHNSWLF P+HR+YLYF+E+ILGKLI DPTF L
Sbjct  177   FMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYLYFYEKILGKLINDPTFAL  236

Query  1219  PFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNL  1040
             PFWNWD PAGM  P++  D N  LYD+ R+  H PP ++DL Y   D+  T+ ++I++NL
Sbjct  237   PFWNWDAPAGMQMPAMFADPNSPLYDKLRDPKHQPPKLIDLDYTXTDSNDTNEQQISSNL  296

Query  1039  ALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGN  860
             ++MY+Q+ ++A T  LF+G  YR+GD+ +PG G++EN PH P+H W GD  + N EDMGN
Sbjct  297   SIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPHGPVHIWCGDRTQPNIEDMGN  356

Query  859   FYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRV  680
             FYSA RD  F+ HH+NVDRMWT+W+ LG  G++++FTD DW++A F+FY+ENAQ VRV+V
Sbjct  357   FYSAARDPIFFSHHSNVDRMWTVWKGLG--GKRKDFTDPDWLDAGFVFYDENAQLVRVKV  414

Query  679   GDCVENQQMGYKYEFANLPWINSKPVPKPRR------RKLALRSAAPYVA-------TVF  539
              DC++  ++ Y Y+  ++PW+ S+  PKPR+       KL  +S     A        VF
Sbjct  415   RDCLDPTKLRYAYQEVDIPWLKSR--PKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVF  472

Query  538   PVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGY  359
             P+ LD  +RV VPRP+K+R+K+EKE EEE+L+I+GIE++ +++ KFD+++NDED+P    
Sbjct  473   PIKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFVKFDIFINDEDDPVSRP  532

Query  358   DKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTI  179
             D  EFAGSF ++PH+  + +K  T L +G++E +EDL AEDDD+V+VTL P  G  V+TI
Sbjct  533   DNTEFAGSFVNVPHQHSHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVITI  592

Query  178   DNIKIEYGS  152
               I+IE  S
Sbjct  593   GGIEIELAS  601



>ref|XP_004146644.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis sativus]
 gb|KGN64656.1| hypothetical protein Csa_1G073640 [Cucumis sativus]
Length=577

 Score =   515 bits (1327),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 291/595 (49%), Positives = 399/595 (67%), Gaps = 45/595 (8%)
 Frame = -1

Query  1867  MASLS-PPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS-----KIDRR  1706
             MASLS PP      F R+     +   ++TP       ++ C A +  D      KIDRR
Sbjct  1     MASLSHPPSLTLTPFLRK-----TKTLLITP-------RISCKATNHNDQNFPNPKIDRR  48

Query  1705  DVIlglg----glygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYL  1538
             D+++GL         + +   A+A PIE P +SKC   P DLP GAD  NCCPP A   L
Sbjct  49    DILIGLTGLYGSSTLSQSTHFALAAPIETPNISKCG--PPDLPPGADATNCCPPPATTIL  106

Query  1537  DYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNG  1358
             D+Q P   P+ +RVRPA H  D  Y EK+ KAVE+MKALP DDPRSFTQQA VHCAYCNG
Sbjct  107   DFQPPP--PSKLRVRPAAHLADRNYIEKYKKAVELMKALPEDDPRSFTQQANVHCAYCNG  164

Query  1357  AYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFP  1178
             AYDQVGFP +E+QVHNSWLFFPFHR+YLYF E+ILG+LI DP+F LPFWN+D P GM  P
Sbjct  165   AYDQVGFP-VEVQVHNSWLFFPFHRFYLYFHEKILGELIGDPSFALPFWNYDAPDGMKMP  223

Query  1177  SILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTA  998
              +  +   SLYDE RN++HLPP +VDL + G D    D  +I +NL++MY+QM + + T 
Sbjct  224   GMYAEEKSSLYDELRNENHLPPRLVDLDFGGVDPNIGDDAQIKSNLSIMYRQMVSGSRTP  283

Query  997   ELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHH  818
              LF G  Y +GD+ +PG GS+EN PH P+H W GD  + N E+MGNFYSA RD  F+ HH
Sbjct  284   SLFFGSAYVAGDEPSPGGGSVENIPHGPVHVWCGDTDQPNFENMGNFYSAARDPIFFAHH  343

Query  817   ANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYE  638
             +N+DR+W++W+ LG  GR++N  + +W+NASF+FY+E AQP+RVRV DC++++ +GY Y+
Sbjct  344   SNIDRLWSVWKTLG--GRRQNLQNPEWLNASFIFYDEKAQPIRVRVRDCLDSKSLGYIYQ  401

Query  637   FANLPWINSKPVPKPRRRKL---------ALRSAAPYVATV------FPVTLDrvvrvkv  503
               +LPW+ ++P P+ R +K          AL +  P  + V      FP+T+   V V+V
Sbjct  402   PVDLPWLQTRPTPR-RAQKTSTVAFGIAPALAAGGPSSSRVKPANIKFPITVKSPVSVEV  460

Query  502   prpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHL  323
              RPKK+R+K+EKE EEE+L+I GI    N   KFDV++NDED+ +   D  EFAGSF ++
Sbjct  461   KRPKKSRSKKEKEEEEEVLVIYGIGFDPNNGIKFDVFINDEDDKEIKPDNTEFAGSFVNV  520

Query  322   PHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             PH+  + +K++T L +G+ E +EDL A++DD+++VT+ P +G G+ +ID +KIE+
Sbjct  521   PHKHGHKKKVKTGLRVGITEELEDLEADNDDSIIVTILPRIGAGLFSIDGLKIEF  575



>emb|CAN61652.1| hypothetical protein VITISV_006012 [Vitis vinifera]
Length=601

 Score =   516 bits (1329),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 298/607 (49%), Positives = 409/607 (67%), Gaps = 41/607 (7%)
 Frame = -1

Query  1867  MASLSPP--RAPANLFSRRPIPTHSHLHILTPVVLNR-----RLKVLCNAAHGGD-----  1724
             MASLSPP      N+ S +P P   H      +V  R     R  V CNA +G +     
Sbjct  1     MASLSPPATTTTTNISSLQPSPLF-HKASQVSLVGKRNPRFVRRVVSCNATNGDERSTSS  59

Query  1723  --------SKIDRRDVIlglgglygaanlpaAMAGP----IEAPEVSKCVVPPTDLPAGA  1580
                      K+DRR+V+LGLGGLYG + L AA        I  P++S+C     DLPAGA
Sbjct  60    SKSGESPLGKLDRRNVLLGLGGLYGVSGLGAADPFAFAAPISPPDLSECGA--ADLPAGA  117

Query  1579  DVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRS  1400
                NCCPP + + +D++LP  + + +R+RPA H    +Y  K+ KA+E+MKALP DDPRS
Sbjct  118   QPTNCCPPVSSKIIDFKLPPKN-SPLRIRPAAHLASKEYIAKYKKAIELMKALPDDDPRS  176

Query  1399  FTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGL  1220
             F QQA VHCAYCNGAY QVGFPD+++QVHNSWLF P+HR+YLYF+E+ILGKLI DPTF L
Sbjct  177   FMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYLYFYEKILGKLINDPTFAL  236

Query  1219  PFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNL  1040
             PFWNWD PAGM  P++  D N  LYD+ R+  H PP ++DL Y   D+  T+ ++I++NL
Sbjct  237   PFWNWDAPAGMQMPAMFADPNSPLYDKLRDAKHQPPKLIDLDYNLTDSNDTNEQQISSNL  296

Query  1039  ALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGN  860
             ++MY+Q+ ++A T  LF+G  YR+GD+ +PG G++EN PH P+H W GD  + N EDMGN
Sbjct  297   SIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPHGPVHIWCGDRTQPNIEDMGN  356

Query  859   FYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRV  680
             FYSA RD  F+ HH+NVDRMWT+W+ LG  G++++FTD DW++A F+FY+ENAQ VRV+V
Sbjct  357   FYSAARDPIFFSHHSNVDRMWTVWKGLG--GKRKDFTDPDWLDAGFVFYDENAQLVRVKV  414

Query  679   GDCVENQQMGYKYEFANLPWINSKPVP----KPRRRKLALRSAAPYVA-------TVFPV  533
              DC++  ++ Y Y   ++PW+ S+P P    K    KL  +S     A        VFP+
Sbjct  415   RDCLDPTKLRYAYHEVDIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFPI  474

Query  532   TLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
              LD  +RV VPRP+K+R+K+EKE EEE+L+I+GIE++ +++ KFD+++NDED+P    D 
Sbjct  475   KLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFVKFDIFINDEDDPVSRPDN  534

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
              EFAGSF ++PH+  + +K  T L +G++E +EDL AEDDD+V+VTL P  G  V+TI  
Sbjct  535   TEFAGSFVNVPHQHSHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVITIGG  594

Query  172   IKIEYGS  152
             I+IE  S
Sbjct  595   IEIELAS  601



>ref|XP_010245321.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=597

 Score =   516 bits (1328),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 297/572 (52%), Positives = 395/572 (69%), Gaps = 36/572 (6%)
 Frame = -1

Query  1783  TPVVLNRRL----KVLCNAA------------HGGDSKIDRRDVIlglgglygaa---nl  1661
              P+V  RR     KV C A              G   ++DRR+V++GLGGLYGA      
Sbjct  34    VPIVGKRRYRMVRKVSCEATDGEKKPTRSGNEEGSLGRLDRRNVLIGLGGLYGATGLGAD  93

Query  1660  paAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALH  1481
               A   PI  P++SKC     +LPAGA   NCCPP +   +D++LPS S   MRVRPA H
Sbjct  94    RLAFGAPIMPPDLSKCGA--ANLPAGAKPTNCCPPASSEIVDFKLPS-SSEPMRVRPAAH  150

Query  1480  RLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWL  1301
              +D +Y  K++KA+ +MKALPADDPR+FTQQA VHCAYC+GAYDQ+GFPD+E+QVHNSWL
Sbjct  151   MVDEEYIAKYSKAIALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWL  210

Query  1300  FFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSH  1121
             FFPFHR+YLYF+ER+LGKLI DPTF LP+WNWD PAGM  P++  + N  LYD+ R+  H
Sbjct  211   FFPFHRYYLYFYERMLGKLIDDPTFALPYWNWDAPAGMKMPTMYANPNSPLYDKLRDAKH  270

Query  1120  LPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAG  941
              PPT++DL Y  +DT  T  + + NNLA MY+Q+ +N  TA+LFLG PYR+GD+ +PG G
Sbjct  271   QPPTMIDLNYNVQDTTMTPEQLLKNNLATMYRQVVSNGSTAQLFLGSPYRAGDQPDPGFG  330

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             S+EN PH P+H W GD  + N E+MGNFYSA RD  FY HH+NVDRMWTIW++LG  GR+
Sbjct  331   SLENVPHGPVHLWAGDRTQPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLG--GRR  388

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP------  599
             ++F D DW+NA FL Y+EN Q VRV+V DC++ +++ Y Y+   +PW+ ++P P      
Sbjct  389   KDFKDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAA  448

Query  598   --KPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEV  425
               K +     L+   P V+  FP  LD   +V V RP+K+R+K+EKE EEEIL+I+ +E+
Sbjct  449   AQKLKITDRGLKKKKPTVSE-FPKELDAPFKVVVKRPRKSRSKKEKEDEEEILVIDQVEL  507

Query  424   QANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQ-KNVEKIRTSLSLGLNEAMEDL  248
             + +   KFDVY+NDEDEP    DK+EFAGSF ++PH+  K + K++T L  G++E +EDL
Sbjct  508   ERDTVVKFDVYINDEDEPSP--DKSEFAGSFVNVPHKHGKKMSKLKTCLRFGISELLEDL  565

Query  247   GAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              AEDDD V+VT+ P +GG +VTI  IKI + S
Sbjct  566   EAEDDDEVVVTIVPRIGGDLVTIGGIKIVFAS  597



>emb|CAQ76694.1| polyphenol oxidase (chloroplast) (chloroplast) [Taraxacum officinale]
Length=594

 Score =   515 bits (1327),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 274/508 (54%), Positives = 372/508 (73%), Gaps = 15/508 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI AP+++KC   P DLP GA   NCCPP     +D++LP  S   +RVRPA H  +
Sbjct  90    FADPIMAPDLTKC--GPADLPQGAVATNCCPPFTKNIIDFKLPPPS-TNLRVRPAAHLAN  146

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQVGFPD+++QVHNSWLF P
Sbjct  147   KDYIAKFNKAIELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLDLQVHNSWLFLP  206

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYFFE+I GKLI DP F +PFWNWD P GM  P+I  ++N  LYD  R+  H PP
Sbjct  207   FHRHYLYFFEKICGKLINDPNFAIPFWNWDTPDGMTIPAIYANKNSQLYDALRDGKHQPP  266

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             ++VDL + G+D   +  ++ + NL +MY+QM +++ TA LF+G PYR+GD+ NPG GS+E
Sbjct  267   SLVDLDFNGEDENLSKSKQTSTNLTIMYRQMVSSSKTASLFMGSPYRAGDEANPGGGSLE  326

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             + PH P+H W GD  + NGEDMGNFYSA RD  FY HHAN+DRMW++W+ LG  GR+ +F
Sbjct  327   SIPHGPVHIWTGDRNQPNGEDMGNFYSAARDPIFYAHHANIDRMWSVWKTLG--GRRNDF  384

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-----  587
             TD DW++++FLFY+ENA+ VRV+V D ++++++GY Y+   +PW+ +KP P+ +R     
Sbjct  385   TDKDWLDSAFLFYDENAELVRVKVRDALDSKKLGYVYQDVGIPWLETKPEPRLKRALSKI  444

Query  586   -RKLALRSA---APYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQA  419
              +KLA+  A    P+   VFP TLD+V++V VPRPKK+R+K++K+ EEEIL+IEGIEV+ 
Sbjct  445   KKKLAVARADEHIPFAKDVFPATLDKVIKVLVPRPKKSRSKKQKDAEEEILVIEGIEVKR  504

Query  418   NQYTKFDVYLNDEDEP-DGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
             +++ KFDV++NDED+      DK EFAGSF ++PH+ K+ + ++T L LG++E ++DLGA
Sbjct  505   DEFVKFDVFVNDEDDGMRATADKTEFAGSFVNVPHKHKHGKSVKTRLRLGISELLDDLGA  564

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             +DDD VLVTL P   G  V+I  +KIEY
Sbjct  565   DDDDNVLVTLVPKNKGDEVSIKGMKIEY  592



>dbj|BAO79387.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=602

 Score =   514 bits (1325),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 298/608 (49%), Positives = 409/608 (67%), Gaps = 42/608 (7%)
 Frame = -1

Query  1867  MASLSPP---RAPANLFSRRPIPTHSHLHILTPVVLNR-----RLKVLCNAAHGGD----  1724
             MASLSPP       N+ S +P P   H      +V  R     R  V CNA +G +    
Sbjct  1     MASLSPPATTTTTTNISSLQPSPLF-HKASQVSLVGKRNPRFVRRVVSCNATNGDERSTS  59

Query  1723  ---------SKIDRRDVIlglgglygaanlpaAMAGP----IEAPEVSKCVVPPTDLPAG  1583
                       K+DRR+V+LGLGGLYG + L AA        I  P++S+C     DLPAG
Sbjct  60    SSKSGESPLGKLDRRNVLLGLGGLYGVSGLGAADPFAFAAPISPPDLSECGA--ADLPAG  117

Query  1582  ADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPR  1403
             A   NCCPP + + +D++LP  + +  R+RPA H    +Y  K+ KA+E+MKALP DDPR
Sbjct  118   AQPTNCCPPVSSKIIDFKLPPKN-SPFRIRPAAHLASKEYIAKYKKAIELMKALPDDDPR  176

Query  1402  SFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFG  1223
             SF QQA VHCAYCNGAY QVGFPD+++QVHNSWLF P+HR+YLYF+E+ILGKLI DPTF 
Sbjct  177   SFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYLYFYEKILGKLINDPTFA  236

Query  1222  LPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNN  1043
             LPFWNWD PAGM  P++  D N  LYD+ R+  H PP ++DL Y   D+  T+ ++I++N
Sbjct  237   LPFWNWDAPAGMQMPAMFADPNSPLYDKLRDAKHQPPKLIDLDYNLTDSNDTNEQQISSN  296

Query  1042  LALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMG  863
             L++MY+Q+ ++A T  LF+G  YR+GD+ +PG G++EN PH P+H W GD  + N EDMG
Sbjct  297   LSIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPHGPVHIWCGDRTQPNIEDMG  356

Query  862   NFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVR  683
             NFYSA RD  F+ HH+NVDRMWT+W+ LG  G++++FTD DW++A F+FY+ENAQ VRV+
Sbjct  357   NFYSAARDPIFFSHHSNVDRMWTVWKGLG--GKRKDFTDPDWLDAGFVFYDENAQLVRVK  414

Query  682   VGDCVENQQMGYKYEFANLPWINSKPVP----KPRRRKLALRSAAPYVA-------TVFP  536
             V DC++  ++ Y Y+  ++PW+ S+P P    K    KL  +S     A        VFP
Sbjct  415   VRDCLDPTKLRYAYQEVDIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFP  474

Query  535   VTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYD  356
             + LD  +RV VPRP+K+R+K+EKE EEE+L+I+GIE++ +++ KFD+++NDED+P    D
Sbjct  475   IKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFVKFDIFINDEDDPVSRPD  534

Query  355   KAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTID  176
               EFAGSF ++PH+  + +K  T L +G++E +EDL AEDDD+V+VTL P  G  V+TI 
Sbjct  535   NTEFAGSFVNVPHQHSHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVITIG  594

Query  175   NIKIEYGS  152
              I+IE  S
Sbjct  595   GIEIELAS  602



>ref|XP_008442274.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis melo]
Length=576

 Score =   513 bits (1320),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 283/568 (50%), Positives = 389/568 (68%), Gaps = 33/568 (6%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDS-----KIDRRDVIlglgglygaanlpaA----MAG  1643
             LH    + +  R+   C A++  D      KIDRRD+++GL GLYG++ L  +    +A 
Sbjct  16    LHKTKTISITSRIS--CKASNHNDQNTSNPKIDRRDILIGLTGLYGSSTLSQSPHFALAA  73

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKY  1463
             PI+ P +SKC   P DLP GAD  NCCPP A   LD+Q P   P  +RVRPA H  D  Y
Sbjct  74    PIQTPNISKCG--PPDLPPGADPTNCCPPPATTILDFQPPP--PTKLRVRPAAHLADQNY  129

Query  1462  KEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHR  1283
              EK+ KA+E+MKALP DDPRSFTQQA VHCAYCNGAYDQ+GFP +E+QVHNSWLFFPFHR
Sbjct  130   IEKYKKAIELMKALPEDDPRSFTQQANVHCAYCNGAYDQIGFP-VEVQVHNSWLFFPFHR  188

Query  1282  WYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIV  1103
             +YLYF E+ILG+LI D +F LPFWN+D P GM  P +  +   SLYDE RN++HLPP +V
Sbjct  189   FYLYFHEKILGELIGDSSFALPFWNYDAPGGMKMPRMYAEEKSSLYDELRNENHLPPRLV  248

Query  1102  DLGYQG-KDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             DL + G  D    D  +I +NL++MY+QM + + T  LF G  Y  GD+ +PG GS+EN 
Sbjct  249   DLDFGGVDDPNIGDDAQIRSNLSIMYRQMVSGSRTPSLFFGSAYVEGDEPSPGGGSVENI  308

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
             PH P+H W GD  + N E+MGNFYSA RD  F+ HH+NVDR+W++W+ LG  GR+++  +
Sbjct  309   PHGPVHVWCGDNDQPNFENMGNFYSAARDPIFFAHHSNVDRLWSVWKTLG--GRRKDLQN  366

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALR-  569
              +W+NASF+FYNE AQPVRV V DC++++ +GY Y+  +LPW+ ++P P+ R +K  +  
Sbjct  367   PEWLNASFIFYNEKAQPVRVHVRDCLDSKSLGYTYQPVDLPWLQTRPTPR-RAQKTTVAF  425

Query  568   ------SAAPYVATV------FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEV  425
                   +A P  + V      FP+T+   V V+V RPKK+R+K+EKE EEE+L+I GI  
Sbjct  426   GIASALAAGPSSSRVKPANIKFPITVKSPVSVEVKRPKKSRSKKEKEEEEEVLVIYGIGF  485

Query  424   QANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLG  245
               N   KFDV++NDED+ +   D  EFAGSF ++PH+Q + +K++T L +G+ E +EDL 
Sbjct  486   DPNNGIKFDVFINDEDDKEIKPDNTEFAGSFVNVPHKQAHKKKVKTGLRVGITEVLEDLE  545

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             A++DD+++VT+ P +G G+ +I  +KIE
Sbjct  546   ADNDDSIIVTIVPKIGAGLFSIGGLKIE  573



>gb|AHC98007.1| PPO [Salvia miltiorrhiza]
Length=589

 Score =   511 bits (1317),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 271/504 (54%), Positives = 358/504 (71%), Gaps = 12/504 (2%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+V++C   P DLPAGA   NCCPP  G  LD+Q P+  PA +R+RPA H  D
Sbjct  88    FAAPISGPDVTQCG--PADLPAGATPTNCCPPLTGEILDFQFPA-PPAKLRIRPAAHLAD  144

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  KF +AVE+M+ALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+QVHNSWLFFP
Sbjct  145   DAYIAKFNRAVELMRALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQVHNSWLFFP  204

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERIL KLI DP+F +P+WNWD PAGM  P I  + + +LYD  R+++H PP
Sbjct  205   FHRYYLYFYERILAKLIDDPSFAMPYWNWDAPAGMPIPRIYANPSSALYDPLRDKAHQPP  264

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              +VDL Y G D   T  ++   NL +MY+QM +N+ T  LF G PYR G+  NPG GS+E
Sbjct  265   ALVDLNYSGTDPATTANQQAQTNLTVMYRQMVSNSKTPRLFFGSPYRRGEDPNPGGGSIE  324

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
               PH P+H W GD  + N E+MGNFYSA RD  FY HH+N+DRMW++W+ LG  GR+++ 
Sbjct  325   GIPHGPVHVWTGDRTQPNTENMGNFYSAARDPIFYAHHSNIDRMWSVWKTLG--GRRQDI  382

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKP-----RR  587
             TD D+++A+FLFY+ENA+ VRV+V DC++ +++GY Y+   +PW NS+P P+      + 
Sbjct  383   TDPDFLDAAFLFYDENAKMVRVKVRDCLDPRKLGYAYQDVEIPWANSRPTPRVSSVLRKL  442

Query  586   RKLALRSAAPYVA--TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQ  413
             +KL    AA   +   VFP  LDRV++V V RPKK R+K+EK+  EEIL+I+GIEV  + 
Sbjct  443   KKLGRAKAADAQSPREVFPAKLDRVLKVMVKRPKKKRSKKEKDELEEILVIKGIEVDRDT  502

Query  412   YTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDD  233
             Y KFDVY+NDED+     +  EFAGSF ++PH+ K+ +KI+T L L +++ +EDL AEDD
Sbjct  503   YVKFDVYINDEDDEITTAENTEFAGSFVNVPHKHKHDKKIKTQLRLSISDILEDLDAEDD  562

Query  232   DTVLVTLAPNVGGGVVTIDNIKIE  161
             + VLVTL P   G  +TI +IKIE
Sbjct  563   EHVLVTLVPTNAGDAITIHDIKIE  586



>gb|KDO75857.1| hypothetical protein CISIN_1g042556mg [Citrus sinensis]
Length=591

 Score =   511 bits (1316),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 282/558 (51%), Positives = 387/558 (69%), Gaps = 34/558 (6%)
 Frame = -1

Query  1756  KVLCNAAHGGD-------SKIDRRDVIlglgglygaanlpaA-----MAGPIEAPEVSKC  1613
             KV C A +  +       +K+DRRDV+L   G     +  ++      A P+ AP++SKC
Sbjct  40    KVTCKATNEQNPSSKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSAPDISKC  99

Query  1612  VVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEM  1433
                     A    DNCCPP +   ++++LP  S +++RVRPA H  D  Y  K++KA+E+
Sbjct  100   G------KADTTTDNCCPPKSTNIINFKLPP-SNSSLRVRPAAHLSDDAYIAKYSKAIEL  152

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             MKALPADDPRSF  QA VHCAYC+GAYDQVGFP++++Q+HNSWLFFPFHR+YLYF+E+IL
Sbjct  153   MKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLYFYEKIL  212

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             GKLI DPTF LPFWNWD P GM  P +  + N  LYD+ RN +H PPT++DL Y   D +
Sbjct  213   GKLIDDPTFALPFWNWDSPPGMQMPPMFANPNSPLYDKLRNANHQPPTLLDLDYNETDDD  272

Query  1072  ATDLER--ITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWV  899
              T  ++  I++NL +MY+QM +N  T++LFLG PYR+GD   PG+GS+EN+PH P+H W 
Sbjct  273   QTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDDPEPGSGSIENAPHNPVHLWC  332

Query  898   GDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFL  719
             GD  + N E+MGNFYSAGRD  F+ HH+N+DRMWTIW+ LG  G++ NFT+ DW++++FL
Sbjct  333   GDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLG--GKRTNFTEPDWLDSAFL  390

Query  718   FYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVAT--  545
             FY+ENA  VRV+V DC++ + +GY Y+   +PW NSKP P+   +K   ++     A   
Sbjct  391   FYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFGVAQAAEL  450

Query  544   --------VFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
                     VFP+ LDRV+   VPRPKK+R+K+EKE EEE+L+++ IE + +   KFDVY+
Sbjct  451   KRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDARVKFDVYI  510

Query  388   N-DEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTL  212
             N DEDE   G D +EFAGSF ++PH+ K+ +K++TSL LGL + +EDLGAEDDD+V+VTL
Sbjct  511   NEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKMKTSLRLGLTDLLEDLGAEDDDSVIVTL  570

Query  211   APNVGGGVVTIDNIKIEY  158
              P  G G+  I  IKI++
Sbjct  571   VPKFGKGLARIGGIKIDF  588



>ref|XP_010039984.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45576.1| hypothetical protein EUGRSUZ_L00689 [Eucalyptus grandis]
Length=595

 Score =   511 bits (1315),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 296/581 (51%), Positives = 389/581 (67%), Gaps = 41/581 (7%)
 Frame = -1

Query  1846  RAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS-------KIDRRDVIlgl  1688
             R PA+L+S+   P+             RR  + C A    DS       K+DRR+ ++GL
Sbjct  36    RGPASLYSKHRKPS------------IRRSTISCKALSNDDSEQNPMSVKLDRRNALIGL  83

Query  1687  gglygaanlpa---AMAGPIEAPEVSKC-VVPPTDLPAGADVDNCCPPTAGRYLDYQLPS  1520
             GG YGA  L +   A+A PI   + ++C  V P        V +CCPP   + LD++LP 
Sbjct  84    GGFYGAVGLRSDPFALADPISVLDFTQCGKVKPC-------VKDCCPPPTTKVLDFKLPP  136

Query  1519  FSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVG  1340
              S +  RVRPA H  D  Y  K+A+A ++MKALPADDPRSF QQA VHCAYC+G Y QVG
Sbjct  137   -SNSPTRVRPAAHLADKDYIAKYAEATKLMKALPADDPRSFMQQANVHCAYCDGYYHQVG  195

Query  1339  FPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDR  1160
             FP++E+QVH+SWLFFPFHR+YLYF+E+ILG LI DPTF LP+WNWD P GM  P++  D 
Sbjct  196   FPNLELQVHDSWLFFPFHRYYLYFYEKILGNLIGDPTFALPYWNWDAPDGMKMPAMFTDP  255

Query  1159  NVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGK  980
                LYD NRN  H  PT+VDL Y  K    +DLE  +NNLA+MY+Q+ +   TA+LFLG 
Sbjct  256   QSPLYDANRNPEHAQPTLVDLNYNCKHPPPSDLE--SNNLAIMYRQIVSCGKTAKLFLGH  313

Query  979   PYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRM  800
              YR+GD+ +PG GS+EN PH  +H W GD R+   EDMG FYSAGRD  F+ HH+NVDRM
Sbjct  314   AYRAGDQASPGRGSIENMPHNTVHDWCGDYRQPKREDMGIFYSAGRDPLFFAHHSNVDRM  373

Query  799   WTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPW  620
             WT+W+ LGGR R  +FTD DW+NA+FLFY+ENAQ +RV+V DC+E   +GYKY+  ++PW
Sbjct  374   WTLWKTLGGRKRT-DFTDPDWLNATFLFYDENAQAMRVKVKDCLETSNLGYKYQDVDIPW  432

Query  619   INSKPVPKPRRRKLALRSAA-------PYVATVFPVTLDrvvrvkvprpkknrtkeekel  461
              N KPVP+ + +KL   S         P     FPV LD+VV   V RPK+ R+K+EKE 
Sbjct  433   RNYKPVPRKKAKKLPKSSGKIADVAGIPRHIVHFPVKLDKVVSTWVKRPKQKRSKKEKEE  492

Query  460   eeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSL  281
             EEE+L IEGIE++++ + KFDV++ND+ +     DK EFAGSF ++PH+ K  +K++T L
Sbjct  493   EEEVLAIEGIELESDAFVKFDVHINDKQDSLSSPDKTEFAGSFVNVPHKHKPGKKMKTKL  552

Query  280   SLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             +LG+ + +EDL  E+D+ VLVTLAP  GG  V I NIKIE+
Sbjct  553   TLGITDLLEDLMREEDEKVLVTLAPRCGGEDVIISNIKIEF  593



>ref|XP_006468218.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Citrus sinensis]
Length=591

 Score =   510 bits (1313),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 281/558 (50%), Positives = 386/558 (69%), Gaps = 34/558 (6%)
 Frame = -1

Query  1756  KVLCNAAHGGD-------SKIDRRDVIlglgglygaanlpaA-----MAGPIEAPEVSKC  1613
             KV C A +  +       +K+DRRDV+L   G     +  ++      A P+  P++SKC
Sbjct  40    KVTCKATNEQNPSSKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSTPDISKC  99

Query  1612  VVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEM  1433
                     A    DNCCPP +   ++++LP  S +++RVRPA H  D  Y  K++KA+E+
Sbjct  100   G------KADTTTDNCCPPKSTNIINFKLPP-SNSSLRVRPAAHLSDDAYIAKYSKAIEL  152

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             MKALPADDPRSF  QA VHCAYC+GAYDQVGFP++++Q+HNSWLFFPFHR+YLYF+E+IL
Sbjct  153   MKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLYFYEKIL  212

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             GKLI DPTF LPFWNWD P GM  P +  + N  LYD+ RN +H PPT++DL Y   D +
Sbjct  213   GKLIDDPTFALPFWNWDSPPGMQMPPMFANPNSPLYDKLRNANHQPPTLLDLDYNETDDD  272

Query  1072  ATDLER--ITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWV  899
              T  ++  I++NL +MY+QM +N  T++LFLG PYR+GD   PG+GS+EN+PH P+H W 
Sbjct  273   QTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDDPEPGSGSIENAPHNPVHLWC  332

Query  898   GDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFL  719
             GD  + N E+MGNFYSAGRD  F+ HH+N+DRMWTIW+ LG  G++ NFT+ DW++++FL
Sbjct  333   GDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLG--GKRTNFTEPDWLDSAFL  390

Query  718   FYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVAT--  545
             FY+ENA  VRV+V DC++ + +GY Y+   +PW NSKP P+   +K   ++     A   
Sbjct  391   FYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFGVAQAAEL  450

Query  544   --------VFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
                     VFP+ LDRV+   VPRPKK+R+K+EKE EEE+L+++ IE + +   KFDVY+
Sbjct  451   KRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDARVKFDVYI  510

Query  388   N-DEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTL  212
             N DEDE   G D +EFAGSF ++PH+ K+ +K++TSL LGL + +EDLGAEDDD+V+VTL
Sbjct  511   NEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKMKTSLRLGLTDLLEDLGAEDDDSVIVTL  570

Query  211   APNVGGGVVTIDNIKIEY  158
              P  G G+  I  IKI++
Sbjct  571   VPKFGKGLARIGGIKIDF  588



>ref|XP_011096441.1| PREDICTED: aureusidin synthase-like [Sesamum indicum]
Length=585

 Score =   509 bits (1312),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 303/585 (52%), Positives = 394/585 (67%), Gaps = 26/585 (4%)
 Frame = -1

Query  1870  PMASLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNA-----AHGGDSKIDRR  1706
             P  +LSP R      + +P       H  T    NR  KV C +           K DRR
Sbjct  9     PATTLSPARTTTTSSTPKP------RHFPTIRKQNRCPKVSCKSPDNDQESAAPGKFDRR  62

Query  1705  DVIlgl---gglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLD  1535
             +V++GL    G    A  P + A PI AP+++KC   P DLP GA   NCCPP   + +D
Sbjct  63    NVLIGLGGLYGATTLAASPFSFAAPISAPDITKCG--PADLPPGAAPTNCCPPPTAKIID  120

Query  1534  YQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGA  1355
             ++ P  S  TMRVRPA H  D  Y  KF KAVE+M+ALP DDPRSF QQA VHCAYC+GA
Sbjct  121   FKFPPPS-TTMRVRPAAHLADEAYIAKFNKAVELMRALPEDDPRSFKQQASVHCAYCDGA  179

Query  1354  YDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPS  1175
             YDQVGFP++E+QVHNSWLFFPFHR+YLYFFERILGKLI DPTF +PFWNWD P GM  P+
Sbjct  180   YDQVGFPNLELQVHNSWLFFPFHRYYLYFFERILGKLIDDPTFAMPFWNWDSPGGMRIPA  239

Query  1174  ILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAE  995
             +  + N  LYD  R+Q H PPT++DL Y G D   +  ++   NL +MY+QM +N+ TA 
Sbjct  240   MYANPNSPLYDSLRDQRHQPPTVLDLNYSGTDPTISADQQTRRNLTVMYRQMVSNSRTAR  299

Query  994   LFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHA  815
             LF G PYR GD  NPG+GS+EN PH P+H W GD  + N E+MGNFYSAGRD  FY HH+
Sbjct  300   LFFGSPYRRGDDPNPGSGSIENIPHGPVHVWTGDRNQPNFENMGNFYSAGRDPIFYAHHS  359

Query  814   NVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEF  635
             N+DR+W+IW+ LG  GR+++ TD D+++ASF+FY+ENAQ VRV+V DC+++ ++GY Y+ 
Sbjct  360   NIDRLWSIWKTLG--GRRQDITDRDFLDASFVFYDENAQMVRVKVRDCLDHTKLGYVYQD  417

Query  634   ANLPWINSKPVPKP-----RRRKLALRSAAPYVA--TVFPVTLDrvvrvkvprpkknrtk  476
               +PW++S+P P+      + +KL   +AA   +   VFP TLD+V++V V RPKK R+K
Sbjct  418   VEIPWLDSRPTPRVSSVLRKLKKLGKANAADTHSPKDVFPATLDKVLKVMVKRPKKKRSK  477

Query  475   eekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEK  296
             +EK+  EEIL+IEGIE+  + Y KFDVY+NDED+     +  EFAGSF ++PH+ K+ +K
Sbjct  478   KEKDELEEILVIEGIELDRDVYAKFDVYINDEDDEITTPENTEFAGSFVNVPHKHKHGKK  537

Query  295   IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             I+T L L + E MEDL A+DDD VLVTL P   G  VT+  IKIE
Sbjct  538   IKTQLRLSITEIMEDLDADDDDHVLVTLVPTNAGDAVTVHGIKIE  582



>ref|XP_008778193.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   509 bits (1311),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 290/588 (49%), Positives = 388/588 (66%), Gaps = 22/588 (4%)
 Frame = -1

Query  1876  ETPMASLSPPRAPANLFSRRP-IPTHSHLHILTPVVLNR-----RLKVLCNAAHGGDSKI  1715
              T   S SP     + + +RP +P  S    L P +  +        +  + A G   K+
Sbjct  10    STSSLSTSPNSFACSFYRQRPRVPLSSKKSHLDPRISCKARDEHEKPMHTSEATGSLGKL  69

Query  1714  DRRDVIlglg----glygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAG  1547
             DRRD+++GLG       G      A+  PIEAP++SKC   P DLP+GA   +CCPP   
Sbjct  70    DRRDMLIGLGGLYGAAAGLGVNRKALGLPIEAPDISKC--GPADLPSGAIPTDCCPPFTS  127

Query  1546  RYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAY  1367
             + +D++LP  S   +R+RPA H +D +Y  K+AKAVE+MKALPADDPR+FTQQA VHCAY
Sbjct  128   KIIDFKLPPRS-DPLRIRPAAHLVDSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAY  186

Query  1366  CNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGM  1187
             C+G+YDQ+GFPDIEIQVHNSW+FFP+HR+YLYF E+ILGKLI D TF LPFWNWD PAGM
Sbjct  187   CDGSYDQIGFPDIEIQVHNSWIFFPWHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGM  246

Query  1186  VFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNA  1007
               PSI  D + SLYD+ R+  H PP ++DL + G+D   T  ++I +NL +MY+Q+  N 
Sbjct  247   RMPSIYTDPSSSLYDKLRDAKHQPPYLIDLDFNGQDPSFTQAQQIDHNLKIMYRQVIANG  306

Query  1006  GTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFY  827
              TA+LF+G PYR+GD+ NPGAGS+EN PH  +H W GD  + NGEDMG  YSA RD  FY
Sbjct  307   KTAQLFMGSPYRAGDQPNPGAGSLENVPHGTVHLWTGDRNQPNGEDMGILYSASRDPIFY  366

Query  826   CHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGY  647
              HH+NVDRMW +W++LG  G+ ++F D DW+N SFLFY+ENA  VRV++ DC++ Q + Y
Sbjct  367   AHHSNVDRMWYVWKKLG--GKHKDFDDKDWLNTSFLFYDENADIVRVKIKDCLDMQWLRY  424

Query  646   KYEFANLPWINSKPVPK-PRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkee  470
              Y+   +PW+ ++P PK     K   RS        FPVTLD  V   V RPK +R+ +E
Sbjct  425   TYQDVEIPWLRTRPTPKGTMAAKKGARSLRAITEARFPVTLDSPVSATVRRPKVSRSSKE  484

Query  469   keleeeilliegiEVQANQYTKFDVYLNDEDEP-DGGYDKAEFAGSFAHLP---HRQKNV  302
             KE EEE+L++EGIE   + + KFDV++N  +E  D G   +EFAG+F  +P      K  
Sbjct  485   KEDEEEVLVVEGIEFDRDGFIKFDVHINTPEEAVDPG--SSEFAGAFVSVPHKHKHSKKE  542

Query  301   EKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             +K+ T+L LG+ E +EDLGAE DD+VLVTL P  G G V +  ++IE+
Sbjct  543   KKLITALRLGITELLEDLGAEADDSVLVTLVPRNGIGKVKVGGLRIEF  590



>ref|XP_006449291.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
 gb|ESR62531.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
Length=591

 Score =   509 bits (1310),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 281/560 (50%), Positives = 387/560 (69%), Gaps = 34/560 (6%)
 Frame = -1

Query  1762  RLKVLCNAAHGGD-------SKIDRRDVIlglgglygaanlpaA-----MAGPIEAPEVS  1619
             + KV C A +  +       +K+DRRDV+L   G     +  ++      A P+ AP++S
Sbjct  38    KRKVTCKATNEQNPSSKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSAPDIS  97

Query  1618  KCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAV  1439
             KC        A    DNCCPP +   ++++LP  S +++RVRPA H  D  Y  K++KA+
Sbjct  98    KCG------KADTTTDNCCPPKSTNIINFKLPP-SNSSLRVRPAAHLADDAYIAKYSKAI  150

Query  1438  EMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFER  1259
             E+MKALPADDPRSF  QA VHCAYC+GAYDQVGFP++++Q+HNSWLFFPFHR+YLYF+E+
Sbjct  151   ELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLYFYEK  210

Query  1258  ILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKD  1079
             ILGKLI DPTF LPFWNWD P GM  P +    N  LYD+ RN +H PPT++DL Y   D
Sbjct  211   ILGKLIDDPTFALPFWNWDSPPGMQMPPMFAKPNSPLYDKLRNANHQPPTLLDLDYNETD  270

Query  1078  TEATDLER--ITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHR  905
              + T  ++  I++NL +MY+QM +N  T++LFLG PYR+GD+  PG+GS+EN+PH P+H 
Sbjct  271   DDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDEPEPGSGSIENTPHNPVHL  330

Query  904   WVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINAS  725
             W GD  + N E+MGNFYSAGRD  F+ HH+N+DRMWTIW+ LG  G++ NFT+ DW++++
Sbjct  331   WCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLG--GKRTNFTEPDWLDSA  388

Query  724   FLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVAT  545
             FLFY+ENA  VRV+V DC++ + +GY Y+   +PW NSKP P+   +K   ++     A 
Sbjct  389   FLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFGVAQAA  448

Query  544   ----------VFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDV  395
                       VFP+ LDRV+   VPRPKK+R+K+EKE EEE+L+++ IE + +   KFDV
Sbjct  449   ELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDARVKFDV  508

Query  394   YLN-DEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLV  218
             Y+N DED    G D +EFAGSF ++PH+ K+ +K++TSL LGL + +EDLGAEDDD+V+V
Sbjct  509   YINEDEDGMPIGPDNSEFAGSFVNVPHKHKHGKKMKTSLRLGLTDLLEDLGAEDDDSVVV  568

Query  217   TLAPNVGGGVVTIDNIKIEY  158
             TL P  G G+  I  IKI++
Sbjct  569   TLVPKFGKGLARIGGIKIDF  588



>gb|AAK29782.1|AF261957_1 polyphenol oxidase [Ananas comosus]
 gb|AAO16864.1| polyphenol oxidase [Ananas comosus]
Length=604

 Score =   509 bits (1310),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 268/513 (52%), Positives = 353/513 (69%), Gaps = 20/513 (4%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI AP++S C  PP DLPA A    CCPP     +D++LP  S A +RVRPA H +D 
Sbjct  94    AAPILAPDLSTCG-PPADLPASARPTVCCPPYQSTIIDFKLPPRS-APLRVRPAAHLVDA  151

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+ KAVE+M+ALPADDPR+F QQAKVHCAYC+GAYDQ+GFPD+EIQ+HNSWLFFP+
Sbjct  152   DYLAKYKKAVELMRALPADDPRNFVQQAKVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPW  211

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR+YLY  ERILGKLI D TF LPFWNWD P GM FPSI  D + SLYD+ R+  H PPT
Sbjct  212   HRFYLYSNERILGKLIGDDTFALPFWNWDAPGGMQFPSIYTDPSSSLYDKLRDAKHQPPT  271

Query  1108  IVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMEN  929
             ++DL Y G D   +  E+I +NLA+MY+Q+ ++  T ELF+G  YR+GD+ +PGAGS+E 
Sbjct  272   LIDLDYNGTDPTFSPEEQINHNLAVMYRQVISSGKTPELFMGSAYRAGDQPDPGAGSVEQ  331

Query  928   SPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFT  749
              PH P+H W GD  + N EDMG  YSA  D  F+ HH N+DRMW +W+ LG  G+ RNFT
Sbjct  332   KPHGPVHVWTGDRNQPNREDMGTLYSAAWDPVFFAHHGNIDRMWYVWRNLG--GKHRNFT  389

Query  748   DADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR----RRK  581
             D DW+NASFLFY+ENAQ VRV+V DC+E   M Y Y+   +PW+ +KP PK      + K
Sbjct  390   DPDWLNASFLFYDENAQLVRVKVKDCLEADAMRYTYQDVEIPWLKAKPTPKSALQKIKSK  449

Query  580   LALRSAAP------YVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQA  419
             ++   A P         T FPV LD+ V   V RPK  R+ +EKE EEE+L++EGIE++ 
Sbjct  450   VSTLKATPRGTTTTTAETTFPVVLDKPVSATVARPKARRSGKEKEEEEEVLVVEGIELEK  509

Query  418   NQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLP------HRQKNVEKIRTSLSLGLNEAM  257
             + + KFDVY+N  +    G + +EFAGSF H+P       + K + ++ T L LG+ + +
Sbjct  510   DVFVKFDVYINSPEHEGVGPEASEFAGSFVHVPHKHKKAKKGKEMARMNTRLKLGITDLL  569

Query  256   EDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             ED+GAEDD++VL+TL P  G G+V +  ++I++
Sbjct  570   EDIGAEDDESVLITLVPRSGKGMVKVGGLRIDF  602



>gb|AAO16863.1| polyphenol oxidase [Ananas comosus]
Length=554

 Score =   506 bits (1304),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 268/513 (52%), Positives = 353/513 (69%), Gaps = 20/513 (4%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI AP++S C  PP DLPA A    CCPP     +D++LP  S A +RVRPA H +D 
Sbjct  44    AAPILAPDLSTCG-PPADLPASARPTVCCPPYQSTIIDFKLPPRS-APLRVRPAAHLVDA  101

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+ KAVE+M+ALPADDPR+F QQAKVHCAYC+GAYDQ+GFPD+EIQ+HNSWLFFP+
Sbjct  102   DYLAKYKKAVELMRALPADDPRNFVQQAKVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPW  161

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR+YLY  ERILGKLI D TF LPFWNWD P GM FPSI  D + SLYD+ R+  H PPT
Sbjct  162   HRFYLYSNERILGKLIGDDTFALPFWNWDAPGGMQFPSIYTDPSSSLYDKLRDAKHQPPT  221

Query  1108  IVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMEN  929
             ++DL Y G D   +  E+I +NLA+MY+Q+ ++  T ELF+G  YR+GD+ +PGAGS+E 
Sbjct  222   LIDLDYNGTDPTFSPEEQINHNLAVMYRQVISSGKTPELFMGSAYRAGDQPDPGAGSVEQ  281

Query  928   SPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFT  749
              PH P+H W GD  + N EDMG  YSA  D  F+ HH N+DRMW +W+ LG  G+ RNFT
Sbjct  282   KPHGPVHVWTGDRNQPNREDMGTLYSAAWDPVFFAHHGNIDRMWYVWRNLG--GKHRNFT  339

Query  748   DADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR----RRK  581
             D DW+NASFLFY+ENAQ VRV+V DC+E   M Y Y+   +PW+ +KP PK      + K
Sbjct  340   DPDWLNASFLFYDENAQLVRVKVKDCLEADAMRYTYQDVEIPWLKAKPTPKSALQKIKSK  399

Query  580   LALRSAAP------YVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQA  419
             ++   A P         T FPV LD+ V   V RPK  R+ +EKE EEE+L++EGIE++ 
Sbjct  400   VSTLKATPRGTTTTTAETTFPVVLDKPVSATVARPKARRSGKEKEEEEEVLVVEGIELEK  459

Query  418   NQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLP------HRQKNVEKIRTSLSLGLNEAM  257
             + + KFDVY+N  +    G + +EFAGSF H+P       + K + ++ T L LG+ + +
Sbjct  460   DVFVKFDVYINSPEHEGVGPEASEFAGSFVHVPHKHKKAKKGKEMARMNTRLKLGITDLL  519

Query  256   EDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             ED+GAEDD++VL+TL P  G G+V +  ++I++
Sbjct  520   EDIGAEDDESVLITLVPRSGKGMVKVGGLRIDF  552



>gb|ADC92563.1| polyphenol oxidase [Nelumbo nucifera]
Length=597

 Score =   508 bits (1307),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 295/572 (52%), Positives = 393/572 (69%), Gaps = 36/572 (6%)
 Frame = -1

Query  1783  TPVVLNRRL----KVLCNAA------------HGGDSKIDRRDVIlglgglygaa---nl  1661
              P+V  RR     KV C A              G   ++DRR+V++GLGGLYGA      
Sbjct  34    VPIVGKRRYRMVRKVSCEATDGEKKPTRSGNEEGSLGRLDRRNVLIGLGGLYGATGLCAG  93

Query  1660  paAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALH  1481
               A   PI  P++SKC     +LPAGA   N CPP +   +D++LPS S   MRVRPA H
Sbjct  94    RLAFGAPIMPPDLSKCGA--ANLPAGAKPTNRCPPASSEIVDFKLPS-SSEPMRVRPAAH  150

Query  1480  RLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWL  1301
              +D +Y  K++KA+ +MKALPADDPR+FTQQA VHCAYC+GAYDQ+GFPD+E+QVHNSWL
Sbjct  151   MVDEEYIAKYSKAIALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWL  210

Query  1300  FFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSH  1121
             FF FHR+YLYF+ER+LGKLI DPTF LP+WNWD PAGM  P++  + N  LYD+ R+  H
Sbjct  211   FFSFHRYYLYFYERMLGKLIDDPTFALPYWNWDAPAGMKMPTMYANPNSPLYDKLRDAKH  270

Query  1120  LPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAG  941
              PPT++DL Y  +DT  T  + + NNLA MY+Q+ +N  TA+LFLG PYR+GD+ +PG G
Sbjct  271   QPPTMIDLNYNVQDTTMTPEQLLKNNLATMYRQVVSNGSTAQLFLGSPYRAGDQPDPGFG  330

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             S+EN PH P+H W GD  + N E+MGNFYSA RD  FY HH+NVDRMWTIW++LG  GR+
Sbjct  331   SLENVPHGPVHLWAGDRTQPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLG--GRR  388

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP------  599
             ++F D DW+NA FL Y+EN Q VRV+V DC++ +++ Y Y+   +PW+ ++P P      
Sbjct  389   KDFKDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAA  448

Query  598   --KPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEV  425
               K +     L+   P V+  FP  LD   +V V RP+K+R+K+EKE EEEIL+I+ +E+
Sbjct  449   AQKLKITDRGLKKKKPTVSE-FPKELDAPFKVVVKRPRKSRSKKEKEDEEEILVIDQVEL  507

Query  424   QANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQ-KNVEKIRTSLSLGLNEAMEDL  248
             + +   KFDVY+NDEDEP    DK+EFAGSF ++PH+  K + K++T L  G++E +EDL
Sbjct  508   ERDTVVKFDVYINDEDEPSP--DKSEFAGSFVNVPHKHGKKMSKLKTCLRFGISELLEDL  565

Query  247   GAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              AEDDD V+VT+ P +GG +VTI  IKI + S
Sbjct  566   EAEDDDEVVVTIVPRIGGDLVTIGGIKIVFAS  597



>dbj|BAA21677.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   507 bits (1306),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 349/512 (68%), Gaps = 26/512 (5%)
 Frame = -1

Query  1639  IEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYK  1460
             I  P+VSKC   P DLP G     CCPP + + +D++LP+  PA +R+RP  H  D  Y+
Sbjct  92    IAPPDVSKC--GPADLPQGGVPTICCPPRSTKIIDFKLPA--PAKLRIRPPAHAGDQAYR  147

Query  1459  EKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRW  1280
             +K  KA+E+MKALP DDPRSF QQ  VHCAYC+GAYDQVGFP++E+Q+HNSWLFFP HR+
Sbjct  148   DKHYKAMELMKALPDDDPRSFKQQGAVHCAYCDGAYDQVGFPELELQIHNSWLFFPLHRY  207

Query  1279  YLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVD  1100
             YLYFFE+ILGKLI DPTF  PFWNWD PAGM  P+I  D    LYD+ R+  H PPT+VD
Sbjct  208   YLYFFEKILGKLINDPTFAGPFWNWDSPAGMPLPAIYADPKSPLYDKLRSAQHQPPTLVD  267

Query  1099  LGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPH  920
             L Y G +   +    I  NL +MY+QM +N+  A+LF G PYR+GD+ +PG GS+E +PH
Sbjct  268   LDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYRAGDEPDPGGGSIEGTPH  327

Query  919   VPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDAD  740
              P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDRMW+IW+ LG  G++ + TD+D
Sbjct  328   APVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIWKTLG--GKRADLTDSD  385

Query  739   WINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL----  572
             W+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP   PRR K+AL    
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPT--PRRAKVALSKIA  443

Query  571   -----------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiE  428
                         S+     T FP+ L   +   V R  +K R+K+ KE EEEIL+IEGIE
Sbjct  444   KKLGVAHAAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIE  503

Query  427   VQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDL  248
                +   KFDVY+ND D+   G DK EFAGSF  +PH  K+ +K+ T L LGL + +E++
Sbjct  504   FDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHSHKHKKKMNTILRLGLTDLLEEI  563

Query  247   GAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              AEDDD+V+VTL P  G   V I  IKIE+ S
Sbjct  564   EAEDDDSVVVTLVPKFGA--VKIGGIKIEFAS  593



>gb|ADI44162.1| polyphenol oxidase 1 [Fragaria pentaphylla]
Length=607

 Score =   506 bits (1304),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 270/516 (52%), Positives = 360/516 (70%), Gaps = 27/516 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA   +CCPP A +  D+QLP  S   +RVRPA H +D
Sbjct  98    FAKPVAPPDVSKCGA--ADLPTGAQKTDCCPPVAQKIFDFQLPPQS--KLRVRPAAHAVD  153

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSF QQA +HCAYC+GAYDQ GFPD+E+Q+H+SWLFFP
Sbjct  154   KAYIEKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHDSWLFFP  213

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERILGKLI DP+F  PFWNWD PAGM  P +  +    LYD+ RN +H PP
Sbjct  214   FHRYYLYFYERILGKLINDPSFASPFWNWDAPAGMQLPGMFANPKSPLYDKFRNANHQPP  273

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              ++DL Y  KD   +D  +I  NL +MY+QM +NA   +LF G PYR+GD+ +PG G++E
Sbjct  274   KLIDLNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYRAGDEPSPGGGAIE  333

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDR+W++W+ LG  G++ +F
Sbjct  334   TTPHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSVWKTLG--GKREDF  391

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFY+ENA  VRV+V DC++++++GY Y+  ++PW+ SKP   PRR KLA 
Sbjct  392   TDSDWLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPT--PRRSKLAK  449

Query  571   RSAAPYVATV------------FPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegi  431
              + A  VA              FP+ LD  +   V R  +K R+K+EKE EEEIL+I GI
Sbjct  450   AAKAIGVARAASSGPKVVGRSDFPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGI  509

Query  430   EVQANQYTKFDVYLN---DEDEPDGGYDKAEFAGSFAHLP--HRQKNVEKIRTSLSLGLN  266
             E + +   KFDVY+N   D+DEP G  D +EFAGSF ++P  H+ K  +K ++ L LGL 
Sbjct  510   EFEKDMAVKFDVYVNDLEDDDEP-GKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLT  568

Query  265   EAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + +EDLGAEDD++V+VTL P  G   + ID IKIE+
Sbjct  569   DLLEDLGAEDDESVVVTLVPRYGTKSLKIDTIKIEF  604



>ref|XP_006370127.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
 gb|ERP66696.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
Length=575

 Score =   505 bits (1300),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 259/504 (51%), Positives = 356/504 (71%), Gaps = 13/504 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P++++C +    LP  +D  NCCPPT+ +  +++ PS S + MR+RPA H +D 
Sbjct  75    ANPIAPPDITQCEL--VTLPTESDPSNCCPPTSTKIKNFEFPSAS-SPMRIRPAAHLVDK  131

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+++Q+H SWLFFP+
Sbjct  132   AYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPW  191

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PP 
Sbjct  192   HRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPKSPLYDPLRDANHQPPI  251

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             ++DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  252   LLDLNYATGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  311

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP + NGE+MGNFYSAGRD  F+CHH+NVDRMW +W+++ G G+++
Sbjct  312   IETTPHTEIHFWTGDPNQTNGENMGNFYSAGRDPIFFCHHSNVDRMWDLWKKIPG-GKRK  370

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +F D DW+N+ FLF+NEN + VRV+V D ++ +++ Y ++   +PW+ ++P PK  R++ 
Sbjct  371   DFKDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRPTPKLTRQEK  430

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
             + RSA   V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ 
Sbjct  431   SRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQL  490

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG DK+EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DD
Sbjct  491   IKFDVLVNDEPDSPGGPDKSEFAGSFVNVPH--KHAKKSKTTMVLGITGLLEDLEAEGDD  548

Query  229   TVLVTLAPNVGGGVVTIDNIKIEY  158
             T++VTL P  GG  VT+ N+KIE+
Sbjct  549   TLVVTLVPRTGGDSVTVANVKIEF  572



>ref|XP_010054349.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=595

 Score =   505 bits (1301),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 295/587 (50%), Positives = 385/587 (66%), Gaps = 49/587 (8%)
 Frame = -1

Query  1852  PPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS-------KIDRRDVIl  1694
             P R PA+ +S+   P+             RR  + C A    DS       K+DRR+V++
Sbjct  34    PKRGPASFYSKHRKPS------------IRRSTISCKALSNDDSEQNPMSVKLDRRNVLI  81

Query  1693  glgglygaanlpa---AMAGPIEAPEVSKC-VVPPTDLPAGADVDNCCPPTAGRYLDYQL  1526
             GLGG YGA  L +   A+A PI  P+ ++C  V P           CCPP     LD++L
Sbjct  82    GLGGFYGAVGLRSDPFALAEPISVPDFTQCGKVNPC-------AKACCPPPTTEVLDFKL  134

Query  1525  PSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQ  1346
             PS S +  RVRPA H  D  Y  K+A+A+ +MKALPADDPRSF QQA VHCAYC+G Y+Q
Sbjct  135   PS-SNSPTRVRPAAHLADEDYIAKYAEAIRLMKALPADDPRSFMQQANVHCAYCDGYYNQ  193

Query  1345  VGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILN  1166
             VGFP +E+QVH SWLFFPFHR+YLYF+E+ILG LI+DPTF LP+WNWD P GM  P++  
Sbjct  194   VGFPHLEVQVHCSWLFFPFHRYYLYFYEKILGSLIKDPTFALPYWNWDAPGGMKMPAMFT  253

Query  1165  DRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFL  986
             D +  LYD NRN  H PP +VDL Y  +    ++L  I NNL++MY+QM ++  TA+LFL
Sbjct  254   DPHSPLYDFNRNPDHAPPMLVDLNYNCEHLPPSNL--IHNNLSIMYRQMVSSGKTAKLFL  311

Query  985   GKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVD  806
             G  YR+GD  NPGAGS+E  PH  +H W GD R+ N EDMG  YSA RD  F+ HH+NVD
Sbjct  312   GHAYRAGDHANPGAGSIELMPHNTVHNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVD  371

Query  805   RMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANL  626
             RMWT+W+ LGG  R  +FT  DW+NASFLFY+EN Q VRV+V DC+E   +GYKY+  ++
Sbjct  372   RMWTLWKTLGGPKRT-DFTHPDWLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDI  430

Query  625   PWINSKPVPKPRRRKLALR-----------SAAPYVATVFPVTLDrvvrvkvprpkknrt  479
             PW NSKPVP    RK+A++           +  P     FPV LD+VV   V RPK+ R+
Sbjct  431   PWRNSKPVP----RKIAIKVTETSGGIADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRS  486

Query  478   keekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVE  299
             K+EKE +EE+L+IEGIE++++ + KFDV++NDE       D  EFAGSF ++PH+ K  +
Sbjct  487   KKEKEEKEEVLVIEGIELESDAFVKFDVHINDEQASLSSPDMTEFAGSFVNVPHKHKPGK  546

Query  298   KIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             K++T L+LG+ E +EDL  EDD+ +LVTL P  GG  V I NIKIE+
Sbjct  547   KMKTKLTLGITELLEDLMCEDDEKILVTLNPRYGGEDVIISNIKIEF  593



>ref|XP_009408264.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   504 bits (1299),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 286/566 (51%), Positives = 385/566 (68%), Gaps = 26/566 (5%)
 Frame = -1

Query  1816  PIPTHSHLHILTPVVLNRRLKVLCNAA--HGGDSKIDRRDVIlglgglygaanl-----p  1658
             P PT   LH+        R  + C A   H   +K+DRRDV++GLGGL GAA        
Sbjct  33    PYPTRRALHV--------RPNIACKAGEEHEIAAKVDRRDVLVGLGGLCGAAAGLGGFDK  84

Query  1657  aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPP--TAGRYLDYQLPSFSPATMRVRPAL  1484
             AA+A PI+AP++SKC   P DLP G  V NCCPP     + +D++ PS S + +RVRPA 
Sbjct  85    AALANPIQAPDLSKC--GPADLPTGVPVVNCCPPYRPGAKIVDFKRPSPS-SPLRVRPAA  141

Query  1483  HRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSW  1304
             H +D +Y  K+ KA+E+MKALPADDPR+F QQA VHCAYC+GAYDQ+GFP++EIQVHNSW
Sbjct  142   HLVDPEYLAKYKKAIELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLEIQVHNSW  201

Query  1303  LFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQS  1124
             LFFP+HR YLYF ERILGKLI D TF LPFWNWD P GM+ PSI  D +  LYD+ R+  
Sbjct  202   LFFPWHRLYLYFNERILGKLIGDDTFSLPFWNWDAPGGMMLPSIYADPSSPLYDKLRDAK  261

Query  1123  HLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGA  944
             H PP +VDL Y G D    D ++I +NL +MY+Q+F+N  T  LFLG  YR+G++ NPGA
Sbjct  262   HQPPVLVDLDYNGTDPTFPDAQQIDHNLKIMYRQVFSNGKTPLLFLGSAYRAGEQPNPGA  321

Query  943   GSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGR  764
             GS+EN PH  +H W GD  + N E+MG FY+A RD  F+ HHAN+DRMW +W++L    +
Sbjct  322   GSVENMPHNNVHLWTGDRTQPNFENMGTFYAAARDPIFFAHHANIDRMWYLWKKLS--RK  379

Query  763   KRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRR  584
              ++F D+DW+ ASFLFY+ENA  VRV V DC+E   + Y Y+   +PW+N++P PK  + 
Sbjct  380   HQDFNDSDWLKASFLFYDENADLVRVTVKDCLETDWLRYTYQDVKIPWVNARPTPKLAKA  439

Query  583   KLALRSAAPYVATV-FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYT  407
             + A  S+    A V FPVTL+  V+  V RPK  R+ +EKE EEEIL++EGIE   + + 
Sbjct  440   RKAASSSLKATAEVQFPVTLESPVKATVKRPKVGRSGKEKEDEEEILIVEGIEFDRDYFI  499

Query  406   KFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR---QKNVEKIRTSLSLGLNEAMEDLGAED  236
             KFDV++N  +        +EFAGSF ++PH+   +K+  K++T L LG+ + +ED+GAED
Sbjct  500   KFDVFVNATEGDGITAGASEFAGSFVNVPHKHKHRKDENKLKTRLCLGITDLLEDIGAED  559

Query  235   DDTVLVTLAPNVGGGVVTIDNIKIEY  158
             DD+VLVT+ P  G G V++  ++I++
Sbjct  560   DDSVLVTIVPKAGKGKVSVGGLRIDF  585



>gb|EYU27938.1| hypothetical protein MIMGU_mgv1a003402mg [Erythranthe guttata]
Length=587

 Score =   504 bits (1299),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 288/561 (51%), Positives = 383/561 (68%), Gaps = 23/561 (4%)
 Frame = -1

Query  1792  HILTPVVLNRRLKVLCNAAHGGDS----KIDRRDVIlglgglygaanlpaA---MAGPIE  1634
             HI T    + R  + C + +  D     K DRRDV++GLGGLYGA  L A+    A PI 
Sbjct  30    HIPTIRKPSHRHIISCKSTNNHDQEPAGKFDRRDVLIGLGGLYGATTLSASPFAFAAPIS  89

Query  1633  APEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEK  1454
             AP+V+KC   P DLP GA   NCCPP     +DY+ P  S  TMRVRPA H  D  Y  K
Sbjct  90    APDVTKCG--PADLPQGAAPTNCCPPPTATIVDYKFPPPS-TTMRVRPAAHLADKAYVAK  146

Query  1453  FAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYL  1274
             F +A+E+M+ALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFPFHR+YL
Sbjct  147   FNRAMELMRALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPNLELQVHNSWLFFPFHRYYL  206

Query  1273  YFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLG  1094
             +FFERILGKLI DPTF +P+WN+D PAGM  P++  + +  LYD+ RNQ H PP ++DL 
Sbjct  207   FFFERILGKLIDDPTFAMPYWNYDSPAGMTIPAMYTNPSSPLYDKLRNQGHQPPALIDLN  266

Query  1093  YQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVP  914
             + G  T  T  +++  NL +MY+QM +N+ T  LF G  YR G+  NPG+GS+EN PH P
Sbjct  267   FSGSGT-ITAEQQVKRNLTVMYRQMVSNSKTPRLFFGSAYRRGEDPNPGSGSVENIPHGP  325

Query  913   IHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWI  734
             +H W GDP + NGE+MGNFYSAGRD  FY HH+N+DR+W++W+ LG  GR+++ TD D++
Sbjct  326   VHVWTGDPTQPNGENMGNFYSAGRDPIFYAHHSNIDRLWSLWKGLG--GRRQDITDPDFL  383

Query  733   NASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPY  554
             +ASFLFY+EN Q VRV+  DC++N ++GY Y+   +PW+ S+P PK       L+     
Sbjct  384   DASFLFYDENGQMVRVKTRDCLDNTKLGYTYQDVEIPWLKSRPTPKVSSVLKKLKKLGKA  443

Query  553   VAT----------VFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTK  404
              A           V P  LD+V+++ V RPKK R+K+EK+  EEIL+I+GIE++ + Y K
Sbjct  444   KAAAAETHRPPKEVLPAKLDKVLKIMVKRPKKKRSKKEKDELEEILIIQGIELERDVYAK  503

Query  403   FDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTV  224
             FDVY+NDED+     +  EFAGSF ++PH+ K+ +KI+T L L + + +EDL AEDD+ V
Sbjct  504   FDVYINDEDDETSTEENTEFAGSFVNVPHKHKHGKKIKTQLRLSITDILEDLDAEDDEHV  563

Query  223   LVTLAPNVGGGVVTIDNIKIE  161
             LVTL P   G  +TI  +KIE
Sbjct  564   LVTLVPTNAGDSITIHGVKIE  584



>ref|XP_011002749.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   503 bits (1296),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 259/503 (51%), Positives = 355/503 (71%), Gaps = 13/503 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI AP++++C +    LP+ +D  NCCPPT+ +  +++ PS S + MR+RPA H +D 
Sbjct  81    ANPIAAPDITQCEL--VTLPSESDPSNCCPPTSTKIKNFEFPSAS-SPMRIRPAAHLVDK  137

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+++Q+H SWLFFP+
Sbjct  138   AYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPW  197

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PPT
Sbjct  198   HRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPQSPLYDPLRDANHQPPT  257

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             ++DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  258   LLDLNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  317

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP + NGE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G+++
Sbjct  318   IETTPHTEIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRK  376

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +  D DW+N+ FLF+NEN + VRV+V D ++ +++ Y ++   +PW+ ++P PK  R++ 
Sbjct  377   DIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRPTPKLTRQEK  436

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
               R+A   V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ 
Sbjct  437   LRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKENEDEVLVIEGIEYEENQL  496

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG DK+EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DD
Sbjct  497   IKFDVLVNDEPDSPGGPDKSEFAGSFVNVPH--KHAKKSKTTMVLGITGLLEDLEAEGDD  554

Query  229   TVLVTLAPNVGGGVVTIDNIKIE  161
             T++VT  P  GG  VT+ N+KIE
Sbjct  555   TLVVTFVPRSGGDSVTVANVKIE  577



>dbj|BAM15848.1| hypothetical protein [Portulaca oleracea]
Length=600

 Score =   504 bits (1298),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 259/517 (50%), Positives = 349/517 (68%), Gaps = 24/517 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRL  1475
             +A PI AP +++C   P DLP  A  D NCCPP A   +D+ LP  +PAT++VRPA H +
Sbjct  91    LAAPITAPNIAQCG--PADLPQDAQGDHNCCPPVAQNIIDFTLPP-TPATLKVRPAAHSV  147

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             D +Y +KF +A+ +MKALP  DPRSF+QQAKVHCAYC+G Y+QVGFP++++QVH SWLF 
Sbjct  148   DNEYLQKFNRAISLMKALPDTDPRSFSQQAKVHCAYCDGGYNQVGFPNLDLQVHGSWLFL  207

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHR YLYFFERILG LI DPTF +PFWNWD PAGM  P+I  DRN  LYD  R+  H P
Sbjct  208   PFHRCYLYFFERILGNLINDPTFAMPFWNWDNPAGMQMPAIYADRNSPLYDSERDGPHQP  267

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             PT+VDL + G+DT+ +  +  T NL +MY+QM +NA TA LFLG+PY++G     G GS+
Sbjct  268   PTLVDLNFDGEDTDMSTDDLTTANLTVMYRQMVSNAKTARLFLGQPYKAGGSPR-GGGSL  326

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSA RD  FY HH+N+DRMW+IW+ LG    +  
Sbjct  327   ENVPHGPVHIWTGDRNQPNTEDMGNFYSAARDPIFYAHHSNIDRMWSIWKTLG--ANRVE  384

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA  575
             FTD+DW++ASF+FY+ENAQ V++RV DC++ +++GY Y+  +LPW+NS+P PK  R    
Sbjct  385   FTDSDWLDASFVFYDENAQAVKIRVRDCLDTKKLGYTYQDVDLPWLNSQPTPKRSRIATL  444

Query  574   LRSAAPYVATV-----------FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
                  P  AT            FP  LD        +  K    ++++  +E +L+  +E
Sbjct  445   FSKLKPAKATTHPPSTSTSPVKFPKPLD-STLKIDIQRPKKSRSKKEKKLQEEVLVVEVE  503

Query  427   VQANQYTKFDVYLNDEDEP--DGGYDKAEFAGSFAHLP---HRQKNVEKIRTSLSLGLNE  263
             +Q++ + KFDVY+NDED+        K E+AGSFA++P     +K   K++T+L LGL +
Sbjct  504   LQSDVFVKFDVYVNDEDDVPLKKTIVKTEYAGSFANVPHKHKHKKEHRKMKTTLRLGLTD  563

Query  262   AMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              +EDLGA+DDD V+VTL P  G  V  I ++KIE+ S
Sbjct  564   LIEDLGADDDDGVMVTLVPRSGKEVTIIKDVKIEFAS  600



>ref|XP_006370118.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
 gb|ERP66687.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
Length=581

 Score =   503 bits (1295),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 259/504 (51%), Positives = 356/504 (71%), Gaps = 13/504 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P++++C + P  LP+ +D  NCCPPT+    +++ PS S + MR+RPA H +D 
Sbjct  81    ANPIAPPDITQCELVP--LPSESDPSNCCPPTSTEIKNFEFPSAS-SPMRIRPAAHLVDQ  137

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+E+Q+H SWLFFP+
Sbjct  138   AYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLELQIHFSWLFFPW  197

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PPT
Sbjct  198   HRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPESPLYDPLRDANHQPPT  257

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             ++DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  258   LLDLNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  317

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP + NGE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G++ 
Sbjct  318   IETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRE  376

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +  D+DW+N+ FLF++EN + VRV+V D ++ +++GY ++   +PW+ ++  PK  R++ 
Sbjct  377   DIEDSDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTTRATPKLTRQEK  436

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
             + R+A   V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ 
Sbjct  437   SRRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQL  496

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG D +EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DD
Sbjct  497   IKFDVLVNDEPDSPGGPDNSEFAGSFVNVPH--KHAKKSKTTMVLGITGLLEDLEAEGDD  554

Query  229   TVLVTLAPNVGGGVVTIDNIKIEY  158
             T++VTL P  GG  VT+ N+KIE+
Sbjct  555   TLVVTLVPRSGGDSVTVANVKIEF  578



>gb|AAO16865.1| polyphenol oxidase [Ananas comosus]
Length=577

 Score =   503 bits (1294),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 257/502 (51%), Positives = 338/502 (67%), Gaps = 16/502 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +  PI+AP++S C  PP DLPA A   +CCPP     +D++LP  S   +RVRPA   +D
Sbjct  86    VGAPIQAPDISTCG-PPADLPATAPPTDCCPPYQSTIVDFKLPPRS-DPLRVRPAAQSVD  143

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KAVE+MKALPADDPR+FTQQA VHCAYC+GAYDQ+GFPD+EIQVH+SWLFFP
Sbjct  144   ADYLAKYKKAVELMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVHSSWLFFP  203

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             +HR+YLYF ERILGKLI D TF LPFWNWD P GM  P+I  D +  LYD+ RN  H PP
Sbjct  204   WHRFYLYFNERILGKLIGDDTFALPFWNWDAPGGMQIPAIYADASSPLYDKLRNAKHQPP  263

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL Y G D   T  ++I +NL +MY+Q+ +   T ELF+G  YR+GD  +PGAG++E
Sbjct  264   TLVDLDYNGTDPTFTPEQQIAHNLTIMYRQVISGGKTPELFMGAAYRAGDAPDPGAGTLE  323

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
               PH  +H W GDP + N EDMG FY+A RD  F+ HH NVDRMW +W++LG  G  R+F
Sbjct  324   LVPHNTMHLWTGDPNQPNDEDMGTFYAAARDPIFFAHHGNVDRMWYVWRKLG--GTHRDF  381

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD DW+NASFLFY+ENAQ VRV+V DC+E   + Y Y+  ++PWI++KP PK    K   
Sbjct  382   TDPDWLNASFLFYDENAQLVRVKVKDCLEADALRYTYQDVDIPWISAKPTPK----KTPG  437

Query  571   RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVY  392
              +A       FPV LD+ V   V RPK  R+  E+E+     +    +V      KFDVY
Sbjct  438   GAAPSTTEATFPVVLDKPVSATVARPKTGRSTGEEEVLVVEGIELDKDVA----VKFDVY  493

Query  391   LNDEDEPDGGYDKAEFAGSFAHLP----HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTV  224
             +N  D    G + +EFAGSF  +P      +K   +I+T+L LG+ + +ED+GAEDD++V
Sbjct  494   INAPDNEGVGPEASEFAGSFVQVPHKHKKGKKEKARIKTTLRLGITDLLEDIGAEDDESV  553

Query  223   LVTLAPNVGGGVVTIDNIKIEY  158
             LVTL P +G G+V +  ++I++
Sbjct  554   LVTLVPRIGEGLVKVGGLRIDF  575



>gb|KCW76289.1| hypothetical protein EUGRSUZ_D00659 [Eucalyptus grandis]
Length=659

 Score =   505 bits (1301),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 295/587 (50%), Positives = 385/587 (66%), Gaps = 49/587 (8%)
 Frame = -1

Query  1852  PPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDS-------KIDRRDVIl  1694
             P R PA+ +S+   P+             RR  + C A    DS       K+DRR+V++
Sbjct  98    PKRGPASFYSKHRKPS------------IRRSTISCKALSNDDSEQNPMSVKLDRRNVLI  145

Query  1693  glgglygaanlpa---AMAGPIEAPEVSKC-VVPPTDLPAGADVDNCCPPTAGRYLDYQL  1526
             GLGG YGA  L +   A+A PI  P+ ++C  V P           CCPP     LD++L
Sbjct  146   GLGGFYGAVGLRSDPFALAEPISVPDFTQCGKVNPC-------AKACCPPPTTEVLDFKL  198

Query  1525  PSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQ  1346
             PS S +  RVRPA H  D  Y  K+A+A+ +MKALPADDPRSF QQA VHCAYC+G Y+Q
Sbjct  199   PS-SNSPTRVRPAAHLADEDYIAKYAEAIRLMKALPADDPRSFMQQANVHCAYCDGYYNQ  257

Query  1345  VGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILN  1166
             VGFP +E+QVH SWLFFPFHR+YLYF+E+ILG LI+DPTF LP+WNWD P GM  P++  
Sbjct  258   VGFPHLEVQVHCSWLFFPFHRYYLYFYEKILGSLIKDPTFALPYWNWDAPGGMKMPAMFT  317

Query  1165  DRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFL  986
             D +  LYD NRN  H PP +VDL Y  +    ++L  I NNL++MY+QM ++  TA+LFL
Sbjct  318   DPHSPLYDFNRNPDHAPPMLVDLNYNCEHLPPSNL--IHNNLSIMYRQMVSSGKTAKLFL  375

Query  985   GKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVD  806
             G  YR+GD  NPGAGS+E  PH  +H W GD R+ N EDMG  YSA RD  F+ HH+NVD
Sbjct  376   GHAYRAGDHANPGAGSIELMPHNTVHNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVD  435

Query  805   RMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANL  626
             RMWT+W+ LGG  R  +FT  DW+NASFLFY+EN Q VRV+V DC+E   +GYKY+  ++
Sbjct  436   RMWTLWKTLGGPKRT-DFTHPDWLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDI  494

Query  625   PWINSKPVPKPRRRKLALR-----------SAAPYVATVFPVTLDrvvrvkvprpkknrt  479
             PW NSKPVP    RK+A++           +  P     FPV LD+VV   V RPK+ R+
Sbjct  495   PWRNSKPVP----RKIAIKVTETSGGIADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRS  550

Query  478   keekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVE  299
             K+EKE +EE+L+IEGIE++++ + KFDV++NDE       D  EFAGSF ++PH+ K  +
Sbjct  551   KKEKEEKEEVLVIEGIELESDAFVKFDVHINDEQASLSSPDMTEFAGSFVNVPHKHKPGK  610

Query  298   KIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             K++T L+LG+ E +EDL  EDD+ +LVTL P  GG  V I NIKIE+
Sbjct  611   KMKTKLTLGITELLEDLMCEDDEKILVTLNPRYGGEDVIISNIKIEF  657



>ref|XP_008779317.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   503 bits (1294),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 283/565 (50%), Positives = 376/565 (67%), Gaps = 20/565 (4%)
 Frame = -1

Query  1816  PIPTHSHLH--ILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIl----glgglygaanlpa  1655
             P    SHLH  I           +  + A G   K+DRRD+++      G   G      
Sbjct  34    PSSKKSHLHPRISCKARDEHEKPMHTSEATGSSGKLDRRDMLIGLGGLYGAAAGLGVNRK  93

Query  1654  AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL  1475
             A+  PIEAP++SKC   P DLP+GA   +CCPP   + +D++LP  S   +R+RPA H +
Sbjct  94    ALGLPIEAPDISKC--GPADLPSGAIPTDCCPPFTSKIIDFKLPPRS-DPLRIRPAAHLV  150

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             D +Y  K+AKAVE+MKALPADDPR+FTQQA VHCAYC+G+YDQ+GFPDIEIQVH+SW+FF
Sbjct  151   DSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHDSWIFF  210

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             P+HR+YLYF E+ILGKLI D TF LPFWNWD PAGM  PSI  D + SLYD+ R+  H P
Sbjct  211   PWHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGMGMPSIYTDPSSSLYDKLRDAKHQP  270

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             P +VDL + G+D   T  ++I +NL +MY+Q+  N  TA+LF+G PYR+GD+ NPG GS 
Sbjct  271   PYLVDLDFNGQDPSFTQAQQIDHNLKIMYRQVIANGKTAQLFMGSPYRAGDQPNPGGGSF  330

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH  +H W GD  + NGEDMG  YSA RD  FY +H+NVDRMW +W++LG  G+ ++
Sbjct  331   ENVPHGTVHEWTGDRNQPNGEDMGVLYSASRDPIFYAYHSNVDRMWYVWKKLG--GKHKD  388

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK-PRRRKL  578
             F D DW+N SFLFY+ENA  VRV++ DC++ Q + Y Y+   +PW+ ++P PK     K 
Sbjct  389   FDDKDWLNTSFLFYDENADIVRVKIKDCLDTQWLRYTYQDVEIPWLRTRPTPKGTMAAKK  448

Query  577   ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFD  398
             + RS        FPVTLD  V   V RPK +R+ +EKE EEE+L++EGIE   + + KFD
Sbjct  449   SARSLRAITEATFPVTLDSPVSATVRRPKVSRSSKEKEDEEEVLVVEGIEFDRDVFIKFD  508

Query  397   VYLNDEDEPDGGYD--KAEFAGSFAHLP---HRQKNVEKIRTSLSLGLNEAMEDLGAEDD  233
             VY+N    P+ G D   +EFAG+F ++P      K  +K+ T+L LG+ E +EDLGAE D
Sbjct  509   VYIN---TPEDGVDPGSSEFAGAFVNVPHKHKHSKKEKKLMTALRLGITELLEDLGAEAD  565

Query  232   DTVLVTLAPNVGGGVVTIDNIKIEY  158
             D+VLVTL P  G G V +  ++IE+
Sbjct  566   DSVLVTLVPRKGKGKVKVGGLRIEF  590



>ref|XP_010910924.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like, 
partial [Elaeis guineensis]
Length=555

 Score =   501 bits (1291),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 273/534 (51%), Positives = 362/534 (68%), Gaps = 13/534 (2%)
 Frame = -1

Query  1738  AHGGDSKIDRRDVIlglg----glygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVD  1571
             A G   K+DRRD+++GLG       G      A+  PIEAP+VSKC   P DLP GA   
Sbjct  20    AIGSSGKLDRRDMLIGLGGLYGAAAGLGVNRKALGLPIEAPDVSKC--GPADLPPGATPT  77

Query  1570  NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQ  1391
             +CCP +  + +D++LP  S   +R+R A H +D +Y  K+AKAVE+MKALPADDPR+FTQ
Sbjct  78    DCCPSSTSKIIDFKLPP-SSNPLRIRSAAHLVDSEYLAKYAKAVELMKALPADDPRNFTQ  136

Query  1390  QAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFW  1211
             QA VH AYC+GAY+Q+GFPD+E+QVHNSW+FFP+HR+YLYF E+ILGKLI D TF LPFW
Sbjct  137   QANVHSAYCDGAYEQIGFPDLELQVHNSWIFFPWHRFYLYFHEKILGKLIGDETFALPFW  196

Query  1210  NWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALM  1031
             NWD PAGM  PSI  D + SLY++  +  H PP +VDLG+ G+D   T  ++I  NL  M
Sbjct  197   NWDAPAGMQMPSIYTDPSSSLYNKLCDAKHQPPYLVDLGFNGQDPSFTHDQQIDYNLKTM  256

Query  1030  YKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYS  851
             Y+Q+ TN  TA+LF+G PYR+GD+ NPGAGS+EN  H  +H W GD  + NGE+MG  YS
Sbjct  257   YRQVITNGKTAQLFMGSPYRAGDQPNPGAGSLENVXHNTVHVWTGDRNQPNGENMGALYS  316

Query  850   AGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDC  671
             A RD  FY HH+NVDRMW +W+ LG  G+ ++F D DW+N+SFLFY+ENA  VRV+V DC
Sbjct  317   AARDPIFYAHHSNVDRMWYVWKMLG--GKHKDFEDKDWLNSSFLFYDENAGLVRVKVKDC  374

Query  670   VENQQMGYKYEFANLPWINSKPVPK-PRRRKLALRSAAPYVATVFPVTLDrvvrvkvprp  494
             ++ Q + Y Y+   +PW+ ++P PK     K   RS         PVTLD  V   V RP
Sbjct  375   LDTQGLRYTYQDVEIPWLKTRPTPKGTAAAKKGARSPRAVTEATLPVTLDSSVSATVRRP  434

Query  493   kknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR  314
             K +R+++EKE EEE+L++EGIE     + KFDVY+N  +E        EFAGSF ++PH+
Sbjct  435   KVSRSRKEKEDEEEVLVVEGIEFDRGMFIKFDVYINTPEEDGVDPGSTEFAGSFVNVPHK  494

Query  313   ---QKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
                 K  +K+RT+L LG+ + +EDLGAE D +VLVTL P    G V +  +++E
Sbjct  495   NNHSKKEKKVRTALRLGITDLLEDLGAEADGSVLVTLVPRKEKGNVKVGGLRLE  548



>gb|AEQ30073.1| polyphenol oxidase [Litchi chinensis]
Length=599

 Score =   502 bits (1293),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 285/535 (53%), Positives = 386/535 (72%), Gaps = 19/535 (4%)
 Frame = -1

Query  1720  KIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTA  1550
             K+DRR+V+LGLGGLYG   L +   + A P+ AP++S+C     DLPAGA   NCCPP +
Sbjct  69    KVDRREVLLGLGGLYGVTTLSSDPLSFAAPVSAPDLSRC--GKADLPAGAKPTNCCPPKS  126

Query  1549  GRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCA  1370
              + +D++LP  S + +R+RPA H  D +Y  K+ KAVE+MKALPADDPR+F QQA VHCA
Sbjct  127   NKIIDFKLPP-SNSPLRIRPAAHLADNEYIAKYYKAVELMKALPADDPRNFMQQADVHCA  185

Query  1369  YCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAG  1190
             YC+GAYDQ+GFP++++QV NSWLFFPFHR+YLYF+E+ILGKLI DPTF +PFWNWD P G
Sbjct  186   YCDGAYDQIGFPNLDLQVRNSWLFFPFHRYYLYFYEKILGKLIGDPTFVMPFWNWDSPPG  245

Query  1189  MVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTN  1010
                P++  +    LYD  RN +H PPT+ DL Y G D   T+ ++I++NL +MY+QM +N
Sbjct  246   TPMPAMFANPKSPLYDTLRNSNHQPPTLADLDYSGTDVTTTNEKQISSNLKVMYRQMVSN  305

Query  1009  AGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISF  830
             + T  LFLG  YR+GD+ +PGAG++EN PH PIH W GD ++ N E+MGNFYSA RD  F
Sbjct  306   SKTPRLFLGNTYRAGDEPDPGAGALENLPHGPIHLWCGDTKQPNFENMGNFYSAARDPIF  365

Query  829   YCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMG  650
             Y HH+NVDRMWT+W+ LG  G++ NFTD DW+NA FLFY+ENA  VRV+V DC++++++G
Sbjct  366   YAHHSNVDRMWTVWKTLG--GKRTNFTDPDWLNAGFLFYDENANLVRVKVRDCLDSKKLG  423

Query  649   YKYEFANLPWINSKPVPKPRRRKLA-LRSAAPYVATV---------FPVTLDrvvrvkvp  500
             Y Y+  ++PW+ +KP PK  R+K+A L       A +         FP+ LD +    VP
Sbjct  424   YVYQDVDVPWLRTKPKPKKLRKKVAKLLGPVALAAEINTKLTPSSQFPLVLDSIKSTVVP  483

Query  499   rpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLP  320
             RPKK+R+K+EKE EEEIL+I+ I  +     KFDVY+NDED+  G  +  EFAGSF ++P
Sbjct  484   RPKKSRSKKEKEEEEEILVIDNIGFEREAVVKFDVYVNDEDQAIGP-ENTEFAGSFVNVP  542

Query  319   HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYG  155
             H+ K+ +K++T L LGL + +EDL AEDDD+V+VTL P  G G+V+I  IKI++ 
Sbjct  543   HKHKHGKKMKTCLRLGLTDLLEDLEAEDDDSVVVTLVPKYGKGLVSIGGIKIDFA  597



>gb|AGU01537.1| polyphenol oxidase [Malus domestica]
Length=616

 Score =   503 bits (1294),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 258/522 (49%), Positives = 350/522 (67%), Gaps = 34/522 (7%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P+++KC     D P+GA   NCCPPT+ + +D++ PS  P  +RVRPA H +D
Sbjct  103   VAKPVSPPDLAKCGA--ADFPSGAVPTNCCPPTSQKIVDFKFPS--PTKLRVRPAAHTVD  158

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSFTQQA +HCAYC+GAYDQVGFP++E+Q+H SWLFFP
Sbjct  159   KAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQSWLFFP  218

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF ERIL KLI DPTF LPFWNWD PAGM  P++  + +  LYDE R  SH PP
Sbjct  219   FHRYYLYFHERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRADSHQPP  278

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL + G D   +   +I  NL +MY+QM +N+    LF G PYR+G + +PGAGS+E
Sbjct  279   TLIDLDFNGTDETMSKDAQIDANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGAGSIE  338

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSA RD  F+ HH+N+DRMW IW+ +G + +  N 
Sbjct  339   TTPHGPVHTWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNIDRMWNIWKSIGTKNKDIN-  397

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA-  575
              D DW++  FLFY++NA+ VRV V D ++N+++GY YE   +PW+ S+P   PRR KLA 
Sbjct  398   -DTDWLDTGFLFYDKNAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPT--PRRTKLAR  454

Query  574   ------------------LRSAAPYVATV-FPVTLDrvvrvkvprpkknrtkeekeleee  452
                                 S+   VA   FP+ L+  +   V RPK  +  ++++ +EE
Sbjct  455   KAKAAGVAKAAGVAKAAETTSSGKVVAGKDFPINLETKISTVVSRPKPKKRSKKEKEDEE  514

Query  451   illieg-iEVQANQYTKFDVYLNDEDEPDG---GYDKAEFAGSFAHLPHRQKNVEKIRTS  284
              +L+   IE+  +   KFDVY+ND D+ D    G DK+EFAGSF  +PH+QK  EK ++ 
Sbjct  515   EILVIQGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQK--EKSKSC  572

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             L LGL + +EDLGAEDD++V+VTL P  G   V I +IKIE+
Sbjct  573   LRLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEF  614



>ref|XP_006370120.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
 gb|ERP66689.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
Length=581

 Score =   500 bits (1287),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 257/504 (51%), Positives = 355/504 (70%), Gaps = 13/504 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P++++C +    LP  +D  NCCPPT+ +  +++ PS S + MR+RPA H +D 
Sbjct  81    ANPIAPPDITQCEL--VTLPTESDPSNCCPPTSTKIKNFEFPSAS-SPMRIRPAAHLVDK  137

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+++Q+H SWLFFP+
Sbjct  138   AYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPW  197

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PPT
Sbjct  198   HRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPESPLYDPLRDANHQPPT  257

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             ++DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  258   LLDLNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  317

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP + NGE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G+++
Sbjct  318   IETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRK  376

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +  D DW+N+ FLF++EN + VRV+V D ++ +++ Y ++   +PW+ ++  PK  R++ 
Sbjct  377   DIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRATPKLTRQEK  436

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
             + R+A   V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ 
Sbjct  437   SRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQS  496

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG DK+EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DD
Sbjct  497   IKFDVLVNDEPDSPGGPDKSEFAGSFVNVPH--KHAKKSKTTMVLGITGLLEDLEAEGDD  554

Query  229   TVLVTLAPNVGGGVVTIDNIKIEY  158
             T++VTL P  GG  VT+ N+KIE+
Sbjct  555   TLVVTLVPRTGGDFVTVANVKIEF  578



>ref|XP_006370115.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
 gb|ERP66684.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
Length=581

 Score =   499 bits (1286),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 258/504 (51%), Positives = 355/504 (70%), Gaps = 13/504 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P++++C +    LP  +D  NCCPPT+ +  +++ PS S + MR+RPA H +D 
Sbjct  81    ANPIAPPDITQCEL--VTLPTESDPSNCCPPTSTKIKNFEFPSAS-SPMRIRPAAHLVDK  137

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+++Q+H SWLFFP+
Sbjct  138   AYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPW  197

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PPT
Sbjct  198   HRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPKSPLYDPLRDANHQPPT  257

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             ++DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  258   LLDLNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  317

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP + NGE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G+++
Sbjct  318   IETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRK  376

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +  D DW+N+ FLF++EN + VRV+V D ++ +++ Y ++   +PW+ ++  PK  R++ 
Sbjct  377   DIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKARATPKFTRQEK  436

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
             + RSA   V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ 
Sbjct  437   SRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQL  496

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG DK+EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DD
Sbjct  497   IKFDVLVNDEPDSPGGPDKSEFAGSFINVPH--KHAKKSKTTMVLGITGLLEDLEAEGDD  554

Query  229   TVLVTLAPNVGGGVVTIDNIKIEY  158
             T++VTL P  GG  VT+ N+KIE+
Sbjct  555   TLVVTLVPRTGGDSVTVANVKIEF  578



>ref|XP_010242012.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=610

 Score =   499 bits (1286),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 284/548 (52%), Positives = 383/548 (70%), Gaps = 26/548 (5%)
 Frame = -1

Query  1738  AHGGDSKIDRRDVIlglgglygaa---nlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDN  1568
               G   ++DRR+V++ LGGLYGA        A   PI AP+++KC     DLP  A   N
Sbjct  70    GEGSLGRMDRRNVLISLGGLYGATGLGADRLAFGAPIMAPDLTKCGA--ADLPTSAKPTN  127

Query  1567  CCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQ  1388
             CCPPT+ + +D++LP  +   MRVR A H +D +Y  K+  A+  MKALP DDPR+FTQQ
Sbjct  128   CCPPTSSKVVDFKLPPQN-EDMRVRQAAHLVDDEYVAKYQDAIARMKALPTDDPRNFTQQ  186

Query  1387  AKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWN  1208
             A VHCAYC+GAYDQVGFPD+E+QVHNSWLFFPFHR+YLYF+ERILGKLI DPTF LPFWN
Sbjct  187   ANVHCAYCDGAYDQVGFPDLELQVHNSWLFFPFHRYYLYFYERILGKLIGDPTFALPFWN  246

Query  1207  WDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMY  1028
             WD PAGM  P++  + + SLY++ R+  H PPT++DL Y  KD   T+ E++ +NLA+MY
Sbjct  247   WDAPAGMTLPAMYTNPSSSLYNKLRDTKHQPPTLIDLDYNLKDPSITNEEQLKHNLAIMY  306

Query  1027  KQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSA  848
             +QM +N  TA+LFLG PYR+GD+ +PG GS+EN PH P+H W GD  + N EDMGNFYSA
Sbjct  307   RQMVSNGSTAQLFLGTPYRAGDEPDPGNGSLENVPHGPVHLWAGDRNQPNVEDMGNFYSA  366

Query  847   GRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCV  668
              RD  FY HHANVDRMWTIW+ LG  G++R+FTD DW++++FLFY+ENA+ V+V+V DC+
Sbjct  367   ARDPIFYAHHANVDRMWTIWKTLG--GKRRDFTDPDWLDSAFLFYDENAELVKVKVRDCL  424

Query  667   ENQQMGYKYEFANLPWINSKPVP--------------KPRRRKLALRSAAPYVATVFPVT  530
             + +++ Y Y+  ++PW+ +KP P              K + ++  L+       + FP  
Sbjct  425   DEKKLRYTYQSVDIPWLKTKPTPVRKMKEALKEEEGLKDKIKERVLKLEKKIAVSEFPKQ  484

Query  529   LDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKA  350
             LD   +  V RP+K+R+K+EKE EEEIL+IE IE++ +   KFDVY+N+EDEP    DK+
Sbjct  485   LDTAFKTVVKRPRKSRSKKEKEDEEEILVIEKIELERDSVVKFDVYINNEDEPSP--DKS  542

Query  349   EFAGSFAHLPH--RQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTID  176
             EFAGSF ++PH   +K  ++++T L L + E +EDL  EDDD V+VT+ P +GG +V I 
Sbjct  543   EFAGSFVNVPHKHGKKKKKRVKTFLRLSITELLEDLETEDDDEVVVTIVPRLGGDLVIIG  602

Query  175   NIKIEYGS  152
              IKI Y S
Sbjct  603   GIKIVYAS  610



>gb|ACF17425.1| polyphenol oxidase [Camellia sinensis]
 gb|ACS88249.1| polyphenol oxidase [Camellia sinensis]
 gb|AFU35561.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   499 bits (1285),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 264/510 (52%), Positives = 355/510 (70%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D+D +N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+     RK
Sbjct  390   FKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRK  449

Query  580   LALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +  ++            A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>gb|ACN38060.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   499 bits (1285),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 264/510 (52%), Positives = 355/510 (70%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D+D +N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+     RK
Sbjct  390   FKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRK  449

Query  580   LALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +  ++            A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>gb|ABR10907.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   499 bits (1285),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 264/510 (52%), Positives = 355/510 (70%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR-----  590
             F D+D +N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+       
Sbjct  390   FKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISIFFRK  449

Query  589   -RRKLALRSAAPYV---ATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
              + K  +  A   +   A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>gb|AAU12256.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=581

 Score =   498 bits (1283),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 257/504 (51%), Positives = 355/504 (70%), Gaps = 13/504 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P++++C +    LP  +D  NCCPPT+ +  +++ PS S + MR+RPA H +D 
Sbjct  81    ANPIAPPDITQCEL--VTLPTESDPSNCCPPTSTKIKNFEFPSAS-SPMRIRPAAHLVDK  137

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+++Q+H SWLFFP+
Sbjct  138   AYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPW  197

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFW+WD PAGM  P+I  D    LYD  R+ +H PPT
Sbjct  198   HRLYLYYFERILGKLIDDPTFALPFWSWDAPAGMQMPAIFTDPKSPLYDPLRDANHQPPT  257

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             ++DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  258   LLDLNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  317

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP + NGE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G+++
Sbjct  318   IETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRK  376

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +  D DW+N+ FLF++EN + VRV+V D ++ +++ Y ++   +PW+ ++  PK  R++ 
Sbjct  377   DIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKARATPKFTRQEK  436

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
             + RSA   V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ 
Sbjct  437   SRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQL  496

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG DK+EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DD
Sbjct  497   IKFDVLVNDEPDSPGGPDKSEFAGSFINVPH--KHAKKSKTTMVLGITGLLEDLEAEGDD  554

Query  229   TVLVTLAPNVGGGVVTIDNIKIEY  158
             T++VTL P  GG  VT+ N+KIE+
Sbjct  555   TLVVTLVPRTGGDSVTVANVKIEF  578



>gb|ADI44161.1| polyphenol oxidase 2 [Fragaria pentaphylla]
Length=603

 Score =   498 bits (1282),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 295/614 (48%), Positives = 399/614 (65%), Gaps = 58/614 (9%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIPT------------HSHLHILTPVVLNRRLKVLCNAA----  1736
             MASLS P     L ++  IPT            H  L   +     R  +++C +     
Sbjct  1     MASLSSP-----LVTKTTIPTSNSLSSLSQNSSHISLVQNSKPSFIRSSRIICKSTSSNQ  55

Query  1735  -------HGGDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPA  1586
                    H   + +DRR+V++GLGGLYG     A   A A P+  P++SKC     DLP 
Sbjct  56    SPSDEHKHPHQTNVDRRNVLIGLGGLYGVGLGGADPFAFAKPVAPPDLSKCGA--ADLPP  113

Query  1585  GADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDP  1406
             GA   NCCPP + + +D+  PS SP  +RVRPA H +D  Y +K++KA+E+MKALP  DP
Sbjct  114   GATPINCCPPISDKIVDFTFPSSSP--LRVRPAAHAVDQAYIDKYSKAIELMKALPDSDP  171

Query  1405  RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTF  1226
             RSF+QQA +HCAYC+GAYDQVGFPD+E+Q+H SWLFFPFHR+YLYF+E+ILGKLI DPTF
Sbjct  172   RSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFFPFHRYYLYFYEKILGKLIDDPTF  231

Query  1225  GLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITN  1046
              LPFWNWD P GM  P++  D    LY+E RN +H PPT++DL +   DT  T+ ++I++
Sbjct  232   ALPFWNWDSPPGMKLPALFADPKSPLYNELRNANHQPPTLLDLDWNLTDTPTTEADQISS  291

Query  1045  NLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDM  866
             NL +MY+QM +NA   +LF G  YR+G   +PG+GS+E++PH PIH W GD  + N EDM
Sbjct  292   NLKIMYRQMVSNAKKQQLFFGTAYRAGTDPSPGSGSIESTPHGPIHVWTGDNTQPNYEDM  351

Query  865   GNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRV  686
             GNFYSA RD  F+ HH+NVDRMW++W+  G     ++ TD DW++  FLFY+ENAQ VRV
Sbjct  352   GNFYSAARDPIFFSHHSNVDRMWSVWKTFGATN--KDITDPDWLDTGFLFYDENAQLVRV  409

Query  685   RVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV------------  542
             +V DC++++++GY Y+  ++PW+ SKP   PRR KLA  + A  VA              
Sbjct  410   KVRDCLDSKKLGYVYQDVDIPWLTSKPT--PRRSKLAKAAKAIGVARAASSGPKVVGRSD  467

Query  541   FPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDVYLN---DEDE  374
             FP+ LD  +   V R  +K R+K+EKE EEEIL+I GIE + +   KFDVY+N   D+DE
Sbjct  468   FPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDMAVKFDVYVNDLEDDDE  527

Query  373   PDGGYDKAEFAGSFAHLP--HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNV  200
             P G  D +EFAGSF ++P  H+ K  +K ++ L LGL + +EDLGAEDD++V+VTL P  
Sbjct  528   P-GKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLGAEDDESVVVTLVPRY  586

Query  199   GGGVVTIDNIKIEY  158
             G   + ID IKIE+
Sbjct  587   GTKSLKIDTIKIEF  600



>gb|ABR24120.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   498 bits (1281),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 263/510 (52%), Positives = 355/510 (70%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              K+  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKHIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D+D +N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+     RK
Sbjct  390   FKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRK  449

Query  580   LALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +  ++            A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>ref|XP_004303397.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=603

 Score =   498 bits (1281),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 294/614 (48%), Positives = 399/614 (65%), Gaps = 58/614 (9%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIPT------------HSHLHILTPVVLNRRLKVLCNAA----  1736
             MASLS P     L ++  IPT            H  L   +     R  +++C       
Sbjct  1     MASLSSP-----LVTKTTIPTSNSLSSLSQNSSHISLVQNSKPSFIRSSRIICKCTSSNQ  55

Query  1735  -------HGGDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPA  1586
                    H   + +DRR+V++GLGGLYG     A   A A P+  P++SKC     DLP 
Sbjct  56    NPSDEHKHSHQTNLDRRNVLIGLGGLYGVGLGSADPFAFAKPVAPPDLSKCGA--ADLPP  113

Query  1585  GADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDP  1406
             GA   NCCPP + + +D+  PS SP  +RVRPA H +D  Y +K++KA+E+MKALP  DP
Sbjct  114   GATPINCCPPISDKIVDFTFPSSSP--LRVRPAAHAVDQAYIDKYSKAIELMKALPDSDP  171

Query  1405  RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTF  1226
             RSF+QQA +HCAYC+GAYDQVGFPD+E+Q+H SWLF+PFHR+YLYF+E+ILGKLI DPTF
Sbjct  172   RSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFYPFHRYYLYFYEKILGKLIDDPTF  231

Query  1225  GLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITN  1046
              LPFWNWD P GM  P++  D    LY+E RN +H PPT++DL +   DT  T+ ++I++
Sbjct  232   ALPFWNWDSPPGMKLPALFADPKSPLYNELRNANHQPPTLLDLDWNLTDTPTTEADQISS  291

Query  1045  NLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDM  866
             NL +MY+QM +NA   +LF G  YR+G   +PG+GS+E++PH P+H W GD  + N EDM
Sbjct  292   NLKIMYRQMVSNAKKQQLFFGTAYRAGTDPSPGSGSIESTPHGPVHVWTGDNTQPNYEDM  351

Query  865   GNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRV  686
             GNFYSA RD  F+ HH+NVDRMW++W+ LG     ++ TD DW++  FLFY+ENAQ VRV
Sbjct  352   GNFYSAARDPIFFSHHSNVDRMWSVWKTLGATN--KDITDPDWLDTGFLFYDENAQLVRV  409

Query  685   RVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV------------  542
             +V DC++++++GY Y+  ++PW+ SKP   PRR KLA  + A  VA              
Sbjct  410   KVRDCLDSKKLGYVYQDVDIPWLTSKPT--PRRSKLAKTAKAVGVARAATSGPKVVGRGD  467

Query  541   FPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDVYLN---DEDE  374
             FP+ LD  +   V R  +K R+K+EKE EEEIL+I GIE + +   KFDVY+N   D+DE
Sbjct  468   FPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDTAVKFDVYVNDLEDDDE  527

Query  373   PDGGYDKAEFAGSFAHLP--HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNV  200
             P G  D +EFAGSF ++P  H+ K  +K ++ L LGL + +EDLGAEDD++V+VTL P  
Sbjct  528   P-GKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLGAEDDESVVVTLVPRY  586

Query  199   GGGVVTIDNIKIEY  158
             G   + ID IKIE+
Sbjct  587   GTKSLKIDTIKIEF  600



>ref|XP_003545882.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=602

 Score =   497 bits (1280),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 272/513 (53%), Positives = 357/513 (70%), Gaps = 23/513 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPAT--MRVRPALHR  1478
              A PI  P+++ C   P DLPAG    NCCPP++ + +D++   FSP+   +RVRPA H 
Sbjct  99    FAAPISPPDLNTCG--PPDLPAGVKPTNCCPPSS-KIIDFK---FSPSNQPLRVRPAAHL  152

Query  1477  LDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
             ++ +Y  K+ KA+++MK LP+DDPR+FTQQA VHCAYC+GAY QVGFPD+++QVHNSWLF
Sbjct  153   VNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQVHNSWLF  212

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+ERILG LI DPTF LPFWNWD P GM  PSI  D    LYD  RN +H 
Sbjct  213   FPFHRWYLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDTLRNANHQ  272

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PPT+VDL +  +D  +    +I+NNL +MY+Q+ +N  T  LFLG PYR+GD+ +PG GS
Sbjct  273   PPTLVDLDFNLEDPISNG--KISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPDPGFGS  330

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +EN PH P+H W GD  + N E+MG FYSA RD  FY HH+N+DRMW+IW+ LG  G++R
Sbjct  331   VENVPHGPVHLWTGDINQPNIENMGTFYSAARDPIFYSHHSNIDRMWSIWKTLG--GKRR  388

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-RK  581
             +FTD+DW+ ++FLFY+EN   VRV+V D ++ +++GY Y+  ++PW+NSKP P+  R +K
Sbjct  389   DFTDSDWLESAFLFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLNSKPTPRRSRVQK  448

Query  580   LALRS----AAPYVATV-----FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             +AL       A + A       FP+ LD VV   V RP K+R+K+EKE EEE+L+IEGIE
Sbjct  449   VALAQNFGVGAAHAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVLVIEGIE  508

Query  427   VQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEK-IRTSLSLGLNEAMED  251
              + N   KFDV++NDED+     D  EFAGSF  +PH   +  K I T L LGL + +E+
Sbjct  509   FERNTPVKFDVFINDEDDKQIRPDNTEFAGSFVSVPHSHMHKNKDIITCLRLGLTDLLEE  568

Query  250   LGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             L AEDDD+V VTL P  G G V I  IKIE  S
Sbjct  569   LEAEDDDSVRVTLVPRYGKGRVKIRGIKIELLS  601



>gb|AHH92831.1| polyphenol oxidase [Musa acuminata AAA Group]
Length=588

 Score =   497 bits (1279),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 274/547 (50%), Positives = 371/547 (68%), Gaps = 19/547 (3%)
 Frame = -1

Query  1756  KVLCNAAH----GGDSKIDRRDVIlglg----glygaanlpaAMAGPIEAPEVSKCVVPP  1601
             K+ C A+       ++K+DRRDV++GLG       G      A+  PI+AP+++KC   P
Sbjct  45    KISCKASDEHEMTANAKLDRRDVLVGLGGLCGAAAGLGIDSKALGNPIQAPDLTKC--GP  102

Query  1600  TDLPAGADVDNCCPP--TAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMK  1427
              DLP GA   NCCPP     + +D++ P  S + +RVRPA H +D  Y +K+ KAVE+M+
Sbjct  103   ADLPTGATPTNCCPPYFPDKKIIDFKRPPNS-SPLRVRPAAHLVDSDYLDKYKKAVELMR  161

Query  1426  ALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGK  1247
             ALPADDPR+F QQA VHCAYC+GAYDQ+GFP++E+QVHNSWLFFP+HR+YLYF ERILGK
Sbjct  162   ALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPWHRFYLYFHERILGK  221

Query  1246  LIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEAT  1067
             LI D TF LPFWNWD P GM  PSI  D + SLYD+ R+  H PP +VDL Y G D   T
Sbjct  222   LIGDDTFALPFWNWDAPGGMKLPSIYADPSSSLYDKFRDAKHQPPVLVDLDYNGTDPSFT  281

Query  1066  DLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPR  887
             D E+I  NL +MY+Q+ +N  T  LFLG  YR+GD  NPGAGS+EN PH P+H W GD  
Sbjct  282   DAEQIDQNLKIMYRQVISNGKTPLLFLGSAYRAGDNPNPGAGSLENIPHGPVHGWTGDRS  341

Query  886   RKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNE  707
             + N EDMGNFYSAGRD  F+ HH+NVDRMW +W++LG  G+ ++F D DW+N +FLFY+E
Sbjct  342   QPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLG--GKHQDFNDKDWLNTTFLFYDE  399

Query  706   NAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKP-RRRKLALRSAAPYVATVFPVT  530
             NA  VRV + DC++ + + Y Y+   +PW+ ++P PK  + +K A ++      T FPVT
Sbjct  400   NADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKALKAQKTAAKTLKATAETPFPVT  459

Query  529   LDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKA  350
             L   V   V RPK +R+ +EKE EEE+L++EGIE   + + KFDV++N  +        +
Sbjct  460   LQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRDYFIKFDVFVNATEGEGITPGAS  519

Query  349   EFAGSFAHLP---HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTI  179
             EFAGSF ++P      K  +K+ T L LG+ + +ED+GAEDDD+VLVT+ P  G G V++
Sbjct  520   EFAGSFVNVPHKHKHSKKEKKLMTRLCLGITDLLEDIGAEDDDSVLVTIVPKAGKGKVSV  579

Query  178   DNIKIEY  158
               ++I++
Sbjct  580   AGLRIDF  586



>ref|XP_008346980.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   495 bits (1275),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 254/516 (49%), Positives = 344/516 (67%), Gaps = 28/516 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P+++KC     D P+GA   NCCPPT+ + +D++ PS  P  +RVRPA H +D
Sbjct  35    VAKPVXPPDLAKCGA--ADFPSGAVPINCCPPTSQKIVDFKFPS--PTKLRVRPAAHTVD  90

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSFTQQA +HCAYC+GAYDQVGFP++E+Q+H  WLFFP
Sbjct  91    KAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQCWLFFP  150

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+Y YF ERIL KLI DPTF LPFWNWD PAGM  P++  + +  LYDE R  SH PP
Sbjct  151   FHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRAASHQPP  210

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL + G D   ++  +I  NL +MY+QM +N+    LF G PYR+G + +PG GS+E
Sbjct  211   TLIDLDFNGTDETMSNDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGGGSIE  270

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+N+DRMW IW+ +G +    N 
Sbjct  271   TTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNIDRMWNIWKSIGTKNXDIN-  329

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL--  578
              D DW++  FLFY+ENA+ VRV V D ++N+++GY YE   +PW+ S+P   PRR KL  
Sbjct  330   -DKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPT--PRRTKLAR  386

Query  577   ------------ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
                            S        FP+ L+  +   V RPK  +  ++++ +EE +L+  
Sbjct  387   KAKAAGVAKAXETTSSGKVVAGKDFPINLETKISTVVSRPKPKKRSKKEKEDEEEILVIQ  446

Query  433   -iEVQANQYTKFDVYLNDEDEPDG---GYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLN  266
              IE+  +   KFDVY+ND D+ D    G DK+EFAGSF  +PH+QK  EK ++ L LGL 
Sbjct  447   GIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQK--EKSKSCLRLGLT  504

Query  265   EAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + +EDLGAEDD++V+VTL P  G   V I +IKIE+
Sbjct  505   DLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEF  540



>ref|XP_011014565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   496 bits (1278),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 257/504 (51%), Positives = 353/504 (70%), Gaps = 13/504 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P++++C +    LP+ ++  NCCP T+ +  +++ PS S + MR+RPA H +D 
Sbjct  81    ANPIAPPDLTQCEL--VTLPSESNPTNCCPQTSTKIKNFEFPSAS-SPMRIRPAAHLVDK  137

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+++Q+H SWLFFP+
Sbjct  138   AYVAKYAKAIALMKSLPDDDPRSFKNQANVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPW  197

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PPT
Sbjct  198   HRAYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPQSPLYDPLRDANHQPPT  257

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             ++DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  258   LLDLNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  317

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP +  GE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G+++
Sbjct  318   IETTPHTEIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRK  376

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +  D DW+N+ FLF+NEN + VRV+V D ++ +++ Y ++   +PW+ ++P PK  R++ 
Sbjct  377   DIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRPTPKLTRQEK  436

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
               R+A   V     + FPV LD+V+ V+V RPKK+R+  EKE E E+L+IEGIE + NQ 
Sbjct  437   LRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEAEVLVIEGIEYEENQL  496

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG DK+EFAGSF ++PH  K+ +K +T+L LG+   +EDL AE DD
Sbjct  497   IKFDVLVNDEPDSPGGPDKSEFAGSFVNVPH--KHAKKSKTNLVLGITGLLEDLEAEGDD  554

Query  229   TVLVTLAPNVGGGVVTIDNIKIEY  158
             T++VTL P  GG  VT+ N+KIE+
Sbjct  555   TLVVTLVPRTGGDFVTVANVKIEF  578



>ref|XP_008366047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08584.1| polyphenol oxidase V [Malus domestica]
Length=610

 Score =   497 bits (1280),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 254/516 (49%), Positives = 342/516 (66%), Gaps = 28/516 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P+++KC     D P+GA   NCCPPT+ + +D++ PS  P  +RVRPA H +D
Sbjct  103   VAKPVSPPDLAKC--GGADFPSGAVPXNCCPPTSQKIVDFKFPS--PTKLRVRPAAHTVD  158

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSFTQQA  HCAYC+GAYDQVGFP++E+Q+H  WLFFP
Sbjct  159   KAYIEKYSKAIELMKALPDDDPRSFTQQADJHCAYCDGAYDQVGFPNLELQIHQXWLFFP  218

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+Y YF ERIL KLI DPTF LPFWNWD PAGM  P++  + +  LYDE R  SH PP
Sbjct  219   FHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRAASHQPP  278

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL + G D   +   +I  NL +MY+QM +N+    LF G PYR+G + +PGAGS+E
Sbjct  279   TLIDLDFNGTDETMSKDAQIDANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGAGSIE  338

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSA RD  F+ HH+N+DRMW IW+ +G +    N 
Sbjct  339   TTPHGPVHTWTGDNTQPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIWKSIGTKNXDIN-  397

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL--  578
              D DW++  FLFY+ENA+ VRV V D ++N+++GY YE   +PW+ S+P   PRR KL  
Sbjct  398   -DKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPT--PRRTKLAR  454

Query  577   ------------ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
                            S        FP+ L+  +   V RPK  +  ++++ +EE +L+  
Sbjct  455   KAKAAGVAKAAETTSSGKVVAGKDFPINLETKISTVVSRPKPKKRSKKEKEDEEEILVIQ  514

Query  433   -iEVQANQYTKFDVYLNDEDEPDG---GYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLN  266
              IE+  +   KFDVY+ND D+ D    G DK+EFAGSF  +PH+QK  EK ++ L LGL 
Sbjct  515   GIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQK--EKSKSCLRLGLT  572

Query  265   EAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + +EDLGAEDD++V+VTL P  G   V I +IKIE+
Sbjct  573   DLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEF  608



>gb|ACN86310.1| polyphenol oxidase [Juglans regia]
Length=603

 Score =   497 bits (1280),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 290/555 (52%), Positives = 384/555 (69%), Gaps = 30/555 (5%)
 Frame = -1

Query  1756  KVLCNAAHGGDS----------KIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSK  1616
             +V C A +G             K DRRDV+LGLGG+YGAANL     A+A P+ APE++ 
Sbjct  51    RVACRATNGDQQNINNGQNPQGKFDRRDVLLGLGGMYGAANLCNDPFALADPVSAPELTL  110

Query  1615  CVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVE  1436
             C     DLPAGA   NCCPPT+ +  D+ LPS +   +RVRPA H +D  Y  K+ K +E
Sbjct  111   CS--EADLPAGALPVNCCPPTSKKIKDFVLPSQN-TPLRVRPAAHLVDNDYIAKYNKGIE  167

Query  1435  MMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERI  1256
             +MK+LPADDPRSFTQQA VHCAYC+GAY QVGFPD+ +QVH  WLFFPFHR+Y+YFFE+I
Sbjct  168   LMKSLPADDPRSFTQQANVHCAYCDGAYTQVGFPDLSLQVHECWLFFPFHRYYVYFFEKI  227

Query  1255  LGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDT  1076
             LGKLI DPTF LPFWNWD P GM  PS+    N ++YD  RN +H PPTI+DL Y     
Sbjct  228   LGKLIGDPTFALPFWNWDSPPGMQLPSLYAVSNSAIYDPLRNANHQPPTIIDLDYGETSE  287

Query  1075  EATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVG  896
               T  +++ +NL +MY+QM + A    LF G PYR+GD+ +PGAG++E++PH  IH W G
Sbjct  288   STTTTDQVPSNLKIMYRQMVSGAKNPTLFFGSPYRAGDEPDPGAGTIESTPHNNIHLWTG  347

Query  895   DPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLF  716
             D  + N E+MGNFYSAGRD  F+ HH+NVDRMWTIW+ LG  G++++ TD DW+N+SF F
Sbjct  348   DDTQPNIENMGNFYSAGRDPIFFAHHSNVDRMWTIWKTLG--GKRKDITDPDWLNSSFFF  405

Query  715   YNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP-KPRRRKLA---------LRS  566
             Y+ENA PVRV+V DCV+N ++ Y Y+   +PW+ +KP P K R +K+A         +  
Sbjct  406   YDENADPVRVKVKDCVDNTKLRYVYQDVEIPWLKTKPTPRKSRVKKVAKAFPAGHGGVAQ  465

Query  565   AAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLN  386
             AA   +  FP+ LD+V+   V RPKK+R+K+EK+ EEE+L+IEGIEV+ +   KFDV++N
Sbjct  466   AAETSSVKFPIVLDKVISTVVARPKKSRSKKEKDDEEEVLVIEGIEVERDIPVKFDVFIN  525

Query  385   DEDE-PDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLA  209
             DED+ P G     EFAGSF  +P +++  +K +T L +G+++ +EDLGAEDDD+V+VTL 
Sbjct  526   DEDDAPTGPGINTEFAGSFVSVPQQKQTKKK-KTYLRIGISDLLEDLGAEDDDSVVVTLV  584

Query  208   PNVGGGVVTIDNIKI  164
             P  G G   I  IKI
Sbjct  585   PRFGKGKAIIGGIKI  599



>gb|ABF19601.1| polyphenol oxidase [Camellia ptilophylla]
Length=595

 Score =   497 bits (1279),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 264/510 (52%), Positives = 352/510 (69%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP +SKC     +LPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  91    LAAPVTAPYLSKCGA--ANLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  147

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  148   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  207

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  208   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  267

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +PGAGS+
Sbjct  268   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSL  327

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  328   ENIPHGPAHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  385

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D DW+N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+     RK
Sbjct  386   FKDPDWLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFLRK  445

Query  580   LALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +  ++            A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIEV+
Sbjct  446   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEVE  505

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRT L LG+ E +EDL A
Sbjct  506   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTGLRLGITELLEDLEA  565

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  566   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  595



>gb|ABR57236.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   497 bits (1279),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 263/510 (52%), Positives = 354/510 (69%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP------KP  593
             F D+D +N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P      + 
Sbjct  390   FKDSDCLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPPISNFFRK  449

Query  592   RRRKLALRSAAPYV---ATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
              + K  +  A   +   A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAG F ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGCFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>gb|KHN08551.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   496 bits (1278),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 266/508 (52%), Positives = 355/508 (70%), Gaps = 19/508 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+++ C   P D PAGA+  NCCPP++ + +D++ P  S   +RVRPA H ++
Sbjct  98    FAAPISPPDLNTCG--PPDTPAGANPTNCCPPSS-KIIDFKFPP-SNQPLRVRPAAHLVN  153

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  K+ KA+++MK LP+DDPR+FTQQA VHCAYC+GAY QVGFPD+++Q+HNSWLFFP
Sbjct  154   DEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSWLFFP  213

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+E+ILG LI DPTF LPFWNWD P GM  PSI  D    LYD  RN +H PP
Sbjct  214   FHRWYLYFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYADPKSPLYDTLRNANHQPP  273

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL +  +D  +    +I+NNL +MY+Q+ +N  T  LFLG PYR+GD+ +PG GS+E
Sbjct  274   TLVDLDFNLEDPISNG--KISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPDPGFGSVE  331

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N PH  +H W GD  + N EDMG FYSA RD  F+ HH+N+DRMW+IW+ LG  G++++F
Sbjct  332   NVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLG--GKRKDF  389

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-RKLA  575
             TD+DW+ + FLFY+EN   VRV+V DC++ +++GY Y+  ++PW+NS+P P+  R +K+A
Sbjct  390   TDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSRVQKVA  449

Query  574   L---------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             L         R+A       FP+ LD VV   V RP K+R+K+EKE EEE+L+IEGIE +
Sbjct  450   LAQNFGVGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVLVIEGIEFE  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEK-IRTSLSLGLNEAMEDLG  245
              N   KFDV++NDED+     D  EFAGSF  +PH  K+  K I T L LGL + +E+L 
Sbjct  510   RNTPVKFDVFINDEDDKQIRPDNTEFAGSFVSVPHSHKHKNKDIITCLRLGLTDLLEELE  569

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             AEDDD+V VTL P  G G V I  IKI+
Sbjct  570   AEDDDSVRVTLVPRYGKGRVKIRGIKIK  597



>gb|ABF19602.1| polyphenol oxidase [Camellia sinensis var. assamica]
Length=599

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 263/510 (52%), Positives = 353/510 (69%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +P AGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPVAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D D +N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+     RK
Sbjct  390   FKDPDLLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFFRK  449

Query  580   LALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +  ++            A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEGEKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>gb|ACR82078.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 263/510 (52%), Positives = 353/510 (69%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +P AGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPVAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D D +N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+     RK
Sbjct  390   FKDPDLLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFFRK  449

Query  580   LALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +  ++            A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEGEKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>ref|XP_004485748.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cicer arietinum]
Length=601

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 269/518 (52%), Positives = 361/518 (70%), Gaps = 27/518 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDN--CCPPTAGRYLDYQLPSFSPATMRVRPALHR  1478
             +A PI  P++S C   P DLP GA  +N  CCPP +   +D+++PS +   +R+R A H 
Sbjct  89    LASPISPPDLSTC--GPPDLPLGATPNNINCCPPNSTNIIDFKIPS-TNQPLRIRQAAHL  145

Query  1477  LDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFP-DIEIQVHNSWL  1301
             +D KY  K+ KAVE+MK+LP+DDPRSF QQA +HCAYC+GAY QVGFP D+++QVHNSWL
Sbjct  146   VDNKYLRKYNKAVELMKSLPSDDPRSFIQQANIHCAYCDGAYSQVGFPSDLDLQVHNSWL  205

Query  1300  FFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSH  1121
             FFPFHRWYLYF+ERILG LI DPTF LPFWN+D P GM FP+I  D   SLYD+ RN  H
Sbjct  206   FFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPTIYTDTKSSLYDKLRNTDH  265

Query  1120  LPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAG  941
              PPT+++L + G D +  + ER++ NL +MY+Q+ +N  T++LFLG  YR+GD+ +PGAG
Sbjct  266   QPPTLINLNFDGDDDDDVN-ERVSTNLTIMYRQVVSNGKTSKLFLGNSYRAGDEPDPGAG  324

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             S+EN PH  +H W GD  + N EDMG FYSA RD  F+ HH+N+DR+W+IW+ LGG+ RK
Sbjct  325   SVENVPHGTVHGWSGDKTQPNREDMGVFYSAARDPIFFSHHSNIDRLWSIWKTLGGKNRK  384

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRK  581
              +FTD+DW+ + FLFY+EN   V V+V DC++ + +GY Y+  ++PW+ SKP P+ + +K
Sbjct  385   -DFTDSDWLESGFLFYDENKNLVNVKVKDCLDTKNLGYVYQDVDIPWLKSKPTPRGKTQK  443

Query  580   L---------------ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeil  446
                             A  S+  YV   FP+ LD VV   V RPKK+R+K+EKE EEE+L
Sbjct  444   KVEVAQGLHFGIGEAHAFESSRKYVK--FPLVLDNVVSTIVKRPKKSRSKKEKEEEEEVL  501

Query  445   liegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPH--RQKNVEKIRTSLSLG  272
             +IEGIE + N   KFDV++NDED+        EFAGSF ++PH    K  +KI + L LG
Sbjct  502   VIEGIEFERNLAVKFDVFINDEDDKVIRPVDTEFAGSFVNVPHFNENKGKKKIISCLRLG  561

Query  271   LNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             L + +EDLGAEDDD+V+VTL P  G G+V I +IKI +
Sbjct  562   LTDLLEDLGAEDDDSVVVTLVPRNGKGLVKIRSIKIVF  599



>gb|ACJ04908.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   495 bits (1275),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 263/510 (52%), Positives = 353/510 (69%), Gaps = 15/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L  DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLPDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  Y +GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYCAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D+DW+N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P  +     RK
Sbjct  390   FKDSDWLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSSRISNFFRK  449

Query  580   LALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +  ++            A VFP  LD VV+V V RP K+R++ EKE EEE++++EGIE++
Sbjct  450   IKNKAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEME  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL A
Sbjct  510   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEA  569

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             EDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   EDDESVLVTLVPRYGSDAVTIGGVKIEFDS  599



>ref|XP_003541740.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=601

 Score =   496 bits (1276),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 265/508 (52%), Positives = 355/508 (70%), Gaps = 19/508 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+++ C   P D PAGA+  NCCPP++ + +D++ P  S   +RVRPA H ++
Sbjct  98    FAAPISPPDLNTCG--PPDTPAGANPTNCCPPSS-KIIDFKFPP-SNQPLRVRPAAHLVN  153

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  K+ KA+++MK LP+DDPR+FTQQA VHCAYC+GAY QVGFPD+++Q+HNSWLFFP
Sbjct  154   DEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSWLFFP  213

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+E+ILG LI DPTF LPFWNWD P GM  PSI  D    LYD  RN +H PP
Sbjct  214   FHRWYLYFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYADPKSPLYDTLRNANHQPP  273

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL +  +D  +    +I+NNL +MY+Q+ +N  T  LFLG PYR+GD+ +PG GS+E
Sbjct  274   TLVDLDFNLEDPISNG--KISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPDPGFGSVE  331

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N PH  +H W GD  + N EDMG FYSA RD  F+ HH+N+DRMW+IW+ LG  G++++F
Sbjct  332   NVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLG--GKRKDF  389

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-RKLA  575
             TD+DW+ + FLFY+EN   VRV+V DC++ +++GY Y+  ++PW+NS+P P+  R +K+A
Sbjct  390   TDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSRVQKVA  449

Query  574   L---------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             L         R+A       FP+ LD VV   V RP K+R+++EKE EEE+L+IEGIE +
Sbjct  450   LAQNFGVGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSRSRKEKEEEEEVLVIEGIEFE  509

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEK-IRTSLSLGLNEAMEDLG  245
              N   KFDV++NDED+     D  EFAGSF  +PH  K+  K I T L LGL + +E+L 
Sbjct  510   RNTPVKFDVFINDEDDKQIRPDNTEFAGSFVSVPHSHKHKNKDIITCLRLGLTDLLEELE  569

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             AEDDD+V VTL P  G G V I  IKI+
Sbjct  570   AEDDDSVRVTLVPRYGKGRVKIRGIKIK  597



>ref|XP_009414395.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   495 bits (1274),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 274/547 (50%), Positives = 372/547 (68%), Gaps = 19/547 (3%)
 Frame = -1

Query  1756  KVLCNAAH----GGDSKIDRRDVIlglg----glygaanlpaAMAGPIEAPEVSKCVVPP  1601
             K+ C A+       ++K+DRRDV++GLG       G      A+  PI+AP+++KC   P
Sbjct  47    KISCKASDEHEMTANAKLDRRDVLVGLGGLCGAAAGLGIDGKALGNPIQAPDLTKC--GP  104

Query  1600  TDLPAGADVDNCCPP--TAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMK  1427
              DLP GA   NCCPP     + +D++ P  S + +RVRPA H +D  Y +K+ KAVE+M+
Sbjct  105   ADLPKGATPTNCCPPYFPDKKIIDFKRPPNS-SPLRVRPAAHLVDSDYLDKYKKAVELMR  163

Query  1426  ALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGK  1247
             ALPADDPR+F QQA VHCAYC+GAYDQ+GFP++E+QVHNSWLFFP+HR+YLYF ERILGK
Sbjct  164   ALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPWHRFYLYFHERILGK  223

Query  1246  LIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEAT  1067
             LI D TF LPFWNWD P GM  PSI  D + SLYD+ R+  H PP +VDL Y G D   T
Sbjct  224   LIGDDTFALPFWNWDAPGGMKLPSIYADPSSSLYDKFRDAKHQPPVLVDLDYNGTDPSFT  283

Query  1066  DLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPR  887
             D E+I  NL +MY+Q+ +N  T  LFLG  YR+GD  NPGAGS+EN PH P+H W GD  
Sbjct  284   DAEQIDQNLKIMYRQVISNGKTPLLFLGSAYRAGDNPNPGAGSLENIPHGPVHGWTGDRN  343

Query  886   RKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNE  707
             + N EDMGNFYSAGRD  F+ HH+NVDRMW +W++LG  G+ ++F D DW+N +FLFY+E
Sbjct  344   QPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLG--GKHQDFNDKDWLNTTFLFYDE  401

Query  706   NAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKP-RRRKLALRSAAPYVATVFPVT  530
             NA  VRV + DC++ + + Y Y+   +PW+ ++P PK  + +K A ++      T FPVT
Sbjct  402   NADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKALKAQKTAAKTLKATAETPFPVT  461

Query  529   LDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKA  350
             L   V   V RPK +R+ +EKE EEE+L++EGIE   + + KFDV++N  +        +
Sbjct  462   LQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRDYFIKFDVFVNATEGEGITPGAS  521

Query  349   EFAGSFAHLP---HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTI  179
             EFAGSF ++P      K  +K++T L LG+ + +ED+GAEDDD+VLVT+ P  G G V++
Sbjct  522   EFAGSFVNVPHKHKHSKKEKKLKTRLCLGITDLLEDIGAEDDDSVLVTIVPKAGKGKVSV  581

Query  178   DNIKIEY  158
               ++I++
Sbjct  582   AGLRIDF  588



>ref|XP_008349220.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=610

 Score =   496 bits (1276),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 255/516 (49%), Positives = 340/516 (66%), Gaps = 28/516 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P+++KC     D P+GA   NCCPPT+ + +D++ PS  P  +RVRPA H +D
Sbjct  103   VAKPVSPPDLAKCGA--ADFPSGAVPTNCCPPTSQKIVDFKFPS--PTKLRVRPAAHAVD  158

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSFTQQA VHCAYCNGAYDQVGFP++E+Q+H SWLFFP
Sbjct  159   KAYIEKYSKAIELMKALPDDDPRSFTQQADVHCAYCNGAYDQVGFPNLELQIHQSWLFFP  218

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF ERIL KLI DPTF LPFWNWD PAGM  P++  + +  LYDE R  SH PP
Sbjct  219   FHRYYLYFHERILAKLIDDPTFALPFWNWDAPAGMQLPALYANPDSPLYDELRAASHQPP  278

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL + G D   +   +I  NL +MY+QM +N+    LF G PYR+G + +PG G +E
Sbjct  279   TLIDLDFNGTDETMSKDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGXGXIE  338

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYS  RD  F+ HH N DRMW IW+ +G +    N 
Sbjct  339   XTPHGPVHXWTGDNTQPNXEDMGNFYSXARDPIFFXHHXNXDRMWNIWKSIGTKNXDIN-  397

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL--  578
              D DW++  FLFY+ENA+ VRV V D ++N+++GY YE   +PW+ S+P   PRR KL  
Sbjct  398   -DKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPT--PRRTKLAR  454

Query  577   ------------ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
                            S        FP+ L+  +   V RPK  +  ++++ +EE +L+  
Sbjct  455   KAKAAGVAKAAETTSSGKVVAGKDFPINLETKIXTVVSRPKPKKRSKKEKEDEEEILVIX  514

Query  433   -iEVQANQYTKFDVYLNDEDEPDG---GYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLN  266
              IE+  +   KFDVY+ND D+ D    G DK+EFAGSF  +PH+QK  EK ++ L LGL 
Sbjct  515   GIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQK--EKSKSCLRLGLT  572

Query  265   EAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + +EDLGAEDD++V+VTL P  G   V I +IKIE+
Sbjct  573   DLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEF  608



>gb|AII22007.1| polyphenol oxidase-5 [Gossypium hirsutum]
Length=598

 Score =   495 bits (1274),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 297/591 (50%), Positives = 393/591 (66%), Gaps = 28/591 (5%)
 Frame = -1

Query  1861  SLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHG-----GDSKI---DRR  1706
             S +P   P++      +P  S L I        +  V C A++G     G S +   DRR
Sbjct  10    SSNPVILPSSCIPTSCLPKTSPLFIFKKKKPFSKKLVSCKASNGNQNNEGSSSLNSFDRR  69

Query  1705  DVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDN--CCPPTAGRY  1541
             D++LGLG LYGA NL +   A+A PI AP++S C        +     +  CCPP     
Sbjct  70    DILLGLGTLYGATNLVSDPFALAAPIAAPDLSLCENSTVTSSSSGTSISVPCCPPKTTNI  129

Query  1540  LDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCN  1361
             LD++ P FS  T+R+RPA H +D  Y EKF KA+E+MKALP DDPRSF QQA VHCAYCN
Sbjct  130   LDFKPPRFS--TIRLRPAAHLVDANYLEKFTKAMELMKALPDDDPRSFKQQANVHCAYCN  187

Query  1360  GAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVF  1181
             GAYDQVGFPD ++QVH SWLFFPFHR YLYF+ERILGKLI DP F +PFWNWD P GM  
Sbjct  188   GAYDQVGFPDQQLQVHFSWLFFPFHRLYLYFYERILGKLIGDPNFAMPFWNWDSPPGMAI  247

Query  1180  PSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGT  1001
             P I  D N  LYDE RN +H PP ++DL Y G + E +  ++I +NL++MY+QM T   T
Sbjct  248   PKIYVDPNSPLYDEKRNVNHQPPNMLDLDYAGTEEELSKRDQIKSNLSVMYRQMVT-YKT  306

Query  1000  AELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCH  821
             A LFLG  YR+GD  +PG GS+EN+PH  +HRWVGD R+   EDMGNFYSAGRD  FY H
Sbjct  307   ASLFLGAAYRAGDDPSPGMGSIENNPHTAVHRWVGDKRQPFSEDMGNFYSAGRDPLFYAH  366

Query  820   HANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKY  641
             H++VDR+W+IW+ L G+ R  +FT  DW+++SFLFY+ENA  VRV+V D +  +  GY Y
Sbjct  367   HSDVDRLWSIWRTLPGKKRT-DFTGTDWLDSSFLFYDENANLVRVKVRDSLNMKTFGYDY  425

Query  640   EFANLPWINSKPVPKPRRRKLA--------LRSAAPYVATVFPVTLDrvvrvkvprpkkn  485
             +  N+PW+ +KP+P+   R  +         ++  P ++  FP+ LD++VRV+VPRPKK+
Sbjct  426   QKVNIPWLKNKPIPRKSGRGKSGGQAVAAETKNTTP-ISIAFPIALDKLVRVEVPRPKKS  484

Query  484   rtkeekeleeeilliegiEVQANQYTKFDVYLNDE-DEPDGGYDKAEFAGSFAHLPH-RQ  311
             RTK EKE EEE+L+++ I++  +   KFDVY+NDE DE     + +EFAGSF +LPH   
Sbjct  485   RTKLEKEDEEEVLVLQNIQLDRDAAVKFDVYINDEDDETPTEPEDSEFAGSFTNLPHNHH  544

Query  310   KNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             K   K+ T+L+L L + +EDL  E D+++LVTL P  G G+V+I NIKI+Y
Sbjct  545   KTGMKLNTNLTLPLTDLLEDLNVEGDESILVTLVPKEGKGLVSIGNIKIDY  595



>ref|XP_003593515.1| Polyphenol oxidase [Medicago truncatula]
 gb|ABN08603.1| Tyrosinase [Medicago truncatula]
 gb|AES63766.1| polyphenoloxidase [Medicago truncatula]
Length=607

 Score =   495 bits (1275),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 265/520 (51%), Positives = 362/520 (70%), Gaps = 33/520 (6%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDN--CCPPTAGRYLDYQLPSFSPATMRVRPALHR  1478
             +A PI  P++S C   P DLP GA  +N  CCPP + + ++Y++PS S   +RVR A H 
Sbjct  95    LASPISPPDLSTC--GPPDLPLGATPNNINCCPPNSTKIINYKIPS-SNQPLRVRQAAHL  151

Query  1477  LDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
             ++ +Y +K+ KA+E+MKALP++DPRSF QQA +HCAYC+GAY QVGFP++++QVHNSWLF
Sbjct  152   VNDEYLQKYKKAIELMKALPSNDPRSFIQQANIHCAYCDGAYSQVGFPNLDLQVHNSWLF  211

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+ERILG LI DPTF LPFWN+D P GM FPSI  DR   LYDE RN +H 
Sbjct  212   FPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPSIYTDRTSPLYDELRNANHQ  271

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PPT++DL Y G D E  + ERI+ NL +MY+Q+ +N  T+ LFLG  YR+GD+ +PGAGS
Sbjct  272   PPTLIDLNYDGDD-ENDENERISTNLTIMYRQLVSNGKTSTLFLGSSYRAGDQPDPGAGS  330

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +EN PH P+HRW GD  + N E+MG FY+A RD  F+ HH+N+DR W++W+ LG  G+++
Sbjct  331   IENVPHGPVHRWSGDNTQPNFENMGTFYAAARDPIFFSHHSNIDRFWSVWKTLG--GKRK  388

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +F D DW+ + FLFY+EN   V+V+V D ++ +++GY Y+  + PW+N+K  PKP R+K+
Sbjct  389   DFKDKDWLESEFLFYDENKNLVKVKVKDSLDTKKLGYVYQDVDTPWLNAK--PKPCRKKI  446

Query  577   ALR-------------------SAAPYVATVFPVTLDrvvrvkvprpkknrtkeekelee  455
                                   ++  YV    P+ LD VV   V RPKK+R+K+EKE +E
Sbjct  447   QKNVEVAQGIFFGIGEAHASEINSRSYVTC--PLVLDNVVSTIVKRPKKSRSKKEKEEKE  504

Query  454   eilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTS--L  281
             E+L+IEGIE   +   KFDV++NDED+        EFAGSF ++PH   + +K +T+  L
Sbjct  505   EVLVIEGIEFDKSLGVKFDVFINDEDDKVIKPVNTEFAGSFVNVPHSSHDHKKKKTNSCL  564

Query  280   SLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
              +GL + +EDLGAEDDD+V+VTL P  G G+V I NIKIE
Sbjct  565   RVGLTDLLEDLGAEDDDSVVVTLVPRYGKGIVKIRNIKIE  604



>gb|AFC36521.1| polyphenol oxidase [Gossypium hirsutum]
Length=598

 Score =   495 bits (1274),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 300/592 (51%), Positives = 390/592 (66%), Gaps = 30/592 (5%)
 Frame = -1

Query  1855  SPPRAPANLFSRR----PIPTHSHLHILTPVVLNRRLKVLCNAAHG-----GDSKI---D  1712
             SPP  P  L S       +P  S L I        +  V C A++G     G S +   D
Sbjct  8     SPPSNPVILPSSSIPTSCLPKTSQLFIFKMKKPFSKNLVSCKASNGNQNNEGSSSLNSFD  67

Query  1711  RRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDN--CCPPTAG  1547
             RRD++LGLG LYGA NL +   A+A  I AP++S C        +     +  CCPP   
Sbjct  68    RRDILLGLGSLYGATNLVSDPFALAALIAAPDLSLCENSTVTSSSSGTSISVPCCPPKTT  127

Query  1546  RYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAY  1367
               LD++ P FS  T+R+RPA H +D  Y EKF KA+E+MKALP DDPRSF QQA VHCAY
Sbjct  128   NILDFKPPRFS--TIRLRPAAHLVDANYLEKFTKAIELMKALPDDDPRSFKQQANVHCAY  185

Query  1366  CNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGM  1187
             CNGAYDQVGFPD ++QVH SWLFFPFHR YLYF+ERILGKLI DP F +PFWNWD P GM
Sbjct  186   CNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLYFYERILGKLIGDPNFAMPFWNWDSPPGM  245

Query  1186  VFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNA  1007
               P I  D N  LYDE RN +H PP ++DL Y G + E +  ++I +NL++MY+QM T  
Sbjct  246   AIPKIYVDPNSPLYDEKRNVNHQPPNMLDLDYAGTEEELSKRDQIKSNLSVMYRQMVT-Y  304

Query  1006  GTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFY  827
              TA LF G  YR+GD  +PG GS+EN+PH  +HRWVGD R+   EDMGNFYSAGRD  F+
Sbjct  305   KTASLFFGAAYRAGDDPSPGMGSIENNPHTAVHRWVGDKRQPFSEDMGNFYSAGRDPLFF  364

Query  826   CHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGY  647
              HH+NVDR+W+IW+ L G+ R  +FTD DW+++SFLFY+ENA  VRV+V D +  +  GY
Sbjct  365   AHHSNVDRLWSIWRTLPGKKRT-DFTDTDWLDSSFLFYDENANLVRVKVRDSLNMKTFGY  423

Query  646   KYEFANLPWINSKPVPKPRRRKLALRSAAPY-------VATVFPVTLDrvvrvkvprpkk  488
              Y+ AN+PW+ +KP P+   R  +   A          ++  FP+ LD++VRV+VPRPKK
Sbjct  424   DYQKANIPWLKNKPNPRKSGRGKSGGQAVAAETKNITPISNAFPIALDKLVRVEVPRPKK  483

Query  487   nrtkeekeleeeilliegiEVQANQYTKFDVYLNDE-DEPDGGYDKAEFAGSFAHLPH-R  314
             +RTK EKE EEE+L+++ I++  +   KFDVY+NDE DE     + +EFAGSF +LPH  
Sbjct  484   SRTKLEKEDEEEVLVLQNIQLDRDAAVKFDVYINDEDDETPTEPEDSEFAGSFTNLPHNH  543

Query  313   QKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
              K   K+ T+L+L L + +EDL  E D+++LVTL P  G G+V+I NIKI+Y
Sbjct  544   HKTGMKLNTNLTLPLTDLLEDLNVEGDESILVTLVPKEGKGLVSIGNIKIDY  595



>gb|ABR57235.1| polyphenol oxidase [Camellia sinensis]
Length=598

 Score =   493 bits (1270),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 260/510 (51%), Positives = 346/510 (68%), Gaps = 16/510 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KAV++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   QKYIAKFSKAVQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+     T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVAGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ L   G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTL--EGKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR--RK  581
             F D DW+N+ F FY+ENAQ V V+V + ++++++GY Y+   +PW+N++P P+     RK
Sbjct  390   FKDPDWLNSEFTFYDENAQVVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFFRK  449

Query  580   L---ALRSAAP----YVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +   A R+ A       A VFP  LD  V   V +      +E +E EEE++++EGIEV+
Sbjct  450   IKNKAGRAMATETLDSAAIVFPRKLD-EVVKVVVKRPTKSRREREEEEEEVVVVEGIEVE  508

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRT L LG+ E +EDL A
Sbjct  509   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTGLRLGITELLEDLEA  568

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             E+D++VLVTL P  G   VTI  +KIE+ S
Sbjct  569   ENDESVLVTLVPRYGSDAVTIGGVKIEFDS  598



>dbj|BAM15849.1| hypothetical protein [Portulaca oleracea]
Length=614

 Score =   493 bits (1269),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 266/571 (47%), Positives = 356/571 (62%), Gaps = 44/571 (8%)
 Frame = -1

Query  1756  KVLCNAAHGGD-------------SKIDRRDVIlglg----glygaanlpaAMAGPIEAP  1628
             K+ C+AA   D             +K+DRR++++GLG            PA+ A PI  P
Sbjct  48    KISCSAAKNDDQNPRSNTHDGNANNKLDRRNMLIGLGGLYGAATNLGGAPASFAAPIATP  107

Query  1627  EVSKCVVPPTDLPAGA-DVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKF  1451
             ++SKC   P DLP+ A D  NCCPP A   +DY  PS S +T+RVRP  H +D  Y  KF
Sbjct  108   DLSKC--EPADLPSNAIDRSNCCPPVATNIIDYT-PSAS-STLRVRPPAHAVDATYLAKF  163

Query  1450  AKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLY  1271
              KA+  MKALP+ DPRSF QQA+VHCAYC+G Y+QVGFP++++QVH SWLF PFHR+YLY
Sbjct  164   NKAIAAMKALPSTDPRSFIQQARVHCAYCDGGYNQVGFPNLDLQVHGSWLFLPFHRYYLY  223

Query  1270  FFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGY  1091
             FFERILG LI DPTF +PFWNWD P GM  PSI  + +  LYD  R+ +H PPT++DL Y
Sbjct  224   FFERILGSLINDPTFAIPFWNWDHPDGMKMPSIYTNTSSPLYDRRRDAAHQPPTVIDLNY  283

Query  1090  QGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPI  911
              G D   +D   I  NL +MY+Q+  NA T  LFLG+PYR+GD    G+GS+EN PH P+
Sbjct  284   DGSDDSTSDNALINANLTVMYQQIVRNASTPRLFLGQPYRAGDASPGGSGSLENVPHGPV  343

Query  910   HRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWIN  731
             H W GD  + N EDMG FY+A +D  FY HHANVDRMW++W+          FTD DW+N
Sbjct  344   HVWTGDRNQPNNEDMGTFYTAAKDPIFYAHHANVDRMWSVWKSRRSNPTAPEFTDTDWLN  403

Query  730   ASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYV  551
             ASF+FY+EN Q VRVRV DC++ +++GY Y+  +LPW+NS+P  +   R   L S  P  
Sbjct  404   ASFIFYDENKQAVRVRVKDCLDTKKLGYTYQNVDLPWLNSRPTSR-ASRVTTLSSTIPKT  462

Query  550   A--------------TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQ  413
             A                FP  LD        +  K    ++++  EE +L+  IE+Q + 
Sbjct  463   ANAAKPPSKPSSSSNVTFPKRLD-SAITIDVKRPKKSRSKKEKKGEEEVLVVEIEIQRDV  521

Query  412   YTKFDVYLNDEDEPDGGYDKA--EFAGSFAHLPHRQ----KNVEKIRTSLSLGLNEAMED  251
             +  FDV++NDED+     ++A  E  GSF ++PH Q    ++ +K++T   +GLNEA+ED
Sbjct  522   HVNFDVFVNDEDDVPSKKNRAFVEHVGSFVNVPHHQHRNNEHGKKMKTFFRVGLNEAIED  581

Query  250   LGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             LGA+DD+ + VTL P  GG  V I  +KIE+
Sbjct  582   LGADDDEGITVTLVPRTGGDAVVIKGLKIEF  612



>ref|XP_007025703.1| Larreatricin hydroxylase [Theobroma cacao]
 gb|EOY28325.1| Larreatricin hydroxylase [Theobroma cacao]
Length=605

 Score =   492 bits (1267),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 266/508 (52%), Positives = 348/508 (69%), Gaps = 14/508 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A PI AP+++ C         G +   CCPPT     DY+ PSFS   +R RP  H +D
Sbjct  99    LAAPIAAPDLTLCGNAVISETTG-ETTYCCPPTTTTITDYKPPSFS--KLRYRPPAHLVD  155

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  KF KA+ +MK LP+DDPRSF QQA VHCAYCNGAYDQVGFPD ++QVH SWLFFP
Sbjct  156   ADYLAKFTKAMNLMKELPSDDPRSFMQQAYVHCAYCNGAYDQVGFPDQDLQVHFSWLFFP  215

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+ERILGKLI DP F +PFWNWD PAGM  P+I  +    LYD+ RN +H PP
Sbjct  216   FHRWYLYFYERILGKLIGDPDFVMPFWNWDAPAGMPIPAIYVNPQSPLYDDKRNVNHQPP  275

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              + DL Y G D + TD E+I  NL LMYKQM +NA TA LF GKPYR+GD  +PG GS+E
Sbjct  276   KLADLDYNGTDKDITDAEQIAINLKLMYKQMVSNATTATLFHGKPYRAGDAGSPGGGSVE  335

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
                H  IHRWVGDPR+   EDMGNFYSAGRD  FY HH NVDRMW+IW+ L G  R  +F
Sbjct  336   LGCHTAIHRWVGDPRQTYNEDMGNFYSAGRDPVFYAHHGNVDRMWSIWKTLPGTKRN-DF  394

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             +D DW++ASF+FY+ENA  VRV+V DCV+++ +GY Y+  + PW+ +KP  +   +K   
Sbjct  395   SDTDWLDASFVFYDENANLVRVKVRDCVDSKNLGYDYQPVDNPWLKTKPTARKFAKKGGK  454

Query  571   RSAAPYVATV---------FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQA  419
                +   A +         FP+ LD+ V +++PRP+K+R+K EKE +EE+L++EGI++  
Sbjct  455   ARGSAMAAEIKSKNVVRNAFPIVLDKTVSIEIPRPRKSRSKREKEEDEEVLVLEGIQLAT  514

Query  418   NQYTKFDVYLNDE-DEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
                 KFD+Y+NDE DE   G + AEFAGSF ++PH   + +K+ T+ SL +++ +EDL  
Sbjct  515   QAAVKFDIYINDEDDEAPSGPEDAEFAGSFTNIPHSHTHAKKLNTTFSLAISDVLEDLDV  574

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             E DD ++VTL P  G G+V++ NIK++Y
Sbjct  575   EGDDNIVVTLVPREGKGLVSVGNIKVDY  602



>sp|Q06215.1|PPO_VICFA RecName: Full=Polyphenol oxidase A1, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Vicia faba]
 emb|CAA77764.1| polyphenol oxidase [Vicia faba]
Length=606

 Score =   492 bits (1266),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 267/523 (51%), Positives = 350/523 (67%), Gaps = 34/523 (7%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDN--CCPPTAGRYLDYQLPSFSPATMRVRPALHR  1478
             +A PI  P++SKCV PP+DLP+G    N  CCPP + +  D++ PS  P  +RVR A H 
Sbjct  91    LASPISPPDLSKCV-PPSDLPSGTTPPNINCCPPYSTKITDFKFPSNQP--LRVRQAAHL  147

Query  1477  LDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
             +D ++ EK+ KA E+MKALP++DPR+FTQQA +HCAYC+GAY Q+GFPD+++QVH SWLF
Sbjct  148   VDNEFLEKYKKATELMKALPSNDPRNFTQQANIHCAYCDGAYSQIGFPDLKLQVHGSWLF  207

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+ERILG LI DPTF LPFWN+D P GM  P+I  D+   LYDE RN SH 
Sbjct  208   FPFHRWYLYFYERILGSLINDPTFALPFWNYDAPDGMQLPTIYADKASPLYDELRNASHQ  267

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PPT++DL +    ++    E I  NL++MY+Q+++N  T+ LFLG PYR+GD +  GAGS
Sbjct  268   PPTLIDLNFCDIGSDIDRNELIKTNLSIMYRQVYSNGKTSRLFLGNPYRAGDAEPQGAGS  327

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +EN PH P+H W GD  + N EDMG FYSA RD  FY HH+NVDR+W IW+ LG  G+K 
Sbjct  328   IENVPHAPVHTWTGDNTQTNIEDMGIFYSAARDPIFYSHHSNVDRLWYIWKTLG--GKKH  385

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +FTD DW+ + FLFY+EN   VRV V D ++  ++GY Y+   +PW  +KPV  PRR K+
Sbjct  386   DFTDKDWLESGFLFYDENKNLVRVNVKDSLDIDKLGYAYQDVPIPWEKAKPV--PRRTKV  443

Query  577   A--------------------LRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekele  458
                                  +R  +P     FP+ L+  V   V RPKK R+K+EKE E
Sbjct  444   QKLVEVEVNDGNLRKSPTIFLVRQQSPRKYVTFPLVLNNKVSAIVKRPKKLRSKKEKEEE  503

Query  457   eeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR---QKNVEKIRT  287
             EE+L+IEGIE   N   KFDVY+NDED+  G     EFAGSF ++PH     KN +KI T
Sbjct  504   EEVLVIEGIEFYMNIAIKFDVYINDEDDKVGA-GNTEFAGSFVNIPHSAHGHKN-KKIIT  561

Query  286   SLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             SL LG+ + +EDL  E DD ++VTL P  G G V I+N++I +
Sbjct  562   SLRLGITDLLEDLHVEGDDNIVVTLVPKCGSGQVKINNVEIVF  604



>ref|XP_008349252.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   489 bits (1259),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 252/516 (49%), Positives = 341/516 (66%), Gaps = 28/516 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P+++KC     D P+GA   NCCPPT+ + +D++ PS  P  +RVRPA H +D
Sbjct  35    VAKPVXPPDLAKCGA--ADFPSGAVPXNCCPPTSQKIVDFKFPS--PTKLRVRPAAHTVD  90

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSFTQQA +HCAYC+GAYDQVGFP++E+Q+H  WLFFP
Sbjct  91    KAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQCWLFFP  150

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+Y YF ERIL KLI DPTF LPFWNWD PAGM  P++  + +  LYDE R  SH PP
Sbjct  151   FHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRAASHQPP  210

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL + G D   +   +I  NL +MY+QM +N+    LF G PYR+  + +PG GS+E
Sbjct  211   TLIDLDFNGTDETMSXDAQIXANLKIMYRQMVSNSKKPLLFFGSPYRAXTEPDPGXGSIE  270

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSA RD  F+ HH+N+DRMW IW+ +G +    N 
Sbjct  271   TTPHGPVHXWTGDNTQPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIWKSIGTKNXDIN-  329

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL--  578
              D DW++  FLFY+ENA+ VRV V D ++N+++GY YE   +PW+ S+P   PRR KL  
Sbjct  330   -DKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPT--PRRTKLAR  386

Query  577   ------------ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
                            S        FP+ L+  +   V RPK  +  ++++ +EE +L+  
Sbjct  387   KAKAAGVAKAXETTSSGKVVAGKDFPINLETKIXTVVSRPKPKKRSKKEKEDEEEILVIX  446

Query  433   -iEVQANQYTKFDVYLNDEDEPDG---GYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLN  266
              IE+  +   KFDVY+ND D+ D    G DK+EFAGSF  +PH+QK  EK ++ L LGL 
Sbjct  447   GIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQK--EKSKSCLRLGLT  504

Query  265   EAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + +EDLGAEDD++V+VTL P  G   V I +IKIE+
Sbjct  505   DLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEF  540



>ref|XP_006370125.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
 gb|ERP66694.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
Length=581

 Score =   490 bits (1262),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 253/504 (50%), Positives = 351/504 (70%), Gaps = 13/504 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P++++C +    LP+ ++  NCCP T+ +  +++ PS S + MR+RPA H +D 
Sbjct  81    ANPIAPPDITQCEL--VTLPSESNPTNCCPQTSTKIKNFEFPSAS-SPMRIRPAAHLVDK  137

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
                 K+AKA+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+E+Q+H SWLFFP+
Sbjct  138   ASLAKYAKAIALMKSLPDDDPRSFKSQANVHCAYCDGAYHQAGFPDLELQIHFSWLFFPW  197

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR YLY+FERILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PPT
Sbjct  198   HRAYLYYFERILGKLIDDPTFALPFWNWDAPAGMQIPAIFTDPKSPLYDPLRDANHQPPT  257

Query  1108  IVDLGYQGKDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             + DL Y   D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G+
Sbjct  258   LFDLNYATGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGT  317

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +E +PH  IH W GDP +  GE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G+++
Sbjct  318   IETTPHTQIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRK  376

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +  D DW+N+ FLF++EN + VRV+V D ++ +++GY ++   +PW+ ++  PK  R++ 
Sbjct  377   DIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTTRATPKLTRQEK  436

Query  577   ALRSAAPYVA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQY  410
             + R+A   V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ 
Sbjct  437   SSRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQL  496

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDD  230
              KFDV +NDE +  GG D +EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DD
Sbjct  497   IKFDVLVNDEPDSPGGPDMSEFAGSFVNVPH--KHAKKSKTTMVLGITGLLEDLEAEGDD  554

Query  229   TVLVTLAPNVGGGVVTIDNIKIEY  158
             T++VT  P  GG  VT+ N+KIE+
Sbjct  555   TLVVTFVPRTGGDSVTVANVKIEF  578



>ref|XP_006370117.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
 gb|ERP66686.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
Length=543

 Score =   488 bits (1257),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 252/496 (51%), Positives = 349/496 (70%), Gaps = 13/496 (3%)
 Frame = -1

Query  1624  VSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAK  1445
             +++C + P  LP  +D  NCCPPT+ +  +++ PS S + MR+RPA H +D  Y  K+AK
Sbjct  51    ITQCELVP--LPTESDPSNCCPPTSTKIKNFEFPSAS-SPMRIRPAAHLVDKAYVAKYAK  107

Query  1444  AVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFF  1265
             A+ +MK+LP DDPRSF  QA VHCAYC+GAY Q GFPD+++Q+H SWLFFP+HR YLY+F
Sbjct  108   AIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRLYLYYF  167

Query  1264  ERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQG  1085
             ERILGKLI  PTF LPFWNWD PAGM  P+I  D    LYD  R+ +H PPT++DL Y  
Sbjct  168   ERILGKLIDGPTFALPFWNWDAPAGMQMPAIFTDPESPLYDPLRDANHQPPTLLDLNYAK  227

Query  1084  KDTE---ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVP  914
              D     A   E   +NL +MY+QM + A    LF GKPYR+GD  +PG G++E +PH  
Sbjct  228   GDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIETTPHTQ  287

Query  913   IHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWI  734
             IH W GDP + NGE+MGNFYSAGRD  FYCHH+NVDRMW +W+++ G G++++  D DW+
Sbjct  288   IHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPG-GKRKDIEDPDWL  346

Query  733   NASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPY  554
             N+ FLF++EN + VRV+V D ++ +++ Y ++   +PW+ ++  PK  R++ + R+A   
Sbjct  347   NSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRATPKLTRQEKSRRAAKKS  406

Query  553   VA----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLN  386
             V     + FPV LD+V+ V+V RPKK+R+  EKE E+E+L+IEGIE + NQ  KFDV +N
Sbjct  407   VVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKFDVLVN  466

Query  385   DEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             DE +  GG DK+EFAGSF ++PH  K+ +K +T++ LG+   +EDL AE DDT++VT  P
Sbjct  467   DEPDSPGGPDKSEFAGSFVNVPH--KHAKKSKTTMVLGITGLLEDLEAEGDDTLVVTFVP  524

Query  205   NVGGGVVTIDNIKIEY  158
               GG  VT+ N+KIE+
Sbjct  525   RSGGDFVTVANVKIEF  540



>ref|XP_007025706.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY28328.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
Length=602

 Score =   490 bits (1262),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 271/571 (47%), Positives = 365/571 (64%), Gaps = 39/571 (7%)
 Frame = -1

Query  1777  VVLNRRLK----------VLCNAAHGGD------SKIDRRDVIlglgglygaanlpa---  1655
             + LN+++K          V C A + G       ++ DRRD+++GLGGLYGA NL     
Sbjct  37    LFLNKKIKKPDYSGPSKVVSCKATNNGSKGDSSLNRFDRRDLLIGLGGLYGATNLSNDPF  96

Query  1654  AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL  1475
             A+A PI AP+++ C    T      +   CCPP   + +D++ P++S   +R R A H +
Sbjct  97    ALAAPIAAPDLTLCG-DATISDTTKETVYCCPPETTKVIDFKPPTYS--KIRYRSAAHLV  153

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             D  Y  KF KA+E+M+ALP DDPRSF QQA +HCAYCNGAYDQVGF D +IQVH SWLFF
Sbjct  154   DPDYLAKFTKAMELMRALPDDDPRSFKQQANIHCAYCNGAYDQVGF-DQDIQVHFSWLFF  212

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHR YLYF+ERILGKLI DP F +PFWNWD PAGM  P+I  + N  LYD+ RN +H P
Sbjct  213   PFHRLYLYFYERILGKLIGDPDFAMPFWNWDAPAGMPIPAIYVNPNSPLYDDKRNVNHQP  272

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             P +VDL Y G D + TD   + +NL +MYKQM + + TA LF GK YR+GDK +PG G +
Sbjct  273   PKVVDLDYNGTDKDITDKAMVQSNLKVMYKQMVSGSKTASLFHGKVYRAGDKPSPGGGVV  332

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             E   H  IHRW GDPR+   EDMGNFYSAGRD  FY HH+NVDRMW+IW+ L G+ R  +
Sbjct  333   ELGSHTAIHRWCGDPRQTYSEDMGNFYSAGRDPLFYAHHSNVDRMWSIWKGLPGKKR-ND  391

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRK--  581
             FTD DW++ASF+FY+ENA  VR RV DC++ + +GY Y+  ++PW+ +KPVP+   +K  
Sbjct  392   FTDTDWLDASFVFYDENANLVRARVRDCLDTRTLGYDYQGVDVPWLKTKPVPRKFSKKGG  451

Query  580   -------LALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
                     A       +   FP+ LD   ++      + +    K  +EE  ++    +Q
Sbjct  452   KGHGQAVAAETKNKNVIRNAFPIVLD---KIVSIEIPRPKKSRTKLEKEEEEVLVLESIQ  508

Query  421   ANQYT--KFDVYLNDE-DEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMED  251
              +  T  KFD+Y+NDE DE   G + +EFAGSF ++PH   + +K+ TS SL ++E +ED
Sbjct  509   LDTSTPVKFDIYINDEDDEAPSGPEDSEFAGSFTNVPHNHSHSKKLETSFSLAISEVLED  568

Query  250   LGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             L  E DD ++VTL P  G G+V++ NIKI+Y
Sbjct  569   LDVEGDDNIVVTLVPREGKGLVSVGNIKIDY  599



>ref|XP_003522849.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
 gb|KHN32510.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   489 bits (1259),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 263/513 (51%), Positives = 347/513 (68%), Gaps = 21/513 (4%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
             A PI  P+++ CV    +LP G +  NCCPP +   +D++ P  S   +RVR A H ++ 
Sbjct  95    AAPILGPDLTTCV--QAELPEGVEPTNCCPPISTNIIDFKFPP-SNQPLRVRSAAHLVNK  151

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  K+ KAV +MK LP+DDPRSF QQAKVHCAYC+G Y Q+GFPD++++VH SWLFFP+
Sbjct  152   DYLAKYEKAVNLMKNLPSDDPRSFAQQAKVHCAYCDGGYHQLGFPDLDLEVHFSWLFFPY  211

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HRWYLYF ERIL  LI DPTF LPFWNWD P GM  PS+  D    LYD  RN +H PPT
Sbjct  212   HRWYLYFHERILASLINDPTFALPFWNWDAPGGMQLPSMYADPKSPLYDSLRNANHQPPT  271

Query  1108  IVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMEN  929
             +V+L +  +D  A     I+ NL  MY+Q+ +NA T  LF G PYR+GD+ NPG GS+E+
Sbjct  272   LVNLDFTIEDPNAE--ANISTNLTTMYRQLVSNAKTPTLFFGNPYRAGDQPNPGGGSVES  329

Query  928   SPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFT  749
             +PH P+H W GD      EDMGN Y+A RD  FYCHH+NVDRMW+IW+ LG  G++R+ T
Sbjct  330   TPHGPVHAWTGDINHPTMEDMGNLYAAARDPIFYCHHSNVDRMWSIWKTLG--GKRRDLT  387

Query  748   DADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP-KPRRRKLAL  572
             D DW+ ++FLFY+EN   VRV+  DC++ +++GY Y+  ++PW+ SKP P + R +K+ L
Sbjct  388   DPDWLESAFLFYDENKNLVRVKTKDCLDTRKLGYVYQDVDIPWLKSKPTPLRSRAQKVEL  447

Query  571   R-----SAAPYVATV-----FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
                    AA + A       FP+ LD VV   V RPKK+R+K+EKE +EEIL++EGIE +
Sbjct  448   TPLFGGVAAAHAAETSRNVKFPLVLDSVVSTVVKRPKKSRSKKEKEEKEEILVVEGIEFE  507

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPH---RQKNVEKIRTSLSLGLNEAMED  251
             ++   KFDV++NDED+     D  EFAGSF  +PH     KN +KI T L LGL + +E+
Sbjct  508   SSTGVKFDVFINDEDDKLVKPDNTEFAGSFVSVPHSHEHHKNNKKIVTCLRLGLTDLLEE  567

Query  250   LGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             LGAEDDD+VLVTL P  G G V I  IKI++ S
Sbjct  568   LGAEDDDSVLVTLVPKYGKGRVNIRGIKIDFVS  600



>gb|ACJ04909.1| polyphenol oxidase [synthetic construct]
Length=600

 Score =   489 bits (1258),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 261/511 (51%), Positives = 348/511 (68%), Gaps = 16/511 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+ +   T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HHANVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVG-DCVENQQMGYKYEFANLPWINSKPVPKPRR--R  584
             F D+DW+N+ F FY+ENAQ V V+V  +   ++      +   +PW+N++P P+     R
Sbjct  390   FKDSDWLNSEFTFYDENAQLVTVKVKREFGSSKNSATSTQNVEIPWLNARPSPRISNFFR  449

Query  583   KLALRSAAPY-------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEV  425
             K+  R+            A VFP  LD VV+V V RP K+R++ EKE EE ++++EGIE+
Sbjct  450   KIKNRAGIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEGVVVVEGIEM  509

Query  424   QANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLG  245
             + +   KFDV++ND+DE   G +K EFAGSF ++P + K+ +KIRTSL LG+ E +EDL 
Sbjct  510   ERDVSVKFDVFINDDDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLE  569

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             AEDD++VLVTL P  G   VTI  +KIE+ S
Sbjct  570   AEDDESVLVTLVPRYGSDAVTIGGVKIEFDS  600



>sp|P43311.1|PPO_VITVI RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Vitis vinifera]
 pir||S52629 catechol oxidase (EC 1.10.3.1) precursor - grape
 emb|CAA81798.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   488 bits (1256),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 288/596 (48%), Positives = 379/596 (64%), Gaps = 47/596 (8%)
 Frame = -1

Query  1840  PANLFSRRPIPTHSHLHILTPVVLNRRL-----KVLCNAAHG-------------GDSKI  1715
             P+ LF R      SH+    PV  NR       KV CN+A+G                K+
Sbjct  25    PSPLFQRA-----SHV----PVARNRSRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKL  75

Query  1714  DRRDVI-----lglgglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTA  1550
             DRR+V+     L        A  P A   PI+AP++SKC      +P G    NCCPP  
Sbjct  76    DRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--ATVPDGVTPTNCCPPVT  133

Query  1549  GRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCA  1370
              + +D+QLPS S + MR RPA H +  +Y  K+ KA+E+ KALP DDPRSF QQA VHC 
Sbjct  134   TKIIDFQLPS-SGSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCT  192

Query  1369  YCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAG  1190
             YC GAYDQVG+ D+E+QVH SWLF PFHR+YLYF ERIL KLI DPTF LP+W WD P G
Sbjct  193   YCQGAYDQVGYTDLELQVHASWLFLPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDG  252

Query  1189  MVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTN  1010
             M  P+I      SLYDE RN  HLPPT++DL Y G +    D E  T+NLA+MYKQ+ + 
Sbjct  253   MYMPTIYASSPSSLYDEKRNAKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSG  312

Query  1009  AGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISF  830
             A T +LFLG PYR+GD  +PGAG++E++PH  +H+W G    K  EDMGNFY+AGRD  F
Sbjct  313   ATTPKLFLGYPYRAGDAIDPGAGTLEHAPHNIVHKWTG-LADKPSEDMGNFYTAGRDPIF  371

Query  829   YCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMG  650
             + HHANVDRMW IW+ +GG+ RK +FTD DW++A+F+FY+EN Q V+V+V DCV+  ++ 
Sbjct  372   FGHHANVDRMWNIWKTIGGKNRK-DFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLR  430

Query  649   YKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV----------FPVTLDrvvrvkvp  500
             Y+Y+   +PW+      K +    + +S     A +          FP  L+ V+RV+VP
Sbjct  431   YQYQDIPIPWLPKNTKAKAKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVP  490

Query  499   rpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLP  320
             RPKK+R+K+EKE EEE+LLI+GIE+    + KFDVY+NDED        +EFAGSF ++P
Sbjct  491   RPKKSRSKKEKEDEEEVLLIKGIELDRENFVKFDVYINDEDYSVSRPKNSEFAGSFVNVP  550

Query  319   HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             H+     K +T+L   +NE +EDLGAEDD++V+VT+ P  GG  VTI  I+IE+ S
Sbjct  551   HKHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEFVS  606



>ref|XP_003526194.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=596

 Score =   487 bits (1253),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 262/508 (52%), Positives = 348/508 (69%), Gaps = 18/508 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+++ C   P DLP GA+  NCCPP +   +D++ P  S   +RVRPA H +D
Sbjct  92    FAAPISPPDLTTCG--PPDLPEGAEPTNCCPPFSSTIIDFKFPP-SNKPLRVRPAAHLVD  148

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+++MK LPA+DPR+F QQA VHCAYC G+YDQVGFP +E+QVH+SWLFFP
Sbjct  149   KNYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFFP  208

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             +HRW+LYF+ERILG LI DPTF LPFWNWD P GM  PSI  D    LYD  RN +H PP
Sbjct  209   YHRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDPLRNANHQPP  268

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VD  +   +  +    RI+ NL +MY+Q+ +N  T  LFLG PYR+GD  +PG GS+E
Sbjct  269   TLVDFDFNLDNPISNG--RISTNLTIMYRQLVSNGKTPTLFLGNPYRAGDAPDPGGGSVE  326

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
               PH P+H W GD  + N E+MG+FYSA RD  FY HH+NVDRMW+IW+ LG  G++R+F
Sbjct  327   GVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIWKTLG--GKRRDF  384

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP-KPRRRKLA  575
             TD+DW+ +  LFY+EN   VRV+V DC++ +++GY Y+   +PW+ SKP P + R +K+A
Sbjct  385   TDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSKPSPRRSRVQKVA  444

Query  574   L---------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             L         R+A       FP+ LD VV + V RPKK+R+K+EKE EEE+L+IEG+E  
Sbjct  445   LGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEEEEVLVIEGVEYD  504

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNV-EKIRTSLSLGLNEAMEDLG  245
             +N   KFDV +NDED+     + +E+AGSF  +PH  K+  +KI T L LGL + +E+L 
Sbjct  505   SNIPVKFDVLINDEDDKQIQPEDSEYAGSFVTVPHSHKHKNKKIITCLRLGLTDLLEELE  564

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             AEDDD+V+VTL P  G G V I  IKI+
Sbjct  565   AEDDDSVVVTLVPRYGKGRVQIGGIKID  592



>gb|KHN46528.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=596

 Score =   487 bits (1253),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 262/508 (52%), Positives = 348/508 (69%), Gaps = 18/508 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+++ C   P DLP GA+  NCCPP +   +D++ P  S   +RVRPA H +D
Sbjct  92    FAAPISPPDLTTCG--PPDLPEGAEPTNCCPPFSSTIIDFKFPP-SNKPLRVRPAAHLVD  148

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+++MK LPA+DPR+F QQA VHCAYC G+YDQVGFP +E+QVH+SWLFFP
Sbjct  149   KNYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFFP  208

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             +HRW+LYF+ERILG LI DPTF LPFWNWD P GM  PSI  D    LYD  RN +H PP
Sbjct  209   YHRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDPLRNANHQPP  268

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VD  +   +  +    RI+ NL +MY+Q+ +N  T  LFLG PYR+GD  +PG GS+E
Sbjct  269   TLVDFDFNLDNPISNG--RISTNLTIMYRQLVSNGKTPTLFLGNPYRAGDAPDPGGGSVE  326

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
               PH P+H W GD  + N E+MG+FYSA RD  FY HH+NVDRMW+IW+ LG  G++R+F
Sbjct  327   GVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIWKTLG--GKRRDF  384

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP-KPRRRKLA  575
             TD+DW+ +  LFY+EN   VRV+V DC++ +++GY Y+   +PW+ SKP P + R +K+A
Sbjct  385   TDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSKPSPRRSRVQKVA  444

Query  574   L---------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             L         R+A       FP+ LD VV + V RPKK+R+K+EKE EEE+L+IEG+E  
Sbjct  445   LGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEEEEVLVIEGVEYD  504

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNV-EKIRTSLSLGLNEAMEDLG  245
             +N   KFDV +NDED+     + +E+AGSF  +PH  K+  +KI T L LGL + +E+L 
Sbjct  505   SNIPVKFDVLINDEDDKQIQPEDSEYAGSFVTVPHSHKHKNKKIITCLRLGLTDLLEELE  564

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             AEDDD+V+VTL P  G G V I  IKI+
Sbjct  565   AEDDDSVVVTLVPRYGKGRVQIGGIKID  592



>ref|XP_008371334.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08582.1| polyphenol oxidase IIb [Malus domestica]
Length=600

 Score =   487 bits (1253),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 269/560 (48%), Positives = 354/560 (63%), Gaps = 26/560 (5%)
 Frame = -1

Query  1771  LNRRLKVLCNAAHGGDS--------------KIDRRDVIlgl---gglygaanlpaAMAG  1643
             ++RR  + C A +  ++              K+DRR+V++GL    G    A  P A A 
Sbjct  47    ISRRSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLIGLGGLYGATTLAQKPLAFAT  106

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKY  1463
             P+  P+++KC +   ++  G +   CCPP + +   +      P  +R RPA H +  +Y
Sbjct  107   PLAPPDLTKCTL--AEITTGGETVACCPPVSTKIKTFTXDQSIP--LRTRPAAHLVTDEY  162

Query  1462  KEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHR  1283
               KF KA  +M+ALP DDPRS  QQAKVHCAYCNGAY QVGFPDI+IQVH SWLFFPFHR
Sbjct  163   LAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222

Query  1282  WYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIV  1103
              YLYF+ERILGKLI DPTF LP+WNWD P G   P I  D    LYD+ R+  H PP +V
Sbjct  223   MYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTTSPLYDQYRHAGHQPPVLV  282

Query  1102  DLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPG-AGSMENS  926
             DL Y G D +  D  RI  NLA+MY+QM + A T +LF G  YR+G+      AG++EN+
Sbjct  283   DLSYGGTDDDVDDQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGETTTGKYAGTIENN  342

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
             PH  IH W GDP + N EDMGNFYSAGRD  FY HH NVDRMW IW+ LG  G++++ TD
Sbjct  343   PHNNIHLWCGDPNQPNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLG--GKRKDPTD  400

Query  745   ADWINASFLFYNENAQPVRVRVGDCVE-NQQMGYKYEFANLPWINSKPVPKPRRRKLALR  569
              DW++A FLFY+ENA+ V  +V D +   + + Y YE  ++PW+ SKP  +  R K   +
Sbjct  401   TDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAK  460

Query  568   SAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDVY  392
              +A  + T FP T D    V+V R   + RTK+EK  EEE+L+I+ IE ++N+  KFDV+
Sbjct  461   VSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVF  520

Query  391   LNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTL  212
             +ND+ E     DK+EFAGSF H+PH QK   K +T+L LG+ + +EDLG EDD +VLVTL
Sbjct  521   INDDAESLSRKDKSEFAGSFVHVPHNQKTGTKTKTNLKLGITDLLEDLGVEDDSSVLVTL  580

Query  211   APNVGGGVVTIDNIKIEYGS  152
              P V    +T+   KIEY S
Sbjct  581   VPRVSNSPITVGGFKIEYSS  600



>dbj|BAO79386.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=607

 Score =   487 bits (1253),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 289/596 (48%), Positives = 379/596 (64%), Gaps = 47/596 (8%)
 Frame = -1

Query  1840  PANLFSRRPIPTHSHLHILTPVVLNRR-----LKVLCNAAHG-------------GDSKI  1715
             P+ LF R      SH+    PV  NR       KV CN+A+G                K+
Sbjct  25    PSPLFQRA-----SHV----PVARNRSRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKL  75

Query  1714  DRRDVI-----lglgglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTA  1550
             DRR+V+     L        A  P A   PI+AP++SKC      +P G    NCCPP  
Sbjct  76    DRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--ATVPDGVTPTNCCPPVT  133

Query  1549  GRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCA  1370
              + +D+QLPS S + MR RPA H +  +Y  K+ KA+E+ KALP DDPRSF QQA VHC 
Sbjct  134   TKIIDFQLPS-SGSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCT  192

Query  1369  YCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAG  1190
             YC GAYDQVG+ D+E+QVH SWLF PFHR+YLYF ERIL KLI DPTF LP+W WD P G
Sbjct  193   YCQGAYDQVGYTDLELQVHASWLFLPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDG  252

Query  1189  MVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTN  1010
             M  P+I      SLYDE RN  HLPPT++DL Y G +    D E  T+NLA+MYKQ+ + 
Sbjct  253   MYMPTIYASSPSSLYDEKRNAKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSG  312

Query  1009  AGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISF  830
             A T +LFLG PYR+GD  +PGAG++E+ PH  +H+W G    K  EDMGNFY+AGRD  F
Sbjct  313   ATTPKLFLGYPYRAGDAIDPGAGTLEHVPHNIVHKWTG-LADKPSEDMGNFYTAGRDPIF  371

Query  829   YCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMG  650
             + HHANVDRMW IW+ +GG+ RK +FTD DW++A+F+FY+EN Q V+V+V DCV+  ++ 
Sbjct  372   FGHHANVDRMWNIWKTIGGKNRK-DFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLR  430

Query  649   YKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV----------FPVTLDrvvrvkvp  500
             Y+Y+   +PW+  K   K +    + +S     A +          FP  L+ V+RV+VP
Sbjct  431   YQYQDIPIPWLPKKTKAKAKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVP  490

Query  499   rpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLP  320
             RPKK+R+K+EKE EEE+LLI+GIE+    + KFDVY+NDED        +EFAGSF ++P
Sbjct  491   RPKKSRSKKEKEDEEEVLLIKGIELDRENFVKFDVYINDEDYSVSRPKNSEFAGSFVNVP  550

Query  319   HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             H+     K +T+L   +NE +EDLGAEDD++V+VT+ P  GG  VTI  I+IE+ S
Sbjct  551   HKHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEFVS  606



>gb|ADF59059.2| polyphenol oxidase V [Pyrus x bretschneideri]
Length=605

 Score =   487 bits (1253),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 261/509 (51%), Positives = 350/509 (69%), Gaps = 19/509 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P++ KC   P DLP+GA   NCCPPT+ + +D++ PS  P  +RVRPA   +D
Sbjct  103   LAKPVSPPDIDKCG--PADLPSGALPTNCCPPTSQKIVDFKFPS--PGKLRVRPAAQSVD  158

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K++KA+E+MKALP DDPRSF+QQA VHCAYC+GAYD+VGFP++E+Q+HN WLFFP
Sbjct  159   KAYIDKYSKAIELMKALPDDDPRSFSQQADVHCAYCDGAYDEVGFPNLELQIHNCWLFFP  218

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERILGKLI DPTF LPFWN+D PAGM  P++  + +  LYD+ R  SH PP
Sbjct  219   FHRYYLYFYERILGKLIGDPTFALPFWNYDAPAGMQIPALYTNPDSPLYDKFRAASHQPP  278

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL + G D   ++  RI  NL LMY+QM +NA    LF G P R+G + +PG GS+E
Sbjct  279   TLIDLDFNGTDETISNDARIDANLKLMYRQMISNAKKQLLFFGAPLRAGTEPDPGQGSIE  338

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDRMW IW+ LG + +  N 
Sbjct  339   TAPHGPVHLWTGDNTQPNIEDMGNFYSAGRDPIFFAHHSNVDRMWNIWKSLGTKNKDIN-  397

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
              D DW++A FLFY+ENA+ VRVRV DC++N+++GY YE   +PW+ ++P   PRR K A 
Sbjct  398   -DPDWLDAGFLFYDENAELVRVRVRDCLDNKKLGYTYEDVEIPWLKTRPT--PRRTKAAG  454

Query  571   RSAAPYVATV--------FPVTLDrvvrvkv-prpkknrtkeekeleeeilliegiEVQA  419
              + A    ++        FPV+L+  +R  V    +K R+K+EKE EEEIL+I+GIE   
Sbjct  455   VAKAAETTSLGKLVGSKDFPVSLETKIRTVVPRPKQKKRSKKEKEDEEEILVIDGIEFDK  514

Query  418   NQYTKF--DVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLG  245
             +   KF   V   D+DE   G   +EFAGSF  +PH+ K  ++ +  L LGL E +EDLG
Sbjct  515   DVAVKFDVCVNDVDDDEAPSGPIYSEFAGSFVSVPHKHKENKRSKGCLRLGLTELLEDLG  574

Query  244   AEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             AEDD++V+VTL P      V I +IKIE+
Sbjct  575   AEDDESVVVTLVPRFSSQAVKIGSIKIEF  603



>gb|ABX09994.1| chloroplast polyphenol oxidase [Taraxacum officinale]
Length=599

 Score =   485 bits (1249),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 272/567 (48%), Positives = 370/567 (65%), Gaps = 27/567 (5%)
 Frame = -1

Query  1792  HILTPVVLNRRLKVL-CNAA----HGGDS-KIDRRDVIlglg----glygaanlpaAMAG  1643
              + TP  LN R  V  C +A    H  DS  +DRR+V+L LG          +   A A 
Sbjct  36    QVPTPKTLNHRHAVTSCKSADDHHHDIDSGTLDRRNVLLRLGGLYGAAATFGSNSLAFAD  95

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKY  1463
             PI AP++++C   P D+PAG  V +CCPP   +  D++LP  S  T+R+RPA H +D  Y
Sbjct  96    PIMAPDLTQC--GPADIPAGGIVTDCCPPFTTKIQDFKLPPPS-NTLRIRPAAHLVDKDY  152

Query  1462  KEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHR  1283
              +KF KA+ +MKALP DDPRSF QQA VHCAYC+GAY+QVG+P +++QVHNSWLFFPFHR
Sbjct  153   IDKFNKAIGLMKALPDDDPRSFKQQAVVHCAYCDGAYEQVGYPGLDLQVHNSWLFFPFHR  212

Query  1282  WYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIV  1103
              YLYFFE+I GKLI DPTF +PFWNWD   GM  P I  +    LYD  R+  H PP++V
Sbjct  213   CYLYFFEKICGKLINDPTFAIPFWNWDAADGMTIPDIYTNSKSPLYDTLRDAKHQPPSVV  272

Query  1102  DLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSP  923
             DL Y G D   +  E+ + NL +MY+QM ++A TA LF+G PYR+GD+ NPG G++EN P
Sbjct  273   DLDYNGVDENLSPSEQTSTNLTIMYRQMVSSAKTASLFMGSPYRAGDEPNPGGGTLENIP  332

Query  922   HVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDA  743
             H P+H W GD  + NGE+MGNFYSAG+D  FY HHANVDRMW+IW+ LG  GR+++FTD+
Sbjct  333   HGPVHIWTGDRNQPNGENMGNFYSAGKDPIFYAHHANVDRMWSIWKTLG--GRRKDFTDS  390

Query  742   DWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKP---VPKPRRRKLAL  572
             DW+++SF FY+ENA+ VRV+V DC++++++GY YE   +PW+ +KP     K RR+ +  
Sbjct  391   DWLDSSFSFYDENAEFVRVKVRDCLDSKKLGYAYEDVKIPWLKTKPRSKYGKSRRKAVGH  450

Query  571   RSAA-------PYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEV--QA  419
             + A        P+   VFP +LD+V+   +    K    ++++ EEE +L+       + 
Sbjct  451   KHAVARADELIPFAKDVFPASLDKVMIKVLVPRPKKSRSKKQKDEEEEVLVVEGIEVKRN  510

Query  418   NQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAE  239
                       +D+DE     DK EFAGSF ++PH  K+ + + T L LG++E ++DLGA+
Sbjct  511   EFVKFDVFVDDDDDEVRATADKTEFAGSFVNVPHVHKHEKNVTTRLRLGISELLDDLGAD  570

Query  238   DDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             DDD VLVTL P   GG V+I  IKIEY
Sbjct  571   DDDNVLVTLVPKTEGGEVSIGMIKIEY  597



>ref|XP_007159290.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
 gb|ESW31284.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
Length=594

 Score =   485 bits (1248),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 255/517 (49%), Positives = 353/517 (68%), Gaps = 25/517 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P  +P+   C   P DLP GA+  +CCPP +   +D++ P  +P  +RVRP  H +D
Sbjct  81    IAAPT-SPDFKSC--GPPDLPRGAESTDCCPPKSSTIVDFKFPPRTP--LRVRPGAHLVD  135

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++K+ +A+ +MK LP++DPRSF QQA +HCAYCNGAY QVGFPD+++QVHNSWLFFP
Sbjct  136   DIYRDKYKEALSIMKGLPSEDPRSFIQQANIHCAYCNGAYHQVGFPDLDLQVHNSWLFFP  195

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIP-AGMVFPSILNDRNVSLYDENRNQSHLP  1115
             +HR+YLYF+ERILG LI DPTF +PFWNWD P  GM  PS+  D+N  LYD  RN SH P
Sbjct  196   YHRFYLYFYERILGSLIGDPTFAIPFWNWDHPKGGMTMPSLFTDKNSPLYDPRRNLSHQP  255

Query  1114  PTIVDLGYQGKD-----TEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNP  950
             PT++DL Y  KD        +  ++I++NL +MY+ + +     +LFLG PYR+G   +P
Sbjct  256   PTLIDLDYNRKDDNNPNQSESVADQISSNLTIMYRNVVSGGKLPKLFLGSPYRAGSDPHP  315

Query  949   GAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGR  770
             GAGS+E+ PH+P+H W GDPR  N EDMG FYSAG+D  FY HHANVDR+W+IW+ + G 
Sbjct  316   GAGSLEHVPHIPVHSWCGDPREPNREDMGVFYSAGKDPIFYAHHANVDRVWSIWKTIPG-  374

Query  769   GRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK-P  593
             G++R+FTD DW+ +SFLFY+EN   VRV+V D ++ + +GY Y+  +LPW+  KP P+  
Sbjct  375   GKRRDFTDPDWLESSFLFYDENKNLVRVKVKDSLDTRNLGYVYQDIDLPWLKKKPKPRMS  434

Query  592   RRRKLALRSA-----------APYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeil  446
             + +K+AL  +               +  FP++LD  V + V RPK  R+KEEKE EEE+L
Sbjct  435   KAKKVALAKSFGVTAARAAETTTSSSVRFPLSLDSKVSIVVKRPKLLRSKEEKEEEEEVL  494

Query  445   liegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVE-KIRTSLSLGL  269
             +I+GIE   ++  KFDV++NDED+       +EFAGSF  LPH   +   K++T   +GL
Sbjct  495   VIDGIEFGRDKAVKFDVFINDEDDEVIKASNSEFAGSFVSLPHTHLHKSMKVKTCFRVGL  554

Query  268   NEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
              + +EDL AE+DD+++VTL P  G G+VTI  IKIE+
Sbjct  555   TDLLEDLEAENDDSIVVTLVPKYGKGLVTIQGIKIEF  591



>ref|XP_008371333.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08581.1| polyphenol oxidase IIa [Malus domestica]
Length=600

 Score =   485 bits (1248),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 270/532 (51%), Positives = 349/532 (66%), Gaps = 18/532 (3%)
 Frame = -1

Query  1720  KIDRRDVIlglgglygaanlp---aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTA  1550
             K+DRR+V++GLGGLYGA  L     A A P+  P+++KC   P ++  G +   CCPP +
Sbjct  78    KLDRRNVLIGLGGLYGATTLAPKPLAFANPLAPPDLTKC--KPAEITTGGETVECCPPVS  135

Query  1549  GRYLDYQLPSFSP---ATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKV  1379
              +     + +F+P     +R RPA H +  +Y  KF KA  +M+ALP DDPRS  QQAKV
Sbjct  136   TK-----IKTFTPDRSIPLRTRPAAHLVTDEYLAKFKKAQALMRALPEDDPRSMVQQAKV  190

Query  1378  HCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDI  1199
             HCAYCNGAY QVGFPDI+IQ+H SWLFFPFHR YLYF+ERILGKLI DPTF LP+WNWD 
Sbjct  191   HCAYCNGAYPQVGFPDIDIQIHFSWLFFPFHRMYLYFYERILGKLIDDPTFALPYWNWDS  250

Query  1198  PAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQM  1019
             P G   P I  D    LYD+ RN  H PP +VDL Y G D +  D  RI  NLA+MY QM
Sbjct  251   PDGFPIPDIYTDTTSPLYDQYRNADHQPPVLVDLSYGGTDDDVDDQTRIDENLAIMYXQM  310

Query  1018  FTNAGTAELFLGKPYRSGDKKNPG-AGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGR  842
              + A T  LF G  YR+GD      AG++ENSPH  IH W GDP + + EDMGNFYSAGR
Sbjct  311   VSGAKTPHLFFGHEYRAGDTTTGTYAGTIENSPHNNIHLWCGDPNQTHQEDMGNFYSAGR  370

Query  841   DISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVE-  665
             D  FY HH NVDRMW +W+ LG  G++++ TD DW++A FLFY+ENA+ V  +V D ++ 
Sbjct  371   DPLFYAHHCNVDRMWNVWKTLG--GKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSLKP  428

Query  664   NQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvpr-pkk  488
              + + Y YE  ++PW+ +KP  +  + K   +  A  + T FP T D    V+V R   +
Sbjct  429   EKDLRYTYEPVSVPWLFTKPTARKPKSKTKAKVGATQLTTKFPATFDSKTTVEVARPKPR  488

Query  487   nrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQK  308
              RTK+EK  EEE+L+I+ IE ++N+  KFDV++ND+ E     DK+EFAGSF H+PH QK
Sbjct  489   KRTKKEKIDEEEVLIIKDIEFESNEAVKFDVFINDDAESLSRKDKSEFAGSFVHVPHNQK  548

Query  307   NVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
                K +T+L LG+ + +EDLG EDD +VLVTL P V    +TI   KIEY S
Sbjct  549   TGTKKKTNLKLGITDLLEDLGVEDDSSVLVTLVPRVSNSPITIGGFKIEYSS  600



>gb|AGC54425.1| polyphenol oxidase 1 [Gossypium hirsutum]
Length=616

 Score =   485 bits (1248),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 292/591 (49%), Positives = 382/591 (65%), Gaps = 29/591 (5%)
 Frame = -1

Query  1855  SPPRAPANLFSRRPIPTHSHLHILT---PVVLNRRLKVLCNAA----HGGDS----KIDR  1709
             +P   P++      IP  S L I     P     +  V C A+    +  DS    + DR
Sbjct  27    TPIIIPSSPLQTSFIPKTSQLSIFKKKKPFNFASKKLVSCKASDRNQNNADSSSLNRFDR  86

Query  1708  RDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGADVDN--CCPPTAGR  1544
             RD++LGLGGLYGA NL +   A A PI AP++S C        +     +  CCPP A  
Sbjct  87    RDILLGLGGLYGATNLVSDPFASAAPIAAPDLSLCENSTVTSSSSGTSISVPCCPPKATN  146

Query  1543  YLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYC  1364
              +D++ P FS   +R+RPA H +D  Y EKF KA+E+MKALP DDPRSF QQA VHCAYC
Sbjct  147   IIDFKPPRFS--NIRLRPAAHLVDANYLEKFTKAMELMKALPDDDPRSFKQQANVHCAYC  204

Query  1363  NGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMV  1184
             NG YD VGFPD ++Q+H SWLFFPFHR+YLYF+ERILGKLI DP F +PFWNWD P GMV
Sbjct  205   NGVYDHVGFPDQQLQIHFSWLFFPFHRFYLYFYERILGKLIGDPNFVMPFWNWDSPPGMV  264

Query  1183  FPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAG  1004
              P I  D    LYDE RN  H PP ++DL Y G +   +  ++I +NL++MY+QM T   
Sbjct  265   IPDIYVDPTSPLYDEKRNVDHQPPKMLDLDYAGTEELLSKRDQIKSNLSVMYRQMVT-YK  323

Query  1003  TAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYC  824
             T  LF G  YR+GD  +PG GS+EN+PH  +HRWVGD R    EDMGNFYSAGRD  FY 
Sbjct  324   TPSLFHGAAYRAGDNPSPGMGSVENNPHTAVHRWVGDKREPFSEDMGNFYSAGRDPLFYA  383

Query  823   HHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYK  644
             HH NVDR+W IW+ L G+ R  +FTD DW+++SFLFY+ENA  VRV+V DC+ ++ +GY 
Sbjct  384   HHCNVDRLWNIWKSLPGKKRT-DFTDTDWLDSSFLFYDENANLVRVKVRDCLNSRTLGYD  442

Query  643   YEFANLPWINSKPVPKPRRR-------KLALRSAAPYVATVFPVTLDrvvrvkvprpkkn  485
             Y+  N+PW+ +KP P+   R         A  S    +   FP+ LD++VR++VPR KK+
Sbjct  443   YQKVNIPWLKNKPTPRRPGRGSGSGSAMAAETSTKTVIRNAFPIVLDKLVRIEVPRTKKS  502

Query  484   rtkeekeleeeilliegiEVQANQYTKFDVYLNDE-DEPDGGYDKAEFAGSFAHLPHRQK  308
             RTK EKE EEE+L+++ I V  +   KFDVY+NDE DE     + +EFAGSF ++PH   
Sbjct  503   RTKVEKENEEEVLVLQNIRVDRDVAVKFDVYINDEDDETPTEPEDSEFAGSFTNIPHNHH  562

Query  307   N-VEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             N   K+ T+L+L L++ +EDL  E DD ++VTL P  G G+V+I NIKI++
Sbjct  563   NPAVKLDTNLTLPLSDLLEDLDIERDDNIVVTLVPKEGKGLVSIGNIKIDF  613



>gb|KHN46329.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=624

 Score =   484 bits (1247),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 268/518 (52%), Positives = 354/518 (68%), Gaps = 26/518 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A PI  P++  C   P DL  GA   NCCPP +   +D++LPS S A +RVRPA H ++
Sbjct  108   IAAPILPPDLKTCG--PPDLATGAKPVNCCPPISSTIIDFKLPS-SGAPLRVRPAAHLVN  164

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ +A++ MKAL  +DPR+FTQQA VHCAYC+GAY QVGFP++++QVHN WLFFP
Sbjct  165   DVYIAKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGFPNLDLQVHNCWLFFP  224

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIP-AGMVFPSILNDRNVSLYDENRNQSHLP  1115
             +HRWYLYF+ERILG LI DPTF LPFWNWD P  GM  PS   D+N  LYD  RN +H P
Sbjct  225   YHRWYLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDKNSPLYDPLRNLNHQP  284

Query  1114  PTIVDLGYQGKD------TEATDL-ERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKK  956
             P ++DL Y  +D      +E+ D  E+I +NL++MY+ + +N     LFLG PYR+GD+ 
Sbjct  285   PVLIDLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKLPRLFLGSPYRAGDEP  344

Query  955   NPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLG  776
              PGAGS+EN PH P+H W GD R  N E+MG FYSA RD  F+ HHANVDRMW+IW+ + 
Sbjct  345   EPGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFFSHHANVDRMWSIWKTIP  404

Query  775   GRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK  596
             G G++R+FTD DW+ ++F FY+EN   VRV+V D ++ +++GY Y+  ++PW+ +KP PK
Sbjct  405   G-GKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLKNKPKPK  463

Query  595   -PRRRKLALRS-----AAPYVATV-----FPVTLDrvvrvkvprpkknrtkeekeleeei  449
               + +KLAL       AA  V T      FP+TLD  V   V RPK  R+KEEKE EEE+
Sbjct  464   RSKAKKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKRPKLLRSKEEKEEEEEV  523

Query  448   lliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR--QKNVEKIRTSLSL  275
             L+I+GIE   N+  KFDV++NDED+        EFAGSF  +PH    KN +KI+T   +
Sbjct  524   LVIDGIEFDRNKAVKFDVFINDEDDKVITPSNTEFAGSFVSVPHSHVHKN-KKIKTCFRV  582

Query  274   GLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             GL + +EDL AE+DD++LVTL P  G G+VTI +IKIE
Sbjct  583   GLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKIE  620



>gb|ADP89908.1| polyphenol oxidase [Nelumbo nucifera]
Length=500

 Score =   479 bits (1234),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 260/496 (52%), Positives = 350/496 (71%), Gaps = 20/496 (4%)
 Frame = -1

Query  1735  HGGDSKIDRRDVIlglgg---lygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNC  1565
              G   ++DRR+V++GLGG     G      A   PI  P++SKC     +LPAGA   NC
Sbjct  13    EGSLGRLDRRNVLIGLGGLYGATGLGADRLAFGAPIMPPDLSKCGA--ANLPAGAKPTNC  70

Query  1564  CPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQA  1385
             CPP +   +D++LPS S   MRVRPA H +D +Y  K++KA+ +MKALPADDPR+FTQQA
Sbjct  71    CPPASSEIVDFKLPS-SSEPMRVRPAAHMVDEEYIAKYSKAIALMKALPADDPRNFTQQA  129

Query  1384  KVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNW  1205
              VHCAYC+GAYDQ+GFPD+E+QVHNSWLFFPFHR+YLYF+ER+LGKLI DPTF LP+WNW
Sbjct  130   NVHCAYCDGAYDQIGFPDLELQVHNSWLFFPFHRYYLYFYERMLGKLIDDPTFALPYWNW  189

Query  1204  DIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYK  1025
             D PAGM  P++  + N  LYD+ R+  H PPT++DL Y  +DT  T  + + NNLA MY+
Sbjct  190   DAPAGMKMPTMYANPNSPLYDKLRDAKHQPPTMIDLNYNVQDTTMTPEQLLKNNLATMYR  249

Query  1024  QMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAG  845
             Q+ +N  TA+LFLG PYR+GD+ +PG GS+EN PH P+H W GD  + N E+MGNFYSA 
Sbjct  250   QVVSNGSTAQLFLGSPYRAGDQPDPGFGSLENVPHGPVHLWAGDRTQPNIENMGNFYSAA  309

Query  844   RDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVE  665
             RD  FY HH+NVDRMWTIW++LG  GR+++F D DW+NA FL Y+EN Q VRV+V DC++
Sbjct  310   RDPIFYAHHSNVDRMWTIWKKLG--GRRKDFKDPDWLNAGFLLYDENKQLVRVKVRDCLD  367

Query  664   NQQMGYKYEFANLPWINSKPVP--------KPRRRKLALRSAAPYVATVFPVTLDrvvrv  509
              +++ Y Y+   +PW+ ++P P        K +     L+   P V+  FP  LD   +V
Sbjct  368   EKKLRYSYQDVEIPWMKTRPTPGKLMAAAQKLKITDRGLKKKKPTVSE-FPKELDAPFKV  426

Query  508   kvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
              V RP+K+R+K+EKE EEEIL+I+ +E++ +   KFDV++NDED P    DK+EFAGSF 
Sbjct  427   VVKRPRKSRSKKEKEDEEEILVIDQVELERDTVVKFDVHINDEDGPSP--DKSEFAGSFV  484

Query  328   HLPHRQ-KNVEKIRTS  284
             ++PH+  K + K+R +
Sbjct  485   NVPHKHGKKMSKLRRA  500



>ref|XP_011083298.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=579

 Score =   482 bits (1241),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 269/555 (48%), Positives = 362/555 (65%), Gaps = 27/555 (5%)
 Frame = -1

Query  1792  HILTPVVLNRRLKVLC----NAAHGGDSKIDRRDVIlglgglygaanlpa---AMAGPIE  1634
             H LT      R +V C    N     D K+DRR+++LGL GLYGAANL +   A A PIE
Sbjct  32    HFLTHASRRHRFQVSCKGVANQEPTADGKVDRRNMLLGLSGLYGAANLVSDPQAYAAPIE  91

Query  1633  APEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKE  1457
             APE   C     D+  G  +D NCCP  + + +DY+LP  +   MR+RPA H++  +Y  
Sbjct  92    APEFKACG-EARDVATGDLLDVNCCPLPSDKIIDYKLPPVN--KMRIRPAAHKVTKEYLA  148

Query  1456  KFAKAVEMMKALPADDP---RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFH  1286
             KF +A+  MKAL  DDP   R F QQA +HCAYCNGA+DQVG+ +++IQVHNSWLFFPFH
Sbjct  149   KFEEAIRRMKALDKDDPTDPRGFMQQANIHCAYCNGAHDQVGYKNLDIQVHNSWLFFPFH  208

Query  1285  RWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTI  1106
             RWYLYF+ERILGKLI DPTF LPFWNWD P GM  P I ++    LY+ NRNQ++ PP I
Sbjct  209   RWYLYFYERILGKLIDDPTFVLPFWNWDNPKGMQMPKIFDNTGSPLYNANRNQANRPPAI  268

Query  1105  VDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             +DLG+ G    + DL+++ NNL +MY +M  +  +   F+G+PYR+G+  +PG GS E  
Sbjct  269   IDLGFSG---ASDDLQKVVNNLTVMYSEMIRSVNSTIDFMGQPYRAGNSPSPGMGSSERG  325

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
              HV  H WVG+P+ K  EDMGNFYSAGRD  FYCHHANVDRMW+IW+ L     K + TD
Sbjct  326   SHVAAHVWVGNPKNKYREDMGNFYSAGRDTLFYCHHANVDRMWSIWRTLKTDVPK-DITD  384

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL-ALR  569
              D++NA+FLFY+EN Q VRV+V DC+++++MGY +E  ++PW+N KP  K  + K+  + 
Sbjct  385   PDFLNAAFLFYDENKQLVRVKVADCLDHRRMGYDFERVDIPWLNYKPPRKAAKAKVETIS  444

Query  568   SAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
               A     +FP+ L           +    K  K   +E+L++E IE    ++ KFDV++
Sbjct  445   QGAQKPEDLFPLNL-------KKITRVLVPKSAKGKADEVLVLENIETDTTKFIKFDVFV  497

Query  388   NDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLA  209
             NDED+     DKAE+AG+FA +PH+ K+ +K ++++SL L E  ED+   DDDT++VTL 
Sbjct  498   NDEDDNAEELDKAEYAGTFAQVPHKTKD-KKGKSTISLRLTELYEDIDVADDDTIVVTLI  556

Query  208   PNVGGGVVTIDNIKI  164
             P   G  VTI  IKI
Sbjct  557   PRSNGDDVTIGGIKI  571



>gb|AAP33165.1| polyphenol oxidase [Medicago sativa]
Length=607

 Score =   483 bits (1242),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 262/521 (50%), Positives = 356/521 (68%), Gaps = 34/521 (7%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDN--CCPPTAGRYLDYQLPSFSPATMRVRPALHR  1478
             +A PI  P++S C   P DLP GA  +N  CCPP + + ++Y++PS S   +RVR A H 
Sbjct  94    LASPISPPDLSTC--GPPDLPLGATPNNINCCPPNSTKIINYKIPS-SNQPLRVRQAAHL  150

Query  1477  LDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
             ++ +Y +K+ KA+E+MKALP+ DPRSF QQA +HCAYC+GAY QVGFP++++QVHNSWLF
Sbjct  151   VNDEYLQKYKKALELMKALPSSDPRSFVQQANIHCAYCDGAYSQVGFPNLDLQVHNSWLF  210

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+ERILG LI DPTF LPFWN+D P GM  PSI  D    LYD+ R  SH 
Sbjct  211   FPFHRWYLYFYERILGSLINDPTFALPFWNYDSPNGMQLPSIYADSTSPLYDKLRTASHQ  270

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PPT++DL Y   D +     RI++NL  MY+QM +N  T+ LFLG  YR+GD+ +PGAGS
Sbjct  271   PPTLIDLNYDDVDVDDDANGRISSNLTTMYRQMVSNGKTSSLFLGSSYRAGDEPDPGAGS  330

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +EN PH P+HRW GD  + N E+MG FY+A RD  F+ HH+N+DR W+IW+ LG  G+++
Sbjct  331   IENVPHGPVHRWSGDNTQPNFENMGVFYAAARDPIFFSHHSNIDRFWSIWKTLG--GKRK  388

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP-------  599
             +F D DW+ + FLFY+EN   V+V+V DC++ +++GY Y+  ++PW+N+KP P       
Sbjct  389   DFKDKDWLESEFLFYDENKNLVKVKVKDCLDTKKLGYVYQDVDIPWLNAKPKPCRKNIQK  448

Query  598   -------------KPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekele  458
                          + R  ++  RS   YV    P+ LD VV   V RPKK+R+K+EKE E
Sbjct  449   NVEVAQGNFFGIGEARASEINSRS---YVTC--PLVLDNVVSTIVKRPKKSRSKKEKEEE  503

Query  457   eeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTS--  284
             EE+L+IEGIE   +   KFDV++NDED+        EFAGSF ++PH   + +K +T+  
Sbjct  504   EEVLVIEGIEFDKSLGVKFDVFINDEDDKVIKPINTEFAGSFVNVPHSSHDHKKKKTNSC  563

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             L +GL + +EDLGAEDDD+++VTL P  G G+V I NIKIE
Sbjct  564   LRVGLTDLLEDLGAEDDDSIVVTLVPRYGKGIVKIRNIKIE  604



>gb|ABK62804.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   481 bits (1239),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 274/552 (50%), Positives = 361/552 (65%), Gaps = 32/552 (6%)
 Frame = -1

Query  1765  RRLKVLCNAAHGGDSKIDRRDVIlglgglyg----aanlpaAMAGPIEAPEVSKCVVPPT  1598
             RRL + C A   G  ++DRR+V+LGLGG             A+A PI+AP++S C  P  
Sbjct  40    RRLSISCEAT--GGRRVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDLSNCQTPA-  96

Query  1597  DLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALP  1418
              LP      NCCP       D++LP  S + +RVRPA H +D +Y  K+ +AV +MK LP
Sbjct  97    -LPNTPPDTNCCPTPGTGITDFELPPAS-SPLRVRPAAHLVDAEYLAKYERAVALMKQLP  154

Query  1417  ADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIR  1238
             ADDPRSF QQ  VHCAYC+ AYDQVGFPD+E+Q+HN WLFFP+HR+YLYF ERILGKLI 
Sbjct  155   ADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFFPWHRFYLYFHERILGKLIG  214

Query  1237  DPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLE  1058
             D TF LPFWNWD PAGM  P I  +R+  LYDE R+ +H PP +VDL Y G D      +
Sbjct  215   DDTFALPFWNWDAPAGMKLPVIYANRSSPLYDERRDPAHQPPVLVDLDYSGTDANIPRDQ  274

Query  1057  RITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKN  878
             +I  NL +MY+QM +NA    LFLG+PYR+GD+ +PGAGS+EN PH P+H W GDPR+ N
Sbjct  275   QIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSVENVPHGPVHNWTGDPRQPN  334

Query  877   GEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQ  698
             GEDMGNFYSA RD  F+ HH N+DR+W +W+ L  R    +FTD DW++A FLFY+E A+
Sbjct  335   GEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPSNTDFTDPDWLDAGFLFYDEEAR  392

Query  697   PVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrv  518
             PVRVRV DC++   + Y Y+   LPW+N++P       K +  + AP      P TLDR 
Sbjct  393   PVRVRVRDCLDPAALRYTYQDVGLPWLNARPA------KASGGTPAPATTGTLPATLDRT  446

Query  517   vrvkvprpkknrtkeekeleeeilliegiEV--QANQYTKFDVYLNDEDEPDGGYD----  356
             +RV V RP+ +R++ EK+ EEE+L++EGIE+    N++ KFDV +N   EP+GG      
Sbjct  447   IRVTVTRPRVSRSRREKDEEEEVLVVEGIEIADHFNKFVKFDVLVN---EPEGGVGGTPA  503

Query  355   --KAEFAGSFAHLPH--RQKNVEK--IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGG  194
                   AGSFAH PH  R + + K  ++T    G+ + M+D+GA+ D TV+V+L P  GG
Sbjct  504   TATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGADGDQTVVVSLVPRCGG  563

Query  193   GVVTIDNIKIEY  158
              +VTI  + I Y
Sbjct  564   DLVTIGGVSISY  575



>ref|XP_006594327.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=670

 Score =   484 bits (1247),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 268/518 (52%), Positives = 354/518 (68%), Gaps = 26/518 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A PI  P++  C   P DL  GA   NCCPP +   +D++LPS S A +RVRPA H ++
Sbjct  154   IAAPILPPDLKTCG--PPDLATGAKPVNCCPPISSTIIDFKLPS-SGAPLRVRPAAHLVN  210

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ +A++ MKAL  +DPR+FTQQA VHCAYC+GAY QVGFP++++QVHN WLFFP
Sbjct  211   DVYIAKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGFPNLDLQVHNCWLFFP  270

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIP-AGMVFPSILNDRNVSLYDENRNQSHLP  1115
             +HRWYLYF+ERILG LI DPTF LPFWNWD P  GM  PS   D+N  LYD  RN +H P
Sbjct  271   YHRWYLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDKNSPLYDPLRNLNHQP  330

Query  1114  PTIVDLGYQGKD------TEATDL-ERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKK  956
             P ++DL Y  +D      +E+ D  E+I +NL++MY+ + +N     LFLG PYR+GD+ 
Sbjct  331   PVLIDLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKLPRLFLGSPYRAGDEP  390

Query  955   NPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLG  776
              PGAGS+EN PH P+H W GD R  N E+MG FYSA RD  F+ HHANVDRMW+IW+ + 
Sbjct  391   EPGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFFSHHANVDRMWSIWKTIP  450

Query  775   GRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK  596
             G G++R+FTD DW+ ++F FY+EN   VRV+V D ++ +++GY Y+  ++PW+ +KP PK
Sbjct  451   G-GKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLKNKPKPK  509

Query  595   -PRRRKLALRS-----AAPYVATV-----FPVTLDrvvrvkvprpkknrtkeekeleeei  449
               + +KLAL       AA  V T      FP+TLD  V   V RPK  R+KEEKE EEE+
Sbjct  510   RSKAKKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKRPKLLRSKEEKEEEEEV  569

Query  448   lliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR--QKNVEKIRTSLSL  275
             L+I+GIE   N+  KFDV++NDED+        EFAGSF  +PH    KN +KI+T   +
Sbjct  570   LVIDGIEFDRNKAVKFDVFINDEDDKVITPSNTEFAGSFVSVPHSHVHKN-KKIKTCFRV  628

Query  274   GLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             GL + +EDL AE+DD++LVTL P  G G+VTI +IKIE
Sbjct  629   GLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKIE  666



>ref|XP_008364152.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08583.1| polyphenol oxidase IVa [Malus domestica]
Length=587

 Score =   481 bits (1239),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 257/544 (47%), Positives = 350/544 (64%), Gaps = 21/544 (4%)
 Frame = -1

Query  1756  KVLCNAAHG-------GDSKIDRRDVIlglgg--lygaanlpaAMAGPIEAPEVSKCVVP  1604
             +V C A  G       G +++DRR++++GLG   LY AA    A A P+ AP+++ C   
Sbjct  48    RVRCKATKGDNDNLDQGLARLDRRNMLIGLGTGGLYSAAGNSFAFAAPVSAPDLTTC--G  105

Query  1603  PTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKA  1424
             P D P G+ +D CCPP     +D++LP   P   R+       +  Y  K+ KA+E+M+A
Sbjct  106   PADKPDGSTID-CCPPITTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAKYKKAIELMRA  164

Query  1423  LPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKL  1244
             LP DDPRS  QQAKVHC+YC+G Y QVG+ D+EIQVH  WLFFPFHRWYLYF+E+I+G+L
Sbjct  165   LPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWYLYFYEKIMGEL  224

Query  1243  IRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATD  1064
             I DPTF LPFWNWD PAGM  P I  + + SLYD+NRN +H PP ++DL Y G D +  D
Sbjct  225   IGDPTFALPFWNWDAPAGMYIPEIFTBTSSSLYDQNRNTAHQPPKLLDLNYGGTDDDVDD  284

Query  1063  LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRR  884
               RI  NL  MY+QM + A +  LF G+PY +GD+ +PGAG++E +PH  IH WVGDP +
Sbjct  285   ATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAGNIETTPHNNIHLWVGDPTQ  344

Query  883   KNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLFYNE  707
              NGEDMG FYSAGRD  FY HH+NVDRMW+I++ +LGG     +    DW++A FLFY+E
Sbjct  345   TNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGT----DIEXTDWLDAXFLFYDE  400

Query  706   NAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVT  530
                 VRV+V D ++ +++GY Y E   +PW+ SKP  +    K     ++  + T FP T
Sbjct  401   KKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNKRKATVSSSDLTTTFPAT  460

Query  529   L-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
             L D +           RT  +K+  +E+L+I+GIE   N+  KFDVY+ND+ E   G DK
Sbjct  461   LSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVKFDVYVNDDAESLAGKDK  520

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
             +EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D +++VTL P VG G +TI  
Sbjct  521   SEFAGSFVHVPHKHK--KNIKTNLRLSIMSLLEELDAETDXSLVVTLVPKVGKGPITIGG  578

Query  172   IKIE  161
               IE
Sbjct  579   FSIE  582



>gb|AAG21983.1|AF263611_1 polyphenol oxidase PPO1 [Populus trichocarpa x Populus deltoides]
Length=563

 Score =   480 bits (1236),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 259/539 (48%), Positives = 358/539 (66%), Gaps = 13/539 (2%)
 Frame = -1

Query  1756  KVLCNAAHGGDSKIDRRDVIlgl--gglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAG  1583
             +V C A     +   RRDV++GL             A A PI  P+++KC +   DLP  
Sbjct  29    RVSCKATDDTQNPPTRRDVLIGLGGLYSATNLADRTAFAKPITPPDLTKCEL--VDLPNP  86

Query  1582  ADVDNCCPPTAGRYLDYQLPS-FSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDP  1406
              +  NCC P   + +D++ PS FSP  +R R A H +D  Y  K+A+A+ +MK+LP +DP
Sbjct  87    ENPSNCCTPLPKKIIDFRPPSPFSP--LRTRRAAHLVDEDYVAKYAEAISLMKSLPENDP  144

Query  1405  RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTF  1226
             R+F QQA VHCAYCNGAY+QVGFP +EI VH+ W FFP+HR+YLYF+ERILGKLI DPTF
Sbjct  145   RNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWFFFPWHRYYLYFYERILGKLINDPTF  204

Query  1225  GLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERI-T  1049
              LPFWNWD P+GM  P I  D    LYD+ R+Q+H PP ++DL Y   D   T+  ++ +
Sbjct  205   ALPFWNWDSPSGMQMPYIFTDPKSPLYDQFRDQNHQPPILLDLDYGAGDPNPTNANQLYS  264

Query  1048  NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGED  869
             +NL +MYKQM + A    LF GK YR+G+  +PGAG++E +PH  IHRW GDP ++N ED
Sbjct  265   SNLTVMYKQMVSGAAKPTLFFGKSYRAGEDTSPGAGTIETTPHNNIHRWTGDPTQENNED  324

Query  868   MGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVR  689
             MGNFYSA RD  F+CHH+NVDRMWTIW+ + G G +R+ +D DW+N+ FLFYNENA+ VR
Sbjct  325   MGNFYSAARDPIFFCHHSNVDRMWTIWKTIPG-GTRRDISDPDWLNSEFLFYNENAELVR  383

Query  688   VRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrv  509
              +V DC++N  + Y Y+   +PW+ SKP+P+   +K A    A    T FP+ LD+ +  
Sbjct  384   CKVSDCLDNTGLRYTYQNVEIPWLESKPIPRRLGKKAAETKTALTPITAFPLVLDKTIVT  443

Query  508   kvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
              V RPKK+R+++EKE E+E+L+IEGIE    ++ KFDV++ND+ E     +  EFAGSF 
Sbjct  444   VVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGKFVKFDVFINDDVEMPSKPENTEFAGSFV  503

Query  328   HLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAP--NVGGGVVTIDNIKIEY  158
             ++ H  K+ +K +T L LG+ E +EDL ++ DD+++V L P  N     V I  +KIE+
Sbjct  504   NVSH--KHAKKSKTRLILGITELLEDLESDGDDSIVVALVPRSNSVSDPVVISGVKIEF  560



>ref|NP_001268045.1| polyphenol oxidase, chloroplastic [Vitis vinifera]
 gb|AAB41022.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   481 bits (1239),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 292/613 (48%), Positives = 383/613 (62%), Gaps = 50/613 (8%)
 Frame = -1

Query  1891  YTAQKETPMASLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRL-----KVLCNAAHG-  1730
             +TA   T   S  PP   + LF R      SH+    PV  NR       KV CN+A+G 
Sbjct  11    FTAIANTTNISAFPP---SPLFQRA-----SHV----PVARNRSRRFAPSKVSCNSANGD  58

Query  1729  ------------GDSKIDRRDVI-----lglgglygaanlpaAMAGPIEAPEVSKCVVPP  1601
                            K+DRR+V+     L        A  P A   PI+AP++SKC    
Sbjct  59    PNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--  116

Query  1600  TDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKAL  1421
               +P G    NCCPP   + +D+QLPS S + MR RPA H +  +Y  K+ KA+E+ KAL
Sbjct  117   ATVPDGVTPTNCCPPVTTKIIDFQLPS-SGSPMRTRPAAHLVSKEYLAKYKKAIELQKAL  175

Query  1420  PADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLI  1241
             P DDPRSF QQA VHC YC GAYDQVG+ D+E+QVH SWLF PFHR+YLYF ERIL KLI
Sbjct  176   PDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASWLFLPFHRYYLYFNERILAKLI  235

Query  1240  RDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDL  1061
              DPT  L +W WD P GM  P+I      SLYDE RN  HLPPT++DL Y G +    D 
Sbjct  236   DDPTIALAYWAWDNPDGMYMPTIYASSPSSLYDEKRNAKHLPPTVIDLDYDGTEPTIPDD  295

Query  1060  ERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRK  881
             E  T+NLA+MYKQ+ + A T +LFLG PYR+GD  +PGAG++E+ PH  +H+W G    K
Sbjct  296   ELKTDNLAIMYKQIVSGATTPKLFLGYPYRAGDAIDPGAGTLEHVPHNIVHKWTG-LADK  354

Query  880   NGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENA  701
               EDMGNFY+AGRD  F+ HHANVDRMW IW+ +GG+ RK +FTD DW++A+F+FY+EN 
Sbjct  355   PSEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGKNRK-DFTDTDWLDATFVFYDENK  413

Query  700   QPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV-------  542
             Q V+V+V DCV+  ++ Y+Y+   +PW+  K   K +    + +S     A +       
Sbjct  414   QLVKVKVSDCVDTSKLRYQYQDIPIPWLPKKTKAKAKTTTKSSKSGVAKAAELPKTTISS  473

Query  541   ---FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEP  371
                FP  L+ V+RV+VPRPKK+R+K+EKE EEE+LLI+GIE+    + KFDVY+NDED  
Sbjct  474   IGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIKGIELDRENFVKFDVYINDEDYS  533

Query  370   DGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGG  191
                   +EFAGSF ++PH+     K +T+L   +NE +EDLGAEDD++V+VT+ P  GG 
Sbjct  534   VSRPKNSEFAGSFVNVPHKHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGD  593

Query  190   VVTIDNIKIEYGS  152
              VTI  I+IE+ S
Sbjct  594   DVTIGGIEIEFVS  606



>ref|XP_008364151.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=582

 Score =   480 bits (1236),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/502 (49%), Positives = 333/502 (66%), Gaps = 16/502 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL-  1475
              A P+ AP+++ C   P + P G+ +D CCPPT    +D++LP   P  +R RPA   + 
Sbjct  87    FAAPVSAPDLTTC--GPANKPDGSTID-CCPPTTTTIIDFELPDSGP--LRTRPAAQDVA  141

Query  1474  -DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
              D +Y  K+ KAVE+M+ALP DDPRS  QQA VHC+YC+G Y QVG+ D+EIQVH  WLF
Sbjct  142   NDPEYLAKYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLF  201

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+E+I+G+LI DPTF LPFWNWD PAGM  P I  D + SLYD+ RN +H 
Sbjct  202   FPFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFIDTSSSLYDQYRNAAHQ  261

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PP ++DL Y G D +  D  RI  NL  MYKQM +NA +  LF G+PY +GD+ +PGAG+
Sbjct  262   PPKLLDLNYGGTDDDVDDATRIKENLTTMYKQMVSNATSHRLFYGEPYSAGDEPSPGAGN  321

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRK  761
             +E +PH  IH W GDP + NGEDMG FYSA RD  FY HH+NVDRMW I++ +LGG    
Sbjct  322   IETTPHNNIHLWAGDPTQTNGEDMGTFYSAARDPLFYSHHSNVDRMWXIYKDKLGGT---  378

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRR  584
              +  + DW++A FLFY+E    VRV+V D ++ +++GY Y E  ++PW+ SKP  +    
Sbjct  379   -DIENTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDENVSIPWLESKPTTRKSTN  437

Query  583   KLALRSAAPYVATVFPVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYT  407
             K     ++  ++T FP TL D +           RT  +K+ ++E+L+I+GIE   N+  
Sbjct  438   KRKAXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETV  497

Query  406   KFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDT  227
             KFDVY+ND+ +   G DK+EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D++
Sbjct  498   KFDVYVNDDADSLAGKDKSEFAGSFVHVPHKHK--KNIKTNLRLSITSLLEELDAETDNS  555

Query  226   VLVTLAPNVGGGVVTIDNIKIE  161
             ++VTL P VG G +TI    IE
Sbjct  556   LVVTLVPKVGKGPITIGGFSIE  577



>gb|AFO55218.1| chloroplast polyphenol oxidase II [Eriobotrya japonica]
Length=576

 Score =   480 bits (1235),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 254/546 (47%), Positives = 349/546 (64%), Gaps = 25/546 (5%)
 Frame = -1

Query  1756  KVLCNAAHG-------GDSKIDRRDVIlglgglygaanlpa--AMAGPIEAPEVSKCVVP  1604
             +V C A  G       G +++DRR++++GLG            A A P+ AP+++ C   
Sbjct  37    RVRCKATKGDNDNLDQGPARLDRRNMLIGLGAGGLYGAAGNPFAFAAPVSAPDLTTC--G  94

Query  1603  PTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL--DGKYKEKFAKAVEMM  1430
             P D P G+ +D CCPPT    +D++LP   P  +R RPA   +  D  Y  K+ KA+++M
Sbjct  95    PADKPDGSTID-CCPPTTTTIIDFKLPDSGP--LRTRPAAQNVAKDPAYLAKYKKAIQLM  151

Query  1429  KALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILG  1250
             + LP DDPRS  QQA VHC+YC+G Y QVG+ D+EIQVH  WLFFPFHRWYLYF+E+I+G
Sbjct  152   RELPDDDPRSHAQQAMVHCSYCDGGYPQVGYTDLEIQVHYCWLFFPFHRWYLYFYEKIMG  211

Query  1249  KLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEA  1070
             +LI DPTF LPFWNWD PAGM  P I  D + SLYD+ RN +H PP ++DL Y G D + 
Sbjct  212   ELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDLNYSGTDDDV  271

Query  1069  TDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDP  890
              D  RIT NL  MY+QM + A +  LF G+PY +GD  +PGAG++E+ PH  IH W GDP
Sbjct  272   DDATRITENLTTMYQQMVSKAASHRLFYGEPYSAGDDPSPGAGNIESIPHNNIHFWTGDP  331

Query  889   RRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLFY  713
              + NGEDMG FYSAGRD  FY HH+NVDRMW+I++ +LGG   ++     DW++  FLFY
Sbjct  332   TQTNGEDMGAFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKT----DWLDTEFLFY  387

Query  712   NENAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYVATVFP  536
             +E    VRV+V D ++  ++GY Y E  ++PW+ SKP  +    K     ++  + T FP
Sbjct  388   DEKKNLVRVKVRDSLDTTKLGYVYDENVSIPWLESKPTARKSTNKRKAAVSSSDLTTTFP  447

Query  535   VTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGY  359
              TL D +           RT  +K+ ++E+L+I+GIE   N+  KFDVY+ND+ +   G 
Sbjct  448   ATLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVYVNDDADSLAGK  507

Query  358   DKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTI  179
             DK+EFAGSF H+PH+ K  + I+T+L L +   +E+LGAE D +++VTL P VG G +TI
Sbjct  508   DKSEFAGSFVHVPHKHK--KNIKTNLRLSITSLLEELGAETDSSLVVTLVPKVGKGPITI  565

Query  178   DNIKIE  161
                 IE
Sbjct  566   GGFSIE  571



>ref|XP_002316852.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
 gb|EEE97464.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
Length=563

 Score =   479 bits (1232),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 259/539 (48%), Positives = 357/539 (66%), Gaps = 13/539 (2%)
 Frame = -1

Query  1756  KVLCNAAHGGDSKIDRRDVIlgl--gglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAG  1583
             +V C A     +   RRDV++GL             A A PI  P+++KC +   DLP  
Sbjct  29    RVSCKATDDTQNPPTRRDVLIGLGGLYSATNLADRTAFAKPITPPDLTKCEL--VDLPNP  86

Query  1582  ADVDNCCPPTAGRYLDYQLPS-FSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDP  1406
              +  NCC P   + +D++ PS FSP  +R R A H +D  Y  K+A+A+ +MK+LP DDP
Sbjct  87    ENPSNCCTPLPKKIIDFRPPSPFSP--LRTRRAAHLVDEDYVAKYAEAISLMKSLPEDDP  144

Query  1405  RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTF  1226
             R+F QQA VHCAYCNGAY+QVGFP +EI VH+ W FFP+HR+YLYF+ERILGKLI DPTF
Sbjct  145   RNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWFFFPWHRYYLYFYERILGKLINDPTF  204

Query  1225  GLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERI-T  1049
              LPFWNWD P+GM  P I  D    LYD+ R+Q+H PP ++DL Y       T+  ++ +
Sbjct  205   ALPFWNWDSPSGMQMPYIFTDPKSPLYDQFRDQNHQPPILLDLDYGAGYPNPTNANQLYS  264

Query  1048  NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGED  869
             +NL +MYKQM + A    LF GK YR+G+  +PGAG++E +PH  IHRW GDP ++N ED
Sbjct  265   SNLTVMYKQMVSGAAKPTLFFGKSYRAGEDTSPGAGTIETTPHNNIHRWTGDPTQENNED  324

Query  868   MGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVR  689
             MGNFYSA RD  F+CHH+NVDRMWTIW+ + G G +R+ +D DW+N+ FLFYNENA+ VR
Sbjct  325   MGNFYSAARDPIFFCHHSNVDRMWTIWKTIPG-GTRRDISDPDWLNSEFLFYNENAELVR  383

Query  688   VRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrv  509
              +V DC++N  + Y Y+   +PW+ SKP+P+   +K A    A    T FP+ LD+ +  
Sbjct  384   CKVSDCLDNTGLRYTYQNVEIPWLESKPIPRRLGKKAAETKTALTPITAFPLVLDKTIVT  443

Query  508   kvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
              V RPKK+R+++EKE E+E+L+IEGIE    ++ KFDV++ND+ E     +  EFAGSF 
Sbjct  444   VVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGKFVKFDVFINDDVEMPSKPENTEFAGSFV  503

Query  328   HLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAP--NVGGGVVTIDNIKIEY  158
             ++ H  K+ +K +T L LG+ E +EDL ++ DD+++V L P  N     V I  +KIE+
Sbjct  504   NVSH--KHAKKSKTRLILGITELLEDLESDGDDSIVVALVPRSNSVSDPVVISGVKIEF  560



>gb|AAT75166.1| polyphenol oxidase [Camellia sinensis]
Length=575

 Score =   479 bits (1232),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 246/510 (48%), Positives = 331/510 (65%), Gaps = 39/510 (8%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+ AP++SKC     DLPA A   NCCPP   + ++++LP  S   +RVRPA H  D
Sbjct  95    LAAPVTAPDLSKCGA--ADLPADAKPTNCCPPKTNKIIEFKLPPPS-NILRVRPAAHLAD  151

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              KY  KF+KA+++MK+LP DDPRSF QQ+ +HCAYC GAY QVGFP  E+QVHNSWLFFP
Sbjct  152   EKYIAKFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFP  211

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILG L+ DP F +PFWNWD PAGM  P++  D N  LY+  R+  H PP
Sbjct  212   FHRFYLYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPP  271

Query  1111  TIVDLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             T++DL Y   D +  D E+    NL +MY+Q+     T  LFLG  YR+GD  +PGAGS+
Sbjct  272   TLIDLDYNLTDPKNVDEEKQKLRNLTIMYRQVVAGGKTPRLFLGSSYRAGDDPDPGAGSL  331

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDR+WT+W+ LG  G++ +
Sbjct  332   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHSNVDRIWTVWKTLG--GKRND  389

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA  575
             F D DW+N+ F FY+ENAQ V V+V + +++++   +     +PW+N++P P+       
Sbjct  390   FKDPDWLNSEFTFYDENAQLVTVKVKESLDHRKR-LRLPSVEIPWLNTRPSPRISNFFRK  448

Query  574   LRSAAPY---------VATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             ++S A            A VFP  +D                       E++++EGIEV+
Sbjct  449   IKSKAGIAMATETLDSAAIVFPRKID-----------------------EVVVVEGIEVE  485

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGA  242
              +   KFDV++NDEDE   G +K EFAGSF ++P + K+ +KIRT L LG+ E +EDL A
Sbjct  486   RDVSVKFDVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTGLRLGITELLEDLEA  545

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             E+D++VLVTL P  G   VTI  +KIE+ S
Sbjct  546   ENDESVLVTLVPRYGSDAVTIGGVKIEFDS  575



>gb|ADG85002.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   479 bits (1232),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 270/552 (49%), Positives = 362/552 (66%), Gaps = 32/552 (6%)
 Frame = -1

Query  1765  RRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlp----aAMAGPIEAPEVSKCVVPPT  1598
             RRL + C AA GG   +DRR+V+LGLG    A         A+A PI+AP++  C  P  
Sbjct  40    RRLSISCEAAGGG--SVDRREVLLGLGSAAAAGLATDQGRGAIAAPIQAPDLRNCQTPA-  96

Query  1597  DLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALP  1418
              LP      NCCP       D++LP  S + +RVRPA H +D +Y  K+ +AV +MK LP
Sbjct  97    -LPNTPPDTNCCPTPGTSITDFELPPAS-SPLRVRPAAHLVDAEYLAKYERAVALMKQLP  154

Query  1417  ADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIR  1238
             ADDPRSF QQ  VHCAYC+ A+DQVGFPD+E+Q+HN WLFFP+HR+Y+YF ERILGKLI 
Sbjct  155   ADDPRSFEQQWHVHCAYCDAAFDQVGFPDLELQIHNCWLFFPWHRFYVYFHERILGKLIG  214

Query  1237  DPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLE  1058
             D TF LPFWNWD PAGM  P+I  +R+  LYDE R+ +H PP +VDL   G D      +
Sbjct  215   DDTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPPVLVDLDSSGTDANIPRDQ  274

Query  1057  RITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKN  878
             +I  NL +MY+QM +NA    LFLG+PYR+GD+ +PGAGS+EN PH  +H W GDPR+ N
Sbjct  275   QIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSVENVPHGTVHGWTGDPRQPN  334

Query  877   GEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQ  698
             GEDMGNFYSA RD  F+ HH N+DR+W +W+ L  R    +FTD DW++A+FLFY+E A+
Sbjct  335   GEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPSNADFTDPDWLDAAFLFYDEEAR  392

Query  697   PVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrv  518
             PVRVRV DC++   + Y Y+   LPW+N++P       K +  + AP   +  P TLDR 
Sbjct  393   PVRVRVRDCLDTAALRYTYQDVGLPWLNARPA------KASGGTPAPATTSTLPATLDRT  446

Query  517   vrvkvprpkknrtkeekeleeeilliegiEV--QANQYTKFDVYLNDEDEPDGGYDKAE-  347
             +RV V RP+ +R++ EKE EEE++++EGIE+    N++ KFDV +N   EP+GG      
Sbjct  447   IRVTVTRPRVSRSRREKEDEEEVVVVEGIEIADHFNKFIKFDVLVN---EPEGGVGSTPA  503

Query  346   -----FAGSFAHLPH--RQKNVEK--IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGG  194
                   AGSFAH PH  R + + K  ++T    G+ + M+D+GA+ D TV+V+L P  GG
Sbjct  504   TATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGADGDQTVVVSLVPRCGG  563

Query  193   GVVTIDNIKIEY  158
              +VT+  + I Y
Sbjct  564   ELVTVGGVSISY  575



>ref|XP_008371330.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
Length=587

 Score =   479 bits (1232),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 256/544 (47%), Positives = 349/544 (64%), Gaps = 21/544 (4%)
 Frame = -1

Query  1756  KVLCNAAHG-------GDSKIDRRDVIlglgg--lygaanlpaAMAGPIEAPEVSKCVVP  1604
             +V C A  G       G +++DRR++++GLG   LY AA    A A P+ AP+++ C   
Sbjct  48    RVRCKATKGDNDNLDQGLARLDRRNMLIGLGTGGLYSAAGNSFAFAAPVSAPDLTTC--G  105

Query  1603  PTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKA  1424
             P D P G+ +D CCPP     +D++LP   P   R+       +  Y  K+ KA+E+M+A
Sbjct  106   PADKPDGSTID-CCPPITTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAKYKKAIELMRA  164

Query  1423  LPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKL  1244
             LP DDPRS  QQAKVHC+YC+G Y QVG+ D+EIQVH  WLFFPFHRWYLYF+E+I+G+L
Sbjct  165   LPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWYLYFYEKIMGEL  224

Query  1243  IRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATD  1064
             I DPTF LPFWNWD PAGM  P I  + + SLYD+NRN +H PP ++DL Y G D +  D
Sbjct  225   IGDPTFALPFWNWDAPAGMYIPEIFTBTSSSLYDQNRNTAHQPPKLLDLNYGGTDDDVDD  284

Query  1063  LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRR  884
               RI  NL  MY+QM + A +  LF G+PY +GD+ +PGAG++E +PH  IH WVGDP +
Sbjct  285   ATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAGNIETTPHNNIHLWVGDPTQ  344

Query  883   KNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLFYNE  707
              NGEDMG FYSAGRD   Y HH+NVDRMW+I++ +LGG     +    DW++A FLFY+E
Sbjct  345   TNGEDMGTFYSAGRDPLXYSHHSNVDRMWSIYKDKLGGT----DIEXTDWLDAEFLFYDE  400

Query  706   NAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVT  530
                 VRV+V D ++ +++GY Y E   +PW+ SKP  +    K     ++  + T FP T
Sbjct  401   KKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNKRKATVSSSDLTTTFPAT  460

Query  529   L-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
             L D +           RT  +K+  +E+L+I+GIE   N+  KFDVY+ND+ E   G DK
Sbjct  461   LSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVKFDVYVNDDAESLAGKDK  520

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
             +EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D +++VTL P VG G +TI  
Sbjct  521   SEFAGSFVHVPHKHK--KNIKTNLRLSIMSLLEELDAETDSSLVVTLVPKVGKGPITIGG  578

Query  172   IKIE  161
               IE
Sbjct  579   FSIE  582



>ref|XP_008225030.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=586

 Score =   479 bits (1232),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 258/515 (50%), Positives = 347/515 (67%), Gaps = 27/515 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P++++C   P DLP+GA   NCCPPT  + +D++LP   P+ +RVRPA   +D
Sbjct  80    FANPISPPDLTQC--GPADLPSGALPTNCCPPTYPKIIDFKLPP--PSRLRVRPAAQTVD  135

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K++KA+ +MKALP DDPR+FTQQA VHCAYC+GAYDQVGFPD+E+Q+HN WLFFP
Sbjct  136   QSYIDKYSKAIALMKALPDDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQIHNCWLFFP  195

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERIL KLI DPTF LPFWNWD PAGM  P++  + + SLYDE R  +H PP
Sbjct  196   FHRYYLYFYERILAKLIDDPTFALPFWNWDAPAGMQLPALYANSDSSLYDELRAAAHQPP  255

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL + G D +     R+  N      Q   NA    LF G PYR+G + +PGAGS+E
Sbjct  256   TLVDLDFNGTDEKVNREARVNTNRG----QRGANARNPLLFFGWPYRAGTEADPGAGSVE  311

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
               PH P+H W GD  + N EDMGNFYSA RD  F+ HH+NVDRMW+IW+ LG +   ++ 
Sbjct  312   AIPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFAHHSNVDRMWSIWKNLGTKN--KDL  369

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRK---  581
             +D DW+++ FLFYNENA+ VRV+V DC++++++GY YE   +PW+ S+P P+  +++   
Sbjct  370   SDKDWLDSGFLFYNENAELVRVKVRDCLDSRKLGYVYEDVEIPWLKSRPTPRRTKQQRKA  429

Query  580   --------LALRSAAPYV-ATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegi  431
                         S    V ++ FP+ L+  +   V R  +K R K+EKE EEEIL+IEGI
Sbjct  430   KAVGVAKAAGTTSLGKLVKSSEFPIQLESKISTVVSRPRQKKRNKKEKEDEEEILVIEGI  489

Query  430   EVQANQYTKFDVYLN---DEDEPDGGYDKAEFAGSFAHLPHRQKNVE-KIRTSLSLGLNE  263
             E + N   KFDVY+N   D+D+   G DK+EFAGSF  +PH  K    K +  L LGL +
Sbjct  490   EYEKNAVVKFDVYMNDVGDDDDVLSGPDKSEFAGSFVSVPHTHKEKRNKSKGCLRLGLTD  549

Query  262   AMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
              +EDL AEDD++++VTL P  G   VTI +I+IE+
Sbjct  550   LLEDLEAEDDESIVVTLVPRFGAQTVTIGSIRIEF  584



>gb|AAK53414.1|AF368291_1 polyphenol oxidase [Populus tremuloides]
Length=563

 Score =   478 bits (1229),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 258/539 (48%), Positives = 358/539 (66%), Gaps = 13/539 (2%)
 Frame = -1

Query  1756  KVLCNAAHGGDSKIDRRDVIlgl--gglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAG  1583
             +V C A     +   RRDV++GL             A A PI +P+++ C +   DLP  
Sbjct  29    RVSCKATDDTQNPATRRDVLIGLGGLYSATNLADRTAYAKPITSPDLTNCKL--VDLPNP  86

Query  1582  ADVDNCCPPTAGRYLDYQLPS-FSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDP  1406
              +  +CC P   + +D++ PS FSP  +R R A H +D  Y  K+A+A+ +MK+LP DDP
Sbjct  87    ENPTDCCSPLPRKIIDFRPPSPFSP--LRTRRAAHLVDEDYVAKYAEAISLMKSLPEDDP  144

Query  1405  RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTF  1226
             R+F QQA VHCAYC+ AY+QVGFP +E+ VH  WLFFP+HR+YLYF+ERILGKLI DPTF
Sbjct  145   RNFYQQANVHCAYCDDAYEQVGFPKLELDVHFCWLFFPWHRYYLYFYERILGKLINDPTF  204

Query  1225  GLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERI-T  1049
              LPFWNWD P+GM  P I  D    LYD+ R+Q+H PP ++DL Y   D   T+  ++ +
Sbjct  205   ALPFWNWDSPSGMQMPYIFTDPKSPLYDQFRDQNHQPPVLLDLDYAAGDPNPTNANQVYS  264

Query  1048  NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGED  869
             +N  +MYKQM + A    LF GKPYR+GD   PGAG++E+SPH  IHRW GDP ++N ED
Sbjct  265   SNRRVMYKQMVSGAAKPTLFFGKPYRAGDDARPGAGTIESSPHNNIHRWTGDPTQENTED  324

Query  868   MGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVR  689
             MGNFYSA RD  F+CHH+NVDRMWTIW+ + G G +R+ TD DW+N+ FLFYNENA+ VR
Sbjct  325   MGNFYSAARDPIFFCHHSNVDRMWTIWKTIPG-GLRRDITDPDWLNSEFLFYNENAELVR  383

Query  688   VRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrv  509
              +V DC++N+++ Y Y+   +PW+ SKP+P+   +K A    A    T FP+ LD+ +  
Sbjct  384   CKVRDCLDNRRLRYTYQNVEIPWLKSKPIPRRLGKKAAETKTALTPITAFPLVLDKTIVT  443

Query  508   kvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
              V RPKK+R+++EKE E+E+L+IEGIE   +++ +FDV++ND+ E     +  EFAGSF 
Sbjct  444   VVSRPKKSRSRKEKEEEDEVLVIEGIEYDNDKFVRFDVFINDDLEIPSKPENTEFAGSFV  503

Query  328   HLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGG--GVVTIDNIKIEY  158
             ++ H  K  +K +T L LG+ E +EDL  + DD+++V L P   G    V I  +KIE+
Sbjct  504   NVSH--KRAKKSKTRLILGITELLEDLETDGDDSIVVALVPRSNGVSDPVVISGVKIEF  560



>gb|ABI96948.1| putative polyphenol oxidase [Sorbus californica]
Length=453

 Score =   473 bits (1218),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 247/456 (54%), Positives = 320/456 (70%), Gaps = 24/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+V NCCPP A + +D++LP+  PA +R+RP  H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPPGAEVTNCCPPPATKIIDFKLPA--PAKLRIRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFP
Sbjct  60    QAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +P+WNWD PAGM  P+I  D    LYD+ R+  H PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAIPYWNWDSPAGMPLPAIYADPKSPLYDKFRSAKHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL Y G +   +    I  NL +MY+QM +N+  A+LF G PYR+GD+ +PG GS+E
Sbjct  180   TLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP   PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPT--PRRAKVAL  355

Query  571   ---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                             S+     T FP++L   +   V R  +K R+K+ KE EEEIL+I
Sbjct  356   SKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             EGIE   +   KFDV++ND D+   G DK EFAGSF
Sbjct  416   EGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSF  451



>ref|XP_006347083.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum tuberosum]
Length=616

 Score =   479 bits (1233),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 276/578 (48%), Positives = 372/578 (64%), Gaps = 39/578 (7%)
 Frame = -1

Query  1825  SRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa---  1655
             S + I  +SH H  +P+ ++++   L N        IDRR+V+LGLGGLYGA+ L     
Sbjct  50    SCKTIDDNSHEHNNSPIDISKKNDSLNNM-------IDRRNVLLGLGGLYGASTLVGGLP  102

Query  1654  -AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHR  1478
              A+A P+  P+V+KC     DLP GA   NCCPP +G  +D+QLPS     +R RPA H 
Sbjct  103   FALAAPVNGPDVTKCGA--ADLPPGAAPVNCCPPMSGNIIDFQLPS--STALRTRPAAHS  158

Query  1477  LDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
             +D  Y EKF + +++MK LP DDPRSF QQA VHCAYC+GAYDQ+GFP+ E+QVH+SW+F
Sbjct  159   VDSAYIEKFNRGIQLMKQLPDDDPRSFKQQANVHCAYCDGAYDQLGFPNSELQVHSSWIF  218

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
              PFHR YLYFFERILG LI DPTF +PFWNWD P GM  P +  +   SLYD  R++ H 
Sbjct  219   LPFHRCYLYFFERILGSLINDPTFAMPFWNWDHPDGMRMPGLYTNSTSSLYDRLRDRRHQ  278

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PPT+VDL + G D   ++ ++ + NL  MY+QM +   T E FLG PYR+G     GAGS
Sbjct  279   PPTMVDLDFNGTDPNISNAQQTSQNLTNMYRQMVSLGRTPETFLGDPYRAGGVPG-GAGS  337

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +EN  H  +H W GD  + N E+MG+FYSA RD  FY HH+N+DR+WT+W+ LG  GR++
Sbjct  338   LENMAHGAVHVWTGDRTQANFENMGDFYSAARDPIFYAHHSNIDRLWTVWKTLG--GRRQ  395

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR---  587
             +FTD D++N SFLFY+E AQ VR+RV D +++ ++GY Y+    PWINS+P P+  R   
Sbjct  396   DFTDPDFLNTSFLFYDEKAQMVRIRVRDVLDSSKLGYVYQNVTNPWINSRPTPRVSRALS  455

Query  586   --RKLALRSAA---------PYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilli  440
               R+L    AA         P    +FP  LD V++V V RP K +  ++++ E+E +LI
Sbjct  456   SVRRLVEAKAADDNSNVMNFPRPKEIFPTKLDHVIKVMVKRPNKKKRNKKEKNEKEEILI  515

Query  439   eg-iEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR-----QKNVEKIRTSLS  278
                +EV+++ + KFDV +NDEDE     D AEF GSF ++PH      +KN  K +T L 
Sbjct  516   VEGLEVESDVFVKFDVLINDEDETLVSPDNAEFVGSFVNVPHHSHGKGEKN-SKRKTKLK  574

Query  277   LGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKI  164
             L + E +EDL AE+D+ VLVT  P  G G V I  +KI
Sbjct  575   LAITELLEDLDAENDENVLVTFVPKNGSGAVKIGGVKI  612



>gb|ACB12084.1| polyphenol oxidase [Triticum dicoccoides]
Length=577

 Score =   478 bits (1229),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 278/582 (48%), Positives = 369/582 (63%), Gaps = 36/582 (6%)
 Frame = -1

Query  1849  PRAPANL--FSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglggly  1676
             PR P +L   +RR +     LH+       RRL V C A   G  ++DRR+V+LGLGG  
Sbjct  12    PRMPCSLQTLARRNL--LRGLHLRKDARQPRRLSVSCEAT--GGCRVDRREVLLGLGGAA  67

Query  1675  gaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPA  1508
              A         A+A PI+AP++  C  P  +LP      NCCP       D+ LP  S +
Sbjct  68    AAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGTGITDFVLPPVS-S  124

Query  1507  TMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDI  1328
              +RVRPA H +D  Y  K+ +AV +MK LPADDPRSF QQ  VHCAYC+ AYDQVGFPD+
Sbjct  125   PLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDL  184

Query  1327  EIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSL  1148
             E+Q+HN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  DR+  L
Sbjct  185   ELQIHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYADRSSPL  244

Query  1147  YDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRS  968
             YDE R+ +H PP +VDL   G DT     ++I  NL +MY+QM +NA    LFLG+PYR+
Sbjct  245   YDERRDPAHQPPVLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRA  304

Query  967   GDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIW  788
             GD+ +PGAGS+EN PH  +H W GDPR+ N  DMGNF+SA RD  F+ HH N+DR+W +W
Sbjct  305   GDQPDPGAGSLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVW  364

Query  787   QQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSK  608
             + L  R    +FTD DW++A+FLFY+E A+PVRVRV DC++   + Y Y+   LPW+N++
Sbjct  365   RGL--RPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNAR  422

Query  607   PVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             P       K +  + AP      P TLD  +RV V RP+ +R++ EK+ EEE+L++EGIE
Sbjct  423   PA------KASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDEEEEVLVVEGIE  476

Query  427   V--QANQYTKFDVYLNDEDEPDGGYD------KAEFAGSFAHLPHRQKNVE----KIRTS  284
             +    N++ KFDV +N   EP+GG D          AGSFAH PH  +  E     ++T 
Sbjct  477   IADHFNKFIKFDVLVN---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTV  533

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                G+ + M+D+GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  534   ARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSISY  575



>gb|ABK62801.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   477 bits (1228),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 278/582 (48%), Positives = 369/582 (63%), Gaps = 36/582 (6%)
 Frame = -1

Query  1849  PRAPANL--FSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglggly  1676
             PR P +L   +RR +     LH+       RRL V C A   G  ++DRR+V+LGLGG  
Sbjct  12    PRMPCSLQTLARRNL--LRGLHLRKDARQPRRLSVSCEAT--GGCRVDRREVLLGLGGAA  67

Query  1675  gaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPA  1508
              A         A+A PI+AP++  C  P  +LP      NCCP       D+ LP  S +
Sbjct  68    AAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGTGITDFVLPPVS-S  124

Query  1507  TMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDI  1328
              +RVRPA H +D  Y  K+ +AV +MK LPADDPRSF QQ  VHCAYC+ AYDQVGFPD+
Sbjct  125   PLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDL  184

Query  1327  EIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSL  1148
             E+Q+HN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  DR+  L
Sbjct  185   ELQIHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYADRSSPL  244

Query  1147  YDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRS  968
             YDE R+ +H PP +VDL   G DT     ++I  NL +MY+QM +NA    LFLG+PYR+
Sbjct  245   YDERRDPAHQPPVLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRA  304

Query  967   GDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIW  788
             GD+ +PGAGS+EN PH  +H W GDPR+ N  DMGNF+SA RD  F+ HH N+DR+W +W
Sbjct  305   GDQPDPGAGSLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVW  364

Query  787   QQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSK  608
             + L  R    +FTD DW++A+FLFY+E A+PVRVRV DC++   + Y Y+   LPW+N++
Sbjct  365   RGL--RPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYMYQDVGLPWLNAR  422

Query  607   PVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             P       K +  + AP      P TLD  +RV V RP+ +R++ EK+ EEE+L++EGIE
Sbjct  423   PA------KASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDEEEEVLVVEGIE  476

Query  427   V--QANQYTKFDVYLNDEDEPDGGYD------KAEFAGSFAHLPHRQKNVE----KIRTS  284
             +    N++ KFDV +N   EP+GG D          AGSFAH PH  +  E     ++T 
Sbjct  477   IADHFNKFIKFDVLVN---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTV  533

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                G+ + M+D+GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  534   ARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSISY  575



>gb|ABI96926.1| putative polyphenol oxidase [Cercocarpus betuloides]
Length=455

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 239/458 (52%), Positives = 313/458 (68%), Gaps = 26/458 (6%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA   NCCPP A + +D++LPS  P  +RVRPA H +D
Sbjct  4     FAKPVAPPDVSKCGA--ADLPTGAQPTNCCPPVASKIIDFKLPS--PTPLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    KAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF E+ILG LI DPTF LPFWNWD PAGM  P+I  +    LYD+ R  +H PP
Sbjct  120   FHRYYLYFHEKILGSLIGDPTFALPFWNWDAPAGMPLPAIYANPKSPLYDKFRAANHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL + G +  A++  +I  NL +MY+QM +NA T +LF G PYR+GD+ +PG GS+E
Sbjct  180   TLVDLDFNGTEDAASNETQINANLKIMYRQMVSNAKTPQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDR+W+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD DW+++ FLFY+ENAQ VRV+V DC+E++ +GY Y+ AN+PW+ SKP   PRR K AL
Sbjct  298   TDTDWLDSGFLFYDENAQMVRVKVRDCLESKNLGYVYQDANIPWLESKPT--PRRVKAAL  355

Query  571   ---------------RSAAPYVA-TVFPVTLDrvvrvkvprpkknrtkeekeleeeilli  440
                             SA+  VA   FP+         V    K + + +KE E+E  ++
Sbjct  356   GKIAKKLHVAHAADNSSASKVVARAAFPIAKLDTKMSTVVARPKQKKRSKKEKEQEEEIL  415

Query  439   egiEVQANQ--YTKFDVYLNDEDEPDGGYDKAEFAGSF  332
                 ++ ++    KFDVY+NDED+   G DK+EFAGSF
Sbjct  416   VIEGIEFDRDVAVKFDVYVNDEDDLPSGPDKSEFAGSF  453



>gb|ABI96930.1| putative polyphenol oxidase [Crataegus monogyna]
Length=453

 Score =   472 bits (1215),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 246/456 (54%), Positives = 320/456 (70%), Gaps = 24/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+V NCCPP A + +D++LP+  PA +R+RPA H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPPGAEVTNCCPPPATKIIDFKLPA--PAKLRIRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ G+P++E+QVHNSWLFFP
Sbjct  60    KAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +PFWNWD P GM  P+I  D    LYD+ R+  H PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPAIYADPKSPLYDKFRSAKHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y G +   +    I  NL +MY+QM +N+  A+LF G PYR+GD+ +PG GS+E
Sbjct  180   TLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP   PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPT--PRRAKVAL  355

Query  571   ---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                             S+     T FP+ L   +   V R  +K R+K++KE EEEIL+I
Sbjct  356   SKIAKKLGVAHAAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKDKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             EGIE   +   KFDV++ND D+   G DK EFAGSF
Sbjct  416   EGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSF  451



>gb|AEY79824.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   477 bits (1227),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 278/582 (48%), Positives = 369/582 (63%), Gaps = 36/582 (6%)
 Frame = -1

Query  1849  PRAPANL--FSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglggly  1676
             PR P +L   +RR +     LH+       RRL V C A   G  ++DRR+V+LGLGG  
Sbjct  12    PRMPCSLQTLARRNL--LRGLHLRKDARQPRRLSVSCEAT--GGCRVDRREVLLGLGGAA  67

Query  1675  gaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPA  1508
              A         A+A PI+AP++  C  P  +LP      NCCP       D+ LP  S +
Sbjct  68    AAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGTGITDFVLPPAS-S  124

Query  1507  TMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDI  1328
              +RVRPA H +D  Y  K+ +AV +MK LPADDPRSF QQ  VHCAYC+ AYDQVGFPD+
Sbjct  125   PLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDL  184

Query  1327  EIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSL  1148
             E+Q+HN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  DR+  L
Sbjct  185   ELQIHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYADRSSPL  244

Query  1147  YDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRS  968
             YDE R+ +H PP +VDL   G DT     ++I  NL +MY+QM +NA    LFLG+PYR+
Sbjct  245   YDERRDPAHQPPVLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRA  304

Query  967   GDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIW  788
             GD+ +PGAGS+EN PH  +H W GDPR+ N  DMGNF+SA RD  F+ HH N+DR+W +W
Sbjct  305   GDQPDPGAGSLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVW  364

Query  787   QQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSK  608
             + L  R    +FTD DW++A+FLFY+E A+PVRVRV DC++   + Y Y+   LPW+N++
Sbjct  365   RGL--RPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNAR  422

Query  607   PVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             P       K +  + AP      P TLD  +RV V RP+ +R++ EK+ EEE+L++EGIE
Sbjct  423   PA------KASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDEEEEVLVVEGIE  476

Query  427   V--QANQYTKFDVYLNDEDEPDGGYD------KAEFAGSFAHLPHRQKNVE----KIRTS  284
             +    N++ KFDV +N   EP+GG D          AGSFAH PH  +  E     ++T 
Sbjct  477   IADHFNKFIKFDVLVN---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTV  533

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                G+ + M+D+GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  534   ARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSISY  575



>emb|CAN62983.1| hypothetical protein VITISV_035472 [Vitis vinifera]
Length=607

 Score =   478 bits (1229),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 284/596 (48%), Positives = 371/596 (62%), Gaps = 47/596 (8%)
 Frame = -1

Query  1840  PANLFSRRPIPTHSHLHILTPVVLNRRL-----KVLCNAAHG-------------GDSKI  1715
             P+ LF R      SH+    PV  NR       KV CN+A+G                K+
Sbjct  25    PSPLFQRA-----SHV----PVARNRSXRFAPSKVSCNSANGDPNSDSTSDVRETSSGKL  75

Query  1714  DRRDVI-----lglgglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTA  1550
             DRR+V+     L        A  P A   PI+AP++SKC      +P G    NCCPP  
Sbjct  76    DRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQAPDISKCGT--ATVPDGVTXTNCCPPVT  133

Query  1549  GRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCA  1370
              + + +QLPS S + MR RPA H +  +Y  K+ KA+E+ KALP DDPRSF QQA VHC 
Sbjct  134   TKJIXFQLPS-SDSPMRTRPAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCX  192

Query  1369  YCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAG  1190
             YC GAYDQVG+ D+E+QVH SWLF PFHR+YLYF ERIL KLI DPTF LP+W WD P G
Sbjct  193   YCQGAYDQVGYTDLELQVHASWLFLPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDG  252

Query  1189  MVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTN  1010
             M  P I      S YDE RN  HLPPT++DL Y G +    D E   +NLA+MYKQ+ + 
Sbjct  253   MYMPXIYASSPSSJYDEKRNAKHLPPTVIDLDYDGTEPTIPDDELKXDNLAIMYKQIVSG  312

Query  1009  AGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISF  830
             A T +LF G PYR+GD  +PGAG++E  PH  +H+W G    K  EDMGNFY+AGRD  F
Sbjct  313   ATTPKLFXGYPYRAGDAIDPGAGTLEXVPHNIVHKWTG-LADKPSEDMGNFYTAGRDPIF  371

Query  829   YCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMG  650
             + HHANVDRMW IW+ +GG+ RK +FTD DW++A+F+FY+EN Q V V+V DCV+  ++ 
Sbjct  372   FGHHANVDRMWNIWKTIGGKNRK-DFTDTDWLDATFVFYDENKQLVXVKVSDCVDTSKLR  430

Query  649   YKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATV----------FPVTLDrvvrvkvp  500
             Y+Y+   +PW+      K +    + +S     A +          FP  L+ V+RV+VP
Sbjct  431   YQYQDIPIPWLPKXTKAKAKTTTKSSKSGVAKAAELPKTTISSIXDFPKALNSVIRVEVP  490

Query  499   rpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLP  320
             RPKK+R+K+EKE EEE+LLI+GIE+    + KFDVY+NDED        +EFAGSF ++P
Sbjct  491   RPKKSRSKKEKEDEEEVLLIKGIELDRENFVKFDVYINDEDYSVSRPKNSEFAGSFVNVP  550

Query  319   HRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             H+     K +T+L   +NE +EDLGAEDD++V+VT+ P  GG  VTI  I+IE+ S
Sbjct  551   HKHMKEMKTKTNLRFAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEFVS  606



>ref|XP_004232833.2| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum lycopersicum]
Length=626

 Score =   478 bits (1231),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 254/517 (49%), Positives = 339/517 (66%), Gaps = 28/517 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A P+  P+V+KC     DLP GA++ NCCPP +G  +D+QLPS S   +R RPA H +D
Sbjct  113   LAAPVNGPDVTKCGA--ADLPPGAELVNCCPPMSGSIIDFQLPS-SSTPLRTRPAAHSVD  169

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EKF +A+++MK LP DDPRSF QQA +HCAYC+GAYDQ+GFP+ E+QVH+SW+F P
Sbjct  170   SAYIEKFNRAIQLMKQLPDDDPRSFKQQANIHCAYCDGAYDQLGFPNSELQVHSSWIFLP  229

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYFFERILG LI DPTF +PFWNWD P GM  P +  +   SLYD  R++ H PP
Sbjct  230   FHRCYLYFFERILGSLINDPTFAMPFWNWDHPDGMRMPGLYTNPTSSLYDRLRDRRHQPP  289

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL + G D   +  ++ + NL  MY+QM +   T E FLG PYR+G     GAGS+E
Sbjct  290   TMVDLDFNGTDPNISTAQQTSQNLTNMYRQMVSLGRTPETFLGDPYRAGGVPG-GAGSLE  348

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N  H  +H W GD  + N E+MG+FYSA RD  FY HH+N+DR+WT+W+ LG  GR+++F
Sbjct  349   NMAHGAVHVWTGDRTQANFENMGDFYSAARDPIFYAHHSNIDRLWTVWKTLG--GRRQDF  406

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-----  587
             TD D++N SFLFY+E AQ VR+RV D +++ ++GY Y+     WINS+P P+  R     
Sbjct  407   TDPDFLNTSFLFYDEKAQMVRIRVRDVLDSSKLGYVYQNVRNQWINSRPTPRVSRALSSV  466

Query  586   RKLALRSAA----------PYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
             R+L    AA          P    +FP  LD V++V V RP K +  ++++ E E +LI 
Sbjct  467   RRLVEARAADDNNNNIMNFPRPKEIFPTKLDHVIKVMVKRPNKKKRNKKEKNEREEILIV  526

Query  436   g-iEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHR-----QKNVEKIRTSLSL  275
               +EV+++ + KFDV +NDEDE     D AEFAGSF ++PH      +KN  K +T L L
Sbjct  527   EGLEVESDVFVKFDVLINDEDETLISPDNAEFAGSFVNVPHHSHGKGEKN-SKRKTKLKL  585

Query  274   GLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKI  164
              + E +EDL AE+DD VLVT  P  G G V I  +KI
Sbjct  586   AITELLEDLDAENDDNVLVTFVPKNGSGAVKIGGVKI  622



>ref|XP_009407067.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   476 bits (1226),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 271/559 (48%), Positives = 370/559 (66%), Gaps = 23/559 (4%)
 Frame = -1

Query  1813  IPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpaAM----A  1646
             I    HLH ++P+         C+        +DRR V++G+G LYGA+    ++    A
Sbjct  32    ISGFKHLHHVSPIS--------CSTRDHNQPLVDRRHVLVGIGSLYGASAALTSLREASA  83

Query  1645  GPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGK  1466
              PI AP++S C +   DLP  A   NCCPP+AG   ++ +P  S + +RVRPA H +D  
Sbjct  84    APIAAPDLSACGL--ADLPPDATPTNCCPPSAGDATEFVIPDPS-SPLRVRPAAHSVDKD  140

Query  1465  YKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFH  1286
             Y  KFAK V +MKALPADDPR+FTQ A VHCAYC+GAY QVGFPD+E+QVHNSWLF P+H
Sbjct  141   YIAKFAKGVALMKALPADDPRNFTQHANVHCAYCDGAYSQVGFPDLELQVHNSWLFLPWH  200

Query  1285  RWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTI  1106
             R YLYFFERILGKLI D +F +PFWNWD P GM  P++  D    LYD  R+  H PPT+
Sbjct  201   RCYLYFFERILGKLIGDDSFAIPFWNWDAPDGMRLPAMYVDPTSPLYDPLRDAQHQPPTL  260

Query  1105  VDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             VDL + G D  ++D ++I +NL +MY+Q+ +NA T  LF G PYR+GD  NPG GS+EN 
Sbjct  261   VDLDFGGIDPSSSDKQQIDHNLKVMYRQIVSNAPTPRLFFGNPYRAGDNPNPGGGSLENV  320

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
             PH P+H W GD  +   EDMGN YSA RD  F+ HH+N+DR+W +W+ LG   R+++  D
Sbjct  321   PHGPVHVWTGDRSQSELEDMGNLYSAARDPVFFAHHSNIDRIWNVWKGLG--SRRKDLAD  378

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKP-VPKPRRRKLALR  569
              DW++ASF+FY+ENA  V++RV DC+++ ++ Y+Y+    PW+N++P V    R ++A  
Sbjct  379   PDWLDASFVFYDENANLVKIRVRDCIDSDKLRYEYQDVGNPWLNTRPTVTSGVRPRVAGV  438

Query  568   SAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
             + A  V   FP+ LD VV  KV RPK  RTKEEKE +EE+L++EGIE+  + + KFDV++
Sbjct  439   AHANVVEPKFPIKLDSVVTAKVKRPKAARTKEEKEEKEEVLVVEGIELDRDVHVKFDVFV  498

Query  388   NDEDEPDGGYDKAEFAGSFAHLPHRQKN---VEKIRTSLSLGLNEAMEDLGAEDDDTVLV  218
             N  D    G    E AGSF ++PHR K+    ++++T L LGL E +EDL A  D +++V
Sbjct  499   NVTDHGKVGPGGRELAGSFVNVPHRHKHDKMSKQLKTRLQLGLTELLEDLKA--DGSIMV  556

Query  217   TLAPNVGGGVVTIDNIKIE  161
             TL P  G G V + ++KIE
Sbjct  557   TLVPRQGKGKVKVGSLKIE  575



>ref|XP_010100566.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82809.1| Polyphenol oxidase [Morus notabilis]
Length=586

 Score =   476 bits (1226),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 280/538 (52%), Positives = 366/538 (68%), Gaps = 32/538 (6%)
 Frame = -1

Query  1720  KIDRRDVIlglgglygaanlpaAMAGPIEAPEVSKC----VVPPTDLPAGADVDNCCPPT  1553
             K+DRR+V+LGLG     +N  A MA PI AP+++KC    +   T LP      +CCPPT
Sbjct  62    KVDRRNVLLGLGITGVGSNPLA-MADPIAAPDLTKCGNAELSDGTVLPV-----DCCPPT  115

Query  1552  AGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHC  1373
             A   +D++ P F+   +RVRP  H++D +Y  K+ KA+ +MKALP  DPRSF+QQA VHC
Sbjct  116   ALEIIDFKPPPFT--KLRVRPVAHKVDKEYIAKYNKALSLMKALPDTDPRSFSQQADVHC  173

Query  1372  AYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPA  1193
             AYCN AYDQ G+P +E+QVHNSWLF+PFHRWYLYF+ERILGKLI DPTF +PFWNWD P 
Sbjct  174   AYCNSAYDQTGYPGVELQVHNSWLFYPFHRWYLYFYERILGKLIGDPTFAIPFWNWDHPD  233

Query  1192  GMVFPSIL-NDRNVSLYDENRNQSHLPPTIVDLGYQ-----GKDTEATDLERITNNLALM  1031
             GM  PS+  +D + +LYD NR+ SH PP ++DL Y      GK  +    +++  NL  M
Sbjct  234   GMKMPSMFTSDTSSALYDVNRSPSHQPPYVIDLDYSPSQDAGKPAKPYK-QQVDENLTTM  292

Query  1030  YKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYS  851
             YKQM + A T  LF G  YR+G+      GS+E+ PH+P+H   G+   KNGEDMGNFYS
Sbjct  293   YKQMVSGANTQSLFFGGDYRAGEPPENSPGSVESRPHIPLHIICGNENNKNGEDMGNFYS  352

Query  850   AGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDC  671
             AGRD  FYCHH NVDRMW++W+QL G+ +K + TD DW+NA+FLFY+ENA+ VRV+V  C
Sbjct  353   AGRDPLFYCHHGNVDRMWSLWKQLPGK-KKNDITDPDWLNATFLFYDENAKLVRVKVAGC  411

Query  670   VENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVAT-------VFPVTLDrvvr  512
             ++ +++GY YE  +LPW+  K     +  KLA+ +A    +T        FP+ L + + 
Sbjct  412   LDTKKLGYVYEQVDLPWLKKK-PKSKKVAKLAVGAAIAAESTKGLTPLSAFPIALKKAIT  470

Query  511   vkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             VKVPRPKK R+K EKE EEEIL+IEGI+   +   KFDVY+NDEDE   G +K+EFAGSF
Sbjct  471   VKVPRPKKGRSKAEKEEEEEILVIEGIDYDKSTAVKFDVYVNDEDE--AGPEKSEFAGSF  528

Query  331   AHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
               +PH  KN EK  T L LG+ E +ED+GA+DD+ VLVTL P  G   VT+  +KI Y
Sbjct  529   VTVPHNTKNKEKTYTKLKLGITELLEDVGADDDEDVLVTLVPKSGN--VTVGGVKIVY  584



>gb|ABI96935.1| putative polyphenol oxidase [Heteromeles arbutifolia]
Length=453

 Score =   471 bits (1212),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 245/456 (54%), Positives = 318/456 (70%), Gaps = 24/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+  NCCPP A + +D++LP+  PA +R+RP  H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPPGAEATNCCPPPATKIIDFKLPA--PAKLRIRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFP
Sbjct  60    QAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D    LYD+ R+  H PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKSPLYDKFRSAKHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y G +   +    I  NL +MY+QM +N+  A+LF G PYR+GD+ +PG GS+E
Sbjct  180   TLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP   PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPT--PRRAKVAL  355

Query  571   RSAAPYVATV---------------FPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                A  +                  FP++L   +   V R  +K R+K+ KE EEEIL+I
Sbjct  356   SKIAKKLGVAHAAVASSSKVVAGAEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             EGIE   +   KFDV++ND D+   G DK EFAGSF
Sbjct  416   EGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSF  451



>sp|Q6UIL3.1|LAHY_LARTR RecName: Full=(+)-larreatricin hydroxylase, chloroplastic; AltName: 
Full=Polyphenol oxidase; Flags: Precursor [Larrea tridentata]
 gb|AAQ67412.1| (+)-larreatricin hydroxylase [Larrea tridentata]
Length=584

 Score =   476 bits (1224),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 343/511 (67%), Gaps = 23/511 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             +A PI+ P +     PP DL  G +V  CCPP     +D+Q+PS +P+ +R+RPA H  D
Sbjct  78    LAAPIQPPVLPDSCHPPEDLAEGVNV-LCCPPDVKDPIDFQMPS-NPSRLRIRPAAHLAD  135

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK+ KA+  MKALP +DPRSF QQA +HCAYCNGAYDQVGFPD+ IQVH+SWLF P
Sbjct  136   PTYIEKYKKALAAMKALPQNDPRSFYQQANIHCAYCNGAYDQVGFPDVNIQVHHSWLFLP  195

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+ERILG LI DPTF +PFWNWD P GM  P +  D N  LYD  RN +H P 
Sbjct  196   FHRWYLYFYERILGSLIDDPTFAIPFWNWDAPKGMHMPHMFIDPNSPLYDAKRNPAHFPD  255

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGD-KKNPGAGSM  935
             TIVDL +   +  + +  +I NNL++MYKQ+   A  A LF G+P ++G      G GS+
Sbjct  256   TIVDLDFSSGEAPSHNPRQIGNNLSIMYKQV-VRAKKARLFHGRPLQAGSFPDESGDGSL  314

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             E +PH  IH W GDPR+ N E+MGNFYSAGRD  FY HHANVDRMW IW+   GR   ++
Sbjct  315   EGTPHGNIHLWSGDPRQSNFENMGNFYSAGRDPLFYAHHANVDRMWYIWKNSLGR---KD  371

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK-----PR  590
             +   DW+NA FL ++ENAQPVRV V D ++ +++GY Y+  ++PWINSKP P+     P 
Sbjct  372   YKKKDWLNAGFLLFDENAQPVRVYVRDALDERKLGYAYQEVDIPWINSKPKPRKANPWPN  431

Query  589   RRKLALRSAAPYVATV---FPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQA  419
             R    LRS A     +   FP+TLD  V  +V RPKK+R+K EKE EEE+L+IE I+ + 
Sbjct  432   R----LRSKATTTTKLINKFPLTLDSTVSFEVKRPKKSRSKSEKEDEEEVLVIEKIKHEP  487

Query  418   NQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKI----RTSLSLGLNEAMED  251
                 KFDVY+NDEDE     D+ EFAGSF ++PH  ++ +K      T+LS+G++E +++
Sbjct  488   QFPLKFDVYINDEDEDPSAADQTEFAGSFVNVPHFHRHGDKKDKRQTTNLSIGISEVLDE  547

Query  250   LGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             L  + DD+++VTL P VG G +TI   KIE+
Sbjct  548   LDVDGDDSIVVTLVPRVGSGQITIGGAKIEF  578



>gb|ACB12081.1| polyphenol oxidase [Triticum urartu]
Length=577

 Score =   475 bits (1222),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 277/582 (48%), Positives = 368/582 (63%), Gaps = 36/582 (6%)
 Frame = -1

Query  1849  PRAPANL--FSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglggly  1676
             PR P +L   +RR +     LH        RRL V C A   G  ++DRR+V+LGLGG  
Sbjct  12    PRMPCSLQTLARRNL--LRALHRRKDARQPRRLPVSCEAT--GGRRVDRREVLLGLGGAA  67

Query  1675  gaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPA  1508
              A         A+A PI+AP++  C  P  +LP      NCCP       D+ LP  S +
Sbjct  68    AAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGTGITDFVLPPAS-S  124

Query  1507  TMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDI  1328
              +RVRPA H +D  Y  K+ +AV +MK LPADDPRSF QQ  VHCAYC+ AYDQVGFPD+
Sbjct  125   PLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDL  184

Query  1327  EIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSL  1148
             E+Q+HN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  DR+  L
Sbjct  185   ELQIHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYADRSSPL  244

Query  1147  YDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRS  968
             YDE R+ +H PP +VDL   G DT     ++I  NL +MY+QM +NA    LFLG+PYR+
Sbjct  245   YDERRDPAHQPPVLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRA  304

Query  967   GDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIW  788
             GD+ +PGAGS+EN PH  +H W GDPR+ N  DMGNF+SA RD  F+ HH N+DR+W +W
Sbjct  305   GDQPDPGAGSLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVW  364

Query  787   QQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSK  608
             + L  R    +FTD DW++A+FLFY+E A+PVRVRV DC++   + Y Y+   LPW+N++
Sbjct  365   RGL--RPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNAR  422

Query  607   PVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             P       K +  + AP      P TLD  +RV V RP+ +R++ EK+ EEE+L++EGI+
Sbjct  423   PA------KASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIK  476

Query  427   V--QANQYTKFDVYLNDEDEPDGGYD------KAEFAGSFAHLPHRQKNVE----KIRTS  284
             +    N++ KFDV +N   EP+GG D          AGSFAH PH  +  E     ++T 
Sbjct  477   IADHFNKFIKFDVLVN---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTV  533

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                G+ + M+D+GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  534   ARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSISY  575



>gb|ABI96928.1| putative polyphenol oxidase [Chamaebatia foliolosa]
Length=455

 Score =   471 bits (1211),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/458 (52%), Positives = 313/458 (68%), Gaps = 26/458 (6%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA   NCCPP A + +D++LPS  P+ +RVRPA H +D
Sbjct  4     FAKPVAPPDVSKCGA--ADLPTGAQPTNCCPPVASKIIDFKLPS--PSRLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    QAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF E+ILG LI DPTF LPFWNWD PAGM  P++  +   SLYD+ R   H PP
Sbjct  120   FHRYYLYFHEKILGSLIGDPTFTLPFWNWDAPAGMPLPALYANPKSSLYDKFRAAKHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL + G +   ++  +I  NL +MY+QM +NA T +LF G PYR+GD+ +PG GS+E
Sbjct  180   TLVDLDFNGTEDSVSNETQINANLKIMYRQMVSNAKTPQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDR+W+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD DW+++ FLFY+ENAQ VRV+V DC+E++ +GY Y+  N+PW+ SKP   PRR K+AL
Sbjct  298   TDTDWLDSGFLFYDENAQMVRVKVRDCLESKNLGYVYQDVNIPWLESKPT--PRRVKVAL  355

Query  571   ---------------RSAAPYVA-TVFPVTLDrvvrvkvprpkknrtkeekeleeeilli  440
                             SA+  VA   FP+         V    K + + +KE E+E  ++
Sbjct  356   GKIAKKLHVAHAADNSSASKVVARAAFPIKKLDTKISTVVPRPKQKKRSKKEKEQEEEIL  415

Query  439   egiEVQANQ--YTKFDVYLNDEDEPDGGYDKAEFAGSF  332
                 ++ ++    KFDVY+NDED+   G DK+EFAGSF
Sbjct  416   VIEGIEFDRDVAVKFDVYVNDEDDLPSGPDKSEFAGSF  453



>ref|XP_007214660.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
 gb|AFI08585.1| polyphenol oxidase II [Prunus persica]
 gb|EMJ15859.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
Length=596

 Score =   475 bits (1223),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 257/505 (51%), Positives = 334/505 (66%), Gaps = 13/505 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+++KC +   ++  G +   CCPP   +   ++ P  S   +R RPA  ++ 
Sbjct  100   FADPIAPPDLTKCQL--AEITTGGETVPCCPPVTTKIKTFK-PDLS-IPLRTRPAAQQVT  155

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  KF KA   M+ALP DDPRS  QQAKVHCAYCNGAY QVGFPD ++QVH SWLFFP
Sbjct  156   DEYLAKFKKAQAAMRALPDDDPRSMVQQAKVHCAYCNGAYPQVGFPDNDLQVHFSWLFFP  215

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYF+ERILGKLI DPTF LP+WNWD PAG   P I  D +  LYD+ RN  H PP
Sbjct  216   FHRMYLYFYERILGKLIDDPTFALPYWNWDSPAGFPIPDIYTDTSSPLYDQYRNSDHQPP  275

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGD---KKNPGAG  941
              +VDLGY   + +  D  RI  NLA+MY+QM + A T +LF G  YR+GD   KK P  G
Sbjct  276   VLVDLGYGKTNDDVDDQTRIDENLAIMYRQMVSGAKTPDLFFGHAYRAGDLNTKKYP--G  333

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             ++EN PH  IH WVGDP + + EDMGNFYSAGRD  FY HH NVDRMWTIW+ LG  G++
Sbjct  334   TIENMPHNNIHLWVGDPNQTHQEDMGNFYSAGRDPLFYAHHCNVDRMWTIWKTLG--GKR  391

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVEN-QQMGYKYEFANLPWINSKPVPKPRRR  584
             ++ TD DW++A FLFY+ENA+ V  +V D ++  +Q+ Y YE A+LPW+ +KP  +  + 
Sbjct  392   QDITDTDWLDAEFLFYDENAELVNCKVRDSLDTAKQLRYNYEPASLPWLFTKPTARKTKN  451

Query  583   KLALRSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYT  407
             K   + AA  + + FP T D    V+V R   + R+K+EK  EEE+L+I+ IE + N+  
Sbjct  452   KTKAKVAATQLTSKFPATFDSKTTVEVARPKPRKRSKKEKVDEEELLIIKDIEFEGNEAV  511

Query  406   KFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDT  227
             KFDV++ND+ E     DK+EFAGSF H+P  +    K +T+L LG+ + +EDLGAEDD +
Sbjct  512   KFDVFINDDAESLSRRDKSEFAGSFVHVPQGKTTKAKTKTNLKLGITDLLEDLGAEDDSS  571

Query  226   VLVTLAPNVGGGVVTIDNIKIEYGS  152
             VLVTL P V    +TI   KIEY S
Sbjct  572   VLVTLVPRVSNSPITIGGFKIEYSS  596



>gb|ABK62802.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   474 bits (1221),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 277/582 (48%), Positives = 368/582 (63%), Gaps = 36/582 (6%)
 Frame = -1

Query  1849  PRAPANL--FSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglggly  1676
             PR P +L   +RR +     LH+       RRL V C A   G  ++DRR+V+LGLGG  
Sbjct  12    PRMPCSLQTLARRNL--LRGLHLRKDARQPRRLSVSCEAT--GGCRVDRREVLLGLGGAA  67

Query  1675  gaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPA  1508
              A         A+A PI+AP++  C  P  +LP      NCCP       D+ LP  S +
Sbjct  68    AAGLATDKGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGTGITDFVLPPVS-S  124

Query  1507  TMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDI  1328
              +RVRPA H +D  Y  K+ +AV +MK LPADDPRSF QQ  VHCAYC+ AYDQVGFPD+
Sbjct  125   PLRVRPAAHLVDAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDL  184

Query  1327  EIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSL  1148
             E+Q+HN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  DR+  L
Sbjct  185   ELQIHNCWLFFPWHRFYLYFQERILGKLIGDDTFALPFWNWDAPAGMTLPAIYADRSSPL  244

Query  1147  YDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRS  968
             YDE R+ +H PP +VDL   G DT     ++I  NL +MY+QM +NA    LFLG+PYR+
Sbjct  245   YDERRDPAHQPPVLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRA  304

Query  967   GDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIW  788
             GD+ +PGA S+EN PH  +H W GDPR+ N  DMGNF+SA RD  F+ HH N+DR+W +W
Sbjct  305   GDQPDPGASSLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNMDRLWHVW  364

Query  787   QQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSK  608
             + L  R    +FTD DW++A+FLFY+E A+PVRVRV DC++   + Y Y+   LPW+N++
Sbjct  365   RGL--RPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNAR  422

Query  607   PVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             P       K +  + AP      P TLD  +RV V RP+ +R++ EK+ EEE+L++EGIE
Sbjct  423   PA------KASSGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDEEEEVLVVEGIE  476

Query  427   V--QANQYTKFDVYLNDEDEPDGGYD------KAEFAGSFAHLPHRQKNVE----KIRTS  284
             +    N++ KFDV +N   EP+GG D          AGSFAH PH  +  E     ++T 
Sbjct  477   IADHFNKFIKFDVLVN---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTV  533

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                G+ + M+D+GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  534   ARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSISY  575



>gb|ABI96934.1| putative polyphenol oxidase [Gillenia trifoliata]
Length=453

 Score =   470 bits (1209),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 249/456 (55%), Positives = 322/456 (71%), Gaps = 24/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+  NCCPP A + +D++ P+  PA +R+RPA H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPPGAEATNCCPPPATKIIDFKRPA--PAQLRIRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K+ KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+QVHNSWLFFP
Sbjct  60    QAYTDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D    LYD+ R  +H PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAIPFWNWDSPAGMPLPAIYADPKSPLYDKLRAANHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y   +   ++   I  NL LMY+QM +N+ T +LF G PYR+GD+ +PG GS+E
Sbjct  180   TLIDLDYNRTEDNVSNETTINANLKLMYRQMVSNSKTPQLFFGNPYRAGDEPDPGTGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              SPH  +H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GSPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC+E++ +GY Y+  ++PW++SKP   PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLESKNLGYVYQDVDIPWLSSKPT--PRRAKVAL  355

Query  571   R--------------SAAPYVA-TVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                            S++  VA T FP++L   +   V R  +K R+K++KE EEEIL+I
Sbjct  356   SKIAKKLGVAHAAGASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKDKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             EGIE   +   KFDVY+ND D+   G DK EFAGSF
Sbjct  416   EGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSF  451



>gb|ABI96927.1| putative polyphenol oxidase [Chaenomeles speciosa]
Length=453

 Score =   469 bits (1207),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 245/457 (54%), Positives = 319/457 (70%), Gaps = 24/457 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+  NCCPP A + +D++LP+  P  +R+RP  H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPPGAEFTNCCPPPATKIIDFKLPA--PTKLRIRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFP
Sbjct  60    KAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D    LYD+ R+  H PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKSPLYDKFRSAQHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL Y G +   +    I  NL +MY+QM +N+  A+LF G PYR+GD+ +PG GS+E
Sbjct  180   TLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC+E +++GY Y+  ++PW++SKP   PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLETKRLGYVYQDVDIPWLSSKPT--PRRAKVAL  355

Query  571   ---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                             S+     T FP++L   +   V R  +K R+K++KE EEEIL+I
Sbjct  356   SKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKDKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             EGIE   +   KFDV++ND D+   G D  EFAGSF 
Sbjct  416   EGIEFDRDVAVKFDVFVNDVDDLPSGPDNTEFAGSFV  452



>gb|ACB12082.1| polyphenol oxidase [Triticum monococcum subsp. aegilopoides]
Length=577

 Score =   474 bits (1219),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 275/582 (47%), Positives = 368/582 (63%), Gaps = 36/582 (6%)
 Frame = -1

Query  1849  PRAPANL--FSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglggly  1676
             PR P +L   +RR +     LH        R L + C A   G  ++DRR+VILGLGG  
Sbjct  12    PRMPCSLQTLARRNL--LRALHRRKDARQPRHLSISCEAT--GRGRVDRREVILGLGGAA  67

Query  1675  gaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPA  1508
              A         A+A PI+AP++  C  P  +LP      NCCP       D++LP  S +
Sbjct  68    AAGLATDQGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGTGITDFELPPAS-S  124

Query  1507  TMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDI  1328
              +RVRPA H +D  Y  ++ +AV +MK LPADDPRSF QQ  VHCAYC+ AYDQVGFPD+
Sbjct  125   PLRVRPAAHLVDAGYLARYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDL  184

Query  1327  EIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSL  1148
             E+Q+HN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  +R+  L
Sbjct  185   ELQIHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSSPL  244

Query  1147  YDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRS  968
             YDE R+ +H PP +VDL   G DT     ++I  NL +MY+QM +NA    LFLG+PYR+
Sbjct  245   YDERRDPAHQPPVLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRA  304

Query  967   GDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIW  788
             GD+ +PGAGS+EN PH  +H W GDPR+ N  DMGNF+SA RD  F+ HH N+DR+W +W
Sbjct  305   GDQPDPGAGSLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVW  364

Query  787   QQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSK  608
             + L  R    +FTD DW++A+FLFY+E A+PVRVRV DC++   + Y Y+   LPW+N++
Sbjct  365   RGL--RPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNAR  422

Query  607   PVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             P       K +  + AP      P TLD  +RV V RP+ +R++ EK+ EEE+L++EGIE
Sbjct  423   PA------KASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIE  476

Query  427   V--QANQYTKFDVYLNDEDEPDGGYD------KAEFAGSFAHLPHRQKNVE----KIRTS  284
             +    N++ KFDV +N   EP+GG D          AGSFAH PH  +  E     ++T 
Sbjct  477   IADHFNKFIKFDVLVN---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTV  533

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                G+ + M+D+GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  534   ARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSISY  575



>gb|AEY79826.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   473 bits (1217),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 276/579 (48%), Positives = 365/579 (63%), Gaps = 31/579 (5%)
 Frame = -1

Query  1861  SLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgg  1682
             S S PR  A   +R P      L  + P    +  ++ C A  G   ++DRRDV+LGLG 
Sbjct  4     SRSVPRCTATPGARMP----CSLQAVVPTKARQPRRLTCKATGG---RVDRRDVLLGLGS  56

Query  1681  lygaanlpa----AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFS  1514
                A         A+A PI+AP++  C   P DLP  A   NCCP +    +D+ LP  S
Sbjct  57    AAAAGLGTQPGRGAIAAPIQAPDLGNCN--PPDLPDTAPDTNCCPTSGTGIIDFVLPPAS  114

Query  1513  PATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFP  1334
              A +RVRPA H  D ++  K+ +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFP
Sbjct  115   TAPLRVRPAAHLADAEHLAKYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFP  174

Query  1333  DIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNV  1154
             D+EIQVHN WLFFP+HR+YLYF ERILGKLI D TFGLPFWNWD PAGM  P+I  +R+ 
Sbjct  175   DLEIQVHNCWLFFPWHRFYLYFHERILGKLIGDDTFGLPFWNWDAPAGMTLPAIYANRSS  234

Query  1153  SLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPY  974
              LY+E R+ +H PP  VDL Y   D      E+I  NL +MY+QM ++A    LF+G+PY
Sbjct  235   PLYNERRDPAHQPPFPVDLDYNEIDVIIPTDEQIDQNLNIMYRQMVSSAKKTRLFMGQPY  294

Query  973   RSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWT  794
             R+GD+ +PGAGS+EN PH  +H W GDP + N EDMGNFYSA RD  F+ HH N+DR+W 
Sbjct  295   RAGDQPDPGAGSLENLPHNTVHIWTGDPAQPNSEDMGNFYSAARDPIFFAHHGNIDRLWH  354

Query  793   IWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWIN  614
             +W+ L  R    +FTDADW++ +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ 
Sbjct  355   VWRGL--RPGNADFTDADWLDTAFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLK  412

Query  613   SKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
             +KP  + RR       A        P TL   VRV V RP+ +R+ +EKE  EE+L+IEG
Sbjct  413   AKPGKRSRRTPAPAEGA-------LPATLRETVRVTVTRPQVSRSDKEKEEAEEVLIIEG  465

Query  433   iEVQAN-QYTKFDVYLNDEDEPDGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLG  272
             I+V  + ++ KFDV +N    P+ G D A    AGS A  PH  +  +K   ++T    G
Sbjct  466   IQVANHFKFVKFDVLVN---APESGGDAASGYCAGSVAMTPHMVRTNKKKGSMKTVARFG  522

Query  271   LNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYG  155
             + + M+++GA+ D TV+V+L P  GG +VT+  + I Y 
Sbjct  523   VCDLMDNIGADGDKTVVVSLVPRCGGELVTVGGVSIGYA  561



>dbj|BAH36897.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   473 bits (1218),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 270/552 (49%), Positives = 362/552 (66%), Gaps = 32/552 (6%)
 Frame = -1

Query  1765  RRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAPEVSKCVVPPT  1598
             RR+ + C A  GG  ++DRR+V+LGLGG   A         A+A PI+AP++  C  P  
Sbjct  40    RRISISCEATGGG--RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDLRNCQTP--  95

Query  1597  DLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALP  1418
             DLP      NCCP       D++LP  S + +RVRPA H +D +Y  K+ +AV +MK LP
Sbjct  96    DLPNTPPDTNCCPTPGTGITDFELPPAS-SPLRVRPAAHLVDAEYLAKYERAVALMKQLP  154

Query  1417  ADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIR  1238
             ADDPRSF QQ  VHCAYC+ A+DQVGFPD+EIQVHN WLFFP+HR+Y+YF ERILGKLI 
Sbjct  155   ADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHRFYVYFHERILGKLIG  214

Query  1237  DPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLE  1058
             D TF LPFWNWD PAGM  P+I  +R+  LYDE R+ +H PP + DL   G D      +
Sbjct  215   DDTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPPVLTDLDSSGTDANIPRDQ  274

Query  1057  RITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKN  878
             +I  NL +MY+QM ++A    LFLG+PYR+GD+ +PGAGS+EN PH  IH W GDP + N
Sbjct  275   QIDQNLKIMYRQMISDAKKTLLFLGQPYRAGDQPDPGAGSLENVPHGTIHVWTGDPAQPN  334

Query  877   GEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQ  698
              EDMGNF+SA RD  F+ HH N+DR+W +W++L  R    +FTD DW++A+FLFY+E A+
Sbjct  335   LEDMGNFFSAARDPIFFAHHGNIDRLWHVWRRL--RPSNTDFTDPDWLDAAFLFYDEEAR  392

Query  697   PVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrv  518
             PVRVRV DC++   + Y Y+   LPW+N++P       K +  + AP      P TLDR 
Sbjct  393   PVRVRVRDCLDPAALRYTYQDVGLPWLNARPA------KASGGTPAPATTGTLPATLDRT  446

Query  517   vrvkvprpkknrtkeekeleeeilliegiEV--QANQYTKFDVYLNDEDEPDGGYDKAE-  347
             +RV V RP+ +R++ EKE EEE+L++EGIE+    N++ KFDV +N   EP+GG      
Sbjct  447   IRVTVTRPRVSRSRREKEEEEEVLVVEGIEIADHFNKFVKFDVLVN---EPEGGVGSTPA  503

Query  346   -----FAGSFAHLPH--RQKNVEK--IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGG  194
                   AGSFAH PH  R + + K  ++T    G+ + M+D+GA+DD TV+V+L P  GG
Sbjct  504   TATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGADDDQTVVVSLVPRCGG  563

Query  193   GVVTIDNIKIEY  158
              +VT+  + I Y
Sbjct  564   ELVTVGGVSISY  575



>gb|AAK56323.1|AF380300_1 polyphenol oxidase 2 precursor [Malus domestica]
Length=586

 Score =   473 bits (1218),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 259/547 (47%), Positives = 351/547 (64%), Gaps = 28/547 (5%)
 Frame = -1

Query  1756  KVLCNAAHG-------GDSKIDRRDVIlglgg--lygaanlpaAMAGPIEAPEVSKCVVP  1604
             +V C A  G       G +++DRR++++GLG   LY AA    A A P+ AP+++ C   
Sbjct  48    RVRCKATKGDNDNLDQGLARLDRRNMLIGLGTGGLYSAAGNSFAFAAPVSAPDLTTC--G  105

Query  1603  PTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKA  1424
             P D P G+ +D CCPP     +D++LP   P   R+       +  Y  K+ KA+E+M+A
Sbjct  106   PADKPDGSTID-CCPPITTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAKYKKAIELMRA  164

Query  1423  LPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKL  1244
             LP DDPRS  QQAKVHC+YC+G Y QVG+ D+EIQVH  WLFFPFHRWYLYF+E+I+G+L
Sbjct  165   LPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWYLYFYEKIMGEL  224

Query  1243  IRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATD  1064
             I DPTF LPFWN D PAGM  P I  D + SLYD+NRN +H PP ++DL Y G D +  D
Sbjct  225   IGDPTFALPFWNRDAPAGMYIPEIFTDTSSSLYDQNRNTAHQPPKLLDLNYGGTDDDVDD  284

Query  1063  LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRR  884
               RI  NL  MY+QM + A +  LF G+PY +GD+ +PGAG++E +PH  IH WVGDP +
Sbjct  285   ATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAGNIETTPHNNIHLWVGDPTQ  344

Query  883   KNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLFYNE  707
              NGEDMG FYSAGRD  FY HH+NVDRMW+I++ +LGG     +  + DW++A FLFY+E
Sbjct  345   TNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGG----TDIENTDWLDAEFLFYDE  400

Query  706   NAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYV---ATVF  539
                 VRV+V D ++ +++GY Y E   +PW+ SKP    RR    +R    ++    T F
Sbjct  401   KKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTLVSRR----IRERPQFIFDLTTTF  456

Query  538   PVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGG  362
             P TL D +           RT  +K+  +E+L+I+GIE   N+  KFDVY+ND+ E   G
Sbjct  457   PATLSDTISVEVTRPSATKRTAAQKKAHDEVLVIKGIEFAGNEPVKFDVYVNDDAESLAG  516

Query  361   YDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
              DK+EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D +++VTL P VG G +T
Sbjct  517   KDKSEFAGSFVHVPHKHK--KNIKTNLRLSIMSLLEELDAETDSSLVVTLVPKVGKGPIT  574

Query  181   IDNIKIE  161
             I    IE
Sbjct  575   IGGFSIE  581



>gb|EYU26238.1| hypothetical protein MIMGU_mgv1a025156mg [Erythranthe guttata]
Length=587

 Score =   473 bits (1218),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 259/560 (46%), Positives = 350/560 (63%), Gaps = 31/560 (6%)
 Frame = -1

Query  1792  HILTPVVLNRRLKVLC-------NAAHGGDS---KIDRRDVIlg---lgglygaanlpaA  1652
             H++T    N RL++ C       +++   D+    +DRR+V+LG   L G     +   A
Sbjct  32    HLITHAKRNNRLQISCSDSQKQKDSSQNADTPQGNVDRRNVLLGFGGLCGAANLISTHTA  91

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRL  1475
              A P++AP++ KC V  T+L  G  +D NCCPP     +D++ P      MR RP+ HR+
Sbjct  92    SANPVQAPQIDKCGVA-TNLNTGKQLDINCCPPMGKNIIDFKPPPL--VQMRTRPSAHRV  148

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
               +Y  K+  A++ MK LP DDPRSF QQA +HCAYCNGAYDQ G   +++QVHNSWLFF
Sbjct  149   SAEYMFKYNTAIDRMKRLPKDDPRSFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLFF  208

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHRWYLYF+ERILGKLI DPTF LPFWNWD P GM  P +  D   ++YD  RN +++P
Sbjct  209   PFHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTIPPMFVDPKAAIYDAKRNPANMP  268

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             P +VDLG  G       L+ ++NNL +MY +M         F+GKPYR G   NPG G+ 
Sbjct  269   PAVVDLGLTGNKDP---LQVVSNNLTVMYSEMVRANSDIYDFMGKPYREGTLVNPGPGAS  325

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQL--GGRGRK  761
             E   HV IH +VGDPR  +GED+GNFYSAGRD  FYCHHANVDRMWT+WQ      +   
Sbjct  326   ERGSHVAIHVFVGDPREPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWQYFLPNNKLID  385

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRK  581
             +  TD D++NASFLFY+ENAQ VRV V DC++N ++GY +E  +LPW++ +P P+  + K
Sbjct  386   KKITDPDYLNASFLFYDENAQLVRVTVKDCLDNTKLGYDFERVDLPWLDYRPPPQTAQAK  445

Query  580   LALRSAAPYVA-TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTK  404
             +    +    A  VFP+ LD          +    K +K   +E+L+IE I V  +++ K
Sbjct  446   VMRTVSTTRKADAVFPLKLD-------GIARVLIQKTKKGKADELLVIEDITVDTSKFLK  498

Query  403   FDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTV  224
             FDV++NDED+  G  DKA +AG++A +PH+  N +   T++ L L E  +D+   +DDTV
Sbjct  499   FDVFVNDEDDNVGELDKAAYAGTYAQVPHKT-NEKTATTTIRLKLTELYDDMDVTEDDTV  557

Query  223   LVTLAPNVGGGVVTIDNIKI  164
             LVTL P   G  VTI  IKI
Sbjct  558   LVTLVPRHEGEGVTIGGIKI  577



>gb|EYU26236.1| hypothetical protein MIMGU_mgv1a027162mg [Erythranthe guttata]
Length=583

 Score =   473 bits (1217),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 264/502 (53%), Positives = 338/502 (67%), Gaps = 10/502 (2%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRL  1475
              A PI +P++SKC    T+L     +D NCCPP +   +DYQLP  +   MR RPA H  
Sbjct  86    FAAPITSPDISKCTTG-TNLNTQKPLDINCCPPQSAEIIDYQLPPVT--QMRYRPAAHLA  142

Query  1474  DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
               +Y  KF KAV +MKALPADDPRSF QQA VHCAYCN  Y Q G P +++Q+HN W FF
Sbjct  143   GKEYYAKFEKAVALMKALPADDPRSFMQQANVHCAYCNLTYPQTGDPKLKLQIHNCWHFF  202

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             P+HRWYLYF+ERILG LI DPTFGLPFWNWD PAGMV P     ++  L++  RNQ+HLP
Sbjct  203   PWHRWYLYFYERILGNLIGDPTFGLPFWNWDNPAGMVMPERFAVQDSPLFNPRRNQTHLP  262

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             PT  DL Y  K +     + I NNL +MY +M  N    E F G  Y  G K +PG GS+
Sbjct  263   PTPTDLAYSAK-SPTNPKKIIPNNLTIMYGEMVRNVKKLEDFYGAKYVVGTKPDPGPGSV  321

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKR  758
             E   H  +H WVG+    +GEDMGNFYS GRD  FY HH NVDR+WTIW+ Q  G  + +
Sbjct  322   ERGSHTAMHAWVGE-NTASGEDMGNFYSTGRDPLFYSHHTNVDRLWTIWRNQRSGPKQPK  380

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +F D+DW+NA +LFY+ENA+ VRV+  D +EN++MGY Y+  +LPW+ ++P  +  + K+
Sbjct  381   DFPDSDWLNADYLFYDENARLVRVKNSDTLENEKMGYVYQEVDLPWLKNRPAARVTKSKV  440

Query  577   ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFD  398
             A  +AAP   TVFPV LD+VV+V V RPKK+R+K+EKE EEE+L+IEGIEV   ++ KFD
Sbjct  441   AATTAAPPPETVFPVKLDKVVKVLVSRPKKSRSKKEKESEEELLVIEGIEVDTAKFVKFD  500

Query  397   VYLNDE-DEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVL  221
             V++NDE DE     DKAE+AGS++ +PHR  N   ++T + LGL E +EDL  E DD +L
Sbjct  501   VFVNDEDDEAADELDKAEYAGSYSQVPHR--NSTTVKTRIRLGLTELLEDLDVEGDDKIL  558

Query  220   VTLAPNVGGGVVTIDNIKIEYG  155
             VTL P  GG  +TI  I I Y 
Sbjct  559   VTLVPKAGGEDITIGGINIIYA  580



>gb|ACB12083.1| polyphenol oxidase [Triticum monococcum]
Length=577

 Score =   473 bits (1216),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 275/582 (47%), Positives = 368/582 (63%), Gaps = 36/582 (6%)
 Frame = -1

Query  1849  PRAPANL--FSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglggly  1676
             PR P +L   +RR +     LH        R L + C A   G  ++DRR+VILGLGG  
Sbjct  12    PRMPCSLQTLARRNL--LRALHRRKDARQPRHLSISCEAT--GRGRVDRREVILGLGGAA  67

Query  1675  gaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPA  1508
              A         A+A PI+AP++  C  P  +LP      NCCP       D++LP  S +
Sbjct  68    AAGLATDQGRGAIAAPIQAPDLRNCQTP--ELPNTPPDTNCCPTPGTGITDFELPPAS-S  124

Query  1507  TMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDI  1328
              +RVRPA H +D  Y  ++ +AV +MK LPADDPRSF QQ  VHCAYC+ AYDQVGFPD+
Sbjct  125   PLRVRPAAHLVDAGYLARYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDL  184

Query  1327  EIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSL  1148
             E+Q+HN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  +R+  L
Sbjct  185   ELQIHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSSPL  244

Query  1147  YDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRS  968
             YDE R+ +H PP +VDL   G DT     ++I  NL +MY+QM +NA    LFLG+PYR+
Sbjct  245   YDERRDPAHQPPVLVDLDSSGFDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRA  304

Query  967   GDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIW  788
             GD+ +PGAGS+EN PH  +H W GDPR+ N  DMGNF+SA RD  F+ HH N+DR+W +W
Sbjct  305   GDQPDPGAGSLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVW  364

Query  787   QQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSK  608
             + L  R    +FTD DW++A+FLFY+E A+PVRVRV DC++   + Y Y+   LPW+N++
Sbjct  365   RGL--RPSNTDFTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNAR  422

Query  607   PVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiE  428
             P       K +  + AP      P TLD  +RV V RP+ +R++ EK+ EEE+L++EGIE
Sbjct  423   PA------KASGGTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIE  476

Query  427   V--QANQYTKFDVYLNDEDEPDGGYD------KAEFAGSFAHLPHRQKNVE----KIRTS  284
             +    N++ KFDV +N   EP+GG D          AGSFAH PH  +  E     ++T 
Sbjct  477   IADHFNKFIKFDVLVN---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTV  533

Query  283   LSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                G+ + M+D+GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  534   ARFGVCDLMDDIGADGDQTVVVSLVPRCGGELVTVGGVSISY  575



>gb|ABK62803.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   473 bits (1216),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 269/552 (49%), Positives = 362/552 (66%), Gaps = 32/552 (6%)
 Frame = -1

Query  1765  RRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAPEVSKCVVPPT  1598
             RR+ + C A  GG  ++DRR+V+LGLGG   A         A+A PI+AP++  C  P  
Sbjct  40    RRISISCEATGGG--RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDLRNCQTP--  95

Query  1597  DLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALP  1418
             DLP      NCCP       D++LP  S + +RVRPA H +D +Y  K+ +AV +MK LP
Sbjct  96    DLPNTPPDTNCCPTPGTGITDFELPPAS-SPLRVRPAAHLVDAEYLAKYERAVALMKQLP  154

Query  1417  ADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIR  1238
             ADDPRSF QQ  VHCAYC+ A+DQVGFPD+EIQVHN WLFFP+HR+Y+YF ERILGKLI 
Sbjct  155   ADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHRFYVYFHERILGKLIG  214

Query  1237  DPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLE  1058
             D TF LPFWNWD PAGM  P+I  +R+  LYDE R+ +H PP + DL   G D      +
Sbjct  215   DDTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPPVLTDLDSSGTDANIPRDQ  274

Query  1057  RITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKN  878
             +I  NL +MY+QM ++A    LFLG+PYR+GD+ +PGAGS+EN PH  +H W GDP + N
Sbjct  275   QIDQNLKIMYRQMISDAKKTLLFLGQPYRAGDQPDPGAGSLENVPHGTVHVWTGDPAQPN  334

Query  877   GEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQ  698
              EDMGNF+SA RD  F+ HH N+DR+W +W++L  R    +FTD DW++A+FLFY+E A+
Sbjct  335   LEDMGNFFSAARDPIFFAHHGNIDRLWHVWRRL--RPSNTDFTDPDWLDAAFLFYDEEAR  392

Query  697   PVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrv  518
             PVRVRV DC++   + Y Y+   LPW+N++P       K +  + AP      P TLDR 
Sbjct  393   PVRVRVRDCLDPAALRYTYQDVGLPWLNARPA------KASGGTPAPATTGTLPATLDRT  446

Query  517   vrvkvprpkknrtkeekeleeeilliegiEV--QANQYTKFDVYLNDEDEPDGGYDKAE-  347
             +RV V RP+ +R++ EKE EEE+L++EGIE+    N++ KFDV +N   EP+GG      
Sbjct  447   IRVTVTRPRVSRSRREKEEEEEVLVVEGIEIADHFNKFVKFDVLVN---EPEGGVGSTPA  503

Query  346   -----FAGSFAHLPH--RQKNVEK--IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGG  194
                   AGSFAH PH  R + + K  ++T    G+ + M+D+GA+DD TV+V+L P  GG
Sbjct  504   TATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGADDDQTVVVSLVPRCGG  563

Query  193   GVVTIDNIKIEY  158
              +VT+  + I Y
Sbjct  564   ELVTVGGVSISY  575



>gb|ACB12086.1| polyphenol oxidase [Aegilops tauschii]
Length=577

 Score =   472 bits (1215),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 269/552 (49%), Positives = 362/552 (66%), Gaps = 32/552 (6%)
 Frame = -1

Query  1765  RRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAPEVSKCVVPPT  1598
             RR+ + C A  GG  ++DRR+V+LGLGG   A         A+A PI+AP++  C  P  
Sbjct  40    RRISISCEATGGG--RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDLRNCQTP--  95

Query  1597  DLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALP  1418
             DLP      NCCP       D++LP  S + +RVRPA H +D +Y  K+ +AV +MK LP
Sbjct  96    DLPNTPPDTNCCPTPGTGITDFELPPAS-SPLRVRPAAHLVDAEYLAKYERAVALMKQLP  154

Query  1417  ADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIR  1238
             ADDPRSF QQ  VHCAYC+ A+DQVGFPD+EIQVHN WLFFP+HR+Y+YF ERILGKLI 
Sbjct  155   ADDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHRFYVYFHERILGKLIG  214

Query  1237  DPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLE  1058
             D TF LPFWNWD PAGM  P+I  +R+  LYDE R+ +H PP + DL   G D      +
Sbjct  215   DDTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPPVLTDLDSSGTDANIPRDQ  274

Query  1057  RITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKN  878
             +I  NL +MY+QM ++A    LFLG+PYR+GD+ +PGAGS+EN PH  +H W GDP + N
Sbjct  275   QIDQNLKIMYRQMISDAKKTLLFLGQPYRAGDQPDPGAGSLENVPHGTVHVWTGDPAQPN  334

Query  877   GEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQ  698
              EDMGNF+SA RD  F+ HH N+DR+W +W++L  R    +FTD DW++A+FLFY+E A+
Sbjct  335   LEDMGNFFSAARDPIFFAHHGNIDRLWHVWRRL--RPSNTDFTDPDWLDAAFLFYDEEAR  392

Query  697   PVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrv  518
             PVRVRV DC++   + Y Y+   LPW+N++P       K +  + AP      P TLDR 
Sbjct  393   PVRVRVRDCLDPAALRYTYQDVGLPWLNARPA------KASGGTPAPATTGTLPATLDRT  446

Query  517   vrvkvprpkknrtkeekeleeeilliegiEV--QANQYTKFDVYLNDEDEPDGGYDKAE-  347
             +RV V RP+ +R++ EKE EEE+L++EGIE+    N++ KFDV +N   EP+GG      
Sbjct  447   IRVTVTRPRVSRSRREKEEEEEVLVVEGIEIADHFNKFVKFDVLVN---EPEGGVGSTPA  503

Query  346   -----FAGSFAHLPH--RQKNVEK--IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGG  194
                   AGSFAH PH  R + + K  ++T    G+ + M+D+GA+DD TV+V+L P  GG
Sbjct  504   TATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGADDDQTVVVSLVPRCGG  563

Query  193   GVVTIDNIKIEY  158
              +VT+  + I Y
Sbjct  564   ELVTVGGVSISY  575



>gb|ABI96933.1| putative polyphenol oxidase [Gillenia stipulata]
Length=453

 Score =   467 bits (1201),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 245/456 (54%), Positives = 318/456 (70%), Gaps = 24/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P++SKC     DLP GA+  NCCPP A + +D++ P+  PA +R+R A H +D
Sbjct  4     FAKPIAPPDLSKCGS--ADLPPGAEATNCCPPPATKIIDFKRPA--PAQLRIRAAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               YK+K+ KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+QVHNSWLFFP
Sbjct  60    QAYKDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+Y+YFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D    LYD+ R+ SH PP
Sbjct  120   FHRYYMYFFEKILGKLINDPTFAMPFWNWDSPAGMTMPAIYTDPKSPLYDKLRSASHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL Y G +   ++   I  NL  MY+QM +N+  ++LF G  YR+GD+ +PG GS+E
Sbjct  180   TLVDLDYNGTEDNVSNETTINANLKTMYRQMVSNSKNSQLFFGNAYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              SPH  +H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GSPHGSVHLWTGDTTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP   PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQNVDIPWLSSKPT--PRRAKVAL  355

Query  571   ---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                             S+     T FP++L   +   V R  +K R+K++KE EEEIL+I
Sbjct  356   GKIAKKLGVAHAAGASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKDKEEEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             EGIE   +   KFDVY+ND D+   G DK EFAGSF
Sbjct  416   EGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSF  451



>gb|ABI96939.1| putative polyphenol oxidase [Neillia thyrsiflora]
Length=451

 Score =   467 bits (1201),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 245/454 (54%), Positives = 321/454 (71%), Gaps = 20/454 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P++SKC  P  DLP GA   NCCPP A + +D+++P+  P  +R+RP  H +D
Sbjct  4     FAKPVAPPDISKCGAP--DLPTGALPTNCCPPLATKIIDFKVPA--PNRLRIRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K++KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQVGFPD+EIQ+HN WLFFP
Sbjct  60    QAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPDLEIQIHNCWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR++LYF+ERILGKLI DPTF LPFWNWD PAGM  P+I  +    LYD+ RN+ H PP
Sbjct  120   FHRYFLYFYERILGKLINDPTFALPFWNWDSPAGMQLPAIFANPQSPLYDKLRNRQHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL Y G +   +    I  NL +MY+QM +NA    LF G PYR+GD+ +PGAGS+E
Sbjct  180   TLVDLDYNGTEDNTSRETTINANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDPGAGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSA RD  F+ HH+NVDR+W IW+ LG  G++ + 
Sbjct  240   LTPHNPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRLWIIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-----  587
             TD+DW+++ FLFYNENA+ VRV+V DC+E++++GY Y+  ++PW++SKP P+        
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLESKKLGYVYQDVDIPWLDSKPTPRRAEQVLSK  357

Query  586   --RKLALRSAAP-----YVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegi  431
               +KL +  AA        AT FP+ LD  +   V R  +K RTK++KE EEEIL+IEGI
Sbjct  358   IAKKLGVAHAAESSTKIVAATEFPINLDTKISTVVKRPQQKKRTKKQKEDEEEILVIEGI  417

Query  430   EVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             E + +   KFDVY+ND D+P G  DK EFAGSF 
Sbjct  418   EFERDVAVKFDVYVNDVDDPSGP-DKTEFAGSFV  450



>gb|AAC28935.1| polyphenol oxidase precursor [Prunus armeniaca]
Length=597

 Score =   472 bits (1214),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 254/504 (50%), Positives = 328/504 (65%), Gaps = 10/504 (2%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+++ C  P    P G++   CCPP   +   ++ P  S   +R  PA H++ 
Sbjct  100   FADPIAPPDLTTCK-PAEITPGGSETVPCCPPVTTKIKTFK-PDLS-IPLRTSPAAHQVT  156

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  KF KA   M+ALP DDPRS  QQAKVHCAYCNGAY QVGF D +IQVH SWLFFP
Sbjct  157   DEYLAKFKKAQAAMRALPDDDPRSMVQQAKVHCAYCNGAYPQVGFTDNDIQVHFSWLFFP  216

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYF+ERILGKLI DPTF LP+WNWD P G   P I  D +  LYD+ RN  H PP
Sbjct  217   FHRMYLYFYERILGKLIDDPTFALPYWNWDSPVGFPIPDIYTDTSSPLYDQYRNADHQPP  276

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGA--GS  938
              +VDL Y GKD +  +  RI  NLA+MY+QM + A T +LF G  YR+G+  N G   G+
Sbjct  277   VLVDLSYGGKDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHAYRAGN-LNTGKYPGT  335

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKR  758
             +EN PH  IH WVGDP + + EDMGNFYSAGRD  FY HHANVDRMW IW+ LG  G+++
Sbjct  336   IENMPHNNIHIWVGDPSQTHQEDMGNFYSAGRDPLFYAHHANVDRMWNIWKTLG--GKRK  393

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVE-NQQMGYKYEFANLPWINSKPVPKPRRRK  581
             + TD DW++A FLFY+ENA+ VRV+V D +E  +Q+ Y YE  +LPW+ +KP  +  + K
Sbjct  394   DITDTDWLDAEFLFYDENAELVRVKVRDSLEPEKQLRYNYEPVSLPWLFTKPTARKTKNK  453

Query  580   LALRSAAPYVATVFPVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTK  404
                + AA  + + FP TL +           + R+K+EK  EEE+L+I+ IE +  +  K
Sbjct  454   TKAKVAATQLTSKFPATLVEVTTVEVARPKPRKRSKKEKVDEEELLIIKDIEFEGTEAVK  513

Query  403   FDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTV  224
             FDV++ND+ E     DK+EFAGSF H+P  +    K +T+L LG+ + +EDLGAEDD +V
Sbjct  514   FDVFINDDAESLSRRDKSEFAGSFVHVPQGKTTKAKTKTNLKLGITDLLEDLGAEDDSSV  573

Query  223   LVTLAPNVGGGVVTIDNIKIEYGS  152
             LVTL P V    +TI   KIEY S
Sbjct  574   LVTLVPRVSNSPITIGGFKIEYSS  597



>ref|XP_009334541.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   472 bits (1214),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 273/563 (48%), Positives = 360/563 (64%), Gaps = 32/563 (6%)
 Frame = -1

Query  1771  LNRRLKVLCNAAHGGDS--------------KIDRRDVIlglgglygaanlpa---AMAG  1643
             ++RR  + C A +  ++              K+DRR+V+LGLGGLYGA  L     A A 
Sbjct  47    VSRRSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAA  106

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSP---ATMRVRPALHRLD  1472
             P+  P+++KC +   ++  G +   CCPP + +     + +F+P     +R RPA H + 
Sbjct  107   PLAPPDLTKCTL--AEITTGGETVACCPPVSTK-----IKAFTPDRSIPLRTRPAAHLVT  159

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  KF KA  +M+ALP DDPRS  QQAKVHCAYCN AY QVGFPDI+IQVH SWLFFP
Sbjct  160   DEYLAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNDAYPQVGFPDIDIQVHFSWLFFP  219

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYF+ERILGKLI DPTF LP+WNWD P G   P I  D    LYD+ RN  H PP
Sbjct  220   FHRMYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTTSPLYDQYRNAGHQPP  279

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPG-AGSM  935
              +VDL Y G D +  +  RI  NLA+MY+QM + A T +LF G  YR+GD      AG++
Sbjct  280   VLVDLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTI  339

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN+PH  IH W GDP + N EDMGNFYS+GRD  FY HH NVDRMW IW+ LG  G++++
Sbjct  340   ENNPHNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLG--GKRKD  397

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVE-NQQMGYKYEFANLPWINSKPVPKPRRRKL  578
              TD DW++A FLFY+ENA+ V  +V D +   + + Y YE  ++PW+ SKP  +  R K 
Sbjct  398   PTDTDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKT  457

Query  577   ALRSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKF  401
               + +A  + T FP T D    V+V R   + RTK+EK  EEE+L+I+ IE ++N+  KF
Sbjct  458   KAKVSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKF  517

Query  400   DVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVL  221
             DV++ND+ E     DK+EFAGSF H+PH+QK   K +T+L LG+ + +EDLG E+D  VL
Sbjct  518   DVFINDDAESLSRKDKSEFAGSFVHVPHKQKTGTKTKTNLKLGITDLLEDLGVEEDSCVL  577

Query  220   VTLAPNVGGGVVTIDNIKIEYGS  152
             VTL P V    +T+   KIEY S
Sbjct  578   VTLVPRVSNSPITVGGFKIEYSS  600



>ref|XP_008225003.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=597

 Score =   471 bits (1213),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 258/505 (51%), Positives = 330/505 (65%), Gaps = 12/505 (2%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P++S C  P    P G++   CCPP   +   ++ P  S   +R RPA H++ 
Sbjct  100   FADPIAPPDLSTCK-PAEITPGGSETVPCCPPVTTKIKTFK-PDLS-IPLRTRPAAHQVT  156

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  KF KA   M+ALP DDPRS  QQAKVHCAYCNGAY QVGF D +IQVH SWLFFP
Sbjct  157   DEYLAKFKKAQAAMRALPDDDPRSMVQQAKVHCAYCNGAYPQVGFTDNDIQVHYSWLFFP  216

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYF+ERILGKLI DPTF LP+WNWD P G   P I  D +  LYD+ RN  H PP
Sbjct  217   FHRMYLYFYERILGKLIDDPTFALPYWNWDSPVGFPIPDIYTDTSSPLYDQYRNADHQPP  276

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGD---KKNPGAG  941
              +VDL Y G D +  +  RI  NLA+MY+QM + A T +LF G  YR+GD   +K P  G
Sbjct  277   VLVDLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHAYRAGDLNTQKYP--G  334

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             ++EN PH  IH WVGDP + + EDMGNFYSAGRD  FY HH NVDRMW IW+ LG  G++
Sbjct  335   TIENMPHNDIHIWVGDPTQTHHEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLG--GKR  392

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVE-NQQMGYKYEFANLPWINSKPVPKPRRR  584
             ++ TD DW++A FLFY+ENA+ V  +V D +E  +Q+ Y YE A LPW+ +KP  +  + 
Sbjct  393   KDITDTDWLDAEFLFYDENAELVNCKVRDSLEPEKQLRYNYEPAPLPWLFTKPTARKTKN  452

Query  583   KLALRSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYT  407
             K   + AA  + + FP TLD    V+V R   + R+K+EK  EEE+L+I+ IE +  +  
Sbjct  453   KTKAKVAATQLTSKFPATLDSKTTVEVARPKPRKRSKKEKVDEEELLIIKDIEFEGTEAV  512

Query  406   KFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDT  227
             KFDV++ND+ E     DK+EFAGSF H+P  +    K +T+L LG+ + +EDLGAEDD +
Sbjct  513   KFDVFINDDAESLSRRDKSEFAGSFVHVPQGKTTKAKTKTNLKLGITDLLEDLGAEDDSS  572

Query  226   VLVTLAPNVGGGVVTIDNIKIEYGS  152
             VLVTL P V    +TI   KIEY S
Sbjct  573   VLVTLVPRVSNSPITIGGFKIEYSS  597



>gb|AAS00454.1| polyphenol oxidase [Triticum aestivum]
Length=542

 Score =   469 bits (1208),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 268/551 (49%), Positives = 361/551 (66%), Gaps = 32/551 (6%)
 Frame = -1

Query  1762  RLKVLCNAAHGGDSKIDRRDVIlglgglygaanlp----aAMAGPIEAPEVSKCVVPPTD  1595
             R+ + C A  GG  ++DRR+V+LGLGG   A         A+A PI+AP++  C  P  D
Sbjct  6     RISISCEATGGG--RVDRREVLLGLGGAAAAGLATDQGRGAIAAPIQAPDLRNCQTP--D  61

Query  1594  LPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPA  1415
             LP      NCCP       D++LP  S + +RVRPA H +D +Y  K+ +AV +MK LPA
Sbjct  62    LPNTPPDTNCCPTPGTGITDFELPPAS-SPLRVRPAAHLVDAEYLAKYERAVALMKQLPA  120

Query  1414  DDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRD  1235
             DDPRSF QQ  VHCAYC+ A+DQVGFPD+EIQVHN WLFFP+HR+Y+YF ERILGKLI D
Sbjct  121   DDPRSFEQQWHVHCAYCDAAFDQVGFPDLEIQVHNCWLFFPWHRFYVYFHERILGKLIGD  180

Query  1234  PTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLER  1055
              TF LPFWNWD PAGM  P+I  +R+  LYDE R+ +H PP + DL   G D      ++
Sbjct  181   DTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPPVLTDLDSSGTDANIPRDQQ  240

Query  1054  ITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNG  875
             I  NL +MY+QM ++A    LFLG+PYR+GD+ +PGAGS+EN PH  +H W GDP + N 
Sbjct  241   IDQNLKIMYRQMISDAKKTLLFLGQPYRAGDQPDPGAGSLENVPHGTVHVWTGDPAQPNL  300

Query  874   EDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQP  695
             EDMGNF+SA RD  F+ HH N+DR+W +W++L  R    +FTD DW++A+FLFY+E A+P
Sbjct  301   EDMGNFFSAARDPIFFAHHGNIDRLWHVWRRL--RPSNTDFTDPDWLDAAFLFYDEEARP  358

Query  694   VRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvv  515
             VRVRV DC++   + Y Y+   LPW+N++P       K +  + AP      P TLDR +
Sbjct  359   VRVRVRDCLDPAALRYTYQDVGLPWLNARPA------KASGGTPAPATTGTLPATLDRTI  412

Query  514   rvkvprpkknrtkeekeleeeilliegiEV--QANQYTKFDVYLNDEDEPDGGYDKAE--  347
             RV V RP+ +R++ EKE EEE+L++EGIE+    N++ KFDV +N   EP+GG       
Sbjct  413   RVTVTRPRVSRSRREKEEEEEVLVVEGIEIADHFNKFVKFDVLVN---EPEGGVGSTPAT  469

Query  346   ----FAGSFAHLPH--RQKNVEK--IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGG  191
                  AGSFAH PH  R + + K  ++T    G+ + M+D+GA+DD TV+V+L P  GG 
Sbjct  470   ATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGADDDQTVVVSLVPRCGGE  529

Query  190   VVTIDNIKIEY  158
             +VT+  + I Y
Sbjct  530   LVTVGGVSISY  540



>gb|ABI96932.1| putative polyphenol oxidase [Fallugia paradoxa]
Length=452

 Score =   466 bits (1199),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 325/453 (72%), Gaps = 19/453 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP G    NCCPP A + +D++LP+  P+T+RVRPA H +D
Sbjct  4     FAKPVAPPDVSKCGA--ADLPNGVTPTNCCPPAATKIIDFKLPA--PSTLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K++KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    DVYIAKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DPTF LPFWNWD PAGM  P++  +    LYD+ R  +H PP
Sbjct  120   FHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFANPKSPLYDKFRAATHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              ++DL Y G +   ++  ++ +NL++MY+QM +NA  A+LF G PYR+GD+ +PG GS+E
Sbjct  180   HLIDLDYNGTEDNTSNTTQVNSNLSIMYRQMVSNAKNAQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSA RD  F+ HH+NVDRMW+IW+ L  +   ++ 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLATKN--KDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRR-----  587
             TD+DW+++ FLFY+ENA  VRV+V DC++++ +GY Y+   +PW+NSKP P+  +     
Sbjct  298   TDSDWLDSGFLFYDENANMVRVKVRDCLDSKNLGYVYQDVEIPWLNSKPTPRRSKVAFSK  357

Query  586   --RKLALRSAAPYVATV-----FPVTLDrvvrvkv-prpkknrtkeekeleeeilliegi  431
               +KL + +AA   A V     FP+TL++ +RV V    +K R+K++KE EEEIL+IEGI
Sbjct  358   IAKKLGVANAATSSAKVVAITDFPLTLNQKIRVAVPRPKQKKRSKKQKEEEEEILVIEGI  417

Query  430   EVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             E   +   KFDVY+NDED+   G DK+EFAGSF
Sbjct  418   EFDRDVAVKFDVYINDEDDLPSGPDKSEFAGSF  450



>gb|ABI96946.1| putative polyphenol oxidase [Pyrus communis subsp. caucasica]
Length=453

 Score =   466 bits (1198),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 244/456 (54%), Positives = 316/456 (69%), Gaps = 24/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+  NCCPP A + +D++LP+  PA +R+RP  H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPQGAEATNCCPPPATKIIDFKLPA--PAKLRIRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFP
Sbjct  60    KAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D    LYD+ R+  H PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKSPLYDKFRSAKHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y G +   +    I  NL +MY+QM +N+  A+LF G PYR+GD+ +PG GS+E
Sbjct  180   TLIDLDYNGTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
              D DW+++ FLFYNENA+ VRV+V DC+E + +GY Y+  ++PW++SKP    RR K+AL
Sbjct  298   ADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPT--RRRAKVAL  355

Query  571   ---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                             S+     T FP++L   +   V R  +K R+K+ KE EEEIL+I
Sbjct  356   GKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             EGIE   +   KFDV++ND D+   G DK EFAGSF
Sbjct  416   EGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSF  451



>gb|AFO55219.1| chloroplast polyphenol oxidase III [Eriobotrya japonica]
Length=614

 Score =   471 bits (1212),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 265/532 (50%), Positives = 348/532 (65%), Gaps = 18/532 (3%)
 Frame = -1

Query  1720  KIDRRDVIlglgglygaanlp---aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTA  1550
             K+DRR+V++GLGGLYGA  L     A A P+  P+++KC +   ++  G +   CCPP +
Sbjct  92    KLDRRNVLIGLGGLYGATTLVPKPLAFANPLAPPDLTKCTL--AEITTGGETVECCPPVS  149

Query  1549  GRYLDYQLPSFSP---ATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKV  1379
              +     + +F+P     +R RPA H +  +Y  KF KA  +M+ALP DDPRS  QQAKV
Sbjct  150   TK-----IKTFTPDLSIPLRTRPAAHLVTDEYLAKFKKAQALMRALPEDDPRSMVQQAKV  204

Query  1378  HCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDI  1199
             HCAYCNGAY Q+GFPDI+IQVH SWLFFPF   YLYF+ERILGKLI DPTF LP+WNWD 
Sbjct  205   HCAYCNGAYPQIGFPDIDIQVHFSWLFFPFPPMYLYFYERILGKLIDDPTFALPYWNWDS  264

Query  1198  PAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQM  1019
               G   P I  D    LYD+ RN  H PP +VDL Y G D +  +  RI  NLA+MY+QM
Sbjct  265   LDGFPIPDIYTDTTSPLYDQYRNADHQPPVLVDLSYGGTDDDVDEQTRIDENLAIMYRQM  324

Query  1018  FTNAGTAELFLGKPYRSGDKKNPG-AGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGR  842
              + A T +LF G  YR+GD      AG++EN+PH  IH W GDP + N EDMGNFYSAGR
Sbjct  325   VSGAKTPDLFFGHEYRAGDTTTGTYAGTIENTPHNNIHLWCGDPNQTNKEDMGNFYSAGR  384

Query  841   DISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVE-  665
             D  FY HH NVDRMW IW+ LG  G++++ TD DW++A FLFY+ENA+ V  +V D ++ 
Sbjct  385   DPLFYAHHCNVDRMWNIWKTLG--GKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSLKP  442

Query  664   NQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvpr-pkk  488
              + + Y YE  ++PW+ +KP  +  + K   + AA  + T FP T D    V+V R   +
Sbjct  443   AKDLRYTYEPVSVPWLFTKPTARKPKSKTKAKVAATQLTTKFPATFDSKTTVEVARPKPR  502

Query  487   nrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQK  308
              RTK+EK  EEE+L+I+ IE ++N+  K  V++ND+ E     DK+EFAGSF H+PH QK
Sbjct  503   KRTKKEKIDEEEVLIIKDIEFESNEAVKLIVFINDDAESLSRKDKSEFAGSFVHVPHNQK  562

Query  307   NVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
                K +T+L LG+ + +EDLGAED+ +VLVTL P V    +TI   KIEY S
Sbjct  563   TGTKKKTNLKLGITDLLEDLGAEDESSVLVTLVPRVSNSPITIGGFKIEYSS  614



>ref|XP_009334704.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   471 bits (1211),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 272/563 (48%), Positives = 359/563 (64%), Gaps = 32/563 (6%)
 Frame = -1

Query  1771  LNRRLKVLCNAAHGGDS--------------KIDRRDVIlglgglygaanlpa---AMAG  1643
             ++RR  + C A +  ++              K+DRR+V+LGLGGLYGA  L     A A 
Sbjct  47    VSRRSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAA  106

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSP---ATMRVRPALHRLD  1472
             P+  P+++KC +   ++  G +   CCPP + +     + +F+P     +R RPA H + 
Sbjct  107   PLAPPDLTKCTL--AEITTGGETVACCPPVSTK-----IKAFTPDRSIPLRTRPAAHLVT  159

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  KF KA  +M+ALP DDPRS  QQA VHCAYCNGAY QVGFPDI+IQVH SWLFFP
Sbjct  160   DEYLAKFKKAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFP  219

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYF+ERILGKLI DPTF LP+WNWD P     P I  D    LYD+ RN  H PP
Sbjct  220   FHRMYLYFYERILGKLIDDPTFALPYWNWDSPVCFPIPDIYTDTTSPLYDQYRNAGHQPP  279

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPG-AGSM  935
              +VDL Y G D +  +  RI  NLA+MY+QM + A T +LF G  YR+GD      AG++
Sbjct  280   VLVDLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTI  339

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN+PH  IH W GDP + N EDMGNFYS+GRD  FY HH NVDRMW IW+ LG  G++++
Sbjct  340   ENNPHNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLG--GKRKD  397

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVE-NQQMGYKYEFANLPWINSKPVPKPRRRKL  578
              TD DW++A FLFY+ENA+ V  +V D +   + + Y YE  ++PW+ SKP  +  R K 
Sbjct  398   PTDTDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKT  457

Query  577   ALRSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKF  401
               + +A  + T FP T D    V+V R   + RTK+EK  EEE+L+I+ IE ++N+  KF
Sbjct  458   KAKVSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKF  517

Query  400   DVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVL  221
             DV++ND+ E     DK+EFAGSF H+PH+QK   K +T+L LG+ + +EDLG E+D  VL
Sbjct  518   DVFINDDAESLSRKDKSEFAGSFVHVPHKQKTGTKTKTNLKLGITDLLEDLGVEEDSCVL  577

Query  220   VTLAPNVGGGVVTIDNIKIEYGS  152
             VTL P V    +T+   KIEY S
Sbjct  578   VTLVPRVSNSPITVGGFKIEYSS  600



>gb|ABI96937.1| putative polyphenol oxidase [Kageneckia oblonga]
Length=453

 Score =   465 bits (1197),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 244/457 (53%), Positives = 318/457 (70%), Gaps = 24/457 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+  NCCPP A + +D++LP+  P  +R+RP  H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPPGAEFTNCCPPPATKIIDFKLPA--PGKLRIRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFP++E+QVHNSWLFFP
Sbjct  60    QAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +PFWNWD PAGM  P+I  D    LYD+ R+ SH PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKSPLYDKLRSASHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y G +   +    I  NL +MY++M +N+    LF G PYR+GD+ +PG GS+E
Sbjct  180   TLIDLDYNGTEDNVSTETTINANLKIMYRRMVSNSKNPLLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC++ ++ GY Y+  ++PW++SK  P PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLDTKKFGYVYQDVDIPWLSSK--PSPRRAKVAL  355

Query  571   ---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                             S+     T FP++L   +   V R  +K R+K++KE EEEIL+I
Sbjct  356   GKIAKKLGVAHAAGASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKDKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             EGIE   +   KFDVY+ND D+   G DK EFAGSF 
Sbjct  416   EGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFV  452



>gb|ADF59058.2| polyphenol oxidase IV [Pyrus x bretschneideri]
Length=587

 Score =   469 bits (1208),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 252/546 (46%), Positives = 346/546 (63%), Gaps = 25/546 (5%)
 Frame = -1

Query  1756  KVLCNAAHG-------GDSKIDRRDVIlglgglygaanlpa--AMAGPIEAPEVSKCVVP  1604
             +V C A  G       G +++DRR++++GLG            A A PI AP+++ C   
Sbjct  48    RVRCKATKGDNDSLDQGLARLDRRNMLIGLGAGGLYGAAGNPFAFAAPISAPDLTTC--G  105

Query  1603  PTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL--DGKYKEKFAKAVEMM  1430
             P D P G+ +D CCPPT    +D++LP   P  +R RPA   +  D  Y  K+ KAVE+M
Sbjct  106   PADKPDGSTID-CCPPTTTTIIDFKLPDKGP--LRTRPAAQDVAKDPAYLAKYKKAVELM  162

Query  1429  KALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILG  1250
             +ALP DDPRS  QQA VHC+YC+G Y QVG+ D+EIQVH  WLFFPFHRWYLYF+E+ILG
Sbjct  163   RALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWYLYFYEKILG  222

Query  1249  KLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEA  1070
             +LI DPTF LPFWNWD PAGM  P I  D + SLYD+ RN +H PP ++DL Y G D + 
Sbjct  223   ELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDLNYSGTDDDV  282

Query  1069  TDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDP  890
              D  RI  NL  MY+QM + A +  LF G+PY +GD  +PGAG++E+ PH  IH W GDP
Sbjct  283   DDPTRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPSPGAGNIESIPHNNIHFWTGDP  342

Query  889   RRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLFY  713
              + NGEDMG FYS+GRD  FY HH+NVDRMW+I++ +LGG   ++     DW++  FLFY
Sbjct  343   TQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKT----DWLDTEFLFY  398

Query  712   NENAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYVATVFP  536
             +E    VRV+V D ++ +++GY Y +   +PW+  KP  +    K     ++  + T FP
Sbjct  399   DEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNKRKASVSSSDLTTTFP  458

Query  535   VTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGY  359
               L D +           RT  +K+ ++E+L+I+GIE   N+  KFDV++ND+ +   G 
Sbjct  459   AVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVFVNDDADSLAGK  518

Query  358   DKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTI  179
             DK+EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D +++VTL P VG G +TI
Sbjct  519   DKSEFAGSFVHVPHKHK--KNIKTNLRLSIASLLEELAAETDSSLVVTLVPKVGKGPITI  576

Query  178   DNIKIE  161
                 IE
Sbjct  577   GGFSIE  582



>ref|XP_010100567.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82810.1| Polyphenol oxidase [Morus notabilis]
Length=604

 Score =   469 bits (1208),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 282/548 (51%), Positives = 373/548 (68%), Gaps = 30/548 (5%)
 Frame = -1

Query  1747  CNAAHGGDSKIDRRDVIlglgglygaanlpa---AMAGPIEAPEVSKCVVPPTDLPAGAD  1577
              N+++ G  K+DRR+++LGLGGLYGAA L +   A+A P+  P++SKC  P + LPAG  
Sbjct  65    ANSSNSGVGKLDRRNMLLGLGGLYGAAGLGSDRFAIADPLLPPDLSKCSTP-SGLPAGV-  122

Query  1576  VDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSF  1397
             V  CCPP +   +DY+ P      +RVRPA H +D +Y  K+ +A + M+ LP  DPR+F
Sbjct  123   VTECCPPYSDEIIDYKPPR---TPLRVRPAAHLVDSEYIAKYNEATKRMRKLPDSDPRNF  179

Query  1396  TQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLP  1217
              QQA VHCAYCNGAYDQV +P+I +QVHN W FFPFHRWYLYF+E+ILGKLI DPTF LP
Sbjct  180   MQQANVHCAYCNGAYDQVNYPEIVLQVHNGWHFFPFHRWYLYFYEKILGKLIDDPTFALP  239

Query  1216  FWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDL--GYQGKDTEATDLERITNN  1043
             FWNWD P GM  P+   +++ +LYDE R+  H PP++VDL  G     T  T  E++  N
Sbjct  240   FWNWDHPNGMQMPAFFTNKSSALYDEKRSIKHQPPSLVDLNFGLSKDTTPKTYNEQVQEN  299

Query  1042  LALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDP--RRKNGED  869
             L +MY+ M + A    LF G+PYR G  K PGAG++E +PH  IH W G    R KNGE+
Sbjct  300   LTIMYQSMVSGAKLQSLFFGEPYRQGTDKEPGAGTVERTPHTAIHIWGGSEKDREKNGEN  359

Query  868   MGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVR  689
             +GNFYSAGRD  FY HHANVDRMW++W+ +GGR RK + +D D++NA FLFY+ENA+ VR
Sbjct  360   LGNFYSAGRDPMFYSHHANVDRMWSLWKTIGGRKRK-DISDPDYLNAEFLFYDENARLVR  418

Query  688   VRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL---------ALRSAAPYVA-TVF  539
             V+V DC++ +++GY Y+   LPW+  K  PKPR+ KL         A  + A  VA + F
Sbjct  419   VKVRDCLDTKKLGYIYDDVELPWLYKK--PKPRKSKLVKLLKNLGVARAADAKRVALSDF  476

Query  538   PVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGG  362
             P+TL D +V   VPR  K R+KEEKE EEE+L+IEGIE       KFDVY+NDED P  G
Sbjct  477   PITLTDNIVTTVVPRAIKGRSKEEKEEEEEVLIIEGIEFDKELAVKFDVYVNDEDVP--G  534

Query  361   YDKAEFAGSFAHLPHRQK-NVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVV  185
              DK+EFAGSF ++PH+ K   E+ + SL LG+++ ++D+GA+DD+ ++V L P      V
Sbjct  535   PDKSEFAGSFGNVPHKLKPGAERGKVSLKLGISDLLDDVGADDDENIIVALVPK-NNYPV  593

Query  184   TIDNIKIE  161
             TI  IKIE
Sbjct  594   TIGGIKIE  601



>gb|ABI96951.1| putative polyphenol oxidase [Vauquelinia californica]
Length=453

 Score =   464 bits (1194),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 243/457 (53%), Positives = 320/457 (70%), Gaps = 24/457 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P+VSKC     DLP GA+V NCCPP A + +D++LP+  P+ +R+RP  H +D
Sbjct  4     FAKPIAPPDVSKCGS--ADLPPGAEVTNCCPPPATKIIDFKLPA--PSKLRIRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y++KF KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ G+P++E+QVHNSWLFFP
Sbjct  60    QAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF +PFWNWD P GM  P+I  D    LYD+ R+ +H PP
Sbjct  120   FHRYYLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPAIYADPKSPLYDKFRSANHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y G +   ++   I  NL +MY+QM +N+   +LF G P R+GD+ +PG GS+E
Sbjct  180   TLIDLDYNGTEDNVSNETTINANLKIMYRQMVSNSKNPQLFFGNPDRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P H W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPGHLWTGDHTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLG--GKRTDL  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V DC+E +++GY Y+  ++PW++SKP   PRR K+AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDCLETKKLGYGYQDVDIPWLSSKPT--PRRAKVAL  355

Query  571   ---------------RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                             S+     T FP++L   +   V R  +K R+K++KE EEEIL+I
Sbjct  356   SKIAKKLGVAHAAGASSSKVVTGTEFPISLGSKISTVVKRPKQKKRSKKDKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             EGIE   +   KFDVY+ND D+   G DK EFAGSF 
Sbjct  416   EGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFV  452



>gb|AEM45934.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   468 bits (1204),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 273/578 (47%), Positives = 360/578 (62%), Gaps = 31/578 (5%)
 Frame = -1

Query  1861  SLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVI----l  1694
             S S PR  A   +R P      L  + P    +  ++ C A  G   ++DRRDV+     
Sbjct  4     STSVPRCTATPGARMP----CSLQAVVPTKARQPRRLSCKATGG---RVDRRDVLLGLGS  56

Query  1693  glgglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFS  1514
                   G      A+A PI+AP++  C   P DLP  A   NCCP +    +D+ LP  S
Sbjct  57    AAATGLGRQRGRGAIAAPIQAPDLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPAS  114

Query  1513  PATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFP  1334
              A +RVRPA H  D +Y  K+ +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFP
Sbjct  115   SAPLRVRPAAHLADAEYLAKYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFP  174

Query  1333  DIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNV  1154
             D+EIQVHN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  +R+ 
Sbjct  175   DLEIQVHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSS  234

Query  1153  SLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPY  974
              LY+E R+ +H PP  VDL Y   D      E+I  NL +MY+QM ++A    LF+G+PY
Sbjct  235   PLYNERRDPAHQPPFPVDLDYNEIDVIIPTDEQIDQNLNIMYRQMVSSAKKTRLFMGQPY  294

Query  973   RSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWT  794
             R+GD+ +PGAGS+EN PH  +H W GDP + N EDMGNFYSA RD  F+ HH N+DR+W 
Sbjct  295   RAGDQPDPGAGSLENLPHNTVHIWTGDPAQPNSEDMGNFYSAARDPIFFAHHGNIDRLWH  354

Query  793   IWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWIN  614
             +W+ L  R    NFTDADW++ +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ 
Sbjct  355   VWRGL--RPGNANFTDADWLDTAFLFYDEEARPVRVRVRDCLDPAAMGYSYQDVGLPWLK  412

Query  613   SKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
             +KP  + RR       A        P TL   VRV V RP+ +R+ +EKE  EE+L+IEG
Sbjct  413   AKPGKRSRRTPAPAAGAL-------PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIIEG  465

Query  433   iEVQAN-QYTKFDVYLNDEDEPDGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLG  272
             I+V  + ++ KFDV +N    P+ G D A    AGS A  PH  +  +K   ++T    G
Sbjct  466   IQVADHFKFVKFDVLVN---APESGGDAASGYCAGSVAMTPHMVRTNKKKGSMKTVARFG  522

Query  271   LNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + + M+++GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  523   VCDLMDNIGADGDKTVVVSLVPRCGGELVTVGGVSIGY  560



>ref|XP_004293563.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   469 bits (1206),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 269/594 (45%), Positives = 358/594 (60%), Gaps = 37/594 (6%)
 Frame = -1

Query  1867  MASLSPPRAPANLF-----------SRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGD-  1724
             MAS  PP   A +F           S  P  T         +V+  +  ++C A +  D 
Sbjct  1     MASPLPPSCTATIFCPNTSLMTSNTSVTPFFTKKFKSQKPSLVIRPKQGIVCKATNNNDQ  60

Query  1723  -----SKIDRRDVIlglgg-----lygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADV  1574
                   K+DRR++++GLG        G    P A A P+  P+++ C   P D P G  +
Sbjct  61    NKDAVGKLDRRNMLIGLGAGGLYGTAGLETNPFAFAAPVPPPDLATC--GPADKPDGTTI  118

Query  1573  DNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL--DGKYKEKFAKAVEMMKALPADDPRS  1400
             D CCPP     +D++LP   P  MR R A   +  D  Y  K+ KA+E+M+ALP DDPRS
Sbjct  119   D-CCPPKTTTIIDFKLPD--PGPMRTRLAAQNVAKDPVYLAKYKKAIELMRALPDDDPRS  175

Query  1399  FTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGL  1220
               QQA VHC+YC+G Y   GF D+EIQVH  WLF+P+HR YLYF+E+I+ KLI DPTF L
Sbjct  176   LAQQAMVHCSYCDGGYPMAGFSDLEIQVHFCWLFYPWHRLYLYFYEKIMCKLIDDPTFAL  235

Query  1219  PFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNL  1040
             PFWNWD PAGM  PSI  D   SLYD+ RN +H PP ++DL Y G D +  D  RI  NL
Sbjct  236   PFWNWDAPAGMYIPSIFTDTTSSLYDQYRNAAHQPPKLLDLNYGGTDDDTDDKTRIRENL  295

Query  1039  ALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGN  860
               MY+QM + A +  LF G+PY +GD+ NPGAG++E+ PH  IH W GDP + NGEDMG 
Sbjct  296   TTMYQQMISKATSHRLFFGEPYSAGDEPNPGAGNIESIPHNNIHLWTGDPTQTNGEDMGA  355

Query  859   FYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRV  680
             FYSAGRD  FY HHANVDRMW+I++  GG     + T  DW++  FLFY+EN   VRV+V
Sbjct  356   FYSAGRDPIFYSHHANVDRMWSIYKARGG----TDITKKDWLDTEFLFYDENKNLVRVKV  411

Query  679   GDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTL-Drvvrvkv  503
              D ++  ++GYKY+   +PW+NSKP  +  + K     ++  + + FP TL + +     
Sbjct  412   RDSLDESKLGYKYQDVEIPWLNSKPTARKSKNKRKAAVSSADLTSKFPATLSETISVEVA  471

Query  502   prpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHL  323
                   RT  EK  EEE+L+I GIE   ++  KFDVY+ND+ +   G DKAEFAGSF H+
Sbjct  472   RPSAAKRTTAEKTKEEEVLVISGIEFAGSEMLKFDVYVNDDADEVSGKDKAEFAGSFVHV  531

Query  322   PHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             PHR    +KI+T+L LG+   + DLGAE+D++V+VTL P  G G + I   KIE
Sbjct  532   PHRAN--KKIKTNLRLGITNLLTDLGAEEDNSVVVTLVPKFGKGAI-IGGFKIE  582



>gb|EPS59410.1| polyphenoloxidase [Genlisea aurea]
Length=575

 Score =   468 bits (1204),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 254/547 (46%), Positives = 342/547 (63%), Gaps = 33/547 (6%)
 Frame = -1

Query  1753  VLCNAAHGGDS----------KIDRRDVIlglgglygaanlpaAMAGPIEAPEVSKCVVP  1604
             + C+AA   +S          K+DRR+++ GLGG+     + A  A PIE PE +KC   
Sbjct  30    ISCSAAKSPNSSNPDPATPLPKVDRRNILFGLGGVGLMNPMDAG-ANPIEPPEFNKCGTA  88

Query  1603  PTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMK  1427
              T+L  G  +D NCCPP   + +D++LP      +RVR + HR+  +Y  K+  A++ MK
Sbjct  89    -TNLNTGKPLDINCCPPVTTKIIDFKLPPV--GKIRVRNSAHRVSAEYTAKYNAAIKAMK  145

Query  1426  ALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGK  1247
             +LP DDPRSF QQA VHCAYCNGAYDQ G   I++QVHNSWLFFPFHRWYLYFFE+ILG 
Sbjct  146   SLPDDDPRSFKQQANVHCAYCNGAYDQPGGGKIDLQVHNSWLFFPFHRWYLYFFEKILGS  205

Query  1246  LIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEAT  1067
             LI+DP F LPFWNWD P GM  P I  D N ++YD NRNQ+HLPP ++DLG  G     T
Sbjct  206   LIKDPDFALPFWNWDNPKGMTIPPIFLDSNSAIYDVNRNQAHLPPAVIDLGLTGN----T  261

Query  1066  D-LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDP  890
             D L+ ++NNL +MY +M     +   F+GK YR GD  NPG G+ E   H  +H WVGD 
Sbjct  262   DPLQVVSNNLTIMYNEMLRGNSSVYDFMGKAYREGDGPNPGPGASERGSHTSVHVWVGDT  321

Query  889   RRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQL--GGRGRKRNFTDADWINASFLF  716
             R  +GEDMGNFYSAGRD  FY HH NVDRMW +WQ      +   +  TD D++NA+FLF
Sbjct  322   RTPSGEDMGNFYSAGRDPLFYVHHTNVDRMWVLWQYFLPSNKVPDKRITDPDFLNAAFLF  381

Query  715   YNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA---LRSAAPYVAT  545
             Y+ENAQ  RV V DC++N  +GY+YE  +LPWI+ +P P+  + K++     +     AT
Sbjct  382   YDENAQLTRVTVKDCLDNLSLGYEYERIDLPWIDYRPPPQTAKAKISRIDTGAKTATSAT  441

Query  544   VFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDG  365
             +FP+ L+          +    K +K   +E+L++E I V   ++ KFDV++NDEDE   
Sbjct  442   LFPLKLE-------SVVRVLVPKTKKGKADELLVLENITVDTTKFLKFDVFINDEDEKPT  494

Query  364   GYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVV  185
               DKA + G++A +PH+  N     TS+ L L +  +D+  E+D+ ++VTL P   G  V
Sbjct  495   ELDKAAYVGTYAQVPHKT-NAGTATTSIQLKLTDVYDDMNVEEDEDLIVTLVPRHQGPGV  553

Query  184   TIDNIKI  164
             TI  IKI
Sbjct  554   TIGGIKI  560



>ref|XP_009334438.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=586

 Score =   468 bits (1205),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 251/546 (46%), Positives = 346/546 (63%), Gaps = 25/546 (5%)
 Frame = -1

Query  1756  KVLCNAAHG-------GDSKIDRRDVIlglgglygaanlpa--AMAGPIEAPEVSKCVVP  1604
             +V C A  G       G +++DRR++++GLG            A A PI AP+++ C   
Sbjct  47    RVRCKATKGDNDNLDQGLARLDRRNMLIGLGAGGLYGAAGNPFAFAAPISAPDLTTC--G  104

Query  1603  PTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL--DGKYKEKFAKAVEMM  1430
             P D P G+ +D CCPP+    +D++LP   P  +R RPA   +  D  Y  K+ KAVE+M
Sbjct  105   PADKPDGSTID-CCPPSTTTIIDFELPDSGP--LRTRPAAQDVAKDPAYLAKYKKAVELM  161

Query  1429  KALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILG  1250
             +ALP DDPRS  QQA VHC+YC+G Y QVG+ D+EIQVH  WLFFPFHRWYLYF+E+ILG
Sbjct  162   RALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWYLYFYEKILG  221

Query  1249  KLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEA  1070
             +LI DPTF LPFWNWD PAGM  P I  D + SLYD+ RN +H PP ++DL Y G D + 
Sbjct  222   ELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDLNYSGTDDDV  281

Query  1069  TDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDP  890
              D  RI  NL  MY+QM + A +  LF G+PY +GD  +PGAG++E+ PH  IH W GDP
Sbjct  282   DDPTRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPSPGAGNIESIPHNNIHFWTGDP  341

Query  889   RRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLFY  713
              + NGEDMG FYS+GRD  FY HH+NVDRMW+I++ +LGG   ++     DW++  FLFY
Sbjct  342   TQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKT----DWLDTEFLFY  397

Query  712   NENAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYVATVFP  536
             +E    VRV+V D ++ +++GY Y +   +PW+  KP  +    K     ++  + T FP
Sbjct  398   DEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNKRKASVSSSDLTTTFP  457

Query  535   VTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGY  359
               L D +           RT  +K+ ++E+L+I+GIE   N+  KFDV++ND+ +   G 
Sbjct  458   AVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVFVNDDADSLAGK  517

Query  358   DKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTI  179
             DK+EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D +++VTL P VG G +TI
Sbjct  518   DKSEFAGSFVHVPHKHK--KNIKTNLRLSIASLLEELAAETDSSLVVTLVPKVGKGPITI  575

Query  178   DNIKIE  161
                 IE
Sbjct  576   GGFSIE  581



>gb|AED02598.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=584

 Score =   468 bits (1205),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 250/547 (46%), Positives = 342/547 (63%), Gaps = 26/547 (5%)
 Frame = -1

Query  1756  KVLCNAAHGGD-------SKIDRRDVIlglgglygaanlpa-----AMAGPIEAPEVSKC  1613
             +V C A +GG+       S++DRR++++GLG               A A P+ AP++++C
Sbjct  44    RVRCKATNGGNDHLEQGLSRLDRRNMLIGLGAGGLYGATGLENNPFASAAPVSAPDLTQC  103

Query  1612  VVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEM  1433
                P D P G  +D CCPPT    +D++LP   P   R+       D  Y  K+ KA+ +
Sbjct  104   --GPADKPDGTTID-CCPPTTTTIIDFKLPDKGPLRTRLAAQDVAKDPVYLAKYKKAIAL  160

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             M+ALP DDPRSFTQQA VHC+YC+G Y QVG+P++EIQVH  WLFFPFHRWYLYFFE+I+
Sbjct  161   MRALPDDDPRSFTQQAMVHCSYCDGGYPQVGYPNLEIQVHFCWLFFPFHRWYLYFFEKIM  220

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             G+LI DPTF LPFWNWD P GM  P I  D    LYD+ RN +H PP ++DL Y G D +
Sbjct  221   GELIGDPTFALPFWNWDAPVGMYLPEIFTDTTSPLYDQYRNAAHQPPKLLDLNYGGTDDD  280

Query  1072  ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGD  893
               D  RI  NL  MY+QM + A +  LF G+PY +GD  +PGAG++EN+PH  IH W GD
Sbjct  281   VDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDASSPGAGNIENTPHNNIHLWTGD  340

Query  892   PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLF  716
             P + NGEDMG FYSAGRD  F+ HH+NVDRMW+I++ +LGG   K+     DW++A FLF
Sbjct  341   PTQTNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGGTDIKKT----DWLDAEFLF  396

Query  715   YNENAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYVATVF  539
             Y+E    +RV+V D ++  ++GY Y +   +PW+  KP  +    K     ++  + T F
Sbjct  397   YDEKKNLMRVKVRDSLDTTKLGYVYGDKVEIPWLTYKPTARKSSNKRKATVSSADLTTNF  456

Query  538   PVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGG  362
             P TL D +         K RT  +K+ ++E+L+I GI+   N+  KFDVY+ND+ +   G
Sbjct  457   PATLTDTITVEVARTSTKKRTSAQKKAQDEVLVISGIKYAMNKAVKFDVYVNDDADSLAG  516

Query  361   YDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
              DK+EFAGSF H+PH  K  + I T+L L + + +E+L AE D +V+VTL P +  G VT
Sbjct  517   KDKSEFAGSFVHVPH--KGSKDITTTLRLSITKLLEELDAETDSSVVVTLVPKI--GTVT  572

Query  181   IDNIKIE  161
             I     E
Sbjct  573   IGGFSTE  579



>gb|AEM45933.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   467 bits (1201),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 275/578 (48%), Positives = 362/578 (63%), Gaps = 31/578 (5%)
 Frame = -1

Query  1861  SLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgg  1682
             S S PR  A   +R P      L  + P    +   + C A  G   ++DRRDV+LG+G 
Sbjct  4     STSVPRCTATPGARMP----CSLQAVVPTKARQPRHLSCKATGG---RVDRRDVLLGIGS  56

Query  1681  lyga----anlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFS  1514
                          A+A PI+AP++  C   P DLP  A   NCCP +    +D+ LP  S
Sbjct  57    AAATGLGRQRGRGAIAAPIQAPDLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPAS  114

Query  1513  PATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFP  1334
              A +RVRPA H  D +Y  K+ +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFP
Sbjct  115   SAPLRVRPAAHLADAEYLAKYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFP  174

Query  1333  DIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNV  1154
             D+EIQVHN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD PAGM  P+I  +R+ 
Sbjct  175   DLEIQVHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSS  234

Query  1153  SLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPY  974
              LY+E R+ +H PP  VDL Y   D      E+I  NL +MY+QM ++A    LF+G+PY
Sbjct  235   PLYNERRDPAHQPPFPVDLDYNEIDVIIPTDEQIDQNLNIMYRQMVSSAKKTRLFMGQPY  294

Query  973   RSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWT  794
             R+GD+ +PGAGS+EN PH  +H W GDP + N EDMGNFYSA RD  F+ HH N+DR+W 
Sbjct  295   RAGDQPDPGAGSLENLPHNTVHIWTGDPAQPNSEDMGNFYSAARDPIFFAHHGNIDRLWH  354

Query  793   IWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWIN  614
             +W+ L  R    NFTDADW++ +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ 
Sbjct  355   VWRGL--RRGNANFTDADWLDTAFLFYDEEARPVRVRVRDCLDPAAMGYSYQDVGLPWLK  412

Query  613   SKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
             +KP  + RR       A        P TL   VRV V RP+ +R+ +EKE  EE+L+IEG
Sbjct  413   AKPGKRSRRTPAPAAGAL-------PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIIEG  465

Query  433   iEVQAN-QYTKFDVYLNDEDEPDGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLG  272
             I+V  + ++ KFDV +N    P+ G D A    AGS A  PH  +  +K   ++T    G
Sbjct  466   IQVADHFKFVKFDVLVN---APESGGDAASGYCAGSVAMTPHMVRTNKKKGSMKTVARFG  522

Query  271   LNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + + M+++GA+ D TV+V+L P  GG +VT+  + I Y
Sbjct  523   VCDLMDNIGADGDKTVVVSLVPRCGGELVTVGGVSIGY  560



>ref|XP_008225000.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   468 bits (1203),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 251/547 (46%), Positives = 341/547 (62%), Gaps = 26/547 (5%)
 Frame = -1

Query  1756  KVLCNAAHGGD-------SKIDRRDVIlglgglygaanlpa-----AMAGPIEAPEVSKC  1613
             +V C A +GG+       S++DRR++++GLG               A A PI AP++++C
Sbjct  48    RVRCKATNGGNDHLEQGLSRLDRRNMLIGLGAGGLYGATGLENNPFASAAPISAPDLTQC  107

Query  1612  VVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEM  1433
                P D P G+ +D CCPPT    +D++LP   P   R+       D  Y  K+ KA+ +
Sbjct  108   --GPADKPDGSTID-CCPPTTTTIIDFKLPDKGPLRTRLAAQDVAKDPVYLAKYKKAIAL  164

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             M+ALP DDPRSFTQQA VHC YC+  Y QVG+P++EIQVH  WLFFPFHRWYLYFFE+I+
Sbjct  165   MRALPDDDPRSFTQQAMVHCTYCDDGYPQVGYPNLEIQVHFCWLFFPFHRWYLYFFEKIM  224

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             G+LI DPTF +PFWNWD P GM  P I  D    LYD+ RN +H PP ++DL Y G D +
Sbjct  225   GELIGDPTFAIPFWNWDAPVGMYLPEIFTDTTSPLYDQYRNAAHQPPKLLDLNYGGTDDD  284

Query  1072  ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGD  893
               D  RI  NL  MY+QM + A +  LF G+PY +GD  +PGAG++EN+PH  IH W GD
Sbjct  285   VDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDASSPGAGNIENTPHNNIHLWTGD  344

Query  892   PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLF  716
             P +KNGEDMG FYSAGRD  F+ HH+NVDRMW+I++ +LGG   K+     DW++A FLF
Sbjct  345   PTQKNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGGTDIKKT----DWLDAEFLF  400

Query  715   YNENAQPVRVRVGDCVENQQMGYKYE-FANLPWINSKPVPKPRRRKLALRSAAPYVATVF  539
             Y+E    +RV+V D ++  ++GY Y+    +PW+  KP  +    K     ++  + T F
Sbjct  401   YDEKKNLMRVKVRDSLDTTKLGYVYDDKVEIPWLTYKPTARKSSNKRKATVSSADLTTNF  460

Query  538   PVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGG  362
             P TL D +         K RT  +K+ ++E+L+I GI+   N+  KFDVY+ND+ E   G
Sbjct  461   PATLTDTISVEVARTSTKKRTSAQKKAQDEVLVISGIKYAGNKTVKFDVYVNDDAESLAG  520

Query  361   YDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
              DK+EFAGSF H+PH  K  + I T+L L + + +E+L AE D +V+VTL P    G VT
Sbjct  521   KDKSEFAGSFVHVPH--KGSKDITTTLRLSITKLLEELDAETDSSVVVTLVPKF--GTVT  576

Query  181   IDNIKIE  161
             I     E
Sbjct  577   IGGFSTE  583



>dbj|BAM15846.1| hypothetical protein [Portulaca oleracea]
Length=597

 Score =   468 bits (1203),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 270/559 (48%), Positives = 368/559 (66%), Gaps = 34/559 (6%)
 Frame = -1

Query  1759  LKVLCNAAHGGDSK-------IDRRDVIlglgglygaanlp----aAMAGPIEAPEVSKC  1613
             LK+ CNAA   D +       +DRR+++LGLGGLYGAA       A++A P  AP +++C
Sbjct  45    LKISCNAAKKDDQQNPNEQHVLDRRNMLLGLGGLYGAAATFGVAPASLAKPT-APAITQC  103

Query  1612  VVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEM  1433
                  +LPA   V NCCPP +   LD++ PS S    R+RPA H +D KY EK+ KA+ +
Sbjct  104   SPDSEELPANVKV-NCCPPMSNNILDFK-PSNSSRITRIRPAAHLVDTKYLEKYHKAISL  161

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             MKALP  DPRSFTQQA VHCAYCNGAY QVGFP I++QVH SWLFFPFHR YLYF+E+IL
Sbjct  162   MKALPDSDPRSFTQQANVHCAYCNGAYHQVGFPKIDLQVHGSWLFFPFHRAYLYFYEKIL  221

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             G LI DPTF +P+WNWD P GM  P+I  D   +LYD  R+  H P   +DL Y G D +
Sbjct  222   GSLINDPTFAIPYWNWDHPDGMTLPAIFADPKSTLYDPVRDSVHTPMVALDLSYDGTDHD  281

Query  1072  ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGD  893
                 ++I  NL +MY+QM +NA  + LF+G+PYR+GD  +   GS+E  PH P+H WVG 
Sbjct  282   VPKDQQIKTNLTVMYRQMVSNAKNSGLFMGQPYRAGDTGS-KPGSLETMPHGPVHIWVGK  340

Query  892   PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFY  713
              +  N EDMGNFYSA RD  FY HH NVDRMW++W+ LG +   +NF D+D++++SF+FY
Sbjct  341   -KTPNREDMGNFYSAARDPIFYAHHGNVDRMWSVWRTLGPKN--KNFKDSDFLDSSFVFY  397

Query  712   NENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA-----  548
             +ENA+ VR+RV D ++ +++GY+Y+  +LPW+ S+P P+  + K         VA     
Sbjct  398   DENAKAVRIRVRDVLDTKKLGYEYQPVDLPWLKSRPTPRRAKVKAVFNKVKDAVAAEPST  457

Query  547   -----TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLND  383
                    FP  LD+V+R  + RP+K+RTK  K+ EEE+L+IE    +A++++KFDVY+ND
Sbjct  458   MDVPTVAFPKPLDKVIRTHLMRPQKSRTKRAKDDEEEVLVIEVES-KAHEFSKFDVYVND  516

Query  382   EDE--PDGGYDKAEFAGSFAHLPHRQKN---VEKIRTSLSLGLNEAMEDLGAEDDDTVLV  218
             EDE        + E+AGSF ++PH+ K      K+ T+L  GL + +EDLGA+DD+ + V
Sbjct  517   EDEYLTKENRVRTEYAGSFVNVPHKHKTGGKEHKMNTTLRFGLTDLIEDLGADDDEGIDV  576

Query  217   TLAPNVGGGVVTIDNIKIE  161
              L P VG   V I ++KIE
Sbjct  577   ILVPRVGTESVVIKSVKIE  595



>ref|XP_011016645.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=560

 Score =   466 bits (1199),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 265/549 (48%), Positives = 363/549 (66%), Gaps = 16/549 (3%)
 Frame = -1

Query  1777  VVLNRRL---KVLCNAAHGGDSKIDRRDVIlgl--gglygaanlpaAMAGPIEAPEVSKC  1613
             V   +RL   +V C A     +   RRDV++GL             A A PI  P+++ C
Sbjct  16    VTKTKRLNVPRVSCKATDDTQNPATRRDVLIGLGGLYSATNLADRTAYAKPITPPDLTNC  75

Query  1612  VVPPTDLPAGADVDNCCPPTAGRYLDYQLPS-FSPATMRVRPALHRLDGKYKEKFAKAVE  1436
              +   DLP   +  NCC P   + +D++ PS F P  +R R A H +D  Y  K+A+A+ 
Sbjct  76    EL--VDLPNPENPTNCCSPLPKKIIDFRPPSPFFP--LRTRRAAHLVDEDYVAKYAEAIS  131

Query  1435  MMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERI  1256
             +MK+LP DDPR+F QQA VHCAYCNGAY+QVGFP +E+ VH  WLFFP+HR+YLYF+ERI
Sbjct  132   LMKSLPEDDPRNFYQQANVHCAYCNGAYEQVGFPKLELDVHFCWLFFPWHRYYLYFYERI  191

Query  1255  LGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDT  1076
             LGKLI DPTF LPFWNWD P+GM  P I  D    LYD+ R+Q+H PP ++DL Y   D 
Sbjct  192   LGKLINDPTFALPFWNWDSPSGMQMPYIFTDPKSPLYDQFRDQNHQPPVLLDLDYAAGDP  251

Query  1075  EATDLERI-TNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWV  899
               T+  ++ ++NL +MYKQM + A    LF GKPYR+GD   PGAG++ENSPH  IHRW 
Sbjct  252   NPTNANKVYSSNLRVMYKQMVSGAAKPTLFFGKPYRAGDDSRPGAGTIENSPHNNIHRWT  311

Query  898   GDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFL  719
             GDP ++N EDMGNFYSA RD  F+CHH+NVDRMWT+W+ + G G +R+ +D DW+N+ FL
Sbjct  312   GDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTLWKTIPG-GIRRDISDPDWLNSEFL  370

Query  718   FYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVF  539
             FYNENA+ VR +V DC++N+++ Y Y+   +PW+ SKP+P+   +K A    A    T F
Sbjct  371   FYNENAELVRCKVRDCLDNRRLRYTYQNVEIPWLKSKPIPRRLGKKAAETKTALTPITAF  430

Query  538   PVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGY  359
             P+ LD+ +   V RPKK+R+++EKE E+E+L+IEGIE    ++ KFDV++ND+ E     
Sbjct  431   PLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGKFVKFDVFINDDLEMPSKP  490

Query  358   DKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAP--NVGGGVV  185
             +  EFAGSF ++ H  K+ +K +T L LG+ E +EDL  +DDD+++V L P  N     V
Sbjct  491   ENTEFAGSFVNVSH--KHAKKSKTRLILGITELLEDLETDDDDSIVVALVPRSNSVSDPV  548

Query  184   TIDNIKIEY  158
              I  +KIE+
Sbjct  549   VISGVKIEF  557



>gb|AEM45935.1| polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   466 bits (1198),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 271/556 (49%), Positives = 354/556 (64%), Gaps = 27/556 (5%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAP  1628
             L  L P  L    ++ C A  G   ++DRRDV+LGLG    A         A+A PI+AP
Sbjct  17    LQALVPTKLRLPRRLTCKATGG---RVDRRDVLLGLGSAAAAGLGTQRGRGAIAAPIQAP  73

Query  1627  EVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFA  1448
             ++  C   P DLP  A   NCCP +    +D+ LP  S A +RVRPA H  D ++  K+ 
Sbjct  74    DLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAALRVRPAAHLADAEHLAKYE  131

Query  1447  KAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYF  1268
             +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFPD+EIQVHN WLFFP+HR+YLYF
Sbjct  132   RAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHRFYLYF  191

Query  1267  FERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQ  1088
              ERILGKLI D TF LPFWNWD PAGM  P+I  +R+  LY+E RN +H PP  VDL Y 
Sbjct  192   HERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSSPLYNERRNPAHQPPFPVDLDYN  251

Query  1087  GKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIH  908
               D      E+I  NL +MY+QM + A    LF+G+PYR+GD+ +PGAGS+EN PH  +H
Sbjct  252   EIDVIIPTDEQIDQNLNIMYRQMVSGAKKTRLFMGQPYRAGDQPDPGAGSVENVPHGTMH  311

Query  907   RWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINA  728
              W GDP + N EDMGNFYSA RD  F+ HH N+DR+W +W+ L  R    +F DADW++ 
Sbjct  312   TWTGDPAQPNNEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPSNTDFADADWLDT  369

Query  727   SFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA  548
             +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ +KP  + RR       A     
Sbjct  370   AFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLKAKPAKRSRRTPAPAAGAL----  425

Query  547   TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN-QYTKFDVYLNDEDEP  371
                P TL   VRV V RP+ +R+ +EKE  EE+L+IEGI+V  + ++ KFDV +N    P
Sbjct  426   ---PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIIEGIQVADHFKFVKFDVLVN---AP  479

Query  370   DGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             + G D A    AGS A  PH  +  +K   ++T    G+ + M+++GA+ D TV+V+L P
Sbjct  480   ESGGDAASGYCAGSVAMTPHMVRTNKKKGSMKTVARFGVCDLMDNIGADGDKTVVVSLVP  539

Query  205   NVGGGVVTIDNIKIEY  158
               GG +VTI  + I Y
Sbjct  540   RCGGELVTIGGVSIGY  555



>gb|ABI96945.1| putative polyphenol oxidase [Prunus mexicana]
Length=452

 Score =   462 bits (1188),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 239/456 (52%), Positives = 314/456 (69%), Gaps = 23/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P++SKC     DLP GA   NCCPP A + +D++LP+  P  +RVRPA H +D
Sbjct  4     FAKPVNPPDLSKCGA--ADLPTGATPTNCCPPLATKIIDFKLPA--PGKLRVRPAAHSVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K++KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    QAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DPTF LPFWNWD PAGM  P++  +    LYD+ R  SH PP
Sbjct  120   FHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFANPKSPLYDKFRAASHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y G D + ++  +I  NL +MY+QM +NA   +LF G PYR+GD+ +PG GS+E
Sbjct  180   TLIDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSA RD  F+ HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             + +DW+++ FLFYNENA+ VRV+V D +E++ +GY Y+  ++PW+ SKP   PRR KL L
Sbjct  298   SQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPT--PRRAKLGL  355

Query  571   RSAAPYVAT--------------VFPVTLDrvvrvkv-prpkknrtkeekeleeeillie  437
                A  +                 FP+ L+  +   V    +K R K+EKE EEEIL+IE
Sbjct  356   SKIAKKLGVAHAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIE  415

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             GIE   +   KFDVY+ND D+   G DK EFAGSF 
Sbjct  416   GIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFV  451



>ref|XP_011098121.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=585

 Score =   466 bits (1199),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 245/485 (51%), Positives = 317/485 (65%), Gaps = 19/485 (4%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             A PI+APE+ KC V  T+L  G  +D NCCPPT+    DYQLP      M+VRP+ HR+ 
Sbjct  88    ANPIKAPELDKCGVA-TNLNTGEKLDMNCCPPTSENIADYQLPPV--VQMKVRPSAHRVS  144

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  K+  A++ MK LP DDPR+F QQA +HCAYCNGAYDQ G   +++QVHNSWLFFP
Sbjct  145   PEYIFKYNMAIDRMKRLPKDDPRNFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLFFP  204

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+ERI+GKLI DPTF LPFWNWD P GM  P +  D   +LYD  RNQ +L  
Sbjct  205   FHRWYLYFYERIMGKLIGDPTFALPFWNWDNPKGMTIPPMFLDPKSALYDSKRNQDNL-K  263

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              ++DLG  G       L+ ++NNL +M+ +M     +   F+GKPYR GDK NPG GS E
Sbjct  264   AVLDLGMTGNKDP---LQVVSNNLTIMHTEMVRGNASVYDFMGKPYREGDKVNPGPGSAE  320

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQL--GGRGRKR  758
                H  +H +VGDPR  +GED+GNFYSAGRD  FYCHHANVDRMWT+W+      +  +R
Sbjct  321   RGSHTAVHVFVGDPREPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWKYFLPSNKVPER  380

Query  757   NFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKL  578
               TD D++N SFLFY+ENAQ VRV V DCV+N +MGY +E  +LPW++ +P P+    K+
Sbjct  381   TITDPDFLNTSFLFYDENAQLVRVTVKDCVDNLRMGYDFERIDLPWLDYRPPPQTAGAKV  440

Query  577   A-LRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKF  401
                R +A    TVFP+ LD          +    K  K + +E+L+IE I V   ++ KF
Sbjct  441   KRTRKSAENAETVFPLKLD-------KIVRVLVPKTRKGVADEVLVIEDITVDTTKFLKF  493

Query  400   DVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVL  221
             DV++NDED+     DKA +AG++A +PH+  N +   TS+ L L E  ED+   DDDTVL
Sbjct  494   DVFVNDEDDNVEELDKAAYAGTYAQVPHKTNN-KTATTSIRLKLKELYEDMDVADDDTVL  552

Query  220   VTLAP  206
             VTL P
Sbjct  553   VTLVP  557



>ref|XP_008371328.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=587

 Score =   465 bits (1197),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 248/544 (46%), Positives = 344/544 (63%), Gaps = 21/544 (4%)
 Frame = -1

Query  1756  KVLCNAAHG-------GDSKIDRRDVIlglgglygaanlpa--AMAGPIEAPEVSKCVVP  1604
             +V C A  G       G +++DRR++++GLG            A A P+ AP+++ C   
Sbjct  48    RVXCKATKGDNENLDQGLARLDRRNMLIGLGAGGLYGAAGNPFAFAAPVSAPDLTTC--G  105

Query  1603  PTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKA  1424
             P D P G+ +D CCPPT    +D++LP   P   R+       +  Y  K+ KA+E+M+A
Sbjct  106   PADKPDGSTID-CCPPTTTTIIDFKLPDRGPLRTRLAAQDVAKNPAYLAKYKKAIELMRA  164

Query  1423  LPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKL  1244
             LP DDPRSF QQAKVHC+YC+G Y QVG+ D+EIQVH  WLFFPFHRWYLYF+E+I+G+L
Sbjct  165   LPDDDPRSFAQQAKVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWYLYFYEKIMGEL  224

Query  1243  IRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATD  1064
             I DPTF LPFWNWD PAGM  P I  D + SLYD+ RN +H PP ++D  Y G D +  D
Sbjct  225   IGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDFNYSGTDDBVDD  284

Query  1063  LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRR  884
                I  NL  MY+QM + A +  LF G+PY +GD  +PGAG++E+ PH  IH W GDP +
Sbjct  285   ATXIKENLTTMYQQMVSKATSHRLFFGEPYSAGDDPSPGAGNIESIPHNNIHFWTGDPTQ  344

Query  883   KNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLFYNE  707
              NGEDMG FYS+GRD  FY HH+NVDRMW+I++ +LGG   ++     DW++  FLFY+E
Sbjct  345   TNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKT----DWLDTEFLFYDE  400

Query  706   NAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVT  530
                 VRV+V D ++ +++GY Y E   +PW+ SKP  +    K     ++  + T FP T
Sbjct  401   KKNLVRVKVCDSLDTKKLGYVYDEKVPIPWLKSKPTXRKSTNKRKAAVSSSDLTTTFPAT  460

Query  529   L-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK  353
             L + +           RT  +K+ ++E+L+I+GIE   N+  KFDVY+ND+ +   G DK
Sbjct  461   LSBTISVEVTRPSATKRTTAQKKAQDEVLVIKGIEFAGNETVKFDVYVNDDADSLAGKDK  520

Query  352   AEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDN  173
             +EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D +++VTL P VG G +TI  
Sbjct  521   SEFAGSFVHVPHKHK--KNIKTNLRLSITSLLEELDAETDSSLVVTLVPKVGKGPITIGG  578

Query  172   IKIE  161
               IE
Sbjct  579   FSIE  582



>gb|ABI96941.1| putative polyphenol oxidase [Physocarpus capitatus]
Length=451

 Score =   460 bits (1184),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 243/456 (53%), Positives = 317/456 (70%), Gaps = 24/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P++SKC     DLP G    NCCPP   + +D++LP+  P  +RVRP  H +D
Sbjct  4     FAKPVAPPDISKCGA--ADLPNGVQPTNCCPPPGTKIIDFKLPA--PNRLRVRPPAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K++KA+++MKALP DDPRSF QQA VHCAYC+GAYDQVGFPD+E+Q+HNSWLFFP
Sbjct  60    QAYIDKYSKAIQLMKALPDDDPRSFKQQALVHCAYCDGAYDQVGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERILGKLI DPTF LPFWNWD PAGM  P+I  +    LYD+ R+  H PP
Sbjct  120   FHRYYLYFYERILGKLINDPTFALPFWNWDSPAGMQLPAIYANPKSPLYDKFRHHQHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL Y G +   +    I  NL +MY+QM +NA    LF G PYR+GD+ +PG GS+E
Sbjct  180   TLVDLDYNGTEDNTSRETTINANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             ++PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDR+W+IW+ LG  G++ + 
Sbjct  240   STPHGPVHLWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFYNENA+ VRV+V D +E++++GY Y+  ++PW++SKP   PRR K AL
Sbjct  298   TDSDWLDSGFLFYNENAELVRVKVRDSLESKKLGYVYQDVDIPWLDSKPT--PRRAKQAL  355

Query  571   RSAAPYV--------------ATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeillie  437
                A  +              AT FP+ LD  +   V R  +K R K++KE EEEIL+IE
Sbjct  356   SKIAKKLGIARAAESSTKIVAATAFPINLDTKISTVVTRPQQKKRNKKQKEDEEEILVIE  415

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             GIE + +   KFDVY+ND DEP G  D  EFAGSF 
Sbjct  416   GIEFERDVAVKFDVYVNDVDEPIGP-DNTEFAGSFV  450



>ref|XP_010686567.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=599

 Score =   465 bits (1197),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 284/604 (47%), Positives = 386/604 (64%), Gaps = 41/604 (7%)
 Frame = -1

Query  1867  MASLSPPRAPA--NLFS--RRPIPTHSHLHILTPVVLNRRL--KVLCNAAHGGDS-KIDR  1709
             MASLSP       NL +  R P+ + S           RR   K+ C AA+  +S K DR
Sbjct  1     MASLSPATTTTTPNLSAVPRNPLLSKSSQLSAFRATQTRRAPAKISCKAANNDESNKFDR  60

Query  1708  RDVIlglgglygaanlpa----AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRY  1541
             R++++GLGGLYGAA         +A P  AP+ ++CV  P  +  G+ +  CCPPT  ++
Sbjct  61    RNLLIGLGGLYGAATTLTGGNVTLAAPT-APDATQCV--PARIDDGSPL-QCCPPTPSQF  116

Query  1540  LDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCN  1361
             +D++ P   P  +R+RPA H +D KY  K++KA+ +MKALP  DPRSF QQA VHCAYCN
Sbjct  117   VDFKRPKVHPHKLRLRPAAHLVDDKYLAKYSKALALMKALPDSDPRSFKQQADVHCAYCN  176

Query  1360  GAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVF  1181
             G Y QVG P++E QVH SWLFFPFHR YLYF+ERILGKLI DPTF +P+WNWD P GMV 
Sbjct  177   GGYHQVGLPNLEFQVHGSWLFFPFHRAYLYFYERILGKLIDDPTFSIPYWNWDHPDGMVM  236

Query  1180  PSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEA--TDLERITNNLALMYKQMFTNA  1007
             PS+ ND+N   ++  R+Q+HLPP +++L Y G DT +  T+ ++I  NL +MYKQM  NA
Sbjct  237   PSMFNDQNSPFFNAVRDQNHLPPNVLNLSYDGPDTVSNLTNEQQINQNLTIMYKQMVVNA  296

Query  1006  GTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNG--EDMGNFYSAGRDIS  833
                 LFLG PYR+GD  NPG G++E  PH  IH WVG+P       EDMGNFYSAGRD  
Sbjct  297   KKPALFLGAPYRAGDPVNPGPGTLEVQPHGTIHNWVGNPPPNTPFWEDMGNFYSAGRDPI  356

Query  832   FYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQM  653
             FY HHANVDR W+IW+ +  R   ++F D D++N+ F FY+ENA+PV++ V D ++ +++
Sbjct  357   FYAHHANVDRTWSIWKNISPRN--KDFRDKDFLNSYFYFYDENAKPVKIYVKDVLDTKKL  414

Query  652   GYKYEFANLPWINSKPVPKPRRRKLALR--------------SAAPYVAT-VFPVTLDrv  518
             GY Y+  +LPW+ SKP PK  RR   L+              +  P V T VFP  L  +
Sbjct  415   GYDYQPMDLPWLKSKPTPKRNRRPKPLKKVFSTIKNAVAAETATDPVVPTVVFPKPLKNI  474

Query  517   vrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDG--GYDKAEF  344
             +R  +PRP+K+RT+ EK+ EEEIL+IE    +A+ Y+KFDVY+NDEDE        + E+
Sbjct  475   IRTNLPRPRKSRTQNEKDDEEEILVIEVES-RADVYSKFDVYVNDEDESPTLENRTQTEY  533

Query  343   AGSFAHLPHRQ--KNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNI  170
             AGSF ++PHR   K+     T++  GL+E ++DL A DD+ + V   P  G   V I ++
Sbjct  534   AGSFVNVPHRHVGKDGHLKMTTVKFGLSELIDDLDANDDEGIDVIFVPRTGTDSVIIKDV  593

Query  169   KIEY  158
             +IE+
Sbjct  594   RIEF  597



>ref|XP_008224999.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   465 bits (1196),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 251/547 (46%), Positives = 341/547 (62%), Gaps = 26/547 (5%)
 Frame = -1

Query  1756  KVLCNAAHGGD-------SKIDRRDVIlglgglygaanlpa-----AMAGPIEAPEVSKC  1613
             +V C A +GGD       S++DRR++++GLG      +        A A P+ APE +KC
Sbjct  48    RVRCKATNGGDDHLQQGLSRLDRRNMLIGLGAGGLYGSTGLENNPFAFAAPVSAPEFTKC  107

Query  1612  VVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEM  1433
                P D P G+ +D CCPPTA   +D++LP   P   R+       D  Y  K+ KA+ +
Sbjct  108   --GPADKPDGSTID-CCPPTATTIIDFKLPDKGPLRTRLAAQNVAKDPVYLAKYKKAIAL  164

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             M+ALP DDPRSF QQAKVHC+YC+G Y QV + D+EIQVH  WLF+PFHRWYLYFFE+I+
Sbjct  165   MRALPDDDPRSFAQQAKVHCSYCDGGYPQVEYSDLEIQVHFCWLFYPFHRWYLYFFEKIM  224

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             G+LI DPTF LPFWNWD PAGM  P I  D   SLYD+ RN +H PP ++DL Y G D +
Sbjct  225   GELIGDPTFALPFWNWDAPAGMYIPEIFTDTTSSLYDQYRNAAHQPPKLLDLNYGGTDDD  284

Query  1072  ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGD  893
               D  RI  NL  MY+QM + A +  LF G+PY +GD  NPGAG++E+ PH  IH W GD
Sbjct  285   VDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPNPGAGNIESIPHNNIHLWTGD  344

Query  892   PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRKRNFTDADWINASFLF  716
               + NGEDMG FYSAGRD  FY HH+NVDRMW+I++ +LGG   ++     D+++A FLF
Sbjct  345   TTQTNGEDMGAFYSAGRDPLFYAHHSNVDRMWSIYKSKLGGTDIEKK----DYLDAEFLF  400

Query  715   YNENAQPVRVRVGDCVENQQMGYKYE-FANLPWINSKPVPKPRRRKLALRSAAPYVATVF  539
             Y+E    VRV+V D ++  ++GY Y+    +PW+  KP  +    K     ++  + T F
Sbjct  401   YDEKKNLVRVKVRDSLDTTKLGYVYDNKVEIPWLTYKPTARKSSNKRKATVSSADLTTNF  460

Query  538   PVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGG  362
             P  L D +           RT  +K+ ++E+L+I GI+   N+  KFDVY+ND+ E   G
Sbjct  461   PAPLTDTISVEVARTSTTKRTSAQKKAQDEVLVISGIKYAGNETVKFDVYVNDDAESLAG  520

Query  361   YDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
              DK+EFAGSF  +PH+ K  + I T+L L + + +E+L AE D +V+VTL P V  G +T
Sbjct  521   KDKSEFAGSFIQVPHKGK--KDITTTLRLSITKLLEELDAETDSSVVVTLVPKV--GTIT  576

Query  181   IDNIKIE  161
             I  +  E
Sbjct  577   IGGVSTE  583



>gb|AAW58109.2| polyphenol oxidase [Prunus salicina var. cordata]
Length=597

 Score =   465 bits (1196),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 255/505 (50%), Positives = 329/505 (65%), Gaps = 12/505 (2%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A PI  P++S C  P    P G++   CCPP   +   ++ P  S   +R RPA H++ 
Sbjct  100   FADPIAPPDLSTCK-PAEITPGGSETVPCCPPVMTKIKTFK-PDLS-IPLRTRPAAHQVT  156

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  KF KA   M+ALP DDPRS  QQAKVHCAYCNGAY QVGF D +IQVH SWLFFP
Sbjct  157   DEYLAKFKKAQAAMRALPDDDPRSMVQQAKVHCAYCNGAYPQVGFTDNDIQVHFSWLFFP  216

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYF+ERILGKLI DPTF LP+WNWD P G   P I  D +  LYD+ RN  H PP
Sbjct  217   FHRMYLYFYERILGKLIDDPTFALPYWNWDSPVGFPIPDIYTDPSSPLYDKYRNADHQPP  276

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGD---KKNPGAG  941
              +VDL Y G + +  +  RI  NLA+MY+QM + A   +LF G  YR+GD   +K P  G
Sbjct  277   VLVDLSYGGTNDDVDEQTRIDENLAIMYRQMVSGAKNPDLFFGHAYRAGDLNTQKYP--G  334

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             ++EN PH  IH WVGDP + + EDMGNFYSAGRD  FY HH NVDRMW IW+ LG  G++
Sbjct  335   TIENMPHNNIHIWVGDPTQTHHEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLG--GKR  392

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVE-NQQMGYKYEFANLPWINSKPVPKPRRR  584
             ++ TD DW++A FLFY+ENA+ V  +V D +E  +Q+ Y YE A LPW+ +KP  +  + 
Sbjct  393   KDITDTDWLDAEFLFYDENAELVNCKVRDSLEPEKQLRYNYEPAPLPWLFTKPTARKTKN  452

Query  583   KLALRSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYT  407
             K   + AA  + + FP TLD    V+V R   + R+K+EK  EEE+L+I+ IE +  +  
Sbjct  453   KTKAKVAATQLTSKFPATLDSKTTVEVARPKPRKRSKKEKVDEEELLIIKDIEFEGTEAV  512

Query  406   KFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDT  227
             KFDV++ND+ E     DK+EFAGSF H+P  +    K +T+L LG+ + +EDLGAEDD +
Sbjct  513   KFDVFINDDAESLSRRDKSEFAGSFVHVPQGKTKKAKTKTNLKLGITDLLEDLGAEDDSS  572

Query  226   VLVTLAPNVGGGVVTIDNIKIEYGS  152
             VLVTL P +    +TI   KIEY S
Sbjct  573   VLVTLVPRISNSPITIGGFKIEYSS  597



>ref|XP_011082867.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=586

 Score =   464 bits (1195),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 278/560 (50%), Positives = 372/560 (66%), Gaps = 31/560 (6%)
 Frame = -1

Query  1765  RRLKVLCNAAHGGDS-------------KIDRRDVIlgl-----gglygaanlpaAMAGP  1640
             R+  + C A +G D              K DRR++++G+          +A+   A A P
Sbjct  36    RQFNLSCKARNGNDEQRESPGKEETFQGKFDRRNLLVGMGGLYGAANLVSADYSPAFASP  95

Query  1639  IEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKY  1463
             I AP++SKC    T+L     +D NCCPP + + +DY+LP  +   MR RPA H    +Y
Sbjct  96    ISAPDLSKCTRG-TNLNTQQPLDVNCCPPLSQKSIDYKLPPVT--KMRFRPAAHLASQEY  152

Query  1462  KEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHR  1283
               K+ KAVE+MKALP DDPRSF QQA VHCAYCN  Y+Q G P + +Q+HN W FFP+HR
Sbjct  153   IAKYEKAVELMKALPEDDPRSFMQQANVHCAYCNLTYEQTGDPSLRLQIHNCWHFFPWHR  212

Query  1282  WYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIV  1103
             WYL+F+ERILGKLI DPTFGLPFWNWD P GMV P++   ++  LY+  RNQ HLPP   
Sbjct  213   WYLFFYERILGKLIDDPTFGLPFWNWDNPPGMVMPNMFVKKDSPLYNPRRNQDHLPPATT  272

Query  1102  DLGYQGKDTEATDLERIT-NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             DL Y GK T  TD  +I  NNL  MY +M  N  T E F G  Y +G K +PG G++E  
Sbjct  273   DLNYAGKPT--TDPSKIIPNNLTEMYSEMVRNVSTLEDFYGAKYVTGTKPDPGPGTVERG  330

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
              H  +H WVG     +GEDMGNFYSAGR+  F+ HHANVDR+W+IW+ L G  + ++F +
Sbjct  331   SHTALHVWVGQA-TPSGEDMGNFYSAGREPLFFSHHANVDRLWSIWRGLRG-SKPKDFPE  388

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRS  566
             +DW+NA+FLFY+ENAQ VRV+VGD +ENQ+MGY ++  +LPW+ ++P  + ++ K+A  S
Sbjct  389   SDWLNANFLFYDENAQLVRVKVGDTLENQKMGYVWQEVDLPWLKNRPTARVKKSKVATTS  448

Query  565   AAPYVA-TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
              AP    TVFPV LD+VV+V V RPKK+R+K++KE EEE+L+I+GIEV   ++ +F+VY+
Sbjct  449   TAPKATETVFPVKLDKVVKVLVDRPKKSRSKKDKEKEEELLVIDGIEVDTAKFVRFEVYI  508

Query  388   NDEDE-PDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTL  212
             NDED+  D   DKAE+AG ++ +PH  KN  K+ + + LGL E +EDL  EDDD +LV+L
Sbjct  509   NDEDDKADEIIDKAEYAGCYSQVPH--KNSTKVTSKIRLGLTELLEDLDVEDDDKILVSL  566

Query  211   APNVGGGVVTIDNIKIEYGS  152
              P  GG  +TI  IKI Y S
Sbjct  567   VPRAGGEDITIGGIKIIYAS  586



>ref|XP_008371327.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=585

 Score =   464 bits (1195),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 242/502 (48%), Positives = 326/502 (65%), Gaps = 16/502 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL-  1475
              A PI AP+++ CV  P   P G+ +D CCPPT    +D++LP   P  +R RPA   + 
Sbjct  90    FAAPISAPDLTTCV--PASKPDGSTID-CCPPTTTTIIDFELPDSGP--LRTRPAAQDVA  144

Query  1474  -DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
              D +Y  K+  AVEMM+ALP DDPRS  QQA VHC+YC+G Y QVG+ D+EIQVH  WLF
Sbjct  145   NDPEYLAKYKNAVEMMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHFCWLF  204

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+E+I+G+LI D TF LPFWNWD PAGM  P I  D   SLYD+ RN +H 
Sbjct  205   FPFHRWYLYFYEKIMGELIGDQTFALPFWNWDAPAGMYIPEIFTDTTSSLYDQYRNTAHQ  264

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PP ++DL Y   D +  D  RI  NL  MYKQM +NA    LF G+PY +GD+ +PGAG+
Sbjct  265   PPKLLDLNYGXTDDDVDDATRIKENLTTMYKQMVSNATCHRLFYGEPYSAGDEPDPGAGN  324

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRK  761
             +E +PH  IH WVGDP + NGEDMG FYSA RD  FY HH+NVDRMW I++ +LGG    
Sbjct  325   IETTPHNNIHLWVGDPTQPNGEDMGTFYSAARDPVFYSHHSNVDRMWXIYKDKLGGT---  381

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEF-ANLPWINSKPVPKPRRR  584
              +  + DW++A FLFY+E     RV   D ++ +++GY Y+   ++PW+ SKP  +    
Sbjct  382   -DIENTDWLDAEFLFYDEKKNLXRVXXRDSLDTKKLGYVYDXNVSIPWLXSKPTXRKSTN  440

Query  583   KLALRSAAPYVATVFPVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYT  407
             K     ++  ++T FP TL D +           RT  +K+ ++E+L+I+GIE   N+  
Sbjct  441   KRKAXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETV  500

Query  406   KFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDT  227
             KFDVY+ND+ +   G DK+EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D++
Sbjct  501   KFDVYVNDDADSLAGKDKSEFAGSFVHVPHKHK--KNIKTNLRLSITSLLEELDAETDNS  558

Query  226   VLVTLAPNVGGGVVTIDNIKIE  161
             ++VTL P VG G +TI    IE
Sbjct  559   LVVTLVPKVGKGPITIGGFSIE  580



>ref|XP_009773173.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=606

 Score =   465 bits (1197),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 262/506 (52%), Positives = 344/506 (68%), Gaps = 16/506 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC   P DLP GA   NCCPPT    +D+QLP  S  T+R RPA H  D
Sbjct  103   FAAPVPGPDVSKC--GPADLPPGAAPVNCCPPTTANIIDFQLPPPS-TTLRTRPAAHSAD  159

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EKF +A+++MK LP DDPRSF QQA VHCAYC+GAYDQ+GFP+ E+QVH SWLF P
Sbjct  160   SAYIEKFNRAIQLMKQLPDDDPRSFRQQANVHCAYCDGAYDQLGFPNSELQVHFSWLFLP  219

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYFFE+ILG LI DPTF +PFWNWD P GM  P++  +R+ SL+D  R++ H PP
Sbjct  220   FHRCYLYFFEKILGSLINDPTFVIPFWNWDHPDGMRLPAMYANRSSSLFDPLRDRRHQPP  279

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              +VDL + G D   ++ ++ + NL +MY+QM +   T   FLG PYR+G +   GAGS+E
Sbjct  280   VMVDLDFNGTDPNISNAQQTSQNLTIMYRQMVSLGSTPATFLGDPYRAGGEPG-GAGSLE  338

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N PH P+H W GD  + N E+MG+FYSA RD  FY HH+N+DR+W++W+ LG  GR+++F
Sbjct  339   NIPHGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTLG--GRRQDF  396

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR------  590
             TD D++NASFLFY+E AQ VR+RV DC++  ++GY Y+    PWINS+P  +        
Sbjct  397   TDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVANPWINSRPRARVSSALSSV  456

Query  589   RRKLALRSAA--PYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN  416
             RR +  R+A   P    VFP  LD V+RV V RP K R K+EK+ +EE L++EGIE++ +
Sbjct  457   RRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPIKKRNKKEKDAKEEFLVVEGIELETD  516

Query  415   QYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQ--KNVEKIRTSLSLGLNEAMEDLGA  242
              + KFDV +NDEDE     + AEFAGSF ++PH    K+ +K +T L L + E +EDL A
Sbjct  517   VFVKFDVLINDEDETVISPNNAEFAGSFVNVPHHSHGKSDKKRKTKLKLAITELLEDLDA  576

Query  241   EDDDTVLVTLAPNVGGGVVTIDNIKI  164
             EDDD V+VT  P  G G V I  +KI
Sbjct  577   EDDDHVVVTFVPKNGSGAVKIGGVKI  602



>ref|XP_008225002.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Prunus mume]
Length=594

 Score =   465 bits (1196),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 251/546 (46%), Positives = 348/546 (64%), Gaps = 24/546 (4%)
 Frame = -1

Query  1753  VLCNAAHG-------GDSKIDRRDVIlglgglygaanlpa-----AMAGPIEAPEVSKCV  1610
             V C A +G       G  K+DRR++++GLG               A A P+ AP+ ++C 
Sbjct  53    VRCQATNGDNDHLEQGLGKLDRRNMLIGLGAGGLYGAAGLENNRFAFAAPLPAPDFTEC-  111

Query  1609  VPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL-DGKYKEKFAKAVEM  1433
               P D P G+ +D CCPP     +D++LP   P   R RPA     D  Y  KF KA+ +
Sbjct  112   -GPADKPDGSTID-CCPPITKTIIDFKLPDRGPLRTR-RPAQDLAKDPVYLAKFKKAIAL  168

Query  1432  MKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERIL  1253
             M+ALP DDPRS  QQA VHC+YC+G Y QVGFPD+EIQVH+ WLF+PFHRWYLYF+E+I+
Sbjct  169   MRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQVHSCWLFYPFHRWYLYFYEKIM  228

Query  1252  GKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTE  1073
             G+LI DPTF LPFWNWD PAGM  P I  D   SLYD+ RN +H PP ++DL Y G D +
Sbjct  229   GELIGDPTFALPFWNWDAPAGMYIPEIFTDPTSSLYDQYRNAAHQPPKLLDLNYGGSDDD  288

Query  1072  ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGD  893
               D  RI  NL  MY+QM + A +  LF G+ Y +GD  +PGAG++E+ PH  IH W GD
Sbjct  289   VDDATRIKENLTTMYQQMVSKATSHRLFYGETYSAGDASSPGAGNIESLPHNNIHLWTGD  348

Query  892   PRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFY  713
             P++ NGE+MG FYSAGRD  FY HH+NVDRMW+I++ L G     +   ADW+N  FLFY
Sbjct  349   PKQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKDLLG---GTDIDKADWLNTEFLFY  405

Query  712   NENAQPVRVRVGDCVENQQMGYKYE-FANLPWINSKPVPKPRRRKLALRSAAPYVATVFP  536
             +E    VRV+V D ++ +++GY Y+    +PW+ +KP P+  + K     ++  + T FP
Sbjct  406   DEKKNLVRVKVRDSLDTRKLGYVYDNKVPIPWLKAKPNPRKSQNKRKAAVSSGDLTTTFP  465

Query  535   VTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGY  359
              TL D++           RT E+K+ ++E+L+I+GIE   N+  KFDV++ND+ + + G 
Sbjct  466   ATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFAGNEPLKFDVFVNDDADSEAGK  525

Query  358   DKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTI  179
             D++EFAGSF H+PH+Q   + I+T+L L + + +E+L AE D +++VTL P +G G +TI
Sbjct  526   DQSEFAGSFIHVPHKQG--KNIKTNLRLSITKLLEELDAETDTSLVVTLVPKLGKGPITI  583

Query  178   DNIKIE  161
                 IE
Sbjct  584   GGFSIE  589



>gb|ACM09905.1| polyphenol oxidase 1/4 [Trifolium pratense]
Length=605

 Score =   465 bits (1196),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 256/517 (50%), Positives = 336/517 (65%), Gaps = 27/517 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDN----CCPPTAGRYLDYQLPSFSPATMRVRPAL  1484
                P+  P+++ CVVPP +LP    + N    CCPP +   +D++ P+F    +RVRPA 
Sbjct  93    FGAPVPIPDLTSCVVPPIELPDDMKIINPPLSCCPPFSSDIIDFKFPTFK--KLRVRPAA  150

Query  1483  HRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSW  1304
               ++  Y  K+ KA+E+M+ALP DDPRSF QQA +HCAYC G Y Q G+ D E+QVHNSW
Sbjct  151   QLVNDDYFAKYNKALELMRALPNDDPRSFYQQANIHCAYCVGGYTQKGY-DAELQVHNSW  209

Query  1303  LFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQS  1124
             LF PFHRWYLYF+ERILG LI DPTF +PFWNWD P GM  PSI  + N SLYD  RN S
Sbjct  210   LFLPFHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSSLYDPRRNPS  269

Query  1123  HLPPTIVDLGY-QGKDTEATD---LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKK  956
             H PPTIVDL Y +  D  AT+    E+I  NL  M+KQM +N+ T   FLG PYR GD  
Sbjct  270   HQPPTIVDLNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTNRQFLGSPYRGGDTP  329

Query  955   NPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLG  776
               GAGS+EN PH PIH W GDPR+ +GEDMG+FY+AGRD  FY HHANVDRMW++W+ LG
Sbjct  330   FKGAGSLENIPHTPIHIWTGDPRQPHGEDMGHFYAAGRDPLFYAHHANVDRMWSVWKTLG  389

Query  775   GRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK  596
                ++++FTD DW+ + FLFY+EN   V+V+V D   ++++GY Y+  ++PWI  K  P 
Sbjct  390   --KKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIPWIKYKSKPS  447

Query  595   PR-----RRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegi  431
              R     + K + +  +  +   FP+ LD +V + V RPKK+R  +EKE EEEIL+I+GI
Sbjct  448   RRVKSKDKNKSSAQRPSKKLVDKFPIVLDSIVSIIVKRPKKSRNSKEKEDEEEILVIDGI  507

Query  430   EVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKN-------VEKIRTSLSLG  272
             E       KFDV +NDED+   G +  EFAG++  + H   +          I T L LG
Sbjct  508   EYDNKTEVKFDVIVNDEDDKVIGGENTEFAGTYVSVLHVHDHGKNKKKKNNNIVTCLRLG  567

Query  271   LNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             L + +EDL A+DDD+++VTL P    G+V I  IKIE
Sbjct  568   LTDLLEDLKADDDDSIVVTLIPRY--GLVKISGIKIE  602



>ref|XP_009610962.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   465 bits (1196),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 282/564 (50%), Positives = 372/564 (66%), Gaps = 35/564 (6%)
 Frame = -1

Query  1768  NRRLKVLC----------NAAHGGDSK----IDRRDVIlglgglygaanl----paAMAG  1643
             NR  +V C          N +   DS     IDRR+++LGLGGLYGAA +      A A 
Sbjct  48    NRSFQVSCKGSEDDQTIYNTSKNSDSSNNKIIDRRNILLGLGGLYGAATIVGGHSFAFAA  107

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKY  1463
             P+  P+VSKC   P DLP GA   NCCPPT    +D+QLP  S  T+R RPA H  D  Y
Sbjct  108   PVNGPDVSKC--GPADLPPGAAPVNCCPPTTANIIDFQLPPPS-TTLRTRPAAHAADSAY  164

Query  1462  KEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHR  1283
              EKF +A+++MK LP DDPRSF QQA VHCAYC+GAYDQ+GFP+ E+QVH SWLF PFHR
Sbjct  165   IEKFNRAIQLMKQLPDDDPRSFKQQANVHCAYCDGAYDQLGFPNSELQVHFSWLFLPFHR  224

Query  1282  WYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIV  1103
              YLYFFE+ILG LI DPTF +PFWNWD P GM  P++  +R+ SL+D  R++ H PP +V
Sbjct  225   CYLYFFEKILGSLINDPTFAIPFWNWDHPDGMRLPAMYTNRSSSLFDPLRDRRHQPPVMV  284

Query  1102  DLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSP  923
             DL + G D   ++ ++ + NL +MY+QM +   T   FLG PYR+G +   GAGS+EN P
Sbjct  285   DLDFNGTDPNISNAQQTSQNLTIMYRQMVSLGSTPTTFLGDPYRAGGEPG-GAGSLENIP  343

Query  922   HVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDA  743
             H P+H W GD  + N E+MG+FYSA RD  FY HH+N+DR+W++W+ LG  GR+++FTD 
Sbjct  344   HGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTLG--GRRQDFTDP  401

Query  742   DWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR------RRK  581
             D++NASFLFY+E AQ VR+RV DC++  ++GY Y+    PWINS+P  +        RR 
Sbjct  402   DFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYAYQNVANPWINSRPRARVSSALSSVRRL  461

Query  580   LALRSAA--PYVATVFPVTLDrvvrvkvprpkknrtkeeke-leeeilliegiEVQANQY  410
             +  R+A   P    VFP  LD V+RV V RP K +  ++++  +EEIL++EGIE++ + +
Sbjct  462   VEARAADNFPSAKDVFPTKLDHVIRVMVKRPNKKKRNKKEKDAKEEILVVEGIELETDVF  521

Query  409   TKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQ--KNVEKIRTSLSLGLNEAMEDLGAED  236
              KFDV +NDEDE     + AEFAGSF ++PH    K+ +K +T L L + E +EDL AED
Sbjct  522   VKFDVLINDEDETVISPNNAEFAGSFVNVPHHSHGKSGKKRKTKLKLAITELLEDLDAED  581

Query  235   DDTVLVTLAPNVGGGVVTIDNIKI  164
             DD VLVT  P  G G V I  +KI
Sbjct  582   DDHVLVTFVPKNGSGAVKIGGVKI  605



>ref|XP_007211389.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
 gb|EMJ12588.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
Length=594

 Score =   464 bits (1194),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 250/547 (46%), Positives = 348/547 (64%), Gaps = 26/547 (5%)
 Frame = -1

Query  1753  VLCNAAHG-------GDSKIDRRDVIlglgglygaanlpa-----AMAGPIEAPEVSKCV  1610
             V C A +G       G  K+DRR++++GLG               A A P+ AP+ ++C 
Sbjct  53    VRCQAKNGDNDHLDQGLGKLDRRNMLIGLGAGGLYGAAGLENNPFAFAAPVSAPDFTECG  112

Query  1609  VPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL--DGKYKEKFAKAVE  1436
               P D P G+ +D CCPP     +D++LP   P  +R R     L  D  Y  K+ KAV 
Sbjct  113   --PADKPDGSTID-CCPPITKTIIDFKLPD--PGPLRTRRPAQDLAKDPVYLAKYKKAVA  167

Query  1435  MMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERI  1256
             +M+ALP DDPRS  QQA VHC+YC+G Y QVGFPD+EIQVH  WLF+PFHRWYLYF+E+I
Sbjct  168   LMRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQVHFCWLFYPFHRWYLYFYEKI  227

Query  1255  LGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDT  1076
             +G+LI DPTF LPFWNWD PAGM  P I  D   SLYD+ RN +H PP ++DL Y G D 
Sbjct  228   MGELIGDPTFALPFWNWDAPAGMYIPEIFTDPTSSLYDQYRNAAHQPPKLLDLNYGGSDD  287

Query  1075  EATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVG  896
             +  D  RI  NL  MY+QM + A +  LF G+PY +GD  +PGAG++E+ PH  IH W G
Sbjct  288   DVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDASPGAGNIESIPHNNIHLWSG  347

Query  895   DPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLF  716
             DP++ NGE+MG FYSAGRD  FY HH+NVDRMW+I++ L G     +    DW+N  FLF
Sbjct  348   DPKQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKDLLG---GTDIDKTDWLNTEFLF  404

Query  715   YNENAQPVRVRVGDCVENQQMGYKYE-FANLPWINSKPVPKPRRRKLALRSAAPYVATVF  539
             Y+E    VRV+V D ++ +++GY Y+    +PW+ +KP P+  + +     ++  + T F
Sbjct  405   YDEKKNLVRVKVRDSLDTKKLGYVYDNKVPIPWLKAKPNPRKSQNQRKAAVSSGDLTTAF  464

Query  538   PVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGG  362
             P TL D++           RT E+K+ ++E+L+I+GIE   N+  KFDV++ND+ + + G
Sbjct  465   PATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFAGNEPLKFDVFVNDDADSEAG  524

Query  361   YDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
              D++EFAGSF H+PH+QK  + I+T+L L + + +E+L AE D +++VTL P +G G +T
Sbjct  525   KDQSEFAGSFIHVPHKQK--KNIKTNLRLSITKLLEELDAETDKSLVVTLVPKLGKGPIT  582

Query  181   IDNIKIE  161
             I    IE
Sbjct  583   IGGFSIE  589



>gb|ABI96944.1| putative polyphenol oxidase [Prunus dulcis]
Length=451

 Score =   458 bits (1179),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 238/455 (52%), Positives = 314/455 (69%), Gaps = 23/455 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P++SKC     DLP GA   NCCPP A + +D++LP+  P  +RVRPA H +D
Sbjct  4     FAKPLNPPDLSKCGA--ADLPTGATPTNCCPPPATKIIDFKLPA--PGKLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK++KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    QAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DPTF LPFWNWD PAGM  P++  +    LYD+ R  SH PP
Sbjct  120   FHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFANPKSPLYDKFRAASHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T++DL Y G D + ++  +I  NL +MY+QM +NA   +LF   PYR+GD+ +PG GS+E
Sbjct  180   TLIDLDYNGTDEKVSNESQINANLKIMYRQMVSNAKNPQLFFANPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH P+H W GD  + N EDMGNFYSA RD  F+ HH++VDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSSVDRMWSIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             + +DW+++ FLFYNENA+ VRV+V D +E++ +GY Y+  ++PW+ SKP   PRR KLA+
Sbjct  298   SHSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPT--PRRAKLAV  355

Query  571   RSAAPYVAT--------------VFPVTLDrvvrvkv-prpkknrtkeekeleeeillie  437
                A  +                 FP+ L+  +   V    +K R K+EKE EEEIL+IE
Sbjct  356   SKIAKKLGVAHAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIE  415

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             GIE   +   KFDVY+ND D+   G DK EFAGSF
Sbjct  416   GIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSF  450



>gb|AAK13244.1| polyphenol oxidase [Trifolium pratense]
Length=599

 Score =   464 bits (1193),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 255/517 (49%), Positives = 340/517 (66%), Gaps = 28/517 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
                P+  P+++KCV+PP+  P      NCCPP +   +D++ PSF    +RVRPA   +D
Sbjct  94    FGAPVPIPDLTKCVIPPSGAPVPI---NCCPPFSKDIIDFKYPSFE--KLRVRPAAQLVD  148

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+E+M+ALP DDPRSF+QQAK+HCAYC G Y Q+G+P+IE+ VHNSWLF  
Sbjct  149   DDYFAKYNKALELMRALPDDDPRSFSQQAKIHCAYCVGGYKQLGYPEIELSVHNSWLFLA  208

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWY+YF+ERILG LI DPTF +PFWN+D P GM  PSI  + N SLYD  R+  H PP
Sbjct  209   FHRWYIYFYERILGSLINDPTFAIPFWNFDAPDGMQIPSIFTNPNSSLYDLKRDSRHQPP  268

Query  1111  TIVDLGYQGKDTE-------ATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKN  953
              I+DL Y  KDTE        +  ++I +NL LM+KQM TN+ T  LF G PYR+G    
Sbjct  269   RIIDLNYN-KDTEDPGPNYPPSAEQQIKDNLTLMHKQMITNSKTCILFHGSPYRAGQAPG  327

Query  952   PGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGG  773
              G G++E SPH  +H W GD ++   EDMGNFYS+GRD  FY  HANVDR+W+IW+ LG 
Sbjct  328   KGHGALEMSPHNNVHIWSGDAKQPYREDMGNFYSSGRDPLFYALHANVDRLWSIWKTLG-  386

Query  772   RGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKP  593
              G++++ TD DW+ + FLFY+EN   V+V+V D ++ +++GY Y+  ++PWINSKP P  
Sbjct  387   -GKRKDPTDDDWLESEFLFYDENKNLVKVKVKDGLDGKKLGYDYQKVDIPWINSKPKPAS  445

Query  592   RRRKLALRSAAP-YVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN  416
             RR +   +   P      FP+ LD VV   V RPKK+R+ +EKE EEEIL+I+GIE  +N
Sbjct  446   RRVQSKGKLLTPRKFVDKFPIVLDSVVSTIVKRPKKSRSSKEKEDEEEILVIDGIEFDSN  505

Query  415   QYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPH---------RQKNVEKIRTSLSLGLNE  263
                KFDV +NDED+   G    EFAG+F +L H         ++KN   I T + LGL +
Sbjct  506   IEVKFDVIVNDEDDKVIGVGNTEFAGTFVNLLHGHNHENSTNKKKN---IVTCMRLGLTD  562

Query  262   AMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              +EDL A+DDD++LVT  P  GG  V I  IKIE+ +
Sbjct  563   LLEDLKADDDDSILVTFIPRYGGDSVKISGIKIEFAN  599



>dbj|BAA08234.1| polyphenol oxidase [Phytolacca americana]
Length=586

 Score =   463 bits (1191),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 264/528 (50%), Positives = 353/528 (67%), Gaps = 21/528 (4%)
 Frame = -1

Query  1732  GGDSKIDRRDVIlglgglygaanlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPT  1553
             G  +K+DRR++++GLG +YGA          + AP ++     PT+  A     NCCPPT
Sbjct  66    GNTNKLDRRNMLIGLGSIYGAGTTLGGGPATLAAPLITPN---PTEFGASDVGLNCCPPT  122

Query  1552  AGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHC  1373
             A   +D+QLP   P T+RVRP  H +D +Y +KF++A+ +MKALPA+DPR+F+QQA VHC
Sbjct  123   ARNIVDFQLPP-QPTTLRVRPPAHLVDDQYLQKFSRAISLMKALPANDPRNFSQQANVHC  181

Query  1372  AYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPA  1193
             AYC+G Y Q GFP++E+QVH SWLFFPFHR+YLYFFERILGKLI DP+F +PFWNWD PA
Sbjct  182   AYCDGGYTQTGFPNLELQVHFSWLFFPFHRFYLYFFERILGKLINDPSFAIPFWNWDTPA  241

Query  1192  GMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKD--TEATDLERITNNLALMYKQM  1019
             GM  P I    N  LYD  R+++H PP ++DL Y G+D   + T  + I+ NL LMY+QM
Sbjct  242   GMQIPGIYTSPNSPLYDPRRDRAHQPPRVIDLNYDGQDDPNDLTGQDLISANLTLMYRQM  301

Query  1018  FTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRD  839
              +N+ T  LFLG+P+R G++ +PGAGS+EN PH P+H W GDP + NGEDMG FYSA R 
Sbjct  302   VSNSTTTRLFLGQPFRVGNRPSPGAGSIENVPHGPVHVWTGDPNQPNGEDMGTFYSAARV  361

Query  838   ISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQ  659
               FY HHA VDRMW IW  LG    +++FTD+DW+NAS + Y  N Q VRV   D ++  
Sbjct  362   PIFYAHHAIVDRMWAIWNALG--NDRQDFTDSDWLNASCIVYGGNGQAVRVPSRDSLDKA  419

Query  658   QMGYKYEFANLP-WINSKPVPKPRRRKLALRSAAPYVATV----FPVTLDrvvrvkvprp  494
             ++GY Y+  +LP W +S   P P+R KL   S  P   T+    FP  LD V+R  V R 
Sbjct  420   RLGYTYQGVDLPEWPSS---PTPQRSKLNTTSRIPMSPTLSTVKFPRALDSVIRTDVKRS  476

Query  493   kknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDK--AEFAGSFAHLP  320
             KK+R + EKE+EEEIL+IE    + + Y KFDV++NDEDE      +   EFAGSF ++P
Sbjct  477   KKSRGRREKEVEEEILVIEIELEK-DIYVKFDVHVNDEDEVPFKKTRVLTEFAGSFVNVP  535

Query  319   HR--QKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
             H+  ++    ++T+L LGL   +E+LGA+DD+TV +TL P  G  VV 
Sbjct  536   HKHHKEGQHGMKTALRLGLTALIEELGADDDETVTITLVPRAGNDVVV  583



>gb|AAK13242.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   463 bits (1192),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 257/519 (50%), Positives = 339/519 (65%), Gaps = 31/519 (6%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDN------CCPPTAGRYLDYQLPSFSPATMRVRP  1490
                P+  P+++ CVVPP +LP   D+ N      CCPP +   +D++ P+F+   +RVRP
Sbjct  93    FGAPVPIPDLTSCVVPPIELPD--DIKNIDPPISCCPPFSSDIIDFKFPTFN--KLRVRP  148

Query  1489  ALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHN  1310
             A   ++  Y  K+ KA+E+M+ALP DDPRSF QQA +HCAYC G Y Q G+ D+E+QVHN
Sbjct  149   AAQLVNDDYFAKYNKALELMRALPDDDPRSFYQQANIHCAYCVGGYTQKGY-DVELQVHN  207

Query  1309  SWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRN  1130
             SWLF PFHRWYLYF+ERILG LI DPTF +PFWNWD P GM  PSI  + N SLYD  RN
Sbjct  208   SWLFLPFHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSSLYDPRRN  267

Query  1129  QSHLPPTIVDLGY-QGKDTEATD---LERITNNLALMYKQMFTNAGTAELFLGKPYRSGD  962
              +H PPTIVDL Y +  D  AT+    E+I  NL  M+KQM +N+ T   FLG PYR GD
Sbjct  268   PTHQPPTIVDLNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTPRQFLGSPYRGGD  327

Query  961   KKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQ  782
                 GAGS+EN PH PIH W GDPR+ +GEDMG+F++AGRD  FY HHANVDRMW++W+ 
Sbjct  328   TPFKGAGSLENIPHTPIHIWTGDPRQPHGEDMGHFWAAGRDPLFYAHHANVDRMWSVWKT  387

Query  781   LGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPV  602
             LG   ++++FTD DW+ + FLFY+EN   V+V+V D   ++++GY Y+  ++PWI  K  
Sbjct  388   LG--KKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIPWIKYKSK  445

Query  601   PKPR-----RRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
             P  R     + K + +  +  +   FP+ LD VV + V RPKK+R  +EKE EEEIL+I+
Sbjct  446   PSRRVKSKDKNKSSAQRPSRKLVDKFPIVLDSVVSIIVKRPKKSRNSKEKEDEEEILVID  505

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKN-------VEKIRTSLS  278
             GIE       KFDV +NDED+ + G +  EFAGS+  + H   +          I T L 
Sbjct  506   GIEYDNKTEVKFDVIVNDEDDKEIGGENTEFAGSYVSVLHVHDHGKNKKKKNNNIVTCLR  565

Query  277   LGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             LGL + +EDL A+DDD+++VTL P  G   V I  IKIE
Sbjct  566   LGLTDLLEDLKADDDDSIVVTLIPRYGN--VKISGIKIE  602



>ref|XP_007148200.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
 gb|ESW20194.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
Length=576

 Score =   462 bits (1188),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 248/487 (51%), Positives = 336/487 (69%), Gaps = 19/487 (4%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+++ C   P DL  G    NCCPP++ + +D++ P  S   +RVRPA H + 
Sbjct  97    FAAPVLPPDLTTCG--PPDLAEGVKPINCCPPSS-KIIDFKFPP-SNQPLRVRPAAHLVT  152

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+++MK LP++DPRSF QQA VHCAYC+GAY QVGFPD+++QVHNSWLFFP
Sbjct  153   DDYLAKYKKALDLMKKLPSNDPRSFMQQANVHCAYCDGAYHQVGFPDLDLQVHNSWLFFP  212

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+ERILG LI DPTF LPFWNWD P GM  PSI  D    LYD  RN +H PP
Sbjct  213   FHRWYLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDPLRNSNHQPP  272

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
             T+VDL +  +D +A    +I++NL +MY+Q+ +N  T  LFLG  YR+GD+ +PG GS+E
Sbjct  273   TLVDLDFDIEDPDADG--KISSNLTIMYRQVVSNGKTPRLFLGNAYRAGDEPDPGGGSVE  330

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N PH P+H W GD  + N E+MG FYSA RD  F+ HH+N+DRMW+IW+ LG  G++R+F
Sbjct  331   NVPHGPVHVWTGDIDQPNIENMGTFYSAARDPIFFSHHSNIDRMWSIWKTLG--GKRRDF  388

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP-KPRRRKLA  575
             +D+DW+ +  LFY+E+   VRV+V DC++  ++GY Y+  ++PW+NS+P P K R RK+A
Sbjct  389   SDSDWLESGLLFYDEDKNLVRVKVKDCLDTTKLGYVYQDVDVPWLNSRPTPVKSRARKVA  448

Query  574   L---------RSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQ  422
             +         R+A       FP+ LD VV  +V RPKK+R+K+ KE EEE+L+IEGIE  
Sbjct  449   VTQNFGVGAARAAETSRNVKFPLVLDSVVSTRVQRPKKSRSKKAKEEEEEVLVIEGIEFD  508

Query  421   ANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEK-IRTSLSLGLNEAMEDLG  245
              N   KFDV++NDED+     D  EFAGSF  + H  K+  K ++T L LGL + +E+L 
Sbjct  509   RNTPVKFDVFVNDEDDKVIRPDNTEFAGSFVSVAHTHKHKNKSMKTCLRLGLTDLLEELE  568

Query  244   AEDDDTV  224
             A+DDD+V
Sbjct  569   ADDDDSV  575



>gb|AEM45931.1| polyphenol oxidase [Triticum aestivum]
 gb|AEM45932.1| polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   461 bits (1186),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 268/556 (48%), Positives = 353/556 (63%), Gaps = 27/556 (5%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAP  1628
             L  L P    +  ++ C A  G   ++DRRDV+LGLG    A         A+A PI+AP
Sbjct  17    LQALVPTKARQTRRLTCKATGG---RVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPIQAP  73

Query  1627  EVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFA  1448
             ++  C   P DLP  A   NCCP +    +D+ LP  S A +RVRPA H  D +Y  K+ 
Sbjct  74    DLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLAKYE  131

Query  1447  KAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYF  1268
             +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFPD+EIQVHN WLFFP+HR+YLYF
Sbjct  132   RAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHRFYLYF  191

Query  1267  FERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQ  1088
              ERILGKLI D TF LPFWNWD P GM  P+I  +R+  LY+E RN +H PP  VDL + 
Sbjct  192   HERILGKLIGDDTFALPFWNWDAPDGMTLPAIYANRSSPLYNERRNPAHQPPFPVDLDFN  251

Query  1087  GKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIH  908
               D      E+I  NL +MY+QM + A    LF+G+PYR+GD+ +PGAGS+EN PH  +H
Sbjct  252   EIDVIIPTDEQIDQNLNIMYRQMVSGAKKTRLFMGQPYRAGDQPDPGAGSVENVPHGTMH  311

Query  907   RWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINA  728
              W GDP + N EDMGNFYSA RD  F+ HH N+DR+W +W+ L  R    +FTD DW++ 
Sbjct  312   TWTGDPAQPNNEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPGNADFTDTDWLDT  369

Query  727   SFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA  548
             +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ +KP  + RR       A     
Sbjct  370   AFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLKAKPAKRSRRTPAPAAGAL----  425

Query  547   TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN-QYTKFDVYLNDEDEP  371
                P TL   VRV V RP+ +R+ +EKE  EE+L++EGI+V  + ++ KFDV +N    P
Sbjct  426   ---PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIVEGIQVADHFKFVKFDVLVN---AP  479

Query  370   DGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             + G D A    AGS A  PH  +  +K   ++T    G+ + M+++GA+ D TV+V+L P
Sbjct  480   ESGGDAASGYCAGSVAMTPHMVRTNKKKGSVKTVARFGVCDLMDNIGADGDKTVVVSLVP  539

Query  205   NVGGGVVTIDNIKIEY  158
               GG +VTI  + I Y
Sbjct  540   RCGGELVTIGGVSIGY  555



>gb|ABI96942.1| putative polyphenol oxidase [Dasiphora fruticosa]
Length=452

 Score =   457 bits (1176),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 240/455 (53%), Positives = 319/455 (70%), Gaps = 23/455 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP G    +CCPPT  + +D++LPS  P  +RVRPA H +D
Sbjct  4     FAKPVAPPDVSKCGA--ADLPNGVAPTDCCPPTPSKIIDFKLPS--PTPLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+E+MKALP  DPRSF  QA VHCAYC+GAYDQ GFP++E+Q+HNSWLFFP
Sbjct  60    DAYIAKYTKAMELMKALPDSDPRSFKNQANVHCAYCDGAYDQAGFPELELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+ERILGKLI DPTF LPFWNWD PAGM  P++  D    LYD+ R+ +H PP
Sbjct  120   FHRYYLYFYERILGKLINDPTFALPFWNWDSPAGMKLPALFADPKSPLYDKFRSAAHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              ++DL + G +   ++  +I +NL++MY+QM +NA  A+LF G PYR+GD+ +PG GS+E
Sbjct  180   KLIDLDFNGTEDNTSNTTQINSNLSIMYRQMVSNAKNAQLFFGNPYRAGDEPDPGGGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             ++PH P+H W GD  + N EDMGNFYSAGRD  F+ HH+NVDRMW+IW+ L  +   ++ 
Sbjct  240   STPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAPKN--KDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD+DW+++ FLFY+ENA  VRV+V DC++ + +GY Y+   +PW+NSKP   PRR K+A 
Sbjct  298   TDSDWLDSGFLFYDENANMVRVKVRDCLDYKNLGYVYQDVEIPWLNSKPT--PRRSKVAF  355

Query  571   RSAAPYVA--------------TVFPVTLDrvvrvkv-prpkknrtkeekeleeeillie  437
              + A  +               T FP+TL R ++V V    +K R+K+EKE EEEIL+IE
Sbjct  356   SNIAKKLGVANAAGSKAKEVAITDFPLTLSRKIKVAVPRPKQKKRSKKEKEDEEEILVIE  415

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             GIE   +   KFDVY+NDED+   G DK+EFAGSF
Sbjct  416   GIEFDRDVAVKFDVYINDEDDLPSGPDKSEFAGSF  450



>gb|AEM45936.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   461 bits (1186),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 272/578 (47%), Positives = 362/578 (63%), Gaps = 31/578 (5%)
 Frame = -1

Query  1861  SLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgg  1682
             S S PR      +R P      L  L P    +  ++ C A  G   ++DRRDV+LGLG 
Sbjct  4     STSVPRCTTAPGTRTP----CCLQALVPTKARQPRRLTCKATGG---RVDRRDVLLGLGS  56

Query  1681  lygaanlpa----AMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFS  1514
                          A+A PI+AP++  C   P DLP  A   NCCP +    +D+ LP  S
Sbjct  57    AAATGLGTQRGRGAIAAPIQAPDLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPAS  114

Query  1513  PATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFP  1334
              A +RVRPA H +D ++  K+ +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFP
Sbjct  115   SAPLRVRPAAHLVDAEHLAKYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFP  174

Query  1333  DIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNV  1154
             D+EIQVHN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD P GM  P+I  +R+ 
Sbjct  175   DLEIQVHNCWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPGGMTLPAIYANRSS  234

Query  1153  SLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPY  974
              LY+E R+ +H PP  VDL +   D      E+I  NL +MY+QM ++A    LF+G+PY
Sbjct  235   PLYNERRDPAHQPPFPVDLDFNEIDVIIPTDEQIDQNLNIMYRQMVSSAKKTPLFMGQPY  294

Query  973   RSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWT  794
             R+GD+ +PGAGS+EN PH  +H W GDP + N EDMGNFYSA RD  F+ HH N+DR+W 
Sbjct  295   RAGDQPDPGAGSLENLPHNTVHIWTGDPAQPNSEDMGNFYSAARDPIFFAHHGNIDRLWH  354

Query  793   IWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWIN  614
             +W+ L  R    +F DADW++ +FLFY+E A+PVRVRV DC++   MGY Y+   LPW++
Sbjct  355   VWRGL--RPGNADFADADWLDTAFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLD  412

Query  613   SKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
             +KP  + RR       A        P TL   VRV V RP+ +R+ +EKE  EE+L+IEG
Sbjct  413   AKPAKRSRRTPAPAAGAL-------PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIIEG  465

Query  433   iEVQAN-QYTKFDVYLNDEDEPDGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLG  272
             I+V  + ++ KFDV +N    P+ G D A    AGS A  PH  +  +K   ++T    G
Sbjct  466   IQVADHFKFVKFDVLVN---APESGGDAASGYCAGSVAMTPHMVRTNKKKGSMKTVARFG  522

Query  271   LNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             + + M+++GA+ D TV+V+L P  GG +VTI  + I Y
Sbjct  523   VCDLMDNIGADGDKTVVVSLVPRCGGELVTIGGVSIGY  560



>gb|ABA62017.1| polyphenol oxidase [synthetic construct]
Length=567

 Score =   461 bits (1186),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 268/556 (48%), Positives = 353/556 (63%), Gaps = 27/556 (5%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAP  1628
             L  L P    +  ++ C A  G   ++DRRDV+LGLG    A         A+A PI+AP
Sbjct  17    LQALVPTKARQTRRLTCKATGG---RVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPIQAP  73

Query  1627  EVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFA  1448
             ++  C   P DLP  A   NCCP +    +D+ LP  S A +RVRPA H  D +Y  K+ 
Sbjct  74    DLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLAKYE  131

Query  1447  KAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYF  1268
             +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFPD+EIQVHN WLFFP+HR+YLYF
Sbjct  132   RAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHRFYLYF  191

Query  1267  FERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQ  1088
              ERILGKLI D TF LPFWNWD P GM  P+I  +R+  LY+E RN +H PP  VDL + 
Sbjct  192   HERILGKLIGDDTFALPFWNWDAPDGMTLPAIYANRSSPLYNERRNPAHQPPFPVDLDFN  251

Query  1087  GKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIH  908
               D      E+I  NL +MY+QM + A    LF+G+PYR+GD+ +PGAGS+EN PH  +H
Sbjct  252   EIDVIIPTDEQIDQNLNIMYRQMVSGAKKTRLFMGQPYRAGDQPDPGAGSVENVPHGTMH  311

Query  907   RWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINA  728
              W GDP + N EDMGNFYSA RD  F+ HH N+DR+W +W+ L  R    +FTD DW++ 
Sbjct  312   TWTGDPAQPNNEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPGNADFTDTDWLDT  369

Query  727   SFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA  548
             +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ +KP  + RR       A     
Sbjct  370   AFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLKAKPAKRSRRTPAPAAGAL----  425

Query  547   TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN-QYTKFDVYLNDEDEP  371
                P TL   VRV V RP+ +R+ +EKE  EE+L++EGI+V  + ++ KFDV +N    P
Sbjct  426   ---PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIVEGIQVADHFKFVKFDVLVN---AP  479

Query  370   DGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             + G D A    AGS A  PH  +  +K   ++T    G+ + M+++GA+ D TV+V+L P
Sbjct  480   ESGGDAASGYCAGSVAMTPHMVRTNKKKGSVKTVARFGVCDLMDNIGADGDKTVVVSLVP  539

Query  205   NVGGGVVTIDNIKIEY  158
               GG +VTI  + I Y
Sbjct  540   RCGGELVTIGGVSIGY  555



>gb|AEY79825.1| polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   460 bits (1184),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 267/556 (48%), Positives = 353/556 (63%), Gaps = 27/556 (5%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAP  1628
             L  L P    +  ++ C A  G   ++DRRDV+LGLG    A         A+A PI+AP
Sbjct  17    LQALVPTKARQTRRLTCKATGG---RVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPIQAP  73

Query  1627  EVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFA  1448
             ++  C   P DLP  A   NCCP +    +D+ LP  S A +RVRPA H  D +Y  K+ 
Sbjct  74    DLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLAKYE  131

Query  1447  KAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYF  1268
             +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFPD+EIQVHN WLFFP+HR+YLYF
Sbjct  132   RAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHRFYLYF  191

Query  1267  FERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQ  1088
              ERILGKLI D TF LPFWNWD P GM  P+I  +R+  LY+E RN +H PP  VDL + 
Sbjct  192   HERILGKLIGDDTFALPFWNWDAPDGMTLPAIYANRSSPLYNERRNPAHQPPFPVDLDFN  251

Query  1087  GKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIH  908
               D      E+I  NL +MY+QM + A    LF+G+PYR+GD+ +PGAGS+EN PH  +H
Sbjct  252   EIDVIIPTDEQIDQNLNIMYRQMVSGAKKTRLFMGQPYRAGDQPDPGAGSVENVPHGTMH  311

Query  907   RWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINA  728
              W GDP + N EDMGNFYSA RD  F+ HH N+DR+W +W+ L  R    +FTD DW++ 
Sbjct  312   TWTGDPAQPNNEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPGNADFTDTDWLDT  369

Query  727   SFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA  548
             +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ +KP  + RR       A     
Sbjct  370   AFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLKAKPAKRSRRTPAPAAGAL----  425

Query  547   TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN-QYTKFDVYLNDEDEP  371
                P TL   VRV V RP+ +R+ +EKE  EE+L++EGI+V  + ++ KFDV +N    P
Sbjct  426   ---PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIVEGIQVADHFKFVKFDVLVN---AP  479

Query  370   DGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             + G D A    AGS A  PH  +  +K   ++T    G+ + M+++GA+ D TV+V+L P
Sbjct  480   ESGGDAASGYCAGSVAMTPHMVRTNKKKGSVKTVARFGVCDLMDNIGADGDKTVVVSLVP  539

Query  205   NVGGGVVTIDNIKIEY  158
               GG +VT+  + I Y
Sbjct  540   RCGGELVTVGGVSIGY  555



>gb|AHZ59731.1| copper-containing polyphenol oxidase [Triticum aestivum]
Length=557

 Score =   460 bits (1184),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 267/556 (48%), Positives = 353/556 (63%), Gaps = 27/556 (5%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAP  1628
             L  L P    +  ++ C A  G   ++DRRDV+LGLG    A         A+A PI+AP
Sbjct  17    LQALVPTKARQTRRLTCKATGG---RVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPIQAP  73

Query  1627  EVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFA  1448
             ++  C   P DLP  A   NCCP +    +D+ LP  S A +RVRPA H  D +Y  K+ 
Sbjct  74    DLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLAKYE  131

Query  1447  KAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYF  1268
             +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFPD+EIQVHN WLFFP+HR+YLYF
Sbjct  132   RAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHRFYLYF  191

Query  1267  FERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQ  1088
              ERILGKLI D TF LPFWNWD P GM  P+I  +R+  LY+E RN +H PP  VDL + 
Sbjct  192   HERILGKLIGDDTFALPFWNWDAPDGMTLPAIYANRSSPLYNERRNPAHQPPFPVDLDFN  251

Query  1087  GKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIH  908
               D      E+I  NL +MY+QM + A    LF+G+PYR+GD+ +PGAGS+EN PH  +H
Sbjct  252   EIDVIIPTDEQIDQNLNIMYRQMVSGAKKTRLFMGQPYRAGDQPDPGAGSVENVPHGTMH  311

Query  907   RWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINA  728
              W GDP + N EDMGNFYSA RD  F+ HH N+DR+W +W+ L  R    +FTD DW++ 
Sbjct  312   TWTGDPAQPNNEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPGNADFTDTDWLDT  369

Query  727   SFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA  548
             +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ +KP  + RR       A     
Sbjct  370   AFLFYDEEARPVRVRVRDCLDPAAMGYAYQGVGLPWLKAKPAKRSRRTPAPAAGAL----  425

Query  547   TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN-QYTKFDVYLNDEDEP  371
                P TL   VRV V RP+ +R+ +EKE  EE+L++EGI+V  + ++ KFDV +N    P
Sbjct  426   ---PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIVEGIQVADHFKFVKFDVLVN---AP  479

Query  370   DGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             + G D A    AGS A  PH  +  +K   ++T    G+ + M+++GA+ D TV+V+L P
Sbjct  480   ESGGDAASGYCAGSVAMTPHMVRTNKKKGSVKTVARFGVCDLMDNIGADGDKTVVVSLVP  539

Query  205   NVGGGVVTIDNIKIEY  158
               GG +VT+  + I Y
Sbjct  540   RCGGELVTVGGVSIGY  555



>emb|CDP06099.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   461 bits (1186),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 273/599 (46%), Positives = 376/599 (63%), Gaps = 47/599 (8%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIPTHSHLHILTPVVLNRRL--KVLCNAAHGGDS---------  1721
             MASL+ P   +NL     I     + +  P   NR+   K+ CN+  G  +         
Sbjct  1     MASLTMPTLSSNLAYSSSIA--HFISLAKPTHPNRKTGPKLTCNSTKGDQNSSDHDTAGS  58

Query  1720  --------KIDRRDVIlglgglygaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGAD  1577
                     K+DRR+V+LG+GG    A+      +A A P+ +P  + C    TD P   +
Sbjct  59    KNGETSLLKLDRRNVLLGIGGGLYGASTFVGNPSAFAAPL-SPTFTACH-DATD-PDSKE  115

Query  1576  VDNCCPP--TAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPR  1403
             +D CCPP  TA    D+ +P+ +P+ +  RPA  ++D  Y +K+  A+E M+ L +DDPR
Sbjct  116   ID-CCPPSATAADITDF-VPT-APSVIATRPAAQQVDSTYLKKYKTAIEKMRNLSSDDPR  172

Query  1402  SFTQQAKVHCAYCNGAYDQVGFPD--IEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPT  1229
             SFT QA VHCAYCNG Y Q G+ D  + + VHNSWLFFPFHRWYLYFFE+I   ++ D T
Sbjct  173   SFTAQANVHCAYCNGGYYQDGYADSSLLLDVHNSWLFFPFHRWYLYFFEKICQNMVDDDT  232

Query  1228  FGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERIT  1049
             F LPFWNWD P GM  P+I  D +  LYD  RN SHL  T++DL Y+G D+  + +  I 
Sbjct  233   FALPFWNWDNPPGMYLPAIFKDSSSPLYDSLRNPSHLN-TVLDLSYEGTDSTDSTITVIK  291

Query  1048  NNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGED  869
             NNL LMYKQM T + T   F GK +R+G+  +PGAGS+E SPH  +HRW GDP   +GE+
Sbjct  292   NNLILMYKQMVTQSTTPLSFFGKTFRAGETSDPGAGSIETSPHTNVHRWTGDPNESHGEN  351

Query  868   MGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVR  689
             MG+FYSAGRD  FY HHANVDRMW++W  LGG    +NFTD+DW+N+SF FYNE A+PV+
Sbjct  352   MGSFYSAGRDPVFYAHHANVDRMWSLWNSLGG----QNFTDSDWLNSSFYFYNEQAKPVK  407

Query  688   VRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrv  509
             V V DC++   +GY Y+  ++PW+NSK  P PRR  +AL + AP  + VFP TL++ + V
Sbjct  408   VYVKDCLDTSVLGYTYQTVDIPWLNSK--PSPRRTAVALPT-APTPSQVFPTTLEKAITV  464

Query  508   kvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
              V RPKK RTK+EK+  EE+L I GI+    ++ KFDVY+N++   + G +K E  GSF 
Sbjct  465   LVKRPKKKRTKKEKQSAEEVLEISGIQYNIGEFVKFDVYINEDTPDESGPEKTELVGSFI  524

Query  328   HLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
             ++PH    +    T+ S  ++E +++LGA++ ++VLVTL P      VTI  +KI+Y S
Sbjct  525   NVPHGHSMIST--TTKSFDISEVLQELGADEFESVLVTLVPK--SSTVTISGVKIKYDS  579



>dbj|BAH36895.1| polyphenol oxidase [Triticum aestivum]
Length=545

 Score =   459 bits (1181),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 267/556 (48%), Positives = 353/556 (63%), Gaps = 27/556 (5%)
 Frame = -1

Query  1795  LHILTPVVLNRRLKVLCNAAHGGDSKIDRRDVIlglgglygaanlpa----AMAGPIEAP  1628
             L  L P    +  ++ C A  G   ++DRRDV+LGLG    A         A+A PI+AP
Sbjct  5     LQALVPTKARQTRRLTCKATGG---RVDRRDVLLGLGSAAAAGLGAQRGRGAIAAPIQAP  61

Query  1627  EVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFA  1448
             ++  C   P DLP  A   NCCP +    +D+ LP  S A +RVRPA H  D +Y  K+ 
Sbjct  62    DLGNC--NPPDLPNTAPDTNCCPTSGTGIIDFVLPPASSAPLRVRPAAHLADAEYLAKYE  119

Query  1447  KAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYF  1268
             +AV +MK LPADDPRSF QQ +VHCAYC+GAYDQVGFPD+EIQVHN WLFFP+HR+YLYF
Sbjct  120   RAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHRFYLYF  179

Query  1267  FERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQ  1088
              ERILGKLI D TF LPFWNWD P GM  P+I  +R+  LY+E RN +H PP  VDL + 
Sbjct  180   HERILGKLIGDDTFALPFWNWDAPDGMTLPAIYANRSSPLYNERRNPAHQPPFPVDLDFN  239

Query  1087  GKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIH  908
               D      E+I  NL +MY+QM + A    LF+G+PYR+GD+ +PGAGS+EN PH  +H
Sbjct  240   EIDVIIPTDEQIDQNLNIMYRQMVSGAKKTRLFMGQPYRAGDQPDPGAGSVENVPHGTMH  299

Query  907   RWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINA  728
              W GDP + N ED+GNFYSA RD  F+ HH N+DR+W +W+ L  R    +FTD DW++ 
Sbjct  300   TWTGDPAQPNNEDLGNFYSAARDPIFFAHHGNIDRLWHVWRGL--RPGNADFTDTDWLDT  357

Query  727   SFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA  548
             +FLFY+E A+PVRVRV DC++   MGY Y+   LPW+ +KP  + RR       A     
Sbjct  358   AFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLKAKPAKRSRRTPAPAAGAL----  413

Query  547   TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQAN-QYTKFDVYLNDEDEP  371
                P TL   VRV V RP+ +R+ +EKE  EE+L++EGI+V  + ++ KFDV +N    P
Sbjct  414   ---PATLRETVRVTVTRPQVSRSDKEKEEAEEVLIVEGIQVADHFKFVKFDVLVN---AP  467

Query  370   DGGYDKAE--FAGSFAHLPHRQKNVEK---IRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
             + G D A    AGS A  PH  +  +K   ++T    G+ + M+++GA+ D TV+V+L P
Sbjct  468   ESGGDAASGYCAGSVAMTPHMVRTNKKKGSVKTVARFGVCDLMDNIGADGDKTVVVSLVP  527

Query  205   NVGGGVVTIDNIKIEY  158
               GG +VTI  + I Y
Sbjct  528   RCGGELVTIGGVSIGY  543



>gb|ABI96929.1| putative polyphenol oxidase [Chamaebatiaria millefolium]
Length=453

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 244/457 (53%), Positives = 315/457 (69%), Gaps = 24/457 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA+  NCCPP A + +D++LP+  P  +RVRPA H +D
Sbjct  4     FAKPVAPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFKLPA--PTRLRVRPAAHTVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K+ KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    QAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DPTF LPFWNWD PAGM  P+I  + N  LYD+ RN +H PP
Sbjct  120   FHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPAIFANPNSPLYDKLRNANHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              +VDL Y G D + ++  +I  NL +MY+QM +NA    LFL  PYR+GD+ +PG GS+E
Sbjct  180   NLVDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPLLFLN-PYRAGDEPDPGGGSIE  238

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH PIH W GD  + N EDMGNFYSAGRD  FY HH+NVDRMW IW+ LG  G++ + 
Sbjct  239   GTPHGPIHLWTGDNTQPNFEDMGNFYSAGRDPIFYSHHSNVDRMWAIWKTLG--GKRTDI  296

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD DW+++ FLFYNENA+ VRV+V D +E++ +GY Y+  ++PW++SKP P  R  KLA+
Sbjct  297   TDKDWLDSGFLFYNENAELVRVKVRDSLESKNLGYVYQEVDIPWLDSKPTPI-RGAKLAV  355

Query  571   RSAAPYVA---------------TVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
                A  +                + FP+ L+  +   V R  +K R K++KE EEEIL+I
Sbjct  356   SKIAKKLGHARAAELSSSKVVPQSDFPINLETKISTVVKRPQQKKRNKKQKEDEEEILVI  415

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             EGIE   +   KFDVY+ND D+   G    EFAGSF 
Sbjct  416   EGIEFDRDVAVKFDVYVNDVDDLPSGPANTEFAGSFV  452



>gb|EYU34166.1| hypothetical protein MIMGU_mgv1a003279mg [Erythranthe guttata]
Length=594

 Score =   460 bits (1183),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 262/565 (46%), Positives = 346/565 (61%), Gaps = 27/565 (5%)
 Frame = -1

Query  1819  RPIPTHSHLHILTPVVLN--RRLKVLCNAAHGGDSKIDRRDVIl----glgglygaanlp  1658
             RP+      H LT    N  RRL    +++    SK+DRR+++L      G     +   
Sbjct  27    RPVVFAKPSHFLTHAKRNHHRRLISCSSSSSNEGSKVDRRNMLLGLGGMYGAANLLSTPD  86

Query  1657  aAMAGPIEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALH  1481
             +A A PI+AP++ KC     D  AG     NCCPP  G  +DY+LP+F P T +VRP+ H
Sbjct  87    SASANPIQAPQIDKCGNSTYDTSAGVATQINCCPPFTGTIIDYKLPNF-PKT-KVRPSAH  144

Query  1480  RLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWL  1301
             RL  +Y  KF  AV+ M+ LP DDPRSF QQA +HCAYCNG YDQ G   +++QVHN WL
Sbjct  145   RLSPEYLFKFNTAVDRMRRLPKDDPRSFMQQANIHCAYCNGGYDQPGQGTLDLQVHNGWL  204

Query  1300  FFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSH  1121
             FFPFHRWYLYF+ERILGKLI DPTF LPFWNWD P GM  P    D   +LYD  RN  +
Sbjct  205   FFPFHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTIPPAFIDPKSALYDAKRNPDN  264

Query  1120  LPPTIVDLGYQGKDTEATD-LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGA  944
             +PP +VDLG+ G    +TD L+ ++NNL +MY +M         F+GK YR G   NPG 
Sbjct  265   MPPAVVDLGFTG----STDPLQVVSNNLTIMYTEMVRGNSDVYDFMGKAYREGTPVNPGP  320

Query  943   GSMENSPHVPIHRWVGDPRRK-NGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQL--GG  773
             GS E   H  IH +VGD + +  GEDMGNFYSAGRD  FY HH+NVDRMWT+WQ      
Sbjct  321   GSSERGSHTAIHAFVGDYKNQPAGEDMGNFYSAGRDPLFYSHHSNVDRMWTLWQFFLPSN  380

Query  772   RGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKP  593
             +   +  TD D++N +FLFY+ENAQ VRV V DC++N +MG++YE  +LPW++ +P  + 
Sbjct  381   KIPDKKITDPDFLNTAFLFYDENAQLVRVTVKDCLDNLKMGFEYERVDLPWLDYRPPAQA  440

Query  592   RRRKL--ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQA  419
                K+  A ++      TVFP+ LD          +    K +K   +E+L+IE I V  
Sbjct  441   ASAKVTRAGKTTVKVEDTVFPIVLD-------KIVRVLLPKTKKGKADELLVIENIVVDT  493

Query  418   NQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAE  239
             +++ KFDV++NDED+     DKA +AG++A +PH+ K  +   TS+ L L +  ED+   
Sbjct  494   SKFLKFDVFVNDEDDNVAEIDKASYAGTYAQIPHKTKE-KTATTSIRLKLTDVYEDMDVT  552

Query  238   DDDTVLVTLAPNVGGGVVTIDNIKI  164
             DDDT+LVTL P   G  VTI  IKI
Sbjct  553   DDDTILVTLVPRHEGPGVTIGGIKI  577



>ref|XP_010686566.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=601

 Score =   460 bits (1183),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 268/561 (48%), Positives = 371/561 (66%), Gaps = 35/561 (6%)
 Frame = -1

Query  1756  KVLCNAAHGGDS-KIDRRDVIlglgglygaanlpaA----MAGPIEAPEVSKCVVPPTDL  1592
             K+ CNAA+  +S K DRR++++GLGGLYGAA    +    +A P  AP+ ++C   P+ +
Sbjct  46    KISCNAANNNESNKFDRRNLLIGLGGLYGAATTLTSGNPTLAAPT-APDATQCA--PSTI  102

Query  1591  PAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPAD  1412
               G+ +  CCPP   +++D++LP  +P  +R+RPA H +D +Y  K++KA+ +MKALP  
Sbjct  103   DDGSTL-LCCPPKPSQFVDFKLPKVNPKQLRLRPAAHLVDEQYLAKYSKALALMKALPDS  161

Query  1411  DPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDP  1232
             DPRSF QQA VHCAYCNG Y QVG P++E QVH SWLFFPFHR YLYF+E+ILGKLI DP
Sbjct  162   DPRSFKQQADVHCAYCNGGYHQVGLPNLEFQVHGSWLFFPFHRAYLYFYEKILGKLIDDP  221

Query  1231  TFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEA--TDLE  1058
             TF +P+WNWD P GM  PS+ N++N   +D  R+Q+HLPPT+++L Y G DT +  T+ E
Sbjct  222   TFTIPYWNWDHPDGMYMPSMFNNQNSPFFDAIRDQNHLPPTLMNLSYDGPDTVSNLTNEE  281

Query  1057  RITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKN  878
             +I  NLA+MYKQM  NA   ELFLG PYR+GD      G++E  PH  IH W G+P    
Sbjct  282   QINQNLAVMYKQMVANAKKPELFLGAPYRAGDPPGQSPGTLEVQPHGTIHNWTGNPPPNT  341

Query  877   G--EDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNEN  704
                EDMGNFYSAGRD  FY HHANVDR W+IW+ L  +   ++F D D++N+ F FY+EN
Sbjct  342   PFWEDMGNFYSAGRDPIFYSHHANVDRTWSIWKSLSPKN--KDFKDKDFLNSYFYFYDEN  399

Query  703   AQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALR--------------S  566
             AQPV++ V D ++ ++MGY Y+  +LPW+ SKP PK  R    L+              +
Sbjct  400   AQPVKIYVRDVLDTKKMGYDYQPQDLPWLKSKPTPKRNRSPKPLKKVFSTVKNAVAAEPA  459

Query  565   AAPYVAT-VFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
               P V T VFP  L  ++R  +PRP+K+RT+ EK+ EEEIL+IE    +A+ Y+KFDVY+
Sbjct  460   TDPVVPTVVFPKPLKNIIRTNLPRPRKSRTQNEKDDEEEILVIEVES-RADVYSKFDVYV  518

Query  388   NDEDEPDG--GYDKAEFAGSFAHLPHRQ--KNVEKIRTSLSLGLNEAMEDLGAEDDDTVL  221
             NDEDE        + E+AGSF ++PHR   K+    +T++  GL+E ++DL A DD+ + 
Sbjct  519   NDEDESPTLENRTQTEYAGSFVNVPHRHGGKDGHLKKTTVKFGLSELIDDLDANDDEGID  578

Query  220   VTLAPNVGGGVVTIDNIKIEY  158
             +   P  G   V I +++IE+
Sbjct  579   IIFVPRTGTDSVIIKDVRIEF  599



>ref|XP_010686565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   460 bits (1183),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 265/589 (45%), Positives = 378/589 (64%), Gaps = 39/589 (7%)
 Frame = -1

Query  1828  FSRRPIPTHSHLHILTPVVLNRRL--KVLCNAAHGGDS-KIDRRDVIlglg----glyga  1670
              +R P+ T S          +RR+   + CNA +  +S K DRR++++GLG         
Sbjct  20    ITRNPLLTKSSQLSTFRSTQSRRIPSNISCNATNNDESNKFDRRNLLIGLGGLYGAATTL  79

Query  1669  anlpaAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRP  1490
              +  A +A P  AP+ ++CV  P+ +  G+ +  CCPP   +++D++LP  +P  +R+RP
Sbjct  80    TSGNATLAAPT-APDATQCV--PSKIDDGSPL-QCCPPKPSQFVDFKLPKVNPKQLRLRP  135

Query  1489  ALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHN  1310
             A H +D KY  K++KA+ +MKALP  DPRSF QQA VHCAYCNG Y QVG P++E QVH 
Sbjct  136   AAHLVDDKYLAKYSKALALMKALPDSDPRSFKQQADVHCAYCNGGYHQVGLPNLEFQVHG  195

Query  1309  SWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRN  1130
             SWLFFPFHR YLYF+ERILGKLI DPTF +P+WNWD P GM  PS+ ND+N   +D  R+
Sbjct  196   SWLFFPFHRAYLYFYERILGKLIDDPTFSIPYWNWDHPDGMYMPSMFNDKNSPFFDAIRD  255

Query  1129  QSHLPPTIVDLGYQGKDTEA--TDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKK  956
             Q+HLPPT+++L Y G DT +  T+ ++I  NL +MYKQM +NA    LFLG  YR+GD  
Sbjct  256   QNHLPPTLMNLSYDGPDTVSNLTNEQQIEQNLTIMYKQMVSNAKKPTLFLGASYRAGDPV  315

Query  955   NPGAGSMENSPHVPIHRWVGDPRRKNG--EDMGNFYSAGRDISFYCHHANVDRMWTIWQQ  782
             NPG G++E  PH  +H W G+P       EDMGNFYSA RD  FY HH NVDR W+IW+ 
Sbjct  316   NPGPGTLEIQPHGTVHNWTGNPPPNTPFWEDMGNFYSAARDPIFYAHHGNVDRTWSIWKD  375

Query  781   LGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPV  602
             +    + ++F D D++N+ F FY+ENA+PV++ V D ++ +++GY Y+  +LPW+ S+P 
Sbjct  376   IS--RKHKDFKDKDFLNSYFYFYDENAKPVKIFVKDVLDTKKLGYDYQPMDLPWLKSRPT  433

Query  601   PKPRRR------------KLALRSAA----PYVAT-VFPVTLDrvvrvkvprpkknrtke  473
             PK  RR            K A+ + A    P V T VFP  LD ++R  + RP+K+RT+E
Sbjct  434   PKRNRRPKKLVKKVFSTVKNAVAAEADTNNPVVPTLVFPRKLDHIIRTNLARPRKSRTQE  493

Query  472   ekeleeeilliegiEVQANQYTKFDVYLNDEDEPDG--GYDKAEFAGSFAHLPHRQ--KN  305
             EK+ EEE+L+I+    +++ Y+KFDVY+NDEDE        + E+AGSF ++PHR   K+
Sbjct  494   EKDDEEEVLVIDVES-RSDVYSKFDVYVNDEDESPTLENRTQTEYAGSFVNVPHRHSGKD  552

Query  304   VEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
                  T++  GL+E ++DL A DD+ + +   P  G   VTI +++IE+
Sbjct  553   GHLKMTTIKFGLSELIDDLDANDDEGLDIIFVPRTGTDSVTIKDVRIEF  601



>gb|ABI96938.1| putative polyphenol oxidase [Lyonothamnus floribundus]
Length=454

 Score =   454 bits (1168),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 242/457 (53%), Positives = 311/457 (68%), Gaps = 23/457 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA   NCCPP A + +D++LP+  P+ +RVRPA H +D
Sbjct  4     FAKPVLPPDVSKCGA--ADLPTGAKPMNCCPPPATKIIDFKLPA--PSRLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EK+ KA+E+MKALP DDPRSF QQA VHCAYC+GAY QVGFPD+E+Q+HNSWLFFP
Sbjct  60    QAYIEKYTKAMELMKALPEDDPRSFKQQAAVHCAYCDGAYHQVGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+Y+YF E+ILGKLI DPTF LPFWNWD P+GM  P +  + N  LYD+ RN +H PP
Sbjct  120   FHRYYVYFHEKILGKLINDPTFALPFWNWDSPSGMQLPGLFANPNSPLYDKFRNANHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              +VDL Y G D   +   +I  NL +MY+QM +NA    LF G PYR+GD+ +PG+GS+E
Sbjct  180   NLVDLDYNGTDENVSKETQINANLKIMYRQMVSNAKHPRLFFGNPYRAGDEPDPGSGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH  IH W GD  + N EDMGNFYSAG+D  FY HH+NVDRMW IW+ LG  G++ + 
Sbjct  240   GTPHSQIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWCIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             +D+DW+N+ FLFYNEN++ VRV+V D +E + +GY Y+  ++PW++SKP P  RR K AL
Sbjct  298   SDSDWLNSGFLFYNENSELVRVKVKDSLETKNLGYVYQEVDIPWLHSKPTPL-RRPKEAL  356

Query  571   RSAAPYVATV---------------FPVTLDrvvrvkvpr-pkknrtkeekeleeeilli  440
             R  A  +                  FP+ L+  +   V R  +K R K+EKE EEEIL+I
Sbjct  357   RKIAKKLGVARAAELSSSKVVPESEFPINLETKISTVVKRPQQKKRNKKEKEDEEEILVI  416

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             EGIE   +   KFDV++ND DE   G    EFAGSF 
Sbjct  417   EGIEFDRDVAVKFDVFVNDVDELPSGPADTEFAGSFV  453



>ref|XP_009782447.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=598

 Score =   458 bits (1178),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 258/499 (52%), Positives = 339/499 (68%), Gaps = 10/499 (2%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC   P DLP GA   NCCPPT    +D+QLP  S  T+R RPA H  D
Sbjct  103   FAAPVPGPDVSKC--GPADLPPGAAPVNCCPPTTANIIDFQLPPPS-TTLRTRPAAHSAD  159

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y EKF +A+++MK LP +DPRSF QQA VHCAYC+GAY+Q+GFP  E+QVH+SWLFFP
Sbjct  160   SAYIEKFNRAIQLMKQLPDNDPRSFKQQANVHCAYCDGAYEQLGFPSSELQVHSSWLFFP  219

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYFFE+ILG LI DPTF +PFWNWD P GM  P++  +R+ SL+D  R+Q H PP
Sbjct  220   FHRCYLYFFEKILGSLINDPTFAIPFWNWDHPDGMRLPAMYANRSSSLFDPLRDQKHQPP  279

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              IVDL + G D   ++ ++ + NL +MY+QM +   T   FLG PYR+G +   GAGS+E
Sbjct  280   VIVDLDFNGADPNISNAQQTSQNLTIMYRQMVSLGSTPAAFLGDPYRAGGEPG-GAGSLE  338

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N PH  +H W GD  + N E+MG FY+AGRD  FY HH+N+DR+W++W+ LG  GR+++F
Sbjct  339   NIPHGTVHVWTGDRTQPNFENMGVFYAAGRDPIFYAHHSNIDRLWSVWKTLG--GRRQDF  396

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLAL  572
             TD D++N+SFLFY+E AQ VR+RV DC++  ++GY Y+    PWINS+P  +      ++
Sbjct  397   TDPDFLNSSFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVVNPWINSRPRARVSSALSSV  456

Query  571   RSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKFDV  395
             R  A      FP  LD V+RV V R   K R KEEK+ +EE L++EGIE++ + + KFDV
Sbjct  457   RRLAE-AKDYFPTKLDHVIRVMVKRPNNKKRNKEEKDAKEEFLVVEGIELETDVFVKFDV  515

Query  394   YLNDEDEPDGGYDKAEFAGSFAHLPHRQ--KNVEKIRTSLSLGLNEAMEDLGAEDDDTVL  221
              +NDEDE     + AEFAGSF ++PH    K+ EK +T L L + E +EDL AEDDD V+
Sbjct  516   LINDEDETVISPNNAEFAGSFVNVPHLSHGKSDEKRKTKLKLAITELLEDLDAEDDDHVV  575

Query  220   VTLAPNVGGGVVTIDNIKI  164
             VT  P  G G V I  +KI
Sbjct  576   VTFVPKNGSGAVKIGGVKI  594



>gb|EYU34161.1| hypothetical protein MIMGU_mgv1a003495mg [Erythranthe guttata]
Length=581

 Score =   457 bits (1176),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 272/558 (49%), Positives = 364/558 (65%), Gaps = 31/558 (6%)
 Frame = -1

Query  1786  LTPVVLNRR---LKVLCNAAH----GGDSKIDRRDVIlglgglygaanl-----paAMAG  1643
             LTP   +RR    +V C   +      + K+DRR+++LGLGGLYGAANL      AA A 
Sbjct  30    LTPAGRHRRSHLFQVSCKQQNPPPPSSEGKVDRRNMLLGLGGLYGAANLIPTNPEAATAS  89

Query  1642  PIEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGK  1466
             PIE PE   C     D+ +G  ++ NCCPPT+ + +D++LP   PA +RVRP  HR+  +
Sbjct  90    PIEPPEFKACGAA-RDVQSGDLLNINCCPPTSDKIVDFKLPP-PPAKLRVRPPAHRVSKE  147

Query  1465  YKEKFAKAVEMMKALPADDP---RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFF  1295
             Y  KF +A+  MKAL   DP   R F QQA +HCAYCNGA+DQVG+ D+++QVHNSWLFF
Sbjct  148   YLAKFEEAIRRMKALDKSDPSDPRGFMQQANIHCAYCNGAHDQVGYKDLDLQVHNSWLFF  207

Query  1294  PFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLP  1115
             PFHRWYLYF+ERILG LI DPTF LPFWNWD P GM  P I ++    LYD NRNQ + P
Sbjct  208   PFHRWYLYFYERILGSLIDDPTFVLPFWNWDNPKGMQMPKIFDNSGSPLYDANRNQKNRP  267

Query  1114  PTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             P I+DLG+ G      DL+ + NNL +MY +M  +  +   F+G+PY++GD  +PG GS 
Sbjct  268   PAIIDLGFSG---ATEDLQVVVNNLTVMYSEMIRSVNSTLDFMGQPYKAGDAASPGMGSS  324

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             E   HV  H WVGDPR K  EDMGNFYSAGRD+ FYCHHANVDRMW++W+ L     K +
Sbjct  325   ERGSHVAAHVWVGDPRNKYSEDMGNFYSAGRDVLFYCHHANVDRMWSVWRTLKTDVPK-D  383

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPV-PKPRRRKL  578
               D D++NA+FLFY+EN Q VRV+VGDC+++++MGY++E  + PW+N KP     + + L
Sbjct  384   IKDPDYLNAAFLFYDENKQLVRVKVGDCLDHKKMGYEFEKVDTPWLNYKPTKKAAKAKIL  443

Query  577   ALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFD  398
              + + A  V  +FP+ L           +    K  K   +E+L++E IE    ++ KFD
Sbjct  444   KIAAGAETVEALFPLNL-------KKITRVLVNKSAKGKADEVLVLENIETDTTKFIKFD  496

Query  397   VYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLV  218
             V++NDED+     DKAE+AG+FA +PH+ K+ +K ++++SL L E  ED+   DDDTV+V
Sbjct  497   VFVNDEDDGSVELDKAEYAGTFAQVPHKTKD-KKGKSTISLRLTELYEDVDVADDDTVVV  555

Query  217   TLAPNVGGGVVTIDNIKI  164
             TL P   G  VTI  IKI
Sbjct  556   TLIPRSNGDDVTIGGIKI  573



>ref|XP_011082866.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=580

 Score =   456 bits (1174),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 263/555 (47%), Positives = 349/555 (63%), Gaps = 27/555 (5%)
 Frame = -1

Query  1792  HILTPVVLNRRLKVLCNAAH----GGDSKIDRRDVIlglgg---lygaanlpaAMAGPIE  1634
              +LT    + R +V CN         D  +DRR+++LGLGG        +   A A PIE
Sbjct  33    QLLTDSRRSHRFQVSCNGGINQNPSADGTVDRRNLLLGLGGLYGAANLVSDSQAYAAPIE  92

Query  1633  APEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDGKYKE  1457
              PE   C V   D+     +D NCCPP   + +DY+LP  +    R+RPA HR+  +Y  
Sbjct  93    PPEFKNCGVA-RDVQTNDILDVNCCPPVTDKIIDYKLPPVT--NWRIRPAAHRVSKEYLA  149

Query  1456  KFAKAVEMMKALPADDP---RSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFH  1286
             KF +A+  MKAL  DDP   R F QQA +HCAYCNGA+DQVGF D+++QVHNSWLFFPFH
Sbjct  150   KFEEAIRRMKALDKDDPTDPRGFMQQANIHCAYCNGAHDQVGFKDLDLQVHNSWLFFPFH  209

Query  1285  RWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTI  1106
             RWYLYF+ERILGKLI DPTF LPFWNWD P GM  P I +     LY+ NR+++H PP +
Sbjct  210   RWYLYFYERILGKLIDDPTFCLPFWNWDNPKGMQMPRIFDKTGSPLYNVNRDKTHRPPAL  269

Query  1105  VDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENS  926
             +DL        + DL+ + NNL +MY +M  +  +   F+GKPYR GD  +PG GS E  
Sbjct  270   IDLSLSNI---SDDLQVVVNNLTVMYSEMIRSVNSTLDFMGKPYRKGDNPSPGMGSSERG  326

Query  925   PHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTD  746
              HV  H WVGDP  +  EDMGNFYSAGRDI FY HHANVDRMW+IW+ L     K + TD
Sbjct  327   SHVAAHVWVGDPNNRYREDMGNFYSAGRDILFYSHHANVDRMWSIWRTLKTDVPK-DITD  385

Query  745   ADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLA-LR  569
              D++NA+FLFY+EN Q VRVRV DC+++++MGY +E  ++PW+N +P  K  + K+  + 
Sbjct  386   PDYLNAAFLFYDENKQLVRVRVADCIDHKKMGYDFEKVDIPWLNYRPPKKAAKTKIQNIS  445

Query  568   SAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYL  389
             S A     +FP+ L           +    K  K   +E+L++E IE  A QY KFDV++
Sbjct  446   SGAQKAEGLFPLNL-------KKITRVLVPKSAKGKADEVLVLENIETDATQYIKFDVFV  498

Query  388   NDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLA  209
             NDED+     DKAE+AG+FA +PH+ K+ + I ++++L L E  ED+  +DDDT++VTL 
Sbjct  499   NDEDDNAKELDKAEYAGTFAQVPHKTKSKKDI-SNINLRLTELYEDIDIDDDDTIVVTLV  557

Query  208   PNVGGGVVTIDNIKI  164
             P   G  VTI  IKI
Sbjct  558   PRSNGDDVTIGGIKI  572



>gb|ABI96950.1| putative polyphenol oxidase [Spiraea densiflora]
Length=454

 Score =   452 bits (1162),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 238/456 (52%), Positives = 314/456 (69%), Gaps = 21/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA+  NCCPP A + +D++LP+  P  +RVRPA H +D
Sbjct  4     FAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPA--PNRLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+E+MKALP  DPRSF  QA +HCAYC+GAYDQ GFPD+E+QVHNSWLFFP
Sbjct  60    KNYIAKYNKAMELMKALPDSDPRSFKSQAAIHCAYCDGAYDQTGFPDLELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DP+F +P+WNWD PAGM  P++  +    LYD+ RN SH PP
Sbjct  120   FHRYYLYFYEKILGKLINDPSFAIPYWNWDNPAGMQMPALFTNPKSPLYDKLRNASHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              ++DL Y G D   T+  ++  NL +MY+ M +NA    LF G+PYR+G   NPG GS+E
Sbjct  180   NMIDLDYSGTDENNTNQVQVNQNLKIMYRAMVSNAKNPLLFFGQPYRAGTSPNPGGGSVE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
             N+PH PIH W GD  + N E+MGNFYSAG+D  FY HH+NVDRMW +W+ LG  G++ + 
Sbjct  240   NTPHGPIHLWAGDKTQPNFENMGNFYSAGKDPIFYSHHSNVDRMWDLWKGLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR------  590
             TD+DW+N+ FLFYNENA+ VRV V DC++++++GY Y+   +PW+ SKP P  R      
Sbjct  298   TDSDWLNSGFLFYNENAEMVRVTVKDCLDSKKLGYTYQDVEIPWLKSKPTPIRRAEQKIS  357

Query  589   --RRKL-----ALRSAAPYV-ATVFPVTL-Drvvrvkvprpkknrtkeekeleeeillie  437
                +KL     A  SAA  V A+ FP+ L +++  V     +K R +EEK+ EEEIL+I+
Sbjct  358   QLAKKLGHAHAAELSAAKVVPASAFPLELTEKISTVVKRPQQKKRKQEEKDEEEEILVIK  417

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             GIE + +Q  KFDVY+ND D+   G    EFAGSF 
Sbjct  418   GIEFERDQVVKFDVYVNDVDDLPSGPSNTEFAGSFV  453



>ref|XP_003593517.1| Polyphenol oxidase A1 [Medicago truncatula]
 gb|ABN08604.1| Tyrosinase [Medicago truncatula]
 gb|AES63768.1| polyphenoloxidase [Medicago truncatula]
Length=608

 Score =   457 bits (1176),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 257/522 (49%), Positives = 356/522 (68%), Gaps = 31/522 (6%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVD--NCCPPTAGRYLDYQLPSFSPATMRVRPALHR  1478
             +A PI AP++S C   P DLP+GA     NCCPP + + +DY+ PS S   +RVR A H 
Sbjct  90    LASPISAPDLSTC--GPPDLPSGATPSGLNCCPPNSTKIIDYKFPS-STQPLRVRQAAHL  146

Query  1477  LDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
             ++ +Y +K+ KA+E+MKALP++DPR+F QQA +HCAYC+GAY QVGFP++++QVH+SWLF
Sbjct  147   VNDEYLQKYKKAIELMKALPSNDPRNFIQQANIHCAYCDGAYSQVGFPNLDLQVHSSWLF  206

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+ERILG LI DPTF LPFWN+D P GM FPSI  DR   LYDE RN +H 
Sbjct  207   FPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPSIYTDRTSPLYDELRNANHQ  266

Query  1117  PPTIVDLGYQ-GKDTEATDL-ERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGA  944
             PPT++D  Y  G D++  D  ERI+ NL +MY+Q+ +   T+ LFLG PYR+GD  +PGA
Sbjct  267   PPTLIDFNYVPGDDSDEVDENERISTNLTIMYRQVVSGGKTSTLFLGNPYRAGDAPDPGA  326

Query  943   GSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGR  764
             GS+E  PH  +H W GD  + N EDMG+FYSA RD  F+ HH+N+DR W+IW+ LG  G+
Sbjct  327   GSVEIVPHNIVHLWSGDDTQPNFEDMGDFYSAARDPIFFSHHSNIDRFWSIWKTLG--GK  384

Query  763   KRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP-KPRR  587
             +++F D DW+ + FLFY+EN   V+V V DC++ +++GY Y+  ++PW+N+KP P K  +
Sbjct  385   RKDFNDKDWLESEFLFYDENKNLVKVNVKDCLDTKKLGYVYQDVDIPWLNAKPTPCKKIQ  444

Query  586   RKLALRSAAPYVA------------------TVFPVTLDrvvrvkvprpkknrtkeekel  461
             +K+ +     +                      FP+ LD +V   V RPKK+R+K+EKE 
Sbjct  445   KKVEVAQGNSFGTGKARLSEINENLTNSRNDIKFPLVLDDMVSTTVKRPKKSRSKKEKEE  504

Query  460   eeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPH--RQKNVEKIRT  287
             EEE+L+IEGI        KFDV++ND+D+    ++  EFAGSF ++PH   ++ ++ I +
Sbjct  505   EEEVLVIEGIVFDTKACVKFDVFINDKDKVVKPFN-TEFAGSFVNVPHSLHEQTMKNINS  563

Query  286   SLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIE  161
             S   GL + +EDLG +DDD+V+VTL P  G G+V I NI IE
Sbjct  564   SCRFGLTDLLEDLGVDDDDSVVVTLVPRYGKGLVKIRNIMIE  605



>ref|XP_008345876.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=585

 Score =   456 bits (1172),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 239/502 (48%), Positives = 321/502 (64%), Gaps = 16/502 (3%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRL-  1475
              A P  AP+++ C   P   P G+ +D CCPPT    +D++LP   P  +R RPA   + 
Sbjct  90    FAAPXSAPDLTTCX--PAXKPDGSTID-CCPPTTTTIIDFELPDSGP--LRTRPAAQDVA  144

Query  1474  -DGKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLF  1298
              D +Y  K+  AVE M+ALP DDPRS  QQA VHC+YC+G Y QVG+ D+EIQVH  WLF
Sbjct  145   NDPEYLAKYKXAVEXMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHXCWLF  204

Query  1297  FPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHL  1118
             FPFHRWYLYF+E+I+G+LI D TF LPFWNWD PAGM  P I  D   SLYD+ RN +H 
Sbjct  205   FPFHRWYLYFYEKIMGELIGDXTFALPFWNWDAPAGMYIPEIFXDTXSSLYDQYRNXAHQ  264

Query  1117  PPTIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGS  938
             PP ++DL Y   D +  D  RI  NL  MYKQM +NA     F G+PY +GD+  PGAG+
Sbjct  265   PPKLLDLNYGXTDDDVDDATRIKENLTTMYKQMVSNATXHRXFYGEPYSAGDEPXPGAGN  324

Query  937   MENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ-QLGGRGRK  761
             +E +PH  IH W GDP + NGEDMG FYSA RD  FY HH+NVDRMW I++ +LGG    
Sbjct  325   IETTPHNNIHLWXGDPTQXNGEDMGTFYSAARDPXFYSHHSNVDRMWXIYKDKLGGT---  381

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKY-EFANLPWINSKPVPKPRRR  584
              +  + DW++A FLFY+E     RV V D ++ +++GY Y E  ++PW+ SKP  +    
Sbjct  382   -DIENTDWLDAEFLFYDEKKNLXRVXVRDSLDTKKLGYVYDENVSIPWLXSKPTXRKSTN  440

Query  583   KLALRSAAPYVATVFPVTL-DrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYT  407
             K     ++  ++T FP TL D +           RT  +K+ ++E+L+I+GIE   N+  
Sbjct  441   KRKAXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETV  500

Query  406   KFDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDT  227
             KFDVY+ND+ +   G DK+EFAGSF H+PH+ K  + I+T+L L +   +E+L AE D++
Sbjct  501   KFDVYVNDDADSLAGKDKSEFAGSFVHVPHKHK--KNIKTNLRLSITSLLEELDAETDNS  558

Query  226   VLVTLAPNVGGGVVTIDNIKIE  161
             ++VTL P VG G +TI    IE
Sbjct  559   LVVTLVPKVGKGPITIGGFSIE  580



>gb|ABM68052.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   456 bits (1173),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 250/519 (48%), Positives = 332/519 (64%), Gaps = 26/519 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
                P+  P+++KCV+PP   P  +   +CCPP +   +D++ PSF    +RVRPA   ++
Sbjct  94    FGAPVPIPDLTKCVIPPEKSPVSS---SCCPPFSADIIDFKFPSFE--KLRVRPAAQLVN  148

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ +A+++M+ALP DDPRSF QQA +HCAYC G Y Q G+P +E+ VH SWLF  
Sbjct  149   DDYFRKYDEALKLMRALPDDDPRSFFQQANIHCAYCVGGYTQKGYPGLELSVHKSWLFLA  208

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWY+YF+ERILG LI DPTF +PFWNWD P GM  PSI  + N SLYD  R+  H PP
Sbjct  209   FHRWYIYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSSLYDPKRDPKHQPP  268

Query  1111  TIVDLGYQGKDTEATD-----------LERITNNLALMYKQMFTNAGTAELFLGKPYRSG  965
             TI+DL Y     + TD            ++I +NL LMYKQM TN+ T   F G PYR+G
Sbjct  269   TIIDLNYSKSKEDPTDPNYDPNFPPSAEQQIKDNLTLMYKQMITNSKTCIQFHGSPYRAG  328

Query  964   DKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQ  785
                +PGAG +E +PH  IH W GDP +KN EDMG+FYS+GRD  FY  HANVDR+W+IW+
Sbjct  329   QAPDPGAGQLEINPHNHIHVWCGDPNQKNREDMGHFYSSGRDPLFYALHANVDRLWSIWK  388

Query  784   QLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKP  605
              LG  G++++ TD DW+   FLFY+EN   V+V+V D ++ +++GY Y+  +LPW N KP
Sbjct  389   TLG--GKRKDPTDDDWLETEFLFYDENKNLVKVKVKDGLDGEKLGYVYQDRDLPWKNCKP  446

Query  604   VPKPR---RRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillieg  434
              P  R   + KL  +  +      FP+ LD VV   V RPKK+R+ +EKE EEEIL+I+G
Sbjct  447   EPSSRVKSKGKLLTQRPSRKFVDKFPIVLDSVVSTIVKRPKKSRSSKEKEDEEEILVIDG  506

Query  433   iEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPH-----RQKNVEKIRTSLSLGL  269
             IE  +N   KFDV +NDED+   G    EFAG+F  L H       K  +   T L LGL
Sbjct  507   IEFDSNIEVKFDVIVNDEDDKVIGVGNTEFAGTFVSLLHGHNHENNKKKKNTVTCLRLGL  566

Query  268   NEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              + +EDL A+DDD+++VTL P  GG  V I  IKIE+ +
Sbjct  567   TDLLEDLKADDDDSIVVTLIPRYGGDGVKISGIKIEFAN  605



>gb|ABI96925.1| putative polyphenol oxidase [Adenostoma fasciculatum]
Length=454

 Score =   450 bits (1158),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 239/456 (52%), Positives = 314/456 (69%), Gaps = 21/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA+  NCCP  A + +D++LP+  P  +RVRPA H +D
Sbjct  4     FAKPVAPPDVSKCGA--ADLPTGAEPMNCCPLPATKIIDFKLPA--PTQLRVRPAAHTVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K+ KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    QAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DPTF LPFWNWD PAGM  P+I  +    LYD+ RN +H PP
Sbjct  120   FHRYYLYFYEKILGKLINDPTFVLPFWNWDSPAGMQLPAIFANPKSPLYDKFRNANHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              +VDL + G D   ++  +I  NL +MY+QM +NA    LF G PYR+GD+ +PGAGS+E
Sbjct  180   NLVDLDFNGTDENDSNATQINANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDPGAGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNF  752
              +PH PIH W GD  + N EDMGNFYSAG+D  FY HH+NVDRMW+IW+ LG  G++ + 
Sbjct  240   GTPHGPIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWSIWKTLG--GKRTDI  297

Query  751   TDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVP----KPRRR  584
             TD DW+++ FLFYNENA+ VRV+V D +E++ +GY Y+  ++PW++SKP P    K    
Sbjct  298   TDKDWLDSGFLFYNENAELVRVKVRDSLESKNLGYVYQEVDIPWLDSKPTPIRGVKHAMS  357

Query  583   KLA----------LRSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeillie  437
             K+A          L S+     + FP+ L+  +   V R  +K R K++KE EEEIL++E
Sbjct  358   KIAKKLGHARAAELSSSKVVPQSDFPIILETKISTVVKRPQQKKRNKKQKEDEEEILVVE  417

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             GIE   +   KFDV++ND D+   G    EFAGSF 
Sbjct  418   GIEFDRDVAVKFDVFVNDVDDLPSGPANTEFAGSFV  453



>gb|ABM68051.1| polyphenol oxidase [Trifolium pratense]
Length=604

 Score =   456 bits (1172),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 254/519 (49%), Positives = 332/519 (64%), Gaps = 27/519 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
                P+  P++SKCV      P   D  +CCPP +   +D++ P+F    +R RPA   +D
Sbjct  94    FGAPVPIPDLSKCV---KSTPKDIDPVDCCPPFSSNIIDFKFPTF--GKLRERPAAQLVD  148

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ +A+++MKALPADDPRSF QQAKVHCAYC G Y Q+G+P +++ VHNSWLFFP
Sbjct  149   DDYIAKYKEALKLMKALPADDPRSFEQQAKVHCAYCVGGYTQLGYPGVQLSVHNSWLFFP  208

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+ERILG LI DPTF +PFWNWD P GM  PSI  D   SLYD  R+  H  P
Sbjct  209   FHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMRIPSIFTDPKSSLYDPKRDCRHQLP  268

Query  1111  TIVDLGYQGKDTEATDLERITN----------NLALMYKQMFTNAGTAELFLGKPYRSGD  962
              IVDL Y     + T++  + N          NL++M++QM TN+ T+  F G PYR+GD
Sbjct  269   KIVDLDYTKSKEDPTNVNYVPNYPSAEQQIQINLSVMHRQMITNSQTSRQFFGSPYRAGD  328

Query  961   K---KNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTI  791
             +    + G GS+E +PH PIH W GDP++  GEDMGNFYSAGRD  FY HH NVDRMW+I
Sbjct  329   EGGVDDKGPGSIELTPHTPIHIWTGDPKQPVGEDMGNFYSAGRDPLFYAHHGNVDRMWSI  388

Query  790   WQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINS  611
             W+ L G  +  N  D DW+++ FLFY+EN   V+V+V DCV+  ++GY Y+  ++PWI+S
Sbjct  389   WKTLPGISKDCN--DNDWLDSEFLFYDENKNLVKVKVKDCVDESKLGYCYQKVDIPWIDS  446

Query  610   KPVPKPR--RRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeillie  437
             KP P  R  R K  L +        FP+ LD VV   V RPKK+R+ +EK+ +EEIL+I 
Sbjct  447   KPKPAGRRVRSKGKLLTKPRKSVDNFPIVLDSVVSTIVKRPKKSRSSKEKKDQEEILVIY  506

Query  436   giEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFAHLPH---RQKNVEK-IRTSLSLGL  269
             GIE       KFDV +NDED+   G +  EFAGSF  L H   ++ N++K   T L +GL
Sbjct  507   GIEFDDKIEVKFDVIVNDEDDKVIGAENTEFAGSFVSLMHVHNKKINMKKNTVTCLRIGL  566

Query  268   NEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEYGS  152
              + +E L A DDD++ VTL P  G G V I  IKIE+ S
Sbjct  567   TDLLEGLNAADDDSIRVTLIPRYGNG-VKIRGIKIEFES  604



>gb|AFH00996.1| polyphenol oxidase II [Pyrus x bretschneideri]
 gb|AFH00997.1| polyphenol oxidase II [Pyrus x bretschneideri]
Length=600

 Score =   455 bits (1171),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 270/563 (48%), Positives = 354/563 (63%), Gaps = 32/563 (6%)
 Frame = -1

Query  1771  LNRRLKVLCNAAHGGDS--------------KIDRRDVIlglgglygaanlpa---AMAG  1643
             ++RR  + C A +  ++              K+DRR+V+LGLGGLYGA  L     A A 
Sbjct  47    ISRRSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAA  106

Query  1642  PIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSP---ATMRVRPALHRLD  1472
             P+  P+++KC +   ++  G +   CCPP + +     + +F+P     +R RPA H + 
Sbjct  107   PLAPPDLTKCTL--AEITTGGETVACCPPVSTK-----IKAFTPDRSIPLRTRPAAHLVT  159

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  KF  A  +M+ALP DDPRS  QQA VHCAYCNGAY QVGFPDI+IQVH SWLFFP
Sbjct  160   DEYLAKFKNAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFP  219

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR YLYF+ERILGKLI DPTF LP+WNWD P G   P I  D    LYD+ RN  H PP
Sbjct  220   FHRMYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTTSPLYDQYRNAGHQPP  279

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPG-AGSM  935
              +VDL Y G D +  +  RI  NLA+MY+QM + A T +LF G  YR+GD      AG++
Sbjct  280   VLVDLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGTYAGTI  339

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN+PH  IH W GDP + N EDMGNFYS+GRD  FY HH NVDRMW IW+ LGG+ RK  
Sbjct  340   ENNPHNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGK-RKVP  398

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVE-NQQMGYKYEFANLPWINSKPVPKPRRRKL  578
             +    W++A FLFY+ENA+ V  +V D +   + + Y YE  ++P + SKP  +  R K 
Sbjct  399   YRHR-WLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPCLFSKPTARKPRNKT  457

Query  577   ALRSAAPYVATVFPVTLDrvvrvkvpr-pkknrtkeekeleeeilliegiEVQANQYTKF  401
               R +   + T FP T D    V+V R   + RTK+EK  EEE+L+I+ IE ++N+  KF
Sbjct  458   KARVSDTQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKF  517

Query  400   DVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTVL  221
             DV++ND+ E     DK+EFAGSF H+PH+QK   K +T+L LG+ + +EDLG E+D  VL
Sbjct  518   DVFINDDAESLSRKDKSEFAGSFVHVPHKQKTGTKTKTNLKLGITDLLEDLGVEEDSCVL  577

Query  220   VTLAPNVGGGVVTIDNIKIEYGS  152
             VTL P V    +T+   KIEY S
Sbjct  578   VTLVPRVSNSPITVGGFKIEYSS  600



>gb|ABI96949.1| putative polyphenol oxidase [Spiraea cantoniensis]
Length=455

 Score =   450 bits (1157),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 241/456 (53%), Positives = 314/456 (69%), Gaps = 22/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA+  NCCPP A + +D++LP+  P  +RVRPA H  D
Sbjct  4     FAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPA--PNRLRVRPAAHAAD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y  K+ KA+E+MKALP  DPRSF  QA VHCAYC+GAYDQVGFPD+E+QVHNSWLFFP
Sbjct  60    KAYIAKYNKAMELMKALPDSDPRSFKSQAAVHCAYCDGAYDQVGFPDLELQVHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DP F +P+WNWD PAGM  P++  +    LYD+ RN SH PP
Sbjct  120   FHRYYLYFYEKILGKLINDPNFAIPYWNWDSPAGMQLPAMFANPKSPLYDKLRNASHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAG-TAELFLGKPYRSGDKKNPGAGSM  935
              ++DL Y G D   T+  +I  NL +MY+ M +NA     LF G+PYR+GD  NPG GS+
Sbjct  180   NMIDLDYSGTDENNTNQVQINQNLKIMYRAMVSNAQRNPLLFFGQPYRAGDSPNPGGGSV  239

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             EN+PH PIH W GD  + N E+MGNFYSAG+D  FY HH+NVDRMW +W+ LG  G++ +
Sbjct  240   ENTPHGPIHLWAGDKTQPNFENMGNFYSAGKDPLFYSHHSNVDRMWDLWKGLG--GKRAD  297

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR-----  590
              TD+DW+N+ FLFYNENA+ VRV V DC++++++GY Y+   +PW+ SKP P  R     
Sbjct  298   ITDSDWLNSGFLFYNENAELVRVTVKDCLDSKKLGYTYQDVEIPWLKSKPTPIRRAEQKI  357

Query  589   ---RRKL-----ALRSAAPYV-ATVFPVTL-Drvvrvkvprpkknrtkeekeleeeilli  440
                 +KL     A  SAA  V A+ FP+ L +++  V     +K R +EEK+ EEEIL++
Sbjct  358   SQLAKKLGHAHAAELSAAKVVPASAFPLELTEKISTVVKRPQQKKRKQEEKDEEEEILVV  417

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             +GIE + +Q  KFDVY+ND D+   G    EFAGSF
Sbjct  418   KGIEFERDQVVKFDVYVNDVDDLPSGPSNTEFAGSF  453



>gb|AHX26182.1| polyphenol oxidase [Sorghum bicolor]
Length=553

 Score =   453 bits (1165),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 262/556 (47%), Positives = 354/556 (64%), Gaps = 33/556 (6%)
 Frame = -1

Query  1783  TPVVLNRRLKVLCNAAHGGDSKIDRRDVI------lglgglygaanlpaAMAGPIEAPEV  1622
              P   + +  + C A  G D    RRDV+         G L  +++   A+A PI+AP++
Sbjct  15    APPCCSLQTTLRCKATGGAD----RRDVLLGLSGAAAAGLLTSSSSRGGAIAAPIQAPDL  70

Query  1621  SKCVVPPTDLPAGADVDNCCPPTAGRYL-DYQLPSFSPAT-MRVRPALHRLDGKYKEKFA  1448
               C   P DLP      NCCPP AG  + D+ LP   PA  +RVRPA H +D +Y  K+ 
Sbjct  71    RDC--HPPDLPDTVGDVNCCPPGAGTAIVDFTLP---PAVGLRVRPAAHLVDEEYLAKYE  125

Query  1447  KAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYF  1268
             KAV +MK LP DDPRSFTQQ +VHCA C+GA+DQVGFPD+EIQ+HN WLFFP+HR+YLYF
Sbjct  126   KAVALMKELPDDDPRSFTQQWRVHCANCDGAFDQVGFPDLEIQIHNCWLFFPWHRFYLYF  185

Query  1267  FERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQ  1088
              ERILGKLI D  F LPFWNWD P GM  P+I  ++   LYDE R+ +H PP  +DL Y 
Sbjct  186   HERILGKLIGDDKFALPFWNWDAPGGMSMPAIYANKTSPLYDERRDPAHQPPFTLDLDYD  245

Query  1087  GKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIH  908
             G +      ++I  NL +MY+QM + A   ELF G PY  GD+ +PGAGS+E  PH  +H
Sbjct  246   GTEPTIPRHQQIDQNLMIMYRQMISGAKKKELFFGLPYHQGDQPDPGAGSVELIPHNTVH  305

Query  907   RWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINA  728
              W GDPR+ NGEDMGNFYSA RD  F+ HH N+DR+W++W  L  R    NFTD DW+NA
Sbjct  306   FWSGDPRQPNGEDMGNFYSAARDPLFFAHHGNIDRLWSVWNGL--RAGNTNFTDPDWLNA  363

Query  727   SFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVA  548
             SFLFY+E A+ VRVRV DC++   +GY Y+   LPW+N++P  +         S AP  +
Sbjct  364   SFLFYDEEARLVRVRVRDCLDTAALGYTYQDVALPWLNARPTTE-------TGSPAP-AS  415

Query  547   TVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEV--QANQYTKFDVYLNDEDE  374
                P TL++ VRV V RP+ +RT++EK+ EEE+L++EGIEV    +++ KFDV++N+   
Sbjct  416   GALPATLNQTVRVAVTRPRTSRTRQEKDDEEEVLVVEGIEVADHFSRFVKFDVFVNESQS  475

Query  373   PDG-GYDKAEFAGSFAHLPHR---QKNVEKIRTSLSLGLNEAMEDLGAEDDDTVLVTLAP  206
               G G   A+ AGS A  PH     K    ++T+   G+ + ++D+GA+ D T++V+L P
Sbjct  476   GGGMGSAAAQCAGSVAMTPHLVRPDKRRGSVKTAARFGICDLLDDIGADGDKTIVVSLVP  535

Query  205   NVGGGVVTIDNIKIEY  158
                G +VT+  ++IEY
Sbjct  536   RCAGDMVTVGCVRIEY  551



>gb|ABI96940.1| putative polyphenol oxidase [Oemleria cerasiformis]
Length=457

 Score =   449 bits (1156),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 242/459 (53%), Positives = 312/459 (68%), Gaps = 24/459 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA+  NCCPP A + +D++LPS  P+ +RVRPA H +D
Sbjct  4     FAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPS--PSRLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K+ KA+E+MK LP DDPRSF QQA VHCAYC+GAYDQVGFPD+E+Q+HNSWLFFP
Sbjct  60    KAYIDKYYKAMELMKGLPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD+ RN +H P 
Sbjct  120   FHRYYLYFFEKILGKLINDPTFALPFWNWDAPAGMQIPAIFADPRSPLYDKLRNANHQPT  179

Query  1111  T---IVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAG  941
             +   ++DL Y G D   +    I  NL +MY+QM +N     LF G PYR+GD+ +PG G
Sbjct  180   SAANVIDLDYNGTDENISKQATINANLKIMYRQMVSNGKNPLLFFGIPYRAGDEPDPGGG  239

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             S+E  PH P+H W GD  + N EDMGNFYS G+D  FY HH+NVDRMW IW+ LG  G++
Sbjct  240   SIEGIPHGPVHLWTGDNTQLNFEDMGNFYSXGKDPIFYSHHSNVDRMWNIWKTLG--GKR  297

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRR-  584
              + TD+DW+N+ FLFYNENA+ VRV+V D ++++++GY Y+  ++PW+ SKPVP  R + 
Sbjct  298   TDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESKPVPLVRAKQ  357

Query  583   ---KLA----------LRSAAPYVATVFPVTL-Drvvrvkvprpkknrtkeekeleeeil  446
                KLA          L S+     + FP+ L  ++  V     +K R K++KE EEEIL
Sbjct  358   TVSKLARKLGVAHAAELSSSKVVAESEFPLDLVTKISTVVKRPQQKKRNKKQKEDEEEIL  417

Query  445   liegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             +IEGIE + +   KFDVY+ND DE   G    EFAGSF 
Sbjct  418   VIEGIEFERDVAVKFDVYVNDVDELPSGPANTEFAGSFV  456



>ref|XP_009628381.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   454 bits (1167),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 263/550 (48%), Positives = 364/550 (66%), Gaps = 25/550 (5%)
 Frame = -1

Query  1768  NRRLKVLCN---AAHGGDSKIDRRDVIlglgglygaanlp--aAMAGPIEAPEVSKC--V  1610
             N + +V CN    A+    K++RR+++LGLGG+YGAA+L    A+A PI +P +++C   
Sbjct  36    NNKFQVSCNQNNEANNSQEKVERRNLLLGLGGIYGAAHLLPYDALASPIPSPTLTQCGTA  95

Query  1609  VPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSP---ATMRVRPALHRLDGKYKEKFAKAV  1439
             +   D P       CCPP         +P ++P   +  RVRPA H +D +Y  K+ +A 
Sbjct  96    IIEGDKPVPY---TCCPPIPEIK---DVPYYNPPPVSRFRVRPAAHTVDDEYIAKYNEAY  149

Query  1438  EMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFER  1259
               MKALP DDPRSF QQA +HCAYCNGAY   G    E+QVH SWLFFPFHRWY+YF+ER
Sbjct  150   SRMKALPTDDPRSFMQQANIHCAYCNGAYKVGG---KELQVHFSWLFFPFHRWYIYFYER  206

Query  1258  ILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKD  1079
             IL  LI DPTF LP+WNWD P GM  P + +    S+Y+E RNQ H    I+DLGY G+D
Sbjct  207   ILASLIDDPTFALPYWNWDNPKGMHLPDMFDVEGTSIYNERRNQKHRNGFIMDLGYAGED  266

Query  1078  TEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWV  899
               A DL+++ NNL LMY+QM TNA    LF GKPYR G + +PG G++EN PH  IHRWV
Sbjct  267   VVANDLQKLVNNLTLMYRQMITNAPCPSLFFGKPYRFGSEPSPGMGTIENVPHNSIHRWV  326

Query  898   GDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFL  719
             GDPR+ N EDMGNFYS+G+D +F+  HANVDRMWTIW+ LG  G++++ +D D+++  F 
Sbjct  327   GDPRQPNEEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLG--GKRKDISDPDYLDTEFF  384

Query  718   FYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALR-SAAPYVATV  542
             FY+E A+P RVRV DC++ +++GY ++  ++PW N KP P+  ++ + +  ++ P  + V
Sbjct  385   FYDEKAKPFRVRVRDCLDEKKLGYTFQPMDIPWKNFKPQPRKNKKNVKIDPNSVPPASQV  444

Query  541   FPV-TLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLN-DEDEPD  368
             FP+  LD+ V   V RPK+ RTK+EKE EEE+L  + +E+   ++ +FDV+LN D D   
Sbjct  445   FPIKKLDKTVTFSVARPKRLRTKKEKEDEEELLTFKNVELDVRKFVRFDVFLNEDNDVIA  504

Query  367   GGYDKAEFAGSFAHLPHRQKNVEKIR-TSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGG  191
                D+ EF GSFA+LPH   + +K +    SL +NE +EDL  E DD V+VTL P  GG 
Sbjct  505   NEIDRTEFVGSFANLPHIHDDPKKEKFPEFSLAINELLEDLKLEGDDLVVVTLVPKSGGE  564

Query  190   VVTIDNIKIE  161
              V+I+ ++I+
Sbjct  565   NVSIEAVEIQ  574



>gb|ABI96931.1| putative polyphenol oxidase [Exochorda racemosa]
Length=459

 Score =   449 bits (1155),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 241/461 (52%), Positives = 316/461 (69%), Gaps = 26/461 (6%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA+  NCCPP A + +D++LP+  P ++RVRPA H ++
Sbjct  4     FAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPATKIIDFRLPA--PNSLRVRPAAHAVN  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K+ KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQ+GFPD+E+Q+HNSWLFFP
Sbjct  60    KAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQIGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF LP+WNWD PAGM  P+I  D    LYD+ RN +H P 
Sbjct  120   FHRYYLYFFEKILGKLINDPTFALPYWNWDAPAGMQIPAIFADPRSPLYDKLRNANHQPT  179

Query  1111  T---IVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAG  941
             +   ++DL + G D   +    +  NL +MY+QM +NA    LF G PYR+GD+ +PG G
Sbjct  180   SAANLIDLDFNGTDENISKQATVNANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDPGGG  239

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             S+EN PH PIH W GD  + N E+MGNFYSAG+D  FY HH+NVDRMW IW+ LG  G++
Sbjct  240   SIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWNIWKTLG--GKR  297

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRR-  584
              + TD+DW+N+ FLFYNENA+ VRV+V D ++++++GY Y+  ++PW+ SKPVP  R + 
Sbjct  298   TDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESKPVPLVRAKV  357

Query  583   -----KLA----------LRSAAPYVATVFPVTL-Drvvrvkvprpkknrtkeekeleee  452
                  KLA          L S+     + FP+ L  ++  V     +K R K+EKE EEE
Sbjct  358   KQTVSKLARKLGVAHGVELSSSKAVAESEFPLDLVTKISTVVKRPQQKKRNKKEKEDEEE  417

Query  451   illiegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             IL+IEGIE + +   KFDVY+ND DE   G    EFAGSF 
Sbjct  418   ILVIEGIEFERDVAVKFDVYVNDVDELPSGPANTEFAGSFV  458



>gb|ABI96943.1| putative polyphenol oxidase [Prinsepia sinensis]
Length=457

 Score =   449 bits (1155),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 242/459 (53%), Positives = 314/459 (68%), Gaps = 24/459 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P+VSKC     DLP GA+  NCCPP   + +D++LP+  P+ +RVRPA H +D
Sbjct  4     FAKPVLPPDVSKCGA--ADLPTGAEPMNCCPPPTTKIIDFRLPA--PSGLRVRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K+ KA+E+MKALP DDPRSF QQA VHCAYC+GAYDQVGFPD+E+Q+HNSWLFFP
Sbjct  60    KAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYFFE+ILGKLI DPTF LPFWNWD PAGM  P+I  D    LYD+ RN +H P 
Sbjct  120   FHRYYLYFFEKILGKLINDPTFALPFWNWDAPAGMQIPAIFADPKSPLYDKLRNANHQPT  179

Query  1111  T---IVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAG  941
             +   ++D  Y G D   +    I  NL +MY+QM +N+    LF G PYR+GD+ +PG G
Sbjct  180   SAANLIDHDYNGTDENISKQATINANLKIMYRQMVSNSKNPLLFFGNPYRAGDEPDPGGG  239

Query  940   SMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRK  761
             S+EN PH PIH W GD  + N E+MGNFYSAG+D  FY HH+NVDRMW IW+ LG  G++
Sbjct  240   SIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWNIWKTLG--GKR  297

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR---  590
              + TD+DW+N+ FLFYNENA+ VRV+V D ++++++GY Y+  ++PW+ SKPVP  R   
Sbjct  298   TDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESKPVPLVRGKQ  357

Query  589   -----RRKLALRSAAPYVATV------FPVTL-Drvvrvkvprpkknrtkeekeleeeil  446
                   RKL +  AA   ++       FP+ L  ++  V     +K R K+EKE EEE+L
Sbjct  358   AVNKLARKLGVAHAAELSSSKVVAESEFPLDLVTKISTVVKRPQQKKRNKKEKEDEEEVL  417

Query  445   liegiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSFA  329
             +IEGIE + +   KFDVY+ND DE   G    EFAGSF 
Sbjct  418   VIEGIEFERDVAVKFDVYVNDVDELPSGPANTEFAGSFV  456



>gb|ABI96936.1| putative polyphenol oxidase [Holodiscus microphyllus]
Length=455

 Score =   449 bits (1154),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 234/456 (51%), Positives = 315/456 (69%), Gaps = 22/456 (5%)
 Frame = -1

Query  1651  MAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
              A P+  P++SKC     DLP GA+  NCCPP A + +D++LP+ +   +R+RPA H +D
Sbjct  4     FAKPVLPPDISKCGA--ADLPTGAEPMNCCPPPATKIIDFKLPATN--RLRIRPAAHAVD  59

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
               Y +K+ KA+E+MKALP  DPRSF  QA VHCAYC+GAYDQ GFPD+E+Q+HNSWLFFP
Sbjct  60    KAYIDKYNKAMELMKALPDSDPRSFKSQAAVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  119

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHR+YLYF+E+ILGKLI DP+F +PFWNWD PAGM  P++  +    LYD+ RN SH PP
Sbjct  120   FHRYYLYFYEKILGKLINDPSFAIPFWNWDAPAGMQIPALFANPKAPLYDKLRNASHQPP  179

Query  1111  TIVDLGYQGKDTEATDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSME  932
              ++DL Y G D   ++  +I  NL +MY+ M +NA   +LF G+PYR+G   NPG GS+E
Sbjct  180   NMIDLDYSGTDENNSNQVQIDQNLNIMYRAMVSNAKNPQLFFGQPYRAGSTANPGPGSIE  239

Query  931   NSPHVPIHRWVGDPRRKNGEDMGNFYSAGRD-ISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             NSPH PIH W GD  + N E+MGNFYSAG+D + +Y  H+NVDRMW IW+ LG  G++ +
Sbjct  240   NSPHGPIHLWAGDKTQPNYENMGNFYSAGKDPLFYYAIHSNVDRMWGIWKSLG--GKRVD  297

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPR-RRKL  578
              +D+DW+N+ FLFYNENA+ VRV V DC+++++MGY Y+   +PW+ +KP P PR  RK+
Sbjct  298   ISDSDWLNSGFLFYNENAEMVRVTVKDCLDSKKMGYTYQDVEVPWLKTKPTPIPRLERKI  357

Query  577   A-------------LRSAAPYVATVFPVTL-Drvvrvkvprpkknrtkeekeleeeilli  440
             +             L SA    A+ FP+ L +++  V     +K R KEEKE EEEIL++
Sbjct  358   SQLTKKLGHAHAAELSSAKVVPASAFPLELTEKISTVVKRPQQKKRKKEEKEEEEEILVV  417

Query  439   egiEVQANQYTKFDVYLNDEDEPDGGYDKAEFAGSF  332
             +GIE + +   KFDVY+ND D+   G    EFAGSF
Sbjct  418   KGIEFERDAVVKFDVYVNDVDDLPSGPSNTEFAGSF  453



>sp|Q9FRX6.1|AS1_ANTMA RecName: Full=Aureusidin synthase; Short=AmAS1 [Antirrhinum majus]
 dbj|BAB20048.1| aureusidin synthase [Antirrhinum majus]
 gb|ABR57233.1| aureusidin synthase [Antirrhinum majus]
Length=562

 Score =   452 bits (1164),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 261/505 (52%), Positives = 346/505 (69%), Gaps = 14/505 (3%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVDNCCPPTAGRYLDYQLPSFSPATMRVRPALHRLDG  1469
              GPI AP+V+KC  P  DLP G    NCCPP   + +D++LP  S  TMRVR A H +D 
Sbjct  60    TGPIAAPDVTKCGQP--DLPPGTAPINCCPPIPAKIIDFELPPPS-TTMRVRRAAHLVDD  116

Query  1468  KYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPF  1289
              Y  KF KAVE+M+ALP DDPRSF QQA VHCAYC GAY+Q GF ++++Q+H SWLFFPF
Sbjct  117   AYIAKFKKAVELMRALPEDDPRSFKQQANVHCAYCAGAYNQAGFTNLKLQIHRSWLFFPF  176

Query  1288  HRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPT  1109
             HR+Y+YFFERILGKLI D TF LPFWN+D P GM  PS+  D N SLYD  R+ +H PPT
Sbjct  177   HRYYIYFFERILGKLINDTTFALPFWNYDSPGGMTIPSMFIDTNSSLYDSLRDSNHQPPT  236

Query  1108  IVDLGYQGKDTEATDL--ERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
             IVDL Y   D++ T    E++  NL ++Y+QM ++A T +LF G+PYR GD++ PG GS+
Sbjct  237   IVDLNYAFSDSDNTTTPEEQMIINLKIVYRQMVSSAKTPQLFFGRPYRRGDQEFPGVGSI  296

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRN  755
             E  PH  IH W G      GE+MG FYS  RD  F+ HH+NVDRMW+IW+ LGG  R+ +
Sbjct  297   ELVPHGMIHLWTGSENTPYGENMGAFYSTARDPIFFAHHSNVDRMWSIWKTLGG-PRRTD  355

Query  754   FTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPK--PRRRK  581
              TD D+++ASF+FY+ENA+ VRV+V DC++ +++GY Y+   +PW+N++P PK  P   K
Sbjct  356   LTDPDFLDASFVFYDENAEMVRVKVRDCLDEKKLGYVYQDVEIPWLNTRPTPKVSPSLLK  415

Query  580   LALRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQ-YTK  404
                R+       VFP  LDRV++V V RPKK R+++EK+  EEIL+IEGIE++ +  + K
Sbjct  416   KFHRTNTANPRQVFPAILDRVLKVIVTRPKKTRSRKEKDELEEILVIEGIELERDHGHVK  475

Query  403   FDVYLNDEDEPDGGY---DKAEFAGSFAHLPHRQKNVEKIRTS-LSLGLNEAMEDLGAED  236
             FDVY+N  DE D      + AEFAGSF  L H+    ++ +T  L+L + + +EDL A++
Sbjct  476   FDVYIN-ADEDDLAVISPENAEFAGSFVSLWHKPIKGKRTKTQLLTLSICDILEDLDADE  534

Query  235   DDTVLVTLAPNVGGGVVTIDNIKIE  161
             DD VLVTL P   G  + I N+KIE
Sbjct  535   DDYVLVTLVPRNAGDAIKIHNVKIE  559



>ref|XP_009603530.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   453 bits (1165),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 267/547 (49%), Positives = 361/547 (66%), Gaps = 19/547 (3%)
 Frame = -1

Query  1768  NRRLKVLCNA---AHGGDSKIDRRDVIlglgglygaanlp--aAMAGPIEAPEVSKCVVP  1604
             N + KV CN    A+    K++RR+++LGLGG+YGAA+L    A+A PI +P +++C   
Sbjct  36    NNKFKVSCNQNNEANNSQEKVERRNLLLGLGGIYGAAHLLPYDALASPIPSPTITQCGTA  95

Query  1603  PTDLPAGADVDNCCPPTAGR--YLDYQLPSFSPATMRVRPALHRLDGKYKEKFAKAVEMM  1430
               D P       CCPP   +     Y LP  S    RVRPA   +D +Y  K+ +A   M
Sbjct  96    FID-PKIPVCYTCCPPIPDKKDVPCYDLPLVS--GFRVRPAAQTVDDEYIAKYNEAYSRM  152

Query  1429  KALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILG  1250
             KALP DDPRSF QQA +HCAYCNGAY   G    E+QVH SWLFFPFHRWYLYF ERIL 
Sbjct  153   KALPTDDPRSFMQQANIHCAYCNGAYKVGG---KELQVHFSWLFFPFHRWYLYFHERILA  209

Query  1249  KLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEA  1070
              LI DPTF LP+WNWD P GM  P + +    S+Y+E RNQ H    I+DLGY G+D  A
Sbjct  210   SLIGDPTFALPYWNWDHPKGMHLPDMFDVEGTSIYNERRNQKHRNGFIMDLGYAGEDVVA  269

Query  1069  TDLERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDP  890
              DL+++ NNLA+MY+QM TNA    LF GKPYR G K +PG G++EN PH  IHRWVGDP
Sbjct  270   NDLQKMVNNLAIMYRQMITNAPCPLLFFGKPYRLGSKPSPGMGTIENVPHNSIHRWVGDP  329

Query  889   RRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYN  710
             R+ N EDMGNFYS+G+D +F+  HANVDRMWTIW+ LG  G++++ +D D+++  F FY+
Sbjct  330   RQPNQEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLG--GKRKDISDPDYLDTEFFFYD  387

Query  709   ENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRKLALR-SAAPYVATVFPV  533
             E A+P RVRV DC++ +++GY ++  + PW N KP+ +   + + +  ++ P  + VFP+
Sbjct  388   EKAKPFRVRVQDCLDEKKLGYTFQPMDTPWKNFKPLLRKNTKNVKIDPNSVPPASQVFPI  447

Query  532   -TLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTKFDVYLN-DEDEPDGGY  359
               LD++V   V RPKK RTK+EKE EEE+L  + +E+   ++ +FDV+LN D D      
Sbjct  448   KKLDKIVTFSVARPKKLRTKKEKEDEEELLTFKNVELDVRKFVRFDVFLNEDNDVIANEI  507

Query  358   DKAEFAGSFAHLPHRQKNVEKIR-TSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVT  182
             D+ EF GSFA+LPH   + +K +    SL +NE +EDL  E DD V+VTL P +GG  V+
Sbjct  508   DRTEFVGSFANLPHIHDDPKKEKFPEFSLAINELLEDLKLEGDDLVVVTLVPKIGGDNVS  567

Query  181   IDNIKIE  161
             I+ ++I+
Sbjct  568   IEAVEIQ  574



>ref|XP_011098120.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
 gb|AFJ42577.1| polyphenol oxidase [Sesamum indicum]
Length=584

 Score =   453 bits (1165),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 243/500 (49%), Positives = 323/500 (65%), Gaps = 21/500 (4%)
 Frame = -1

Query  1648  AGPIEAPEVSKCVVPPTDLPAGADVD-NCCPPTAGRYLDYQLPSFSPATMRVRPALHRLD  1472
             A P++ PE+ KC    T+L  G  +D NCCPP   R LDY+LP      ++VRP+ HR+ 
Sbjct  91    ANPVQPPELDKCGTA-TNLNTGEQLDINCCPPVTDRILDYRLPPVY--QLKVRPSAHRVS  147

Query  1471  GKYKEKFAKAVEMMKALPADDPRSFTQQAKVHCAYCNGAYDQVGFPDIEIQVHNSWLFFP  1292
              +Y  K+ KA+++MK LPADDPR+F QQA +HCAYCNGAYDQ G   +++Q+HNSWLFFP
Sbjct  148   PEYIAKYNKAIDLMKRLPADDPRNFMQQAMIHCAYCNGAYDQPGQGSLDLQIHNSWLFFP  207

Query  1291  FHRWYLYFFERILGKLIRDPTFGLPFWNWDIPAGMVFPSILNDRNVSLYDENRNQSHLPP  1112
             FHRWYLYF+ERIL KLI DPTF LPFWNWD P GM  P + ND   ++YD  RNQ  L  
Sbjct  208   FHRWYLYFYERILAKLIGDPTFALPFWNWDNPKGMTIPPMFNDTKAAIYDPKRNQDRL-T  266

Query  1111  TIVDLGYQGKDTEATD-LERITNNLALMYKQMFTNAGTAELFLGKPYRSGDKKNPGAGSM  935
              +VDLG  G     TD L+ + NNL +MY +M         F+G+PYR G   NPG GS 
Sbjct  267   AVVDLGMTGN----TDPLQLVANNLTIMYSEMIRGNADVYDFMGQPYREGTAVNPGPGSS  322

Query  934   ENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDISFYCHHANVDRMWTIWQQL--GGRGRK  761
             E   H  IH +VGDPR  +GED+GNFYSAGRD  FYCHHANVDRMWT+WQ      +   
Sbjct  323   ERGSHTAIHVFVGDPREPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWQYFLPSNKVPD  382

Query  760   RNFTDADWINASFLFYNENAQPVRVRVGDCVENQQMGYKYEFANLPWINSKPVPKPRRRK  581
             +  TD D++NASF+FY+ENAQ VRV V D ++N +MGY +E  +LPWI+ +P P+  + K
Sbjct  383   KRITDPDFLNASFVFYDENAQLVRVTVKDSLDNLRMGYDFERVDLPWIDYRPPPQTVKAK  442

Query  580   LA-LRSAAPYVATVFPVTLDrvvrvkvprpkknrtkeekeleeeilliegiEVQANQYTK  404
             +    + AP   T+FP+ L+          +    K +K   +E+L++E I V   ++ K
Sbjct  443   IVRTGTTAPKADTLFPLKLE-------KVVRFQVPKAKKGKADELLVLENITVDTTKFLK  495

Query  403   FDVYLNDEDEPDGGYDKAEFAGSFAHLPHRQKNVEKIRTSLSLGLNEAMEDLGAEDDDTV  224
             FDV++NDED+     DKA +AG++A +PH+ KN +   TS+ L L +  +D+   DDDT+
Sbjct  496   FDVFVNDEDDNAFELDKAAYAGTYAQVPHKSKN-KTATTSIRLKLTDLYDDMDIGDDDTI  554

Query  223   LVTLAPNVGGGVVTIDNIKI  164
             +VTL P   G  VTI  IK+
Sbjct  555   VVTLVPRHQGPGVTIGGIKV  574



>dbj|BAJ10872.1| polyphenol oxidase [Hordeum vulgare subsp. vulgare]
Length=576

 Score =   452 bits (1164),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 259/591 (44%), Positives = 353/591 (60%), Gaps = 40/591 (7%)
 Frame = -1

Query  1867  MASLSPPRAPANLFSRRPIPTHSHLHILTP------VVLNRR-----LKVLCNAAHGGDS  1721
             M+  S PR    L +R P    S+L  L P      ++ +R+      ++ C A  G   
Sbjct  3     MSITSAPRCTTTLGTRMP----SNLQALVPKGHAHALLRDRKEARQPRRLACKATGG---  55

Query  1720  KIDRRDVIlglgglygaanlp----aAMAGPIEAPEVSKCVVPPTDLPAGADVDNCCPPT  1553
             ++DRRDV+LGLG    A         A+A PI+AP++  C   P +LP  A   NCCP +
Sbjct  56    RVDRRDVLLGLGSAAAAGLGTRRGRGAIAAPIQAPDLGNC--NPPELPNTAPDTNCCPTS  113

Query  1552  AGRYLDYQLP-SFSPATMRVRPALHRLDGKYKEKFAKAVEMMKALPADDPRSFTQQAKVH  1376
                  D+ LP + S A +RVRPA H +D  +  K+ +AV +MK LPADDPRSF QQ +VH
Sbjct  114   GTGITDFVLPPAASSAPLRVRPAAHLVDAGHLAKYERAVALMKQLPADDPRSFEQQWRVH  173

Query  1375  CAYCNGAYDQVGFPDIEIQVHNSWLFFPFHRWYLYFFERILGKLIRDPTFGLPFWNWDIP  1196
             CAYC+GAYDQ GFPD+EIQVHN WLFFP+HR+YLYF ERILGKLI D TF LPFWNWD P
Sbjct  174   CAYCDGAYDQAGFPDLEIQVHNCWLFFPWHRFYLYFHERILGKLIGDDTFTLPFWNWDAP  233

Query  1195  AGMVFPSILNDRNVSLYDENRNQSHLPPTIVDLGYQGKDTEATDLERITNNLALMYKQMF  1016
              GM  P++  + +  LY++ R+ +H PP  VDL Y   D      E+I  NL +MY+QM 
Sbjct  234   GGMTVPAMYANTSSPLYNQRRDPAHQPPFPVDLDYNEVDVVVPTDEQIDQNLRIMYRQMV  293

Query  1015  TNAGTAELFLGKPYRSGDKKNPGAGSMENSPHVPIHRWVGDPRRKNGEDMGNFYSAGRDI  836
             ++A   +LF+G+PYR+GD+ +PGAGSMEN PH  +H W GDP + NGEDMGNFYSA RD 
Sbjct  294   SSAKKTQLFMGQPYRAGDQPDPGAGSMENVPHGTVHTWTGDPAQPNGEDMGNFYSAARDP  353

Query  835   SFYCHHANVDRMWTIWQQLGGRGRKRNFTDADWINASFLFYNENAQPVRVRVGDCVENQQ  656
              F+ HHAN+DR+W +W+ L  R    +F DADW++A+FLFY+E A+ VRVRV DC++   
Sbjct  354   IFFAHHANIDRLWHVWRGL--RPGNADFADADWLDAAFLFYDEEARLVRVRVRDCLDLAA  411

Query  655   MGYKYEFANLPWINSKPVPKPRRRKLALRSAAPYVATVFPVTLDrvvrvkvprpkknrtk  476
             MGY Y+   LPW+ +KP    +R       AA  +      T+   V            +
Sbjct  412   MGYAYQDVGLPWLEAKPA---KRSGATPAPAAGALPATLGETVRVTVTRPQVSRSSKEKE  468

Query  475   eekeleeeilliegiEVQANQYTKFDVYLNDEDEPDGGYDKAE--FAGSFAHLPHRQKNV  302
             E +E+     +        N++ KFDV +N   EP+ G D A    AGS A  PH  +  
Sbjct  469   EAEEVLIIEGIEVADHF--NKFIKFDVLVN---EPESGGDGASGYCAGSVALTPHMVRTN  523

Query  301   EK---IRTSLSLGLNEAMEDLGAEDDDTVLVTLAPNVGGGVVTIDNIKIEY  158
             EK   ++T    G+ + M+++GA+ D TV+V+L P  GG +VT+  + + Y
Sbjct  524   EKKGSVKTVARFGVCDLMDNIGADGDKTVVVSLVPRCGGELVTVGGVSVGY  574



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5576455993584