BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25916_g5_i6 len=1665 path=[21805:0-557 15926:558-876 33968:877-893
33985:894-900 7880:901-1664]

Length=1665
                                                                      Score     E

ref|XP_009761763.1|  PREDICTED: uncharacterized protein LOC104213904    216   3e-61   
ref|XP_009604586.1|  PREDICTED: uncharacterized protein LOC104099...    212   1e-59   
ref|XP_009604588.1|  PREDICTED: uncharacterized protein LOC104099...    212   2e-59   
ref|XP_004235021.1|  PREDICTED: uncharacterized protein LOC101249...    212   2e-59   
ref|XP_006347514.1|  PREDICTED: uncharacterized protein LOC102588139    212   3e-59   
ref|XP_010318058.1|  PREDICTED: uncharacterized protein LOC101249...    195   3e-53   
ref|XP_007039200.1|  Uncharacterized protein isoform 1                  159   6e-40   
ref|XP_007039201.1|  Uncharacterized protein isoform 2                  157   2e-39   
ref|XP_010662932.1|  PREDICTED: uncharacterized protein LOC100853133    157   2e-39   
gb|KDP45520.1|  hypothetical protein JCGZ_17073                         144   5e-35   
gb|EYU19694.1|  hypothetical protein MIMGU_mgv11b009143mg               142   2e-34   
ref|XP_010035316.1|  PREDICTED: uncharacterized protein LOC104424553    140   1e-33   
ref|XP_011075894.1|  PREDICTED: uncharacterized protein LOC105160...    134   8e-32   
ref|XP_011084569.1|  PREDICTED: uncharacterized protein LOC105166784    133   1e-31   
emb|CDP04990.1|  unnamed protein product                                127   6e-29   
ref|XP_010267379.1|  PREDICTED: uncharacterized protein LOC104604...    123   2e-27   
ref|XP_010267380.1|  PREDICTED: uncharacterized protein LOC104604...    122   5e-27   
ref|XP_008376815.1|  PREDICTED: uncharacterized protein LOC103439946    119   3e-26   
ref|XP_009361282.1|  PREDICTED: uncharacterized protein LOC103951586    119   4e-26   
ref|XP_008234646.1|  PREDICTED: uncharacterized protein LOC103333569    118   1e-25   
ref|XP_002524424.1|  conserved hypothetical protein                     114   4e-25   Ricinus communis
ref|XP_006441238.1|  hypothetical protein CICLE_v10020653mg             116   6e-25   
gb|KDO38743.1|  hypothetical protein CISIN_1g017129mg                   116   6e-25   
ref|XP_011003259.1|  PREDICTED: uncharacterized protein LOC105110055    114   3e-24   
ref|XP_011075895.1|  PREDICTED: uncharacterized protein LOC105160...    111   4e-24   
ref|XP_006493204.1|  PREDICTED: uncharacterized protein LOC102614232    112   9e-24   
ref|XP_008381492.1|  PREDICTED: uncharacterized protein LOC103444331    112   1e-23   
ref|XP_002321364.2|  hypothetical protein POPTR_0015s00740g             111   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_004307917.1|  PREDICTED: uncharacterized protein LOC101313650    110   4e-23   
ref|XP_002318455.2|  hypothetical protein POPTR_0012s02820g             109   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006374085.1|  hypothetical protein POPTR_0015s00740g             107   5e-22   
ref|XP_002515870.1|  conserved hypothetical protein                     105   7e-22   Ricinus communis
ref|XP_011043691.1|  PREDICTED: rho GTPase-activating protein gac...    106   1e-21   
ref|XP_009351922.1|  PREDICTED: uncharacterized protein LOC103943361    106   1e-21   
ref|XP_007221171.1|  hypothetical protein PRUPE_ppa021823mg             108   2e-21   
ref|XP_010519570.1|  PREDICTED: uncharacterized protein LOC104798986    105   2e-21   
ref|XP_011043692.1|  PREDICTED: rho GTPase-activating protein gac...    105   3e-21   
ref|XP_007136438.1|  hypothetical protein PHAVU_009G045300g           99.8    4e-20   
ref|XP_006394704.1|  hypothetical protein EUTSA_v10005511mg             100   9e-20   
ref|XP_006581687.1|  PREDICTED: uncharacterized protein LOC100776...  98.6    1e-19   
ref|XP_003527999.1|  PREDICTED: uncharacterized protein LOC100776...  98.2    2e-19   
ref|XP_010099428.1|  hypothetical protein L484_003252                 99.4    2e-19   
gb|KFK27727.1|  hypothetical protein AALP_AA8G421600                  98.2    5e-19   
gb|KGN50314.1|  hypothetical protein Csa_5G167060                     97.8    8e-19   
ref|XP_008437012.1|  PREDICTED: uncharacterized protein LOC103482569  96.7    2e-18   
ref|XP_006578872.1|  PREDICTED: uncharacterized protein LOC102663205  94.4    4e-18   
ref|XP_003602376.1|  hypothetical protein MTR_3g092670                92.4    1e-17   
ref|XP_002874202.1|  hypothetical protein ARALYDRAFT_326742           92.8    2e-17   
ref|XP_006286735.1|  hypothetical protein CARUB_v10002983mg           92.4    5e-17   
ref|XP_010666129.1|  PREDICTED: probable ATP-dependent helicase P...  92.0    5e-17   
emb|CDY68447.1|  BnaC02g48760D                                        90.9    1e-16   
ref|XP_006376666.1|  hypothetical protein POPTR_0012s02820g           90.1    2e-16   
ref|NP_197838.2|  uncharacterized protein                             90.1    3e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11202.1|  unnamed protein product                              89.4    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805185.1|  PREDICTED: uncharacterized protein LOC103718240  87.8    1e-15   
ref|XP_010922572.1|  PREDICTED: uncharacterized protein LOC105045...  86.7    2e-15   
ref|XP_010922571.1|  PREDICTED: uncharacterized protein LOC105045...  87.0    3e-15   
ref|XP_009420008.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  85.9    4e-15   
ref|XP_009420007.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  85.9    6e-15   
emb|CDY05438.1|  BnaA02g32530D                                        85.1    9e-15   
ref|XP_010907408.1|  PREDICTED: uncharacterized protein LOC105034083  85.5    9e-15   
ref|XP_009130062.1|  PREDICTED: protein fantom                        84.3    1e-14   
ref|XP_008805011.1|  PREDICTED: uncharacterized protein LOC103718115  82.0    5e-14   
ref|XP_006840601.1|  hypothetical protein AMTR_s00084p00030860        80.5    4e-13   
ref|XP_008347320.1|  PREDICTED: uncharacterized protein LOC103410393  77.0    6e-12   
emb|CAN80175.1|  hypothetical protein VITISV_018394                   77.4    8e-12   Vitis vinifera
gb|AAS45434.1|  At5g24500                                             75.1    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502756.1|  PREDICTED: uncharacterized protein LOC101513...  73.2    3e-11   
ref|XP_010493611.1|  PREDICTED: uncharacterized protein LOC104770849  72.8    1e-10   
gb|EPS62702.1|  hypothetical protein M569_12088                       70.5    2e-10   
ref|XP_010454767.1|  PREDICTED: uncharacterized protein LOC104736472  70.9    6e-10   
gb|KHN23302.1|  hypothetical protein glysoja_015604                   63.5    2e-08   
gb|KHN19561.1|  hypothetical protein glysoja_027818                   60.5    1e-07   
ref|XP_010424276.1|  PREDICTED: uncharacterized protein LOC104709344  61.6    3e-07   
ref|XP_003598530.1|  hypothetical protein MTR_3g014780                55.5    7e-05   



>ref|XP_009761763.1| PREDICTED: uncharacterized protein LOC104213904 [Nicotiana sylvestris]
Length=331

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 156/354 (44%), Positives = 199/354 (56%), Gaps = 54/354 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCSISTQKSG S WLDRLRSSKGF   D+        Q+   ++   P +    +    
Sbjct  1     MLCSISTQKSG-SNWLDRLRSSKGFSFADH--------QTPDGSNSISPHAETQLRGNNN  51

Query  396   NLASVSCSTRPGSEKQQVLETPVDP--AGGKQQLFNAFSNALSELFNMGESSNYPAQ--K  563
             N      S+ P     +  +TP  P  +G  +QL N  +N LSELF MGES+++P    K
Sbjct  52    NNVGSESSSDPIRSVNEPAQTPAAPGNSGDNEQLCNVVTNVLSELFCMGESTSFPKFNFK  111

Query  564   KGSRKQINPRFF-SSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekID--  734
             KGSRKQ NPRF  SSE+NN            +ASPMSDD SRVE+K  +    E+  +  
Sbjct  112   KGSRKQTNPRFCASSEINN------------AASPMSDDNSRVEIKESQVKLLEQGSNLN  159

Query  735   ---------AHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkk  887
                       +L GFSR+EV VIDTSCAPWK +KLL+RKKNVWKVRDK+SK T       
Sbjct  160   VAEEEDKSHPNLLGFSRTEVMVIDTSCAPWKFEKLLYRKKNVWKVRDKKSKAT------S  213

Query  888   kkrkANDGGAAEDGNFGGIKKHKVSNGEETQISN-----------IIQGLQPGNKFEEGC  1034
                K        + +  G KK KV +G +   S+           + + L   +K EE C
Sbjct  214   AGNKKRKKADVVNEDVAGEKKPKVVSGNDGCGSSKDEKVGVCKFPVNEELWFNDKLEETC  273

Query  1035  KKTLDSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHHH  1196
             ++T DSVGQ  ++K  +  LKKA+SSVVLIK+IP SKK+GTGI K +LK SH H
Sbjct  274   RRTSDSVGQPSKKKQGNLKLKKASSSVVLIKSIPTSKKNGTGIAKNSLKPSHRH  327



>ref|XP_009604586.1| PREDICTED: uncharacterized protein LOC104099337 isoform X1 [Nicotiana 
tomentosiformis]
Length=331

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 158/354 (45%), Positives = 206/354 (58%), Gaps = 54/354 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCSISTQKSG + WLDRLRSSKGF   D+         + + ++ N   +    +    
Sbjct  1     MLCSISTQKSGAN-WLDRLRSSKGFSFADH--------HTPNGSNSNSSHAETQLRDSSN  51

Query  396   NLASVSCSTRPGSEKQQVLETPVDPA--GGKQQLFNAFSNALSELFNMGESSNYPAQ--K  563
             N A    S+ P     + ++TP  P   G  +QL N  +N LSELF MGES+++P    K
Sbjct  52    NNAGSESSSDPIRSGNEPVQTPTAPGNRGDDEQLCNVVTNVLSELFCMGESTSFPKFNFK  111

Query  564   KGSRKQINPRFF-SSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekID--  734
             KGSRKQ NPRF  SSE+NN            +ASPMSD+ SRVE+K  +    E+  D  
Sbjct  112   KGSRKQTNPRFCASSEINN------------AASPMSDENSRVEIKDSKVKLLEQGHDLN  159

Query  735   ---------AHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkk  887
                      A+L GFSR+EV VIDTSCAPWK +KLLFRKKN WKVRDK+SKTT  +G KK
Sbjct  160   LVGEEDKSQANLLGFSRTEVMVIDTSCAPWKFEKLLFRKKNAWKVRDKKSKTT-SVGNKK  218

Query  888   kkrkANDGGAAEDGNFGGIKKHKVSNGEETQISN-----------IIQGLQPGNKFEEGC  1034
             +K+        ED N  G KK KV +G++   S+           + + +   ++ EE C
Sbjct  219   RKKA---DVVNEDVN--GEKKQKVVSGKDGCGSSKDEKGGVCKFPVNEKIWLNDELEETC  273

Query  1035  KKTLDSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHHH  1196
             ++T D+VGQ  ++K  +  LKKA+SSVVLIK+IP SKK+GTG  K  LK SH  
Sbjct  274   RRTSDTVGQASKKKQGNLKLKKASSSVVLIKSIPTSKKNGTGAAKNCLKPSHRQ  327



>ref|XP_009604588.1| PREDICTED: uncharacterized protein LOC104099337 isoform X2 [Nicotiana 
tomentosiformis]
Length=330

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 205/353 (58%), Gaps = 53/353 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCSISTQKSG + WLDRLRSSKGF   D+         + + ++ N   +    +    
Sbjct  1     MLCSISTQKSGAN-WLDRLRSSKGFSFADH--------HTPNGSNSNSSHAETQLRDSSN  51

Query  396   NLASVSCSTRPGSEKQQVLETPVDPA--GGKQQLFNAFSNALSELFNMGESSNYPAQ--K  563
             N A    S+ P     + ++TP  P   G  +QL N  +N LSELF MGES+++P    K
Sbjct  52    NNAGSESSSDPIRSGNEPVQTPTAPGNRGDDEQLCNVVTNVLSELFCMGESTSFPKFNFK  111

Query  564   KGSRKQINPRFF-SSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekID--  734
             KGSRKQ NPRF  SSE+NN            +ASPMSD+ SRVE+K  +    E+  D  
Sbjct  112   KGSRKQTNPRFCASSEINN------------AASPMSDENSRVEIKDSKVKLLEQGHDLN  159

Query  735   ---------AHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkk  887
                      A+L GFSR+EV VIDTSCAPWK +KLLFRKKN WKVRDK+SKTT  +G KK
Sbjct  160   LVGEEDKSQANLLGFSRTEVMVIDTSCAPWKFEKLLFRKKNAWKVRDKKSKTT-SVGNKK  218

Query  888   kkrkANDGGAAEDGNFGGIKKHKVSNGEETQISN----------IIQGLQPGNKFEEGCK  1037
             +K+        ED N  G KK KV +G++   S+           +  +   ++ EE C+
Sbjct  219   RKKA---DVVNEDVN--GEKKQKVVSGKDGCGSSKDEKGGVCKFPVNEIWLNDELEETCR  273

Query  1038  KTLDSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHHH  1196
             +T D+VGQ  ++K  +  LKKA+SSVVLIK+IP SKK+GTG  K  LK SH  
Sbjct  274   RTSDTVGQASKKKQGNLKLKKASSSVVLIKSIPTSKKNGTGAAKNCLKPSHRQ  326



>ref|XP_004235021.1| PREDICTED: uncharacterized protein LOC101249438 isoform X1 [Solanum 
lycopersicum]
Length=345

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 206/349 (59%), Gaps = 27/349 (8%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQss-----sstspnppasinpt  380
             MLCSISTQKS  S WLDRLRSSKGF   D  NLEQFL   +     S  S       +  
Sbjct  1     MLCSISTQKSAGSNWLDRLRSSKGFSFADNRNLEQFLTHQTPNGSDSLPSSTETEIRDSN  60

Query  381   KLGQTNLASVSCSTRPGSEKQQVLETPVDPA-----GGKQQLFNAFSNALSELFNMGESS  545
                 T   S S   RP +E   VL     PA     G  ++L +  +N LS+LF MGES+
Sbjct  61    NKDNTGSESSSDPIRPVNE--SVLPRDQAPAASHNSGDNEELCSVVTNVLSDLFCMGEST  118

Query  546   NYP--AQKKGSRKQINPRFF-SSELNNVS----GSRDDRGK--DKSASPMSDDQSRVemk  698
             ++P  + K+GSRKQ NPRF  SSE+N  +    G R +  +  DK    + D Q ++  +
Sbjct  119   SFPKLSVKRGSRKQTNPRFCASSEINGDAVVEGGQRKEETESLDKCRVEIKDSQVKLLEE  178

Query  699   --lleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIH  872
                L  +EEE+K +A+L GFSR+EV VIDTSCAPWK +KLLFRKKNVWKVRDK+SK T++
Sbjct  179   GHNLNLAEEEDKSNANLMGFSRTEVMVIDTSCAPWKFEKLLFRKKNVWKVRDKKSK-TLN  237

Query  873   LGkkkkkrkANDGGAAEDGNFGGIKKHK--VSNGEETQISNIIQGLQPGNKFEEGCKKTL  1046
             LGKKK+K       A  +     I  H      G E + S++ + LQ  +K E  CK+T 
Sbjct  238   LGKKKRKVDVTSEDARGEKKRKFISGHNGYAEKGRECK-SSVSEKLQLDDKLEGTCKRTS  296

Query  1047  DSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHH  1193
             DS GQ  ++K R   LKKA+SSVVLIK+IP SKK+G G  K +LK SH 
Sbjct  297   DSFGQASKKKQRYLKLKKASSSVVLIKSIPTSKKNGVGFAKNSLKPSHR  345



>ref|XP_006347514.1| PREDICTED: uncharacterized protein LOC102588139 [Solanum tuberosum]
Length=348

 Score =   212 bits (539),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 162/348 (47%), Positives = 216/348 (62%), Gaps = 25/348 (7%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFL-RQsssstspnppasinptKLGQ  392
             MLCSISTQKS  S WLDRLRSSKGF   D  NLEQF+  Q+ + +   PP++    +   
Sbjct  1     MLCSISTQKSAGSNWLDRLRSSKGFSFADNRNLEQFITHQTPNGSDSLPPSTETEIRDSN  60

Query  393   TNLASVSCS--TRPGSEKQQVL---ETPVDP--AGGKQQLFNAFSNALSELFNMGESSNY  551
              N+ S S S   RP +E   VL   + P  P  +G  ++L +  +N LSELF MGES+++
Sbjct  61    NNIGSESSSDPIRPVNEP--VLHRDQAPAAPHNSGDNEELCSVVTNVLSELFCMGESTSF  118

Query  552   P--AQKKGSRKQINPRFF-SSELNNVS----GSRDDRGK--DKSASPMSDDQSRVemk--  698
             P  + K+GSRKQ NPRF  SSE+N+ +    G R +  +  DK    + D Q ++  +  
Sbjct  119   PKFSVKRGSRKQTNPRFCASSEINSDAVVEGGQRKEETESLDKCRVEIKDSQVKLLEQGH  178

Query  699   lleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLG  878
              L  +EEE+K +A+L GFSR+EV VIDTSCAPWK +KLLFRKKNVWKVRDK+SK T++ G
Sbjct  179   NLNLAEEEDKSNANLMGFSRTEVMVIDTSCAPWKFEKLLFRKKNVWKVRDKKSK-TLNWG  237

Query  879   kkkkkrkANDGGAAEDGNFGGIKKHK--VSNGEETQISNIIQGLQPGNKFEEGCKKTLDS  1052
             KKK+K       A  +     I  H    + G E + S++ + LQ  +K E  CK+T DS
Sbjct  238   KKKRKADVTSEDARGEKKQKFISGHDGYAAKGRECK-SSVSEKLQLDDKSEGTCKRTSDS  296

Query  1053  VGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHHH  1196
             VGQ  ++K     LKK++ SVVLIK+IP SKK+GTG  K +LK SH  
Sbjct  297   VGQASKKKQGSLKLKKSSPSVVLIKSIPTSKKNGTGFAKNSLKPSHRQ  344



>ref|XP_010318058.1| PREDICTED: uncharacterized protein LOC101249438 isoform X2 [Solanum 
lycopersicum]
Length=343

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 204/348 (59%), Gaps = 29/348 (8%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQss-----sstspnppasinpt  380
             MLCSISTQKS  S WLDRLRSSKGF   D  NLEQFL   +     S  S       +  
Sbjct  1     MLCSISTQKSAGSNWLDRLRSSKGFSFADNRNLEQFLTHQTPNGSDSLPSSTETEIRDSN  60

Query  381   KLGQTNLASVSCSTRPGSEKQQVLETPVDPA-----GGKQQLFNAFSNALSELFNMGESS  545
                 T   S S   RP +E   VL     PA     G  ++L +  +N LS+LF MGES+
Sbjct  61    NKDNTGSESSSDPIRPVNE--SVLPRDQAPAASHNSGDNEELCSVVTNVLSDLFCMGEST  118

Query  546   NYP--AQKKGSRKQINPRFF-SSELNNVS----GSRDDRGK--DKSASPMSDDQSRVemk  698
             ++P  + K+GSRKQ NPRF  SSE+N  +    G R +  +  DK    + D Q ++  +
Sbjct  119   SFPKLSVKRGSRKQTNPRFCASSEINGDAVVEGGQRKEETESLDKCRVEIKDSQVKLLEE  178

Query  699   --lleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIH  872
                L  +EEE+K +A+L GFSR+EV VIDTSCAPWK +KLLFRKKNVWKVRDK+SK T++
Sbjct  179   GHNLNLAEEEDKSNANLMGFSRTEVMVIDTSCAPWKFEKLLFRKKNVWKVRDKKSK-TLN  237

Query  873   LGkkkkkrkANDGGAAEDGNFGGIKKHK--VSNGEETQISNIIQGLQPGNKFEEGCKKTL  1046
             LGKKK+K       A  +     I  H      G E + S++ + LQ  +K E  CK+T 
Sbjct  238   LGKKKRKVDVTSEDARGEKKRKFISGHNGYAEKGRECK-SSVSEKLQLDDKLEGTCKRTS  296

Query  1047  DSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSH  1190
             DS GQ    K +   LKKA+SSVVLIK+IP SKK+G G  K +LK SH
Sbjct  297   DSFGQA--SKKKQRKLKKASSSVVLIKSIPTSKKNGVGFAKNSLKPSH  342



>ref|XP_007039200.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY23701.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=353

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 191/358 (53%), Gaps = 38/358 (11%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCSIST KSG S WLDRLRSSKGFP GD ++L+ FL   + S SP   AS +P    ++
Sbjct  1     MLCSISTGKSG-SNWLDRLRSSKGFPTGDNLDLDHFLTNPNPSDSPITDASNSPNSNSES  59

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYP--AQKKG  569
               ++        +   +V+ +  +PAG K+  F   SN LSELFNMG+ +     ++KK 
Sbjct  60    THSNDKELQNRKAPPPEVVSS--EPAGDKE-WFGIMSNVLSELFNMGDQAQTSRFSRKKT  116

Query  570   SRKQINPRFFSSELNNVSGSRDDRGKDKS--------ASPMSDDQSRVemklleqseeee  725
             SRKQ NP+    + +NV+ S + +    S        AS  S +      +  ++  ++ 
Sbjct  117   SRKQTNPKICIIKTSNVNTSEEQKSSSDSVRKDENIPASTTSLNSKEEAKREWKEEGDDY  176

Query  726   kI------------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTI  869
              +            +  L G+SRSEVTVIDTSC  WK DKL+FR+KN+WKV+DK+ K+ I
Sbjct  177   NVEEEEQEEENGKGERELLGYSRSEVTVIDTSCEVWKVDKLIFRRKNIWKVKDKKGKSRI  236

Query  870   HLGkkkkkrkANDGGAAEDGNFGGI--KKHKVSNGEETQISNI--------IQGLQPGNK  1019
              +G+KK+K        + D N GG+  KK K+S+ E   + +              PG K
Sbjct  237   -VGRKKRKAPPPPPPPSYDDNNGGVWNKKRKISSSELRSLKDTSGKESGSPTNHNAPGEK  295

Query  1020  FEEGCKKTLDSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHH  1193
              E  C +T D + Q L RK       K ++SV+LIK+IP  KK+G  + K  LK +  
Sbjct  296   GELVCNETPDDLTQVL-RKRLPRKSGKGSTSVILIKSIPTGKKNGAKLAKNRLKDTQR  352



>ref|XP_007039201.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY23702.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=355

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 134/361 (37%), Positives = 193/361 (53%), Gaps = 42/361 (12%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCSIST KSG S WLDRLRSSKGFP GD ++L+ FL   + S SP   AS +P    ++
Sbjct  1     MLCSISTGKSG-SNWLDRLRSSKGFPTGDNLDLDHFLTNPNPSDSPITDASNSPNSNSES  59

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYP--AQKKG  569
               ++        +   +V+ +  +PAG K+  F   SN LSELFNMG+ +     ++KK 
Sbjct  60    THSNDKELQNRKAPPPEVVSS--EPAGDKE-WFGIMSNVLSELFNMGDQAQTSRFSRKKT  116

Query  570   SRKQINPRFFSSELNNVSGSRDDRGKDKS--------ASPMSDDQSRVemklleqseeee  725
             SRKQ NP+    + +NV+ S + +    S        AS  S +      +  ++  ++ 
Sbjct  117   SRKQTNPKICIIKTSNVNTSEEQKSSSDSVRKDENIPASTTSLNSKEEAKREWKEEGDDY  176

Query  726   kI------------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTI  869
              +            +  L G+SRSEVTVIDTSC  WK DKL+FR+KN+WKV+DK+ K+ I
Sbjct  177   NVEEEEQEEENGKGERELLGYSRSEVTVIDTSCEVWKVDKLIFRRKNIWKVKDKKGKSRI  236

Query  870   HLGkkkkkrkANDGGAAEDGNFGGI--KKHKVSNGEETQISNIIQGLQ-----------P  1010
              +G+KK+K        + D N GG+  KK K+S+ E   + +   G +           P
Sbjct  237   -VGRKKRKAPPPPPPPSYDDNNGGVWNKKRKISSSELRSLKD-TSGKESGSPTNHGQNAP  294

Query  1011  GNKFEEGCKKTLDSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSH  1190
             G K E  C +T D + Q L RK       K ++SV+LIK+IP  KK+G  + K  LK + 
Sbjct  295   GEKGELVCNETPDDLTQVL-RKRLPRKSGKGSTSVILIKSIPTGKKNGAKLAKNRLKDTQ  353

Query  1191  H  1193
              
Sbjct  354   R  354



>ref|XP_010662932.1| PREDICTED: uncharacterized protein LOC100853133 [Vitis vinifera]
Length=329

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 139/350 (40%), Positives = 190/350 (54%), Gaps = 44/350 (13%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCSIST KSG SKWLDRLRS+KGFP G+  +LE FL     + S +P    +  K    
Sbjct  1     MLCSISTGKSG-SKWLDRLRSAKGFPTGNDDDLEHFLTHRDPNLSNSPITKPSDPK----  55

Query  396   NLASVSCS-TRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYP--AQKK  566
             +++  +CS  +P  ++ Q  ET      G+++ F   SN L+ELFNMG+S+  P  + KK
Sbjct  56    SISDSTCSDEKPVQDRSQPPET------GEKEWFGIMSNVLAELFNMGDSNQIPKLSGKK  109

Query  567   GSRKQINPR--FFSS--ELNNVSGSRDDRGKDKSASPMSDDQSRVemklleq----seee  722
              SRKQ NP+    SS  + + V  +    G D S + M D    V+     +      EE
Sbjct  110   SSRKQTNPKICLLSSVRQEDEVPATAPSSG-DNSLTEMKDSNGEVKTVNQGKVDCLDAEE  168

Query  723   ekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkkkkrkA  902
             EK +  L  +SRSEVTVIDTSCA WK +KLLFRKKNVWKVRDK+ K+     KK+K  + 
Sbjct  169   EKCNQDLSAYSRSEVTVIDTSCAVWKFEKLLFRKKNVWKVRDKKGKSRSIGRKKRKASEC  228

Query  903   NDGGAAEDGNFGGIKKHKVSNGEETQI-SNIIQGLQPGNKFEEGCKKTLDSVGQT-----  1064
             ++   A       ++  K  N EE+ + SN  Q   P N  +E CK+T D + Q      
Sbjct  229   DEQLEARKKMKLSVESFKERNEEESAMPSNEEQN--PHNAKKEECKETSDGLSQVPKKRS  286

Query  1065  ----LERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLK-SSHHHR  1199
                 L RK R+       S V+L++    SKK+G  +PK  LK +S  H+
Sbjct  287   PFSRLPRKSRE-----GGSPVILVR---GSKKTGANLPKITLKDTSRRHK  328



>gb|KDP45520.1| hypothetical protein JCGZ_17073 [Jatropha curcas]
Length=351

 Score =   144 bits (364),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 124/355 (35%), Positives = 183/355 (52%), Gaps = 35/355 (10%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+ T    +S WLDRLRS+KGFP  + ++L+ FL    +S S +P   ++ + +   
Sbjct  1     MLCSVPTGGKSSSNWLDRLRSNKGFPVTENLDLDHFLTNHQNSLSDSPVTDLSNSVINPH  60

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMG---ESSNYPAQKK  566
               ++ S + +  +++ Q  ET  +     +Q F   +N L +LFNMG   E  +  ++KK
Sbjct  61    FESTQSDNKQLAADRSQAAETSSESTD--RQWFGVMTNVLCDLFNMGDPKEKISRFSRKK  118

Query  567   GSRKQINPRFFSSELNNVSGSRDDRGKDK-----SASPMSDDQSRV------------em  695
              +RKQ NP+F        + + +  GK++     +AS  SD+ S V            + 
Sbjct  119   STRKQTNPKFCDVSAPTTANAIESIGKEEYVQATTASLHSDNNSNVGINADCGDDDVDDE  178

Query  696   klleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHL  875
             K           D  L G+SRSEVTVIDTS   WK DKL+FR+KN+WKVRDK+ K+    
Sbjct  179   KEKGGGGGGGASDRELKGYSRSEVTVIDTSFEVWKFDKLVFRRKNIWKVRDKKGKSWTSG  238

Query  876   GkkkkkrkANDGGAAEDGNFGGIKKHKVSNGE--ETQISNIIQGLQPGN------KFEEG  1031
              KK+K  +   G    +GN    KK K+SN E   ++ SN    + P N      + EE 
Sbjct  239   SKKRKGNQLESG----NGNVVLKKKAKISNLEFGSSKDSNGEDFMLPSNDKPQDGRREEI  294

Query  1032  CKKTLDSVGQTLERKHRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHHH  1196
              K+T D   Q + +K      KK  SSV+L+K IP SKK G  +PK +LK +   
Sbjct  295   SKETSDDYFQ-VPKKRSPRKTKKIGSSVILVKAIPTSKKYGKNLPKDHLKDTQRQ  348



>gb|EYU19694.1| hypothetical protein MIMGU_mgv11b009143mg [Erythranthe guttata]
Length=295

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 131/334 (39%), Positives = 173/334 (52%), Gaps = 55/334 (16%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLC   T KSG S WLDRLR++KGFP     +LEQFL+  +S T   P          + 
Sbjct  1     MLCPAPTGKSGKS-WLDRLRTAKGFPENGVNDLEQFLQNPNSPTHEMPQP--------KP  51

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGK-QQLFNAFSNALSELFNMGESSNYPAQ-KKG  569
             N AS+S                 DP  GK +QLF+  SN L+ELFN G+  + PA+ KK 
Sbjct  52    NSASIS-----------------DPDQGKDEQLFSMMSNVLNELFNFGDKCSNPAKMKKS  94

Query  570   SRKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQS-------RVemklleqseeeek  728
             +RKQ NPR  +  + N+     +    K A   S D +        +     E  EE   
Sbjct  95    ARKQTNPRICA--VPNIGADASNVASVKVALLRSGDSNSGVEGVRELCKWDNEGGEEGLG  152

Query  729   IDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkkkkrkAND  908
              D +L GFSR+EVTVIDTS   WK DKLL++KKNVWKVRDK+ K  I LG KKK++ +  
Sbjct  153   RDGNLIGFSRTEVTVIDTSYECWKFDKLLYKKKNVWKVRDKKGKGEI-LGSKKKRKVS--  209

Query  909   GGAAEDGNFGGIKKHKVSNGEETQISNIIQGLQPGNKFEEGCKKTLDSVGQTLERK--HR  1082
              G  E+   GG KK KV +    +++             E  +K    VG  L++K    
Sbjct  210   -GEMEENQRGG-KKSKVDDLSSNEMNK-----------SEIHEKASKKVGGILKKKRSRS  256

Query  1083  DFALKKANSSVVLIKNIPASKKSGTGIPKTNLKS  1184
             D   +  N+SV+LIK+I  S K+GT I K+ LKS
Sbjct  257   DLNSEDGNASVILIKSIHTSNKNGTSISKSYLKS  290



>ref|XP_010035316.1| PREDICTED: uncharacterized protein LOC104424553 [Eucalyptus grandis]
 gb|KCW46621.1| hypothetical protein EUGRSUZ_K00429 [Eucalyptus grandis]
Length=344

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 125/341 (37%), Positives = 170/341 (50%), Gaps = 52/341 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+   +SG S WLDRLRS++GFPAGD + L+ FL     +   NP     P     T
Sbjct  1     MLCSVPADRSG-SNWLDRLRSTRGFPAGDGLGLDHFL-----ANPQNPSPPTPPAPDPST  54

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQKKGSR  575
             + ++ S  ++ G++         DP GG++  +   +  LSELFNMG+       +K SR
Sbjct  55    SESTHSVQSQIGTQDHAHSARAQDP-GGERDWYGIMTGVLSELFNMGDGGEGEVARKSSR  113

Query  576   KQINPRFF-SSELNNVSGSR-----------------DDRGKDKSASPMSDDQSRVemkl  701
             KQ NPRFF +S  ++ S                    +   +  SA   SD   R     
Sbjct  114   KQPNPRFFPNSRTSDASAGEKISDCAAAAAAGAAGGENAGWRTPSADLESDAVDRTAKGA  173

Query  702   leqseeeekI------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKT  863
                 EEEE+       +  L G+SRSEVTVIDTSC  WK +K+L+R+KNVWKVRD++ K 
Sbjct  174   DADGEEEEEEEKESGDNQDLVGYSRSEVTVIDTSCESWKFEKVLYRRKNVWKVRDRKGKV  233

Query  864   TIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQISNIIQGLQPGNKFEEGCKKT  1043
                +G+KK+K     GG +EDG  GG KK KVS  E  ++     G +  N  E G  +T
Sbjct  234   RSSIGRKKRKL----GGGSEDGIVGGKKKLKVSGSEVDEL-----GEEQNN--ENGKAET  282

Query  1044  LDSVGQTLE-----RKHRDFA-----LKKANSSVVLIKNIP  1136
                +   L+     R H  F       +   SSVVLIK IP
Sbjct  283   SKELAHNLDKSCKTRFHLQFCESPRKRRTGGSSVVLIKGIP  323



>ref|XP_011075894.1| PREDICTED: uncharacterized protein LOC105160278 isoform X1 [Sesamum 
indicum]
Length=305

 Score =   134 bits (337),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 125/339 (37%), Positives = 179/339 (53%), Gaps = 49/339 (14%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+S  KSG S WLDRLR++KGF      +LE FL+                      
Sbjct  1     MLCSVSAGKSG-SGWLDRLRNAKGFSNDGATDLENFLQ----------------------  37

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGK-QQLFNAFSNALSELFNMGESSNYPAQ-KKG  569
                ++  S +  S+        +DP G    QL    S+ L+ELFN G + +  A+ KK 
Sbjct  38    ---NIDSSNQENSDPSPTSNRELDPIGNDDNQLITIMSDVLNELFNFGGNCSSAAKFKKS  94

Query  570   SRKQINPRF--FSSELNNVSGSRDDRGKDKSA-SPMSDDQSRVe----mklleqseeeek  728
             +RKQ NPR   FS   NN S   ++   +K+  S   D  S VE    + + E   EE+ 
Sbjct  95    ARKQANPRICAFS---NNGSDENNNAASEKAVVSRNGDSNSGVEGVKRLAIRENEGEEDG  151

Query  729   IDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkkkkrkAND  908
              + +L GFSR+EVTVIDTS   WK +KLL+RKKN+WKVRDK+ K+   +G K+K++   D
Sbjct  152   REGNLSGFSRTEVTVIDTSYEHWKLEKLLYRKKNMWKVRDKKGKSE-SVGNKRKRKV--D  208

Query  909   GGAAEDGNFGGIKKHKVSN----GEETQISNIIQGLQPGNKFEEGCKKTLDSVGQTLERK  1076
                 E+   G  KK K+      GEE+++  + +     NK  E  +K  D +G+ L++K
Sbjct  209   MVVREEQPEG--KKQKIDEKKGCGEESELQ-LNEVYHQSNK-PEAHEKVPDKLGKVLKKK  264

Query  1077  HRDFALKKANSSVVLIKNIPASKKSGTGIPKTNLKSSHH  1193
               +  L   +SSV+LIK+IP  KK+ T I K+ LKS  +
Sbjct  265   QAELNLGNGSSSVILIKSIPICKKNVTNISKSCLKSKQN  303



>ref|XP_011084569.1| PREDICTED: uncharacterized protein LOC105166784 [Sesamum indicum]
Length=298

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 120/326 (37%), Positives = 163/326 (50%), Gaps = 49/326 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             M+CS+ST KS +S WLDRLR++KGFP     +LE FL+  SS  +  P +          
Sbjct  1     MICSVSTGKSRSS-WLDRLRTAKGFPENGVTDLEMFLQNPSSPIAERPGSV--------A  51

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGES-SNYPAQKKGS  572
             N   + CSTR                   +Q FN  S+ L+ELFN G+   N    K  +
Sbjct  52    NSDPICCSTRDED----------------KQFFNIMSDVLNELFNFGDKCGNSTKLKTSA  95

Query  573   RKQINPRFF------SSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekID  734
             RKQINPR        S E+NN +  +      +S    S  +   E+   E   E  + D
Sbjct  96    RKQINPRICVFSNNGSREINNAAAEKPTL--LRSGDSNSGVEGVRELDKWENDGEGVERD  153

Query  735   AHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkkkkrkANDGG  914
              +L GFSR+EV VIDTS   WK +KLL+RKKNVWKVRDK+ K+ I   KKK+K       
Sbjct  154   GNLTGFSRTEVMVIDTSYESWKFEKLLYRKKNVWKVRDKKGKSVIMRSKKKRKVSR----  209

Query  915   AAEDGNFGGIKKHKV------SNGEETQISNIIQGLQPGNKFEEGCKKTLDSVGQTLERK  1076
             + E+   GG KK KV      + G E  ++ +   +       +G  K    VG TLE+K
Sbjct  210   SVEEDQHGG-KKLKVDKKEGSTEGCELPLNEVYHQINKSEVLGKGSSK----VGGTLEKK  264

Query  1077  HRDFALKKANSSVVLIKNIPASKKSG  1154
               D      +SSV+LIK+I   +K+G
Sbjct  265   QEDLKSGNGSSSVILIKSIHTGRKNG  290



>emb|CDP04990.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 120/327 (37%), Positives = 169/327 (52%), Gaps = 38/327 (12%)
 Frame = +3

Query  258   WLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQTNLASVSCSTRPGSE  437
             WL++LRSSKGFP+   ++LEQFL    +   P PP ++ P+K  QT+  +          
Sbjct  25    WLEKLRSSKGFPSSTDLDLEQFLALPQNHNHPVPPDNLEPSKHPQTHHPT----------  74

Query  438   KQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESS-NYPAQKKGSRKQINPRFF--SSE  608
               Q+L+ P      +   F   +N L+ELF MG+SS      KK SRKQ  P+F   S  
Sbjct  75    -DQLLQNPTQ----QNPFFTIVTNVLAELFCMGDSSLKIQPGKKCSRKQTIPKFCLPSDP  129

Query  609   LNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekID----------AHLFGFSR  758
              ++ S +  + G  K  +    D  +V++       EE +++           +L GFSR
Sbjct  130   PSDFSNNTANYGLGKELA----DHQQVKLVENVICIEEGEVEEEEEEEEMGYGNLSGFSR  185

Query  759   SEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkkkkrkANDGGAAEDGNFG  938
             +EVTVIDTS A WK DK+LFRKKNVWKVRDKR +  +  GKKKK++ ++       G   
Sbjct  186   TEVTVIDTSFASWKFDKMLFRKKNVWKVRDKRGQ-FMSSGKKKKRKASSVDSENVRGGLH  244

Query  939   GIKKHKVSNGEETQISNIIQG-----LQPGNKFEEGCKKTLDSVGQTLERKHRDFALKKA  1103
              +KK K  NG+         G         +K     +K  DS  + L++K    +L+  
Sbjct  245   RVKKPKTFNGQRGLSKKGSDGAFKDEYHLNDKSRTASRKISDSFSKALKKKQSTLSLENG  304

Query  1104  NSSVVLIKNIPASKKSGTGIPKTNLKS  1184
              SSVVLIKNIP  KKSGT  P++  KS
Sbjct  305   GSSVVLIKNIPTGKKSGTSSPRSCPKS  331



>ref|XP_010267379.1| PREDICTED: uncharacterized protein LOC104604644 isoform X1 [Nelumbo 
nucifera]
Length=364

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 120/369 (33%), Positives = 186/369 (50%), Gaps = 50/369 (14%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLR----QsssstspnppasinptK  383
             MLCSIS+ KS  + WLDRLRSSKGFP  D ++LE FL     Q++ S+  N   +     
Sbjct  1     MLCSISSGKSAPN-WLDRLRSSKGFPVADGLDLEHFLNPNPNQTTLSSETNASYATQEIG  59

Query  384   LGQTNLASVSCSTRPGSEKQQVLETPVDPAG-GKQQLFNAFSNALSELFNMGESSNYPA-  557
               + +  S S   +P +++++ +  P D    GK+  F    N L+ELFNMG+S  +   
Sbjct  60    YSKPHPESTSLDEKPVADRKKSMAGPGDRKNQGKEDWFGIMGNVLAELFNMGDSGEFQKI  119

Query  558   ----QKKGSRKQINPRF----FSSELNNVSGSRDDRGKD-KSASPMSDDQSRVemkll--  704
                 +K+  RKQ NP+      S+ +N+   +   R +   S SP S D S  EMK    
Sbjct  120   RGFDEKRSCRKQPNPKICVFSASASVNDSFLAAAPRLESVPSMSPPSGDNSVTEMKETVN  179

Query  705   -----------eqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDK  851
                          + +E+K+   L  +SR EVT+IDTSC  WK +KLLFRK +VWKVRDK
Sbjct  180   SLKPKKQGKVVSIAHDEDKLQTDLSTYSRVEVTIIDTSCPVWKSEKLLFRKGSVWKVRDK  239

Query  852   ----RSKTTIHLGkkkkkrkANDGGAAEDGNF----------GGIKKHKVSNGEETQISN  989
                 R+ ++    +K        GG  + G F           G +++KV   E   +S 
Sbjct  240   KWKSRNASSFRKKRKANHSDKEAGGGKKKGKFFLPLVNITREAGPEENKVPLDE---LSY  296

Query  990   IIQGLQPGNKFEEGCKKTLDSVGQTLERKHRDFALKKA---NSSVVLIKNIPASKKSGTG  1160
             + QG  P ++ +  CK++ D+     +R+    + +K    +S V  ++ +P S+KSG  
Sbjct  297   LEQG-PPQDEKKAPCKESADNAIVVAKRRSFSRSPRKPAHRDSPVFHVQAVPTSRKSGVH  355

Query  1161  IPKTNLKSS  1187
             +P++ LK +
Sbjct  356   LPRSRLKDT  364



>ref|XP_010267380.1| PREDICTED: uncharacterized protein LOC104604644 isoform X2 [Nelumbo 
nucifera]
Length=358

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 183/361 (51%), Gaps = 40/361 (11%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLR----QsssstspnppasinptK  383
             MLCSIS+ KS  + WLDRLRSSKGFP  D ++LE FL     Q++ S+  N   +     
Sbjct  1     MLCSISSGKSAPN-WLDRLRSSKGFPVADGLDLEHFLNPNPNQTTLSSETNASYATQEIG  59

Query  384   LGQTNLASVSCSTRPGSEKQQVLETPVDPAG-GKQQLFNAFSNALSELFNMGESSNYPA-  557
               + +  S S   +P +++++ +  P D    GK+  F    N L+ELFNMG+S  +   
Sbjct  60    YSKPHPESTSLDEKPVADRKKSMAGPGDRKNQGKEDWFGIMGNVLAELFNMGDSGEFQKI  119

Query  558   ----QKKGSRKQINPRF----FSSELNNVSGSRDDRGKD-KSASPMSDDQSRVemkll--  704
                 +K+  RKQ NP+      S+ +N+   +   R +   S SP S D S  EMK    
Sbjct  120   RGFDEKRSCRKQPNPKICVFSASASVNDSFLAAAPRLESVPSMSPPSGDNSVTEMKETVN  179

Query  705   -----------eqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDK  851
                          + +E+K+   L  +SR EVT+IDTSC  WK +KLLFRK +VWKVRDK
Sbjct  180   SLKPKKQGKVVSIAHDEDKLQTDLSTYSRVEVTIIDTSCPVWKSEKLLFRKGSVWKVRDK  239

Query  852   RSKTTIHLGkkkkkrkAN--DGGAAEDGN----FGGIKKHKVSNGEETQISNIIQGLQPG  1013
             + K+  +    +KKRKAN  D  A         F  +       G E     + +G  P 
Sbjct  240   KWKSR-NASSFRKKRKANHSDKEAGGGKKKGKFFLPLVNITREAGPEENKVPLDEG-PPQ  297

Query  1014  NKFEEGCKKTLDSVGQTLERKHRDFALKKA---NSSVVLIKNIPASKKSGTGIPKTNLKS  1184
             ++ +  CK++ D+     +R+    + +K    +S V  ++ +P S+KSG  +P++ LK 
Sbjct  298   DEKKAPCKESADNAIVVAKRRSFSRSPRKPAHRDSPVFHVQAVPTSRKSGVHLPRSRLKD  357

Query  1185  S  1187
             +
Sbjct  358   T  358



>ref|XP_008376815.1| PREDICTED: uncharacterized protein LOC103439946 [Malus domestica]
 ref|XP_008376817.1| PREDICTED: uncharacterized protein LOC103439946 [Malus domestica]
 ref|XP_008376818.1| PREDICTED: uncharacterized protein LOC103439946 [Malus domestica]
Length=366

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 129/379 (34%), Positives = 178/379 (47%), Gaps = 72/379 (19%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+   KSG S WL+RLRS+KGFP  D  +L+ FL +++SS            +    
Sbjct  1     MLCSVPATKSG-SNWLNRLRSNKGFPTADNSDLDHFLTRNASSLC----------EFPAP  49

Query  396   NLASVSC-STRPGSEKQQVLETPVDPAGGKQ--QLFNAFSNALSELFNMG--ESSNYPAQ  560
             N+ S S  STRP S++       + P G  Q  ++    SN LSELF MG  + S+  + 
Sbjct  50    NVVSSSTDSTRPDSDRVGNRSESLCPNGDDQGGEIIGMMSNVLSELFFMGGADESSRLSG  109

Query  561   KKGSRKQINPRFFSSELNNVSGSRD-----------------DRGKDKSASPMSDDQSRV  689
             KK  RKQ NPR       N +G                    +   DK AS   D+ S V
Sbjct  110   KKIPRKQANPRVCVGSTTNSNGDATATANEAEEKSSESEGNIENALDKVAS---DNNSLV  166

Query  690   -------------emklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKN  830
                            +   + +EEE+    + G+SRSEVTVIDTSC  WK +KL+FR+KN
Sbjct  167   GKKKKKELGGNVGGGQCEGEEDEEEEEKGEMKGYSRSEVTVIDTSCGVWKTEKLVFRRKN  226

Query  831   VWKVRDKRSK------------TTIHLGkkkkkrkANDGGAAEDGNFGG-----IKKHKV  959
             VWKVR+K+ K               H+     K+KA    +A D   GG     +   +V
Sbjct  227   VWKVREKKVKGRSFGRHKRKVVVEEHVADDIDKKKAKVSVSALDVEAGGDECIALNSIQV  286

Query  960   SNGEETQISNI-IQGLQPGNKFEEGCKKTLDSV-GQTLERKHRDFALKKANSSVVLIKNI  1133
                +   + N+  +G + G    E   KT D+  G +L R  R+  LKK  SSV+LIK +
Sbjct  287   QKPQNDTLDNLNDRGEEFGKHLPE--NKTKDTRKGFSLNRSPRN--LKKGGSSVILIKGL  342

Query  1134  PASKKSGTGIPKTNLKSSH  1190
             P   K+G  + K  LK S 
Sbjct  343   PTDNKNGGKLHKKTLKDSQ  361



>ref|XP_009361282.1| PREDICTED: uncharacterized protein LOC103951586 [Pyrus x bretschneideri]
Length=366

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 128/381 (34%), Positives = 176/381 (46%), Gaps = 76/381 (20%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+   KSG S WL+RLRS+KGFP  D  +L+ FL ++++S S          +    
Sbjct  1     MLCSVPATKSG-SNWLNRLRSNKGFPTADNSDLDHFLTRNANSLS----------EFPAP  49

Query  396   NLASVSC-STRPGSEK--QQVLETPVDPAGGKQQLFNAFSNALSELFNMG--ESSNYPAQ  560
             N+ S S  STRP S++   +   +  +       +    SN LSELF MG  + S+  + 
Sbjct  50    NVVSSSTDSTRPDSDRVGNRSESSCPNGDDQGGGIIGMMSNVLSELFFMGGADESSRLSG  109

Query  561   KKGSRKQINPRFFSSELNNVSG------------SRDDRGKDKSA--SPMSDDQSRV---  689
             KK  RKQ NPR       N +G            S +  G  ++A     SD+ S V   
Sbjct  110   KKIPRKQANPRVCVGSTTNSNGDATATANAAEEKSSESEGNIENALDKVASDNNSLVGKK  169

Query  690   ----------emklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWK  839
                         +   + +EEE+    + G+SRSEVTVIDTSCA WK +KL+FR+KNVWK
Sbjct  170   KKKELGGNEGGGQCEGEEDEEEEEKGEMKGYSRSEVTVIDTSCAVWKTEKLVFRRKNVWK  229

Query  840   VRDKRSK------------TTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQI  983
             VR+K+ K               HLG    K+KA    +A D   G          +E   
Sbjct  230   VREKKVKGRSFGRHKRKVVVEEHLGDDIDKKKAKVSVSALDVEAG---------VDECIA  280

Query  984   SNIIQGLQPGNKFEEGCKKTLDSVGQTL-ERKHRDFA-----------LKKANSSVVLIK  1127
              N IQG +P N   +      +  G+ L E K +D             LKK  SSV+LIK
Sbjct  281   LNAIQGQKPQNDTLDNLNDRGEEFGKHLPENKTKDIRKGFSLNRSPRNLKKGGSSVILIK  340

Query  1128  NIPASKKSGTGIPKTNLKSSH  1190
              +P   K+G  + K  LK S 
Sbjct  341   GLPTDNKNGGKLHKKTLKDSQ  361



>ref|XP_008234646.1| PREDICTED: uncharacterized protein LOC103333569 [Prunus mume]
Length=374

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 123/378 (33%), Positives = 176/378 (47%), Gaps = 68/378 (18%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+   KSG S WLDRLRS+KG P GD ++L+ FL ++++S+S          +    
Sbjct  1     MLCSVPASKSG-SNWLDRLRSNKGLPTGDNLDLDHFLSRNTNSSS----------EFQTP  49

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGKQ--QLFNAFSNALSELFNMGESSNYPAQ--K  563
             N++S + S+RPGS++     T   P    Q        +  LSELF MG S        K
Sbjct  50    NVSSSTESSRPGSDRVVNQSTSSCPNRDNQGEAFIGLMNTVLSELFFMGGSDERSKLLGK  109

Query  564   KGSRKQINPRFFSSELNNVS----------------GSRDDRGKDKSASPMSDDQSRVem  695
             K  RKQ NPR   +   N                  G  D+   DK+A   S + S ++ 
Sbjct  110   KIPRKQANPRVCVASTTNADSNAATANATEEKSSDWGRNDENVLDKAACLDSQNGSLMKN  169

Query  696   klleqseeeekIDA------------HLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWK  839
             K L     EE  +              L G+S SEVTVIDTSC  WK +K++FR+KNVWK
Sbjct  170   KDLGNVGGEEGEEVEEEEEEEKEELRELKGYSISEVTVIDTSCGVWKTEKVVFRRKNVWK  229

Query  840   VRDKRSKTTIHLGkkkkkrkAN----DGGAAEDGNFGGIKKHKVSNGEETQISNIIQGLQ  1007
             VR+K++K     G++K+K        +GG   D     +   K ++G+E       +G  
Sbjct  230   VREKKAKVR-KFGRRKRKVVDEEVGVEGGDDIDKKKAKVAALKEADGDECIALKSTEGQN  288

Query  1008  PGNKF-EEGCKKTLDSVGQTLERKHRDFA-------------------LKKANSSVVLIK  1127
               N   +E C+ T DS+ +  E   +D                     +KK +SSV+LIK
Sbjct  289   SQNDTSKEVCEDTPDSLNERREEFGKDMPGAKSKDAKKGFPLSRSPRKMKKGDSSVILIK  348

Query  1128  NIPASKKSGTGIPKTNLK  1181
              IP   K+G  + +T LK
Sbjct  349   GIPTDNKNGGKLLRTCLK  366



>ref|XP_002524424.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37959.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 126/232 (54%), Gaps = 36/232 (16%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS+S      S WLDRLRS+KGFPA + ++L+ FL  SS                   
Sbjct  1    MLCSVSAGTKSGSNWLDRLRSTKGFPATENLDLDNFLSNSSLLNPSISE-----------  49

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQ---KK  566
              +++S + R  S++ Q  +T  +   G+++ F   +N L +LFNMG+S +  ++    K
Sbjct  50   --STLSHNKRVTSDQTQFPDTSSE--NGEKEWFGLVTNVLCDLFNMGDSQDKNSRLSGTK  105

Query  567  GSRKQINPRFFSSELNNVSGSRDDRGKDKS--ASPMSDDQSRV-----------emklle  707
             SRKQ NP+FF     ++   R +     +  AS  SD+ S V           +   ++
Sbjct  106  SSRKQTNPKFF-----DIESVRKEECVQVATPASFRSDNNSNVVGMNADCFSNDDDNNVD  160

Query  708  qseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKT  863
            + +E+   D  L G+S+SEVTVIDTS   WK DKL+FR+KN+WKVRDK+ K+
Sbjct  161  EEKEKCSSDKELKGYSKSEVTVIDTSFEMWKFDKLVFRRKNIWKVRDKKGKS  212



>ref|XP_006441238.1| hypothetical protein CICLE_v10020653mg [Citrus clementina]
 gb|ESR54478.1| hypothetical protein CICLE_v10020653mg [Citrus clementina]
Length=374

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 149/276 (54%), Gaps = 43/276 (16%)
 Frame = +3

Query  210  APMLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLG  389
            + M+CS+ST KS  S WLDRLRS+KGFP GD + L+ FL                     
Sbjct  29   SAMICSMSTGKS-CSNWLDRLRSNKGFPVGDDLELDHFLENK------------------  69

Query  390  QTNLASVSCSTRPGSEKQQVLETPV---DPAGGKQQLFNAFSNALSELFNMGESSNYPA-  557
             +NL   S S+     ++   E      +    K + F   +N LS+LF MGES++  + 
Sbjct  70   DSNLKPKSNSSESTQNRKVATEEICGENENGDDKGEWFGIMNNVLSDLFIMGESNDDQSC  129

Query  558  ---QKKGSRKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeek  728
               +KK SRKQ NP+F    ++ ++ S  +  +        D+ +++E KL E+ + EE 
Sbjct  130  KFSRKKISRKQTNPKFCL--VSRMTSSNVEEEQSCGGCERKDENAQIENKLKEEVDGEEN  187

Query  729  ID----------AHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLG  878
            ++            L G+SR+EVTVIDTSC  WK +KL++RK+NVWKVR+K+ K+ + +G
Sbjct  188  VNNVVEMEDGEREELLGYSRNEVTVIDTSCTEWKFEKLVYRKRNVWKVREKKGKSRM-IG  246

Query  879  kkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQIS  986
              +KKRKAN  GA  D N    KK K+++ E+   S
Sbjct  247  LGRKKRKAN--GA--DANVDTKKKFKLNSQEDCIFS  278



>gb|KDO38743.1| hypothetical protein CISIN_1g017129mg [Citrus sinensis]
Length=376

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 149/276 (54%), Gaps = 43/276 (16%)
 Frame = +3

Query  210  APMLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLG  389
            + M+CS+ST KS  S WLDRLRS+KGFP GD + L+ FL                     
Sbjct  29   SAMICSMSTGKS-CSNWLDRLRSNKGFPVGDDLELDHFLENK------------------  69

Query  390  QTNLASVSCSTRPGSEKQQVLETPV---DPAGGKQQLFNAFSNALSELFNMGESSNYPA-  557
             +NL   S S+     ++   E      +    K + F   +N LS+LF MGES++  + 
Sbjct  70   DSNLKPKSNSSESTQNRKVATEEICGENENGDDKGEWFGIMNNVLSDLFIMGESNDDQSC  129

Query  558  ---QKKGSRKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeek  728
               +KK SRKQ NP+F    ++ ++ S  +  +        D+ +++E KL E+ + EE 
Sbjct  130  KFSRKKISRKQTNPKFCL--VSRMTSSNVEEEQSCGGCERKDENAQIENKLKEEVDGEEN  187

Query  729  ID----------AHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLG  878
            ++            L G+SR+EVTVIDTSC  WK +KL++RK+NVWKVR+K+ K+ + +G
Sbjct  188  VNNVVEMEDGEREELLGYSRNEVTVIDTSCTEWKFEKLVYRKRNVWKVREKKGKSRM-IG  246

Query  879  kkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQIS  986
              +KKRKAN  GA  D N    KK K+++ E+   S
Sbjct  247  LGRKKRKAN--GA--DANVDTKKKFKLNSQEDCIFS  278



>ref|XP_011003259.1| PREDICTED: uncharacterized protein LOC105110055 [Populus euphratica]
Length=343

 Score =   114 bits (284),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 131/361 (36%), Positives = 179/361 (50%), Gaps = 55/361 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+ T KSG S WLDRL S+KGF   D               S   P+S   T    +
Sbjct  1     MLCSVKTSKSG-SNWLDRLWSNKGFNNND-----------DDEPSVPNPSSSPITDASNS  48

Query  396   NLASVSCSTRPGSEKQQVLETPVDP--AGGKQQLFNAFSNALSELFNMG------ESSNY  551
              + S S ST   S++ +V  T      +   + LF   +N LS+LFNMG      E S+ 
Sbjct  49    VINSNSESTHSESDQNKVTTTTTREISSSDNKDLFFLMNNVLSDLFNMGGCSDPIEGSSR  108

Query  552   PAQKKGS--RKQINPRF-FSSELNNVSGSRDDRGKDK-----SASPMSDDQSRVemklle  707
              ++KK    RKQ  P+F F S  N+ + S D   KD+     + S  SD  S      ++
Sbjct  109   HSRKKERIPRKQTKPKFCFVSGNNSSNDSLDCVRKDENVLVATGSLNSDKNSNNVDCGVD  168

Query  708   qseeeekI---------------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKV  842
               +EEE+                D  L G+SRSEVTVIDTSC  WK DKL+FRKKNVWKV
Sbjct  169   DDDEEEEEEEDIEEKEKGFGVSGDKELKGYSRSEVTVIDTSCLVWKFDKLVFRKKNVWKV  228

Query  843   RDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGE--ETQISNIIQGLQPGN  1016
             RDK+ K+ +   KK+K   +     + +GN G  KK KVSN E   ++ +N +Q  +P +
Sbjct  229   RDKKGKSWVSGSKKRKVIDS----ESANGN-GTKKKAKVSNLEAGSSKDANDVQ--KPED  281

Query  1017  KFEEGCKKTLDSVGQTLERKHRDFAL---KKANSSVVLIKNIPASKKSGTGIPKTNLKSS  1187
             +  +  +   D+     +R H   +    K + SSV+ IK IP S KSG  I K  LK +
Sbjct  282   ERRQEVEMAEDNSQVATKRIHLSRSAGKSKTSGSSVIFIKAIPTSNKSGRNITKNRLKDT  341

Query  1188  H  1190
              
Sbjct  342   Q  342



>ref|XP_011075895.1| PREDICTED: uncharacterized protein LOC105160278 isoform X2 [Sesamum 
indicum]
Length=250

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 117/225 (52%), Gaps = 38/225 (17%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS+S  KSG S WLDRLR++KGF      +LE FL+                      
Sbjct  1    MLCSVSAGKSG-SGWLDRLRNAKGFSNDGATDLENFLQ----------------------  37

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGK-QQLFNAFSNALSELFNMGESSNYPAQ-KKG  569
               ++  S +  S+        +DP G    QL    S+ L+ELFN G + +  A+ KK 
Sbjct  38   ---NIDSSNQENSDPSPTSNRELDPIGNDDNQLITIMSDVLNELFNFGGNCSSAAKFKKS  94

Query  570  SRKQINPRF--FSSELNNVSGSRDDRGKDKSA-SPMSDDQSRVemkll----eqseeeek  728
            +RKQ NPR   FS   NN S   ++   +K+  S   D  S VE        E   EE+ 
Sbjct  95   ARKQANPRICAFS---NNGSDENNNAASEKAVVSRNGDSNSGVEGVKRLAIRENEGEEDG  151

Query  729  IDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKT  863
             + +L GFSR+EVTVIDTS   WK +KLL+RKKN+WKVRDK+ K+
Sbjct  152  REGNLSGFSRTEVTVIDTSYEHWKLEKLLYRKKNMWKVRDKKGKS  196



>ref|XP_006493204.1| PREDICTED: uncharacterized protein LOC102614232 [Citrus sinensis]
Length=376

 Score =   112 bits (281),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 151/273 (55%), Gaps = 37/273 (14%)
 Frame = +3

Query  210  APMLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLG  389
            + M+CS+ST KS  S WLDRLRS+KGFP GD + L+ FL    S+               
Sbjct  29   SAMICSMSTGKS-CSNWLDRLRSNKGFPVGDDLELDHFLENKDSNLK-------------  74

Query  390  QTNLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPA----  557
              + +S S   R  + ++   E   +    K + F   +N LS+LF MGES++  +    
Sbjct  75   SKSNSSESTQNRKAATEEICGEN--ENGDDKGEWFGIMNNVLSDLFIMGESNDDQSCKFS  132

Query  558  QKKGSRKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDA  737
            +KK SRKQ NP+F    ++ ++ S  +  +        D+ +++E KL E+ + EE ++ 
Sbjct  133  RKKISRKQTNPKFCL--VSRMTSSNVEEEQSCGGCERKDENAQIENKLKEEVDGEENVNN  190

Query  738  ----------HLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkk  887
                       L G+SR+EVTVIDTSC  WK +KL++RK+NVWKVR+K+ K+ + +G  +
Sbjct  191  AVEMEDGERDELLGYSRNEVTVIDTSCTEWKFEKLVYRKRNVWKVREKKGKSRM-IGLGR  249

Query  888  kkrkANDGGAAEDGNFGGIKKHKVSNGEETQIS  986
            KKRKAN  GA  D N    KK K+++ E+   S
Sbjct  250  KKRKAN--GA--DANVDTKKKFKLNSQEDCIFS  278



>ref|XP_008381492.1| PREDICTED: uncharacterized protein LOC103444331 [Malus domestica]
Length=369

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 175/386 (45%), Gaps = 83/386 (22%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+   KSG S WL+RLRS+KGFP  +  +L+ FL ++ SS+S          +    
Sbjct  1     MLCSVPATKSG-SNWLNRLRSNKGFPTCESSDLDHFLTRNLSSSS----------EFPNP  49

Query  396   NLASVSC-STRPGSEK-QQVLETPV-DPAGGKQQLFNAFSNALSELFNMG--ESSNYPAQ  560
             N  S S  STRP S++     ET   +    +  +    SN LSELF MG  + S+  + 
Sbjct  50    NXVSPSTDSTRPDSDRVDNRYETSFPNRDDXRGAIIGMMSNVLSELFFMGGADESSKISX  109

Query  561   KKGSRKQINPRFFSSELNNVSGSRD---------------DRGKDKSASPMSDDQSRV--  689
             KK  RKQ NPR   +   N +G                  +   DKSAS   D+ S V  
Sbjct  110   KKIPRKQANPRVCVASSTNSNGDATANAAEEKSSGCERNVENAXDKSAS---DNSSLVGK  166

Query  690   ---------------emklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRK  824
                              +   + EEEE+    + G+SRSEVTVIDTSC  WK DKL+FR+
Sbjct  167   KKKKKKKNEVGGNVGGGECEGEEEEEEEDKGEMKGYSRSEVTVIDTSCGVWKTDKLVFRR  226

Query  825   KNVWKVRDK--------RSKTTI----HLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNG  968
             KNVWKVR+K        R K  +    H+G    K+KA    +A D   GG         
Sbjct  227   KNVWKVREKKVKGRSSGRHKRKVVDEEHVGDDIDKKKAKVSVSALDVEAGG--------D  278

Query  969   EETQISNIIQGLQPGNKFEEGCKKTLDSVGQTL-------ERKHRDF-----ALKKANSS  1112
             E   +++I +G +P N   +      +  G+ L        RK   F      L+K  SS
Sbjct  279   ECIALNSIHEGQKPQNDMLDNLNDRGEEFGKYLPDNKTKDRRKGFPFNRTMRTLEKRGSS  338

Query  1113  VVLIKNIPASKKSGTGIPKTNLKSSH  1190
             V+ IK IP   K G  + +  LK S 
Sbjct  339   VICIKGIPTDSKKGGKLHRKCLKDSQ  364



>ref|XP_002321364.2| hypothetical protein POPTR_0015s00740g [Populus trichocarpa]
 gb|EEF05491.2| hypothetical protein POPTR_0015s00740g [Populus trichocarpa]
Length=385

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 133/361 (37%), Positives = 178/361 (49%), Gaps = 56/361 (16%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+ T KSG S WLDRL S+KGF   D               S   P+S   T    +
Sbjct  44    MLCSVKTSKSG-SNWLDRLWSNKGFSNND-----------DDDPSVPNPSSSPITDASNS  91

Query  396   NLASVSCSTRPGSEKQQVLETPVDP--AGGKQQLFNAFSNALSELFNMG------ESSNY  551
              + S S ST   S++ +V  T      +   + LF   +N LS+LFNMG      E S+ 
Sbjct  92    VINSNSESTHSESDQNKVTTTTTREISSSDNKDLFFLMNNVLSDLFNMGGCSDPIEGSSR  151

Query  552   PAQKKGS--RKQINPRF-FSSELNNVSGSRDDRGKDK-----SASPMSDDQSRVemklle  707
              ++KK    RKQ  P+F F S  N+ + S D   KD+     + S  SD  S      ++
Sbjct  152   HSRKKERIPRKQTKPKFCFVSGNNSSNDSLDCVRKDENVLVATGSLNSDKNSNNVDCGVD  211

Query  708   qseeeekI---------------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKV  842
               +EEE+                D  L G+SRSEVTVIDTSC  WK DKL+FRKKNVWKV
Sbjct  212   DDDEEEEEEDVEEEKGKAFGVSGDKELKGYSRSEVTVIDTSCLVWKFDKLVFRKKNVWKV  271

Query  843   RDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGE--ETQISNIIQGLQPGN  1016
             RDK+ K+ +   KK+K         + +GN G  KK KVSN E   ++ +N +Q  +P +
Sbjct  272   RDKKGKSWVSGSKKRKVIDL----ESANGN-GAKKKAKVSNLEVGSSKDANDVQ--KPED  324

Query  1017  KFEEGCKKTLDSVGQTLERKHRDFA---LKKANSSVVLIKNIPASKKSGTGIPKTNLKSS  1187
             +  E  +   D      +R H   +    KK+ SSV+ IK IP S KSG  I K  LK +
Sbjct  325   ERREEVEMAEDHSQVATKRIHLSRSPDKSKKSGSSVIFIKAIPTSNKSGR-ITKNRLKDT  383

Query  1188  H  1190
              
Sbjct  384   Q  384



>ref|XP_004307917.1| PREDICTED: uncharacterized protein LOC101313650 [Fragaria vesca 
subsp. vesca]
Length=323

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 118/350 (34%), Positives = 174/350 (50%), Gaps = 55/350 (16%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+   KSG + WLDRLRS+KGFPA D ++L+ FL+ + +S+S +P  + + T L   
Sbjct  1     MLCSVRATKSGPN-WLDRLRSNKGFPACDNLDLDHFLKHNPTSSSESPNPNADSTPL---  56

Query  396   NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNM--GESSNYPAQKKG  569
                    S RP S        P   A   + L    S A+SELF +   E S+  + KK 
Sbjct  57    ------VSNRPESS------GPTRDAKKGEALLGLMSTAISELFFIDGSEESSRLSGKKV  104

Query  570   SRKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAHLFG  749
              RKQ +PR   +     SGS  +   D    P  + ++ VE++   + E +        G
Sbjct  105   PRKQTHPRLCVTSKLKSSGSIGNDVNDLRTVPSLNSKNEVELEERGERELK--------G  156

Query  750   FSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkkkkrkANDGGAAEDG  929
             +S+SEVTVIDTSC  WK +KL+FR+K+VWKVR+K+SK     G+ K+K  + D    E+G
Sbjct  157   YSKSEVTVIDTSCEVWKTEKLVFRRKSVWKVREKKSKVR-SFGRNKRKVVSGD----EEG  211

Query  930   NFGGIKKHKVSNGEETQISNIIQGLQP-----GNKFEEGCKKTLDSVG------------  1058
             + G   + K    +E ++S+    L P      +  +E CK   D++             
Sbjct  212   DDG--IEEKRKKKKEAEVSDQCISLNPIENSRNDARKEVCKDATDNLNDRGKDFCKDNMP  269

Query  1059  QTLERKHRDFALK-----KANSSVVLIKNIPASKKSGTGIPKTNLKSSHH  1193
                E   + F LK     K  SS+V IK IP  +K+   +P+  LK S  
Sbjct  270   DDREDSEKGFPLKPRKTIKDGSSLVFIKGIPTDEKNEGKLPRKCLKDSQR  319



>ref|XP_002318455.2| hypothetical protein POPTR_0012s02820g [Populus trichocarpa]
 gb|EEE96675.2| hypothetical protein POPTR_0012s02820g [Populus trichocarpa]
Length=355

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 134/370 (36%), Positives = 182/370 (49%), Gaps = 63/370 (17%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+ T KS +S WLDRL S++GF              + ++ S   P+S   T    +
Sbjct  1     MLCSVQTSKS-SSNWLDRLWSNRGFNN-----------NNDNNPSVPNPSSSPTTNASNS  48

Query  396   NLASVSCSTRPGSEKQQVLETPVD------PAGGKQQLFNAFSNALSELFNMG-------  536
              + S S ST   S++ +V  T          +   + LF   +N LS+LFNMG       
Sbjct  49    VINSNSESTHSDSDQIKVTATTATATTREISSSDNKDLFFIMNNVLSDLFNMGGVSDPVE  108

Query  537   ESSNYPAQK-KGSRKQINPRF-FSSELNNVSGSRDDRGKDK-----SASPMSDDQSRVem  695
             ESS    +K K  RKQ  P+F F S  N+ + S D   KD+     + S  SD  S    
Sbjct  109   ESSRLSRKKEKVPRKQTKPKFCFISGNNSGNDSLDCVRKDRNVLAATGSLNSDKNSNNVD  168

Query  696   klleqseeeekI-----------------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRK  824
               +   ++++                   D  L G+SRSEVTVIDTSC  WK DKL+FRK
Sbjct  169   CGVVVDDDDDDEEDVEEDVEEEKGFGVGGDKELKGYSRSEVTVIDTSCQVWKFDKLVFRK  228

Query  825   KNVWKVRDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGE--ETQISNIIQ  998
             KNVWKVRDK+ K+ +      KKRK ND  +A +GN G  KK KVSN E   ++  N +Q
Sbjct  229   KNVWKVRDKKGKSWVF---GSKKRKGNDLESA-NGN-GAKKKAKVSNLEVGSSKDVNDVQ  283

Query  999   GLQPGNKFEEGCKKTLDSVGQTLERKHRDFALK-----KANSSVVLIKNIPASKKSGTGI  1163
               Q   + EE  K+  + + Q + +K   F+       K+ SSV+LIK IP S KSG  I
Sbjct  284   K-QEDERREEEHKQMPEDLSQ-VPKKRFHFSRSPEKSIKSGSSVILIKTIPTSNKSGKNI  341

Query  1164  PKTNLKSSHH  1193
              K  LK +  
Sbjct  342   TKNRLKDNQR  351



>ref|XP_006374085.1| hypothetical protein POPTR_0015s00740g [Populus trichocarpa]
 gb|ERP51882.1| hypothetical protein POPTR_0015s00740g [Populus trichocarpa]
Length=383

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 132/359 (37%), Positives = 174/359 (48%), Gaps = 54/359 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+ T KSG S WLDRL S+KGF   D               S   P+S   T    +
Sbjct  44    MLCSVKTSKSG-SNWLDRLWSNKGFSNND-----------DDDPSVPNPSSSPITDASNS  91

Query  396   NLASVSCSTRPGSEKQQVLETPVDP--AGGKQQLFNAFSNALSELFNMG------ESSNY  551
              + S S ST   S++ +V  T      +   + LF   +N LS+LFNMG      E S+ 
Sbjct  92    VINSNSESTHSESDQNKVTTTTTREISSSDNKDLFFLMNNVLSDLFNMGGCSDPIEGSSR  151

Query  552   PAQKKGS--RKQINPRF-FSSELNNVSGSRDDRGKDK-----SASPMSDDQSRVemklle  707
              ++KK    RKQ  P+F F S  N+ + S D   KD+     + S  SD  S      ++
Sbjct  152   HSRKKERIPRKQTKPKFCFVSGNNSSNDSLDCVRKDENVLVATGSLNSDKNSNNVDCGVD  211

Query  708   qseeeekI---------------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKV  842
               +EEE+                D  L G+SRSEVTVIDTSC  WK DKL+FRKKNVWKV
Sbjct  212   DDDEEEEEEDVEEEKGKAFGVSGDKELKGYSRSEVTVIDTSCLVWKFDKLVFRKKNVWKV  271

Query  843   RDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQISNIIQGLQPGNKF  1022
             RDK+ K+ +   KK+K         + +GN G  KK KVSN E    S+     +P ++ 
Sbjct  272   RDKKGKSWVSGSKKRKVIDL----ESANGN-GAKKKAKVSNLEVG--SSKDANDKPEDER  324

Query  1023  EEGCKKTLDSVGQTLERKHRDFA---LKKANSSVVLIKNIPASKKSGTGIPKTNLKSSH  1190
              E  +   D      +R H   +    KK+ SSV+ IK IP S KSG  I K  LK + 
Sbjct  325   REEVEMAEDHSQVATKRIHLSRSPDKSKKSGSSVIFIKAIPTSNKSGR-ITKNRLKDTQ  382



>ref|XP_002515870.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46539.1| conserved hypothetical protein [Ricinus communis]
Length=268

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 140/262 (53%), Gaps = 43/262 (16%)
 Frame = +3

Query  240  KSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQTNLASVSCS  419
            KSG S WLDRLRS+KGFPA + ++L+ FL   S   S                 ++ S +
Sbjct  10   KSG-SNWLDRLRSTKGFPATENLDLDNFLSDPSLPNSE----------------STQSLN  52

Query  420  TRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQ---KKGSRKQINP  590
             R  S++ ++ +T  +   G+++ F   +N L +LFNMG+S +  ++   KK SRKQ NP
Sbjct  53   RRVTSDQTEIPDTLRE--NGEREWFGVVTNVLCDLFNMGDSQDKNSRISGKKSSRKQTNP  110

Query  591  RFFSSELNNVSGSRDDRGKD-KSASPMSDDQSRVemklle--------------qseeee  725
            +FF ++    S  +++  +   +AS  SD+ S V     +              + +E+ 
Sbjct  111  KFFDAD----SVRKEEYVQAATTASFHSDNNSNVVGMNADCFVDDDDEYNGKLDEKKEKS  166

Query  726  kIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTIHLGkkkkkrkAN  905
              D  L G+S+SEVTVIDTS   WK DKL+FR+K++WKVRDK+ K+     KK+K     
Sbjct  167  SSDKELKGYSKSEVTVIDTSFEVWKFDKLVFRRKSIWKVRDKKGKSWNFASKKRKGNHLE  226

Query  906  DGGAAEDGNFGGIKKHKVSNGE  971
               A  +GN    KK K+S+ E
Sbjct  227  --SATNNGNVSSKKKAKMSDSE  246



>ref|XP_011043691.1| PREDICTED: rho GTPase-activating protein gacZ-like isoform X1 
[Populus euphratica]
Length=349

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 130/362 (36%), Positives = 177/362 (49%), Gaps = 53/362 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+ T KS +S WLDRL S++GF              + +  S   P+S   T    +
Sbjct  1     MLCSVQTSKS-SSNWLDRLWSNRGFNN-----------NNDNDPSVPNPSSSPTTNASNS  48

Query  396   NLASVSCSTRPGSEKQQVLETPVD------PAGGKQQLFNAFSNALSELFNMG-------  536
              + S S ST   S++ +V  T          +   + LF   +N LS+LFNMG       
Sbjct  49    VINSNSESTHSDSDQIKVTATTATATTREISSSDNKDLFFIMNNVLSDLFNMGGVSDPVE  108

Query  537   ESSNYPAQK-KGSRKQINPRF-FSSELNNVSGSRDDRGKDK-----SASPMSDDQSRVem  695
             ESS    +K K  RKQ  P+F F S  N+ + S D   KD+     + S  SD  S    
Sbjct  109   ESSRLSRKKEKVPRKQTKPKFCFISGNNSGNDSLDCVRKDRNVLAATGSLNSDKNSNNVD  168

Query  696   klleqseeeekI-----------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKV  842
               ++  +++E+            D  L G+SRSEVTVIDTSC  WK DKL+FRKKNVWKV
Sbjct  169   CGVDDDDDDEEDVEEEKGFGVGGDKELKGYSRSEVTVIDTSCQVWKFDKLVFRKKNVWKV  228

Query  843   RDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQISNIIQGLQPGNKF  1022
             RDK+ K+ +      KKRK ND  +A +GN G  KK KVSN E     ++    +  ++ 
Sbjct  229   RDKKGKSWVF---GSKKRKGNDLESA-NGN-GAKKKAKVSNLEVGSSKDVNDFQKREDER  283

Query  1023  EEGCKKTLDSVGQTLERKHRDFALK-----KANSSVVLIKNIPASKKSGTGIPKTNLKSS  1187
              E   K +      + +K   F+       K+ SSV+LIK IP S KSG  I K  LK +
Sbjct  284   REEEHKQMPEDLSQVPKKRLHFSRSPEKSIKSGSSVILIKTIPTSNKSGKNITKNRLKDT  343

Query  1188  HH  1193
               
Sbjct  344   QR  345



>ref|XP_009351922.1| PREDICTED: uncharacterized protein LOC103943361 [Pyrus x bretschneideri]
Length=357

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 167/364 (46%), Gaps = 66/364 (18%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+   KSG S WL+RLRS+KGFP  +  +L+ FL ++ SS+S          +    
Sbjct  1     MLCSVPATKSG-SNWLNRLRSNKGFPTCESSDLDNFLTRNLSSSS----------EFPNP  49

Query  396   NLASVSC-STRPGSEKQQVLETPVDPAGGKQQ--LFNAFSNALSELFNMG--ESSNYPAQ  560
             N+ S S  STRP S++         P    Q+  +    SN LSELF MG  + S+  + 
Sbjct  50    NVVSPSTDSTRPDSDRVDNRYETSYPNRDDQRGAIIGMMSNVLSELFFMGGADESSKISG  109

Query  561   KKGSRKQINPRFFSSELNNVSGSRDDRGKDKSASPM------------SDDQSRVemkll  704
             KK  RKQ NPR   +   N +G       ++ +S              SD+ S V  K  
Sbjct  110   KKIPRKQANPRVRVASSTNSNGDATANAAEEKSSGCELNVKNAFDKLASDNSSLVGKKKK  169

Query  705   eqseeeekIDAH------------------LFGFSRSEVTVIDTSCAPWKCDKLLFRKKN  830
             ++++E                         + G+SRSEVTVIDTSC  WK DKL+FR+KN
Sbjct  170   KKTKEGGGNVGGGECEGEEEEEEEEEDKGEMKGYSRSEVTVIDTSCGVWKTDKLVFRRKN  229

Query  831   VWKVRDKRSK------------TTIHLGkkkkkrkANDGGAAEDGNFGG---IKKHKVSN  965
             VWKVR+K+ K               H+G    K+KA    +A D   GG   I  +    
Sbjct  230   VWKVREKKVKGRSFGRHKRKVVDEEHVGDDIDKKKAKVSVSALDVEAGGDECIALNSTHE  289

Query  966   GEETQ---ISNIIQGLQPGNKFEEGCKKTLDSVGQTLERKHRDFALKKANSSVVLIKNIP  1136
             G++ Q   + N+  G +  +K+    K      G    R  R+  L+K  SSV+ +K +P
Sbjct  290   GQKPQNDTLDNLNDGGEEFDKYLPDNKTKDIRKGFPFNRTPRN--LEKRGSSVICVKGLP  347

Query  1137  ASKK  1148
                K
Sbjct  348   TDSK  351



>ref|XP_007221171.1| hypothetical protein PRUPE_ppa021823mg [Prunus persica]
 gb|EMJ22370.1| hypothetical protein PRUPE_ppa021823mg [Prunus persica]
Length=723

 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 122/248 (49%), Gaps = 43/248 (17%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS+   KSG S WLDRLRS+KG P GD ++L+ FL +           + + +++   
Sbjct  1    MLCSVPASKSG-SNWLDRLRSNKGLPTGDNLDLDHFLSR----------NTNSSSEVPTP  49

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQ--QLFNAFSNALSELFNMGESSNYPAQ--K  563
            N++S + STRPGS++     T   P    Q        +N LSELF MG S        K
Sbjct  50   NVSSSTESTRPGSDRVVNQSTTSCPNRDNQGEAFIGLVNNVLSELFFMGGSDERSKLLGK  109

Query  564  KGSRKQINPRFFSSELNNVS----------------GSRDDRGKDKSASPMSDDQSRVem  695
            K  RKQ NPR   +   N                  G  D+   DK+A   S + S ++ 
Sbjct  110  KIRRKQANPRVCVTSTANYDSNAATANATEEKSSDWGRNDEHVLDKAACLDSQNGSLMKN  169

Query  696  klleqseeeekIDA------------HLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWK  839
            K L     EE  +              L G+S SEVTVIDTSC  WK +K++FR+KNVWK
Sbjct  170  KDLGNVGGEEGEEVEEEEEEEKEELRELKGYSISEVTVIDTSCGVWKTEKVVFRRKNVWK  229

Query  840  VRDKRSKT  863
            VR+K++K 
Sbjct  230  VREKKAKV  237



>ref|XP_010519570.1| PREDICTED: uncharacterized protein LOC104798986 [Tarenaya hassleriana]
Length=339

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 123/248 (50%), Gaps = 41/248 (17%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGD-------YVNLEQFLRQsssstspnppasin  374
            MLCS+S  K   S WLDRLRSS+G    +       +++L+ FLR++        P    
Sbjct  1    MLCSVSGDKPSGSTWLDRLRSSRGLSGANDDDAGEAHLSLDHFLRRNYRRELAGDP----  56

Query  375  ptKLGQTNLASVSCSTRPGSEKQQVLETPVDP---AGGKQQLFNAFSNALSELFNMG--E  539
                   N+AS    + P    +++ E+P +     GG  + +   S+ LSELFN G   
Sbjct  57   -----PMNVASDDPPSAPTPSNRELTESPREEDEKYGGDGEWYGVMSDVLSELFNFGGAT  111

Query  540  SSNYPAQKKGSRKQINPRFFSSELNN------------VSGSRD------DRGKDKSASP  665
             S+  ++KK  RKQ NPR    E  N            + G R+      +    K A  
Sbjct  112  PSSTISRKKFRRKQPNPRHCPVEAPNNLAVMNLGDSNILPGVREFATTSLNSDNKKPAPE  171

Query  666  MSDDQSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVR  845
              + + R+      + EE+ + D  L G+SRSEVTVIDTS   WK +KL+FR+K+VWKVR
Sbjct  172  KRERRRRIVEPEEVEEEEKGERD--LVGYSRSEVTVIDTSFEIWKSEKLVFRRKSVWKVR  229

Query  846  DKRSKTTI  869
            DK+ K+ I
Sbjct  230  DKKGKSRI  237



>ref|XP_011043692.1| PREDICTED: rho GTPase-activating protein gacZ-like isoform X2 
[Populus euphratica]
Length=347

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 133/362 (37%), Positives = 180/362 (50%), Gaps = 55/362 (15%)
 Frame = +3

Query  216   MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
             MLCS+ T KS +S WLDRL S++GF              + +  S   P+S   T    +
Sbjct  1     MLCSVQTSKS-SSNWLDRLWSNRGFNN-----------NNDNDPSVPNPSSSPTTNASNS  48

Query  396   NLASVSCSTRPGSEKQQVLETPVD------PAGGKQQLFNAFSNALSELFNMG-------  536
              + S S ST   S++ +V  T          +   + LF   +N LS+LFNMG       
Sbjct  49    VINSNSESTHSDSDQIKVTATTATATTREISSSDNKDLFFIMNNVLSDLFNMGGVSDPVE  108

Query  537   ESSNYPAQK-KGSRKQINPRF-FSSELNNVSGSRDDRGKDK-----SASPMSDDQSRVem  695
             ESS    +K K  RKQ  P+F F S  N+ + S D   KD+     + S  SD  S    
Sbjct  109   ESSRLSRKKEKVPRKQTKPKFCFISGNNSGNDSLDCVRKDRNVLAATGSLNSDKNSNNVD  168

Query  696   klleqseeeekI-----------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKV  842
               ++  +++E+            D  L G+SRSEVTVIDTSC  WK DKL+FRKKNVWKV
Sbjct  169   CGVDDDDDDEEDVEEEKGFGVGGDKELKGYSRSEVTVIDTSCQVWKFDKLVFRKKNVWKV  228

Query  843   RDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQISNIIQGLQPGNKF  1022
             RDK+ K+ +      KKRK ND  +A +GN G  KK KVSN  E   S  +   +   + 
Sbjct  229   RDKKGKSWVF---GSKKRKGNDLESA-NGN-GAKKKAKVSN-LEVGSSKDVNDKREDERR  282

Query  1023  EEGCKKTLDSVGQTLERKHRDFALK-----KANSSVVLIKNIPASKKSGTGIPKTNLKSS  1187
             EE  K+  + + Q + +K   F+       K+ SSV+LIK IP S KSG  I K  LK +
Sbjct  283   EEEHKQMPEDLSQ-VPKKRLHFSRSPEKSIKSGSSVILIKTIPTSNKSGKNITKNRLKDT  341

Query  1188  HH  1193
               
Sbjct  342   QR  343



>ref|XP_007136438.1| hypothetical protein PHAVU_009G045300g [Phaseolus vulgaris]
 gb|ESW08432.1| hypothetical protein PHAVU_009G045300g [Phaseolus vulgaris]
Length=224

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 97/215 (45%), Gaps = 36/215 (17%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS  T KSG + WLDRLRSSKG P GD  +L+ FL                       
Sbjct  1    MLCSAQTGKSGLN-WLDRLRSSKGIPTGDEPDLDSFL-----------------------  36

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQKKGSR  575
                   +  P S + +  + P  P    +      +  L+ELF MG +      KK  R
Sbjct  37   ------LTAHPQSPQARPNDPPRKPPSATRDEPKPMTALLAELFCMGATLTK-TNKKCPR  89

Query  576  KQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAHLFGFS  755
            KQ NP+ F +     +          +A+P  D       +       EE     L GF+
Sbjct  90   KQTNPKIFLASAAANTAV-----VAAAAAPRVDTVVPEVEEEATADRGEEAEGNELKGFT  144

Query  756  RSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
            +SEVTVIDTSC  WK DK +FRK NVWKVR+++ K
Sbjct  145  KSEVTVIDTSCPGWKVDKFVFRKNNVWKVRERKPK  179



>ref|XP_006394704.1| hypothetical protein EUTSA_v10005511mg [Eutrema salsugineum]
 gb|ESQ31990.1| hypothetical protein EUTSA_v10005511mg [Eutrema salsugineum]
Length=332

 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 120/245 (49%), Gaps = 44/245 (18%)
 Frame = +3

Query  219  LCSISTQKSGTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasinp  377
            L S+   K   S WLDRLR S+G         +G+ ++L+ FLR++  +           
Sbjct  3    LSSVIDDKPVASTWLDRLRLSRGLSTTDDDDASGNPLSLDDFLRRNYHNEITG-------  55

Query  378  tKLGQTNLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMG---ESSN  548
                  + AS S  + P     ++ E P+DP  G ++ +   S+ LSELFN G    SS 
Sbjct  56   ------DPASDSPPSAPILSALELPEIPLDPNPG-EEWYGVMSDVLSELFNFGGSSRSST  108

Query  549  YPAQKKGSRKQINPRFFSSEL-------------NNVSGSRD-----DRGKDKSASPMSD  674
             P  KK  RKQ NPR  S E              N + G+R+         +K  +P   
Sbjct  109  IPG-KKLPRKQSNPRHCSVETLADVPLLNQKRDSNCLPGAREFATSSRSSYNKKPAPEKR  167

Query  675  DQSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
            ++ R   +     EEE   +  L GFSRSEVTVIDTS   WK +KL+FR++NVWKVRDKR
Sbjct  168  ERRRSVAEADGVEEEERG-EKDLVGFSRSEVTVIDTSFKIWKSEKLVFRRRNVWKVRDKR  226

Query  855  SKTTI  869
             K+ +
Sbjct  227  GKSRV  231



>ref|XP_006581687.1| PREDICTED: uncharacterized protein LOC100776590 isoform X2 [Glycine 
max]
Length=233

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 104/219 (47%), Gaps = 35/219 (16%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS  T KSG + WLDRLRS+KG P GD  +L+ FL                       
Sbjct  1    MLCSPQTGKSGLN-WLDRLRSNKGIPTGDEPDLDSFL-----------------------  36

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQKKGSR  575
                   S  P S + +  + P++P    +      S  L+ELF MG + +    KK  R
Sbjct  37   ------LSAPPQSPQARPNDPPLNPPSVARDEPMPMSTILAELFCMGATLSK-TNKKCPR  89

Query  576  KQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAH----L  743
            KQ NP+ F +     + +   +      +P +     +  ++ ++   +   D      L
Sbjct  90   KQTNPKIFLASSAAATTTTSSKSSAPVPAPAAPSSDALVPEVEDEPAADRDEDEEEGNEL  149

Query  744  FGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
             GF++SEVTVIDTSC  WK DK +FRK NVWKVR+++ K
Sbjct  150  KGFTKSEVTVIDTSCPGWKVDKFVFRKNNVWKVRERKPK  188



>ref|XP_003527999.1| PREDICTED: uncharacterized protein LOC100776590 isoform X1 [Glycine 
max]
Length=238

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 104/219 (47%), Gaps = 35/219 (16%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS  T KSG + WLDRLRS+KG P GD  +L+ FL                       
Sbjct  1    MLCSPQTGKSGLN-WLDRLRSNKGIPTGDEPDLDSFL-----------------------  36

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQKKGSR  575
                   S  P S + +  + P++P    +      S  L+ELF MG + +    KK  R
Sbjct  37   ------LSAPPQSPQARPNDPPLNPPSVARDEPMPMSTILAELFCMGATLSK-TNKKCPR  89

Query  576  KQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAH----L  743
            KQ NP+ F +     + +   +      +P +     +  ++ ++   +   D      L
Sbjct  90   KQTNPKIFLASSAAATTTTSSKSSAPVPAPAAPSSDALVPEVEDEPAADRDEDEEEGNEL  149

Query  744  FGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
             GF++SEVTVIDTSC  WK DK +FRK NVWKVR+++ K
Sbjct  150  KGFTKSEVTVIDTSCPGWKVDKFVFRKNNVWKVRERKPK  188



>ref|XP_010099428.1| hypothetical protein L484_003252 [Morus notabilis]
 gb|EXB78390.1| hypothetical protein L484_003252 [Morus notabilis]
Length=353

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 116/377 (31%), Positives = 172/377 (46%), Gaps = 95/377 (25%)
 Frame = +3

Query  216   MLCSISTQKS-GTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQ  392
             MLCS+   KS G S WL R+RS KGFPAGD  +L  F+ Q                    
Sbjct  1     MLCSVPAGKSAGGSNWLSRIRSIKGFPAGDDDDLGHFITQ--------------------  40

Query  393   TNL-ASVSCSTRPGSEKQQVLETPVDPAGGKQQL----FNAFSNALSELFNMGE----SS  545
              NL +S S STR   ++  V  +P  P   + ++      A    LSELF MG     SS
Sbjct  41    -NLNSSASESTRLDPQRIAVPNSPEAPGRIRGRVEPEWVGAMDTVLSELFFMGGAGEISS  99

Query  546   NYPAQKKGSRKQINPRFFSSELNNVSGS--------------RDDRGKD---KSASPMSD  674
             +  + K+  RKQ NP+  ++  +N + +              +  +G D   K+AS  SD
Sbjct  100   SRHSGKRIPRKQTNPKICAASASNNNNNNNNSGNSNSSGVVEQKKKGSDFAPKTASLSSD  159

Query  675   D------QSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVW  836
                    +    + +    ++E++ +  L G+SRSEVTVIDTSC  WK +KL+FR+K+VW
Sbjct  160   SGNNSTREGHGNVDVDFDVDDEDEDEKELKGYSRSEVTVIDTSCGSWKSEKLVFRRKSVW  219

Query  837   KVRDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQISNII-------  995
             +VR+K+ K   + G+KK+K   +D              H +S        ++I       
Sbjct  220   RVREKKGKLR-NFGRKKRKLAIDD-------------HHVMSLASSDHHQSLIMPSSDEG  265

Query  996   QGLQPGNKFEEGCKKTLDSVGQTLERKHRDFA-------------------LKKANSSVV  1118
             Q L+  ++ EE CK T +++  T E    D                     +KK  SSVV
Sbjct  266   QNLKNDSR-EEKCKGTANNLNMTREEVSTDSPNNLSEDLKKRSQVSGSLKKVKKGGSSVV  324

Query  1119  LIKNIPASKKSGTGIPK  1169
             LIK +P  KK+   + K
Sbjct  325   LIKGVPTDKKNAVKLSK  341



>gb|KFK27727.1| hypothetical protein AALP_AA8G421600 [Arabis alpina]
Length=333

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 123/246 (50%), Gaps = 43/246 (17%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasin  374
            ML S+   K   S WLDRLR S+G         +G+ + L+ FLR++ ++          
Sbjct  1    MLTSVIDDKPVVSTWLDRLRLSRGISITEDDDASGNPLTLDDFLRRNHNTEITT------  54

Query  375  ptKLGQTNLASVSCSTRPGS----EKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGES  542
                G+ +LA+ S S  P S       ++ E+P+DP  G  + +   S+ LSELFN G  
Sbjct  55   ----GE-DLATTSASNSPPSAPIPSDPELSESPLDPNPG--EWYGVMSDVLSELFNFGGG  107

Query  543  SNYPAQ---KKGSRKQINPRFFSSE--------------LNNVSGSRDDRGKDKSASPMS  671
            S+  +    KK  RKQ NP+  S E              L N + SR+   K       +
Sbjct  108  SSSSSTISGKKLPRKQSNPKHCSVETPLTLQNQKRDSNFLPNATSSRNSYIKKPVME--T  165

Query  672  DDQSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDK  851
             ++ R  +   E    +E+ D  L GFSR EVTVIDTS   WK +K++FR+KNVWKVRDK
Sbjct  166  KERRRTSVVEEEDDGVDEEGDKELVGFSRCEVTVIDTSFKIWKSEKMVFRRKNVWKVRDK  225

Query  852  RSKTTI  869
            + K+ +
Sbjct  226  KGKSRV  231



>gb|KGN50314.1| hypothetical protein Csa_5G167060 [Cucumis sativus]
Length=334

 Score = 97.8 bits (242),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 121/236 (51%), Gaps = 28/236 (12%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLR-QsssstspnppasinptKLGQ  392
            MLCS+   K+G + WLDRLRS+KGFP  D + L+ FL  Q+  +      ++ + T+   
Sbjct  1    MLCSVRAGKAGPN-WLDRLRSNKGFPITDNLELDHFLTDQNLDNPCSLSDSNPHSTRADP  59

Query  393  TNLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPA--QKK  566
             + A+++   +  S     +E       G    F   ++ LS+LFNMG +S       KK
Sbjct  60   RSDANLNSHHQDNSSSNSPIEN------GNPSSFGIITDILSDLFNMGGASRNSKCFSKK  113

Query  567  GSRKQINPRFFS------------------SELNNVSGSRDDRGKDKSASPMSDDQSRVe  692
              RKQ NP+ +S                   + +N+  S  D          SD    V 
Sbjct  114  YPRKQSNPKIYSIPSVTNGDYADAKNLCCLQKEDNILSSNSDNSSKGCIDSGSDMAQNVC  173

Query  693  mklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
            +K++E+   +EK +  L G+S+SEVTVIDTS   WK DKL+FR+K+VWKV+DK+ K
Sbjct  174  LKVVEEEVWDEKCEKELKGYSKSEVTVIDTSDDVWKSDKLIFRRKSVWKVKDKKCK  229



>ref|XP_008437012.1| PREDICTED: uncharacterized protein LOC103482569 [Cucumis melo]
 ref|XP_008437013.1| PREDICTED: uncharacterized protein LOC103482569 [Cucumis melo]
 ref|XP_008437014.1| PREDICTED: uncharacterized protein LOC103482569 [Cucumis melo]
Length=336

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 121/236 (51%), Gaps = 28/236 (12%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLR-QsssstspnppasinptKLGQ  392
            MLCS+   K+G + WLDRLRS+KGFP  D + L+ FL  Q+  +      ++ + T+   
Sbjct  1    MLCSVRAGKAGPN-WLDRLRSNKGFPITDNLELDHFLTDQNLDNPCSLSDSNPHSTRADP  59

Query  393  TNLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESS--NYPAQKK  566
             + A+++   +  S     +E       G    F   ++ LS+LFNMG +S  +    KK
Sbjct  60   HSDANLNSQHQDNSSSNSPIE------NGNPSSFEIITDILSDLFNMGGASRNSKCCSKK  113

Query  567  GSRKQINPRFFS------------------SELNNVSGSRDDRGKDKSASPMSDDQSRVe  692
              RKQ NP+  S                   + +N+  S  D          SD    V 
Sbjct  114  YPRKQSNPKICSIPSIANVDYADAKNLCCLQKEDNILSSNSDNSSKGCTDSGSDMAQNVC  173

Query  693  mklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
            +K++E+   +EK +  L G+S+SEVTVIDTS   WK DKL+FR+K+VWKV+DK+ K
Sbjct  174  LKVVEEEVWDEKCEKELKGYSKSEVTVIDTSDDVWKSDKLIFRRKSVWKVKDKKCK  229



>ref|XP_006578872.1| PREDICTED: uncharacterized protein LOC102663205 [Glycine max]
Length=232

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 105/218 (48%), Gaps = 34/218 (16%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS  T KSG + WLDRLRS+KG P GD  NL+ FL                       
Sbjct  1    MLCSAQTGKSGLN-WLDRLRSNKGIPTGDEPNLDSFL-----------------------  36

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQKKGSR  575
                   +  P S + +  + P +P    +      S  L+ELF MG + +    KK  R
Sbjct  37   ------LTAHPQSPQARPNDPPRNPPSEARDEPMPMSTILAELFCMGATLSK-TNKKCPR  89

Query  576  KQINPRFF--SSELNNVSGSRDDRGKDKSASPMSDDQ-SRVemklleqseeeekIDAHLF  746
            KQ NP+ F  SS     + S+        A+P  D     VE +      E+E+    L 
Sbjct  90   KQTNPKIFLASSATTTTTNSKPSVPAALPAAPSGDPAVPEVEEEAAADRGEDEEEGNELK  149

Query  747  GFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
            GF++SEVTVIDTS   WK DK +FRK NVWKVR+K++K
Sbjct  150  GFTKSEVTVIDTSSPGWKVDKFVFRKNNVWKVREKKTK  187



>ref|XP_003602376.1| hypothetical protein MTR_3g092670 [Medicago truncatula]
 gb|AES72627.1| hypothetical protein MTR_3g092670 [Medicago truncatula]
Length=216

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 97/216 (45%), Gaps = 43/216 (20%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            M+CS  + K G S WLDRLRS+KG P  D ++L+ F+                       
Sbjct  1    MICSPRSNKPG-SNWLDRLRSNKGIPTDDNLDLDTFI----------------------L  37

Query  396  NLASVSCSTRPGSE-KQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQKKGS  572
            NLA+ S   RP    + +   T  DP           +  L+ LFN G ++     KK  
Sbjct  38   NLATHSPQPRPIKPLRHRPPITHDDPP---------LTTVLAHLFNPGAATI--TSKKCP  86

Query  573  RKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAHLFGF  752
            RKQ NP+ F      +S +  +           D ++R               +    GF
Sbjct  87   RKQTNPKIFIPSSTIISTTTANAPAATGVDAAVDVENRGVEGEDG--------EEDFKGF  138

Query  753  SRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
            ++SEVTVIDTSC  WK DK +FR+ NVWK+R+++ K
Sbjct  139  TKSEVTVIDTSCPVWKVDKFVFRRNNVWKIRERKQK  174



>ref|XP_002874202.1| hypothetical protein ARALYDRAFT_326742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50461.1| hypothetical protein ARALYDRAFT_326742 [Arabidopsis lyrata subsp. 
lyrata]
Length=305

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 125/252 (50%), Gaps = 49/252 (19%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasin  374
            ML SI   K   S WL+RLR ++G         +G+ + L+ FLR++  +          
Sbjct  1    MLSSIIDDKPVASTWLNRLRLNRGLSTTEDDDASGNPLTLDDFLRRNHHT----------  50

Query  375  ptKLGQTNLASVSCSTRPGSEKQQVLETPVD-PAGGKQQLFNAFSNALSELFNMG---ES  542
              ++  T+ AS S  + P     ++ E+P + P  G  + +   S+ LSELFN G   +S
Sbjct  51   --EITATSSASDSPPSAPVPSDPELAESPSEEPVPG--EWYGVMSDVLSELFNFGGSSKS  106

Query  543  SNYPAQKKGSRKQINPRFFSSELNN-----------------------VSGSRDDRGKDK  653
            S  P +KK  RKQ NPR  S +  N                        S SR    K K
Sbjct  107  STIPGKKKLPRKQSNPRHCSLDTPNDVVPLVNQKSNDANCVPSVREFATSSSRSSYNK-K  165

Query  654  SASPMSDDQSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNV  833
            + +P    + R   +  +  EEEEK +  L GFSRSEVTVIDTS   WK +KL+FR++NV
Sbjct  166  TPAPEIRGRRRSVAEDEDVDEEEEKGEKDLVGFSRSEVTVIDTSFKIWKSEKLVFRRRNV  225

Query  834  WKVRDKRSKTTI  869
            WKVR+K+ K+ +
Sbjct  226  WKVREKKGKSRV  237



>ref|XP_006286735.1| hypothetical protein CARUB_v10002983mg [Capsella rubella]
 gb|EOA19633.1| hypothetical protein CARUB_v10002983mg [Capsella rubella]
Length=339

 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 121/257 (47%), Gaps = 54/257 (21%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDY-------VNLEQFLRQsssstspnppasin  374
            ML SI   K   S WL+RLR ++G    +Y       + L+ FLR++  +          
Sbjct  1    MLSSIIDDKPVGSSWLNRLRLNRGLTTTEYDDASGNPLTLDDFLRRNHHTEITG------  54

Query  375  ptKLGQTNLASVSCSTRPGSEKQQVLETPVD-PAGGKQQLFNAFSNALSELFNM------  533
                   + AS S  + P     ++ E+P++ P  G  + +   S+ LSELFN       
Sbjct  55   -------DSASDSPPSAPIPSDPELAESPLEEPNPG--EWYGVMSDVLSELFNFDGGGSA  105

Query  534  GESSNYPAQKKGSRKQINPRFFS---------------SELNNV--------SGSRDDRG  644
             +SS  P +KK  RKQ NPR  S               S+ N V        S SR    
Sbjct  106  SKSSTIPGKKKLPRKQSNPRHCSLETPQDVAPLVNTKISDANCVPSVREFATSSSRSSYN  165

Query  645  KDKSASPMSDDQSRVemklleqseeeekIDAH--LFGFSRSEVTVIDTSCAPWKCDKLLF  818
            K   A  + + +  V  +  E+  +EE+      L GFSRSEVTVIDTS   WK +KL+F
Sbjct  166  KKPPAPEIRERRRSVVAEEGEEGVDEEEEKGEKDLVGFSRSEVTVIDTSFKVWKSEKLVF  225

Query  819  RKKNVWKVRDKRSKTTI  869
            R++NVWKVRDK+ K+ I
Sbjct  226  RRRNVWKVRDKKGKSKI  242



>ref|XP_010666129.1| PREDICTED: probable ATP-dependent helicase PF08_0048 [Beta vulgaris 
subsp. vulgaris]
Length=336

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 113/229 (49%), Gaps = 41/229 (18%)
 Frame = +3

Query  243  SGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQTNLASVSCST  422
            + +S WLDRLRSS+GFP G  ++L++FL  SSS + P   ++ +      T L       
Sbjct  4    ASSSNWLDRLRSSRGFPTGSELDLDRFLSSSSSGSVPTTESATHSESTQSTRL-------  56

Query  423  RPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNM--GESSNYPAQKKGSRKQINPRF  596
                 +++++ +P        +     S  LS+LFNM  GE+S     KK SRKQ NPRF
Sbjct  57   ----RREKIIISP-------PEWTPPVSGLLSDLFNMGVGETSRT-FSKKSSRKQPNPRF  104

Query  597  F----SSELNNVSGSRDDRGKDKSASPMSD----------------DQSRVemklleqse  716
            F    SSE    S S D R +       S                 D+ R          
Sbjct  105  FCSGPSSETELPSSSDDLRREQNQNQNQSSGDNSLNERLENNVIRVDELRKVDDDNNNGG  164

Query  717  eeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKT  863
             EE+ D  L  +SR+EVTVIDTSC  WK DK +FRK + WK+R+K+SK+
Sbjct  165  GEEEEDVDLKTYSRNEVTVIDTSCEEWKSDKWVFRKNDDWKIREKKSKS  213



>emb|CDY68447.1| BnaC02g48760D [Brassica napus]
Length=316

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/219 (36%), Positives = 107/219 (49%), Gaps = 34/219 (16%)
 Frame = +3

Query  228  ISTQKSGTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasinptKL  386
            +S+ K   S WLDRLR SKG         +G  ++L+ FLR++ S               
Sbjct  2    LSSDKPVASTWLDRLRISKGLSTTEDDDASGTPLSLDDFLRRNHS---------------  46

Query  387  GQTNLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQ--  560
                 AS S  + P     ++ ++P DP  G  + +   S+ LSELFN   SS       
Sbjct  47   -----ASDSPPSAPTPSDPELTDSPSDPNPG--EWYGVMSDVLSELFNYSGSSRSTTTVP  99

Query  561  -KKGSRKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDA  737
             KK  RKQ NP+  S E       R     +K  +         +  + E+ EEE + D 
Sbjct  100  VKKLPRKQSNPKHCSVETPPPPPQRPKFATEKRETKRRRVVEEEDDGVEEEEEEEGEKD-  158

Query  738  HLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
             L GFSRSEVTVIDTS   WK +K++FR++NVWKVRDK+
Sbjct  159  -LVGFSRSEVTVIDTSFKIWKAEKVVFRRRNVWKVRDKK  196



>ref|XP_006376666.1| hypothetical protein POPTR_0012s02820g [Populus trichocarpa]
 gb|ERP54463.1| hypothetical protein POPTR_0012s02820g [Populus trichocarpa]
Length=310

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 143/289 (49%), Gaps = 54/289 (19%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS+ T KS +S WLDRL S++GF              + ++ S   P+S   T    +
Sbjct  1    MLCSVQTSKS-SSNWLDRLWSNRGFNN-----------NNDNNPSVPNPSSSPTTNASNS  48

Query  396  NLASVSCSTRPGSEKQQVLETPVD------PAGGKQQLFNAFSNALSELFNMG-------  536
             + S S ST   S++ +V  T          +   + LF   +N LS+LFNMG       
Sbjct  49   VINSNSESTHSDSDQIKVTATTATATTREISSSDNKDLFFIMNNVLSDLFNMGGVSDPVE  108

Query  537  ESSNYPAQK-KGSRKQINPRF-FSSELNNVSGSRDDRGKDK-----SASPMSDDQSRVem  695
            ESS    +K K  RKQ  P+F F S  N+ + S D   KD+     + S  SD  S    
Sbjct  109  ESSRLSRKKEKVPRKQTKPKFCFISGNNSGNDSLDCVRKDRNVLAATGSLNSDKNSNNVD  168

Query  696  klleqseeeekI-----------------DAHLFGFSRSEVTVIDTSCAPWKCDKLLFRK  824
              +   ++++                   D  L G+SRSEVTVIDTSC  WK DKL+FRK
Sbjct  169  CGVVVDDDDDDEEDVEEDVEEEKGFGVGGDKELKGYSRSEVTVIDTSCQVWKFDKLVFRK  228

Query  825  KNVWKVRDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGE  971
            KNVWKVRDK+ K+ +      KKRK ND  +A +GN G  KK KVSN E
Sbjct  229  KNVWKVRDKKGKSWVF---GSKKRKGNDLESA-NGN-GAKKKAKVSNLE  272



>ref|NP_197838.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO64164.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04090.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00388.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93317.1| uncharacterized protein AT5G24500 [Arabidopsis thaliana]
Length=334

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 126/252 (50%), Gaps = 49/252 (19%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF------PAGDYVNLEQFLRQsssstspnppasinp  377
            ML SI   K  +S WL+RLR ++G        +G+ + L+ FLR++  +           
Sbjct  1    MLSSIIDDKPASSTWLNRLRLNRGLTTDDDDASGNPLTLDDFLRRNHHT-----------  49

Query  378  tKLGQTNLASVSCSTRPGSEKQQVLETPVD-PAGGKQQLFNAFSNALSELFNMG---ESS  545
             ++  T+ AS S  + P     ++ E+P + P  G  + +   S+ L ELFN     +SS
Sbjct  50   -EIAATSSASDSPPSAPIPSDPELAESPSEEPVPG--EWYGVMSDVLFELFNFSGSSKSS  106

Query  546  NYPAQKKGSRKQINPRFFSSE-------------------LNNV-----SGSRDDRGKDK  653
              P +KK  RKQ NPR  S E                   L +V     S SR    K K
Sbjct  107  TIPGKKKLPRKQSNPRHCSLETPEDVVVPLVNQKSDDANCLPSVREFATSSSRSSYNK-K  165

Query  654  SASPMSDDQSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNV  833
              +P   ++ R  ++     EEEEK +  L GFSRSEVTVIDTS   WK +KL+FR++NV
Sbjct  166  PPAPEIRERRRSVVEGDGVDEEEEKGEKDLVGFSRSEVTVIDTSFKIWKSEKLVFRRRNV  225

Query  834  WKVRDKRSKTTI  869
            WKVR+K+ K+ +
Sbjct  226  WKVREKKGKSRV  237



>dbj|BAB11202.1| unnamed protein product [Arabidopsis thaliana]
Length=306

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 126/252 (50%), Gaps = 49/252 (19%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF------PAGDYVNLEQFLRQsssstspnppasinp  377
            ML SI   K  +S WL+RLR ++G        +G+ + L+ FLR++  +           
Sbjct  1    MLSSIIDDKPASSTWLNRLRLNRGLTTDDDDASGNPLTLDDFLRRNHHT-----------  49

Query  378  tKLGQTNLASVSCSTRPGSEKQQVLETPVD-PAGGKQQLFNAFSNALSELFNMG---ESS  545
             ++  T+ AS S  + P     ++ E+P + P  G  + +   S+ L ELFN     +SS
Sbjct  50   -EIAATSSASDSPPSAPIPSDPELAESPSEEPVPG--EWYGVMSDVLFELFNFSGSSKSS  106

Query  546  NYPAQKKGSRKQINPRFFSSE-------------------LNNV-----SGSRDDRGKDK  653
              P +KK  RKQ NPR  S E                   L +V     S SR    K K
Sbjct  107  TIPGKKKLPRKQSNPRHCSLETPEDVVVPLVNQKSDDANCLPSVREFATSSSRSSYNK-K  165

Query  654  SASPMSDDQSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNV  833
              +P   ++ R  ++     EEEEK +  L GFSRSEVTVIDTS   WK +KL+FR++NV
Sbjct  166  PPAPEIRERRRSVVEGDGVDEEEEKGEKDLVGFSRSEVTVIDTSFKIWKSEKLVFRRRNV  225

Query  834  WKVRDKRSKTTI  869
            WKVR+K+ K+ +
Sbjct  226  WKVREKKGKSRV  237



>ref|XP_008805185.1| PREDICTED: uncharacterized protein LOC103718240 [Phoenix dactylifera]
Length=330

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 115/228 (50%), Gaps = 20/228 (9%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCSIST +S ++ WLDRL +SKGF     ++L+ FL    SS     P S +       
Sbjct  1    MLCSISTSRSSSN-WLDRLHTSKGFSIPADLDLDHFL----SSNPNPDPNSNSCFPPPPP  55

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGE---SSNYPAQKK  566
            +    SC+ R       V  +    AG K+Q+F+  S+AL+ELF MG+        A KK
Sbjct  56   SETRPSCARRKQHPPPPVSASGSKTAGEKEQIFDLMSSALAELFVMGDRPAPGTLRASKK  115

Query  567  GSRKQINPRFFSSEL------NNVSGSRDDRGKDKSASPMSDDQSRVemklleqseee--  722
             SRKQ NP+     +      N ++G+        + SP S + S  E K          
Sbjct  116  SSRKQPNPKACVPSVSASIGGNFLAGAPAACHVTPATSPSSAENSVAEAKKSRTKARRKR  175

Query  723  ----ekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
                  +++ L  +S++EVTVIDTS   WK +KL+FRK  VWKVRDK+
Sbjct  176  GTAGSPVESDLSTYSKTEVTVIDTSSPGWKSEKLIFRKGIVWKVRDKK  223



>ref|XP_010922572.1| PREDICTED: uncharacterized protein LOC105045848 isoform X2 [Elaeis 
guineensis]
Length=285

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/235 (33%), Positives = 107/235 (46%), Gaps = 33/235 (14%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCS  +    +S WLDRL +SKGF     ++L+ FL                       
Sbjct  1    MLCS-ISTSRSSSNWLDRLHTSKGFSIPADLDLDHFL----------SSNPNPDPNTNSC  49

Query  396  NLASVSCSTRPGS--EKQQVLETPVDPAG-----GKQQLFNAFSNALSELFNMGESS---  545
                    TRP     +Q     PV  AG     GK+Q+F+   +AL+ELF MG+ S   
Sbjct  50   FPPLPPPETRPSDAWRRQPHPSPPVSAAGNKTAGGKEQIFDLMGSALAELFIMGDGSAPA  109

Query  546  NYPAQKKGSRKQINPRFFSSEL------NNVSGSRDDRGKDKSASPMSDDQSRVemklle  707
               A KK +RKQ NP+     +      N ++G+        + SP S + S  E K   
Sbjct  110  TLRASKKSARKQPNPKACVPSISASIGGNFLAGAPAACRVTPATSPSSAENSVAEAKKSR  169

Query  708  qseee------ekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
                         +++ L  +S++EVTVIDTS   WK +KL+FRK  VWKVRDK+
Sbjct  170  TKARRKRGTAGSPVESDLSTYSKTEVTVIDTSSPGWKSEKLIFRKGIVWKVRDKK  224



>ref|XP_010922571.1| PREDICTED: uncharacterized protein LOC105045848 isoform X1 [Elaeis 
guineensis]
Length=332

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 111/235 (47%), Gaps = 33/235 (14%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            MLCSIST +S ++ WLDRL +SKGF     ++L+ FL                       
Sbjct  1    MLCSISTSRSSSN-WLDRLHTSKGFSIPADLDLDHFL----------SSNPNPDPNTNSC  49

Query  396  NLASVSCSTRPGS--EKQQVLETPVDPAG-----GKQQLFNAFSNALSELFNMGESS---  545
                    TRP     +Q     PV  AG     GK+Q+F+   +AL+ELF MG+ S   
Sbjct  50   FPPLPPPETRPSDAWRRQPHPSPPVSAAGNKTAGGKEQIFDLMGSALAELFIMGDGSAPA  109

Query  546  NYPAQKKGSRKQINPRFFSSEL------NNVSGSRDDRGKDKSASPMSDDQSRVemklle  707
               A KK +RKQ NP+     +      N ++G+        + SP S + S  E K   
Sbjct  110  TLRASKKSARKQPNPKACVPSISASIGGNFLAGAPAACRVTPATSPSSAENSVAEAKKSR  169

Query  708  qseee------ekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
                         +++ L  +S++EVTVIDTS   WK +KL+FRK  VWKVRDK+
Sbjct  170  TKARRKRGTAGSPVESDLSTYSKTEVTVIDTSSPGWKSEKLIFRKGIVWKVRDKK  224



>ref|XP_009420008.1| PREDICTED: neural Wiskott-Aldrich syndrome protein isoform X2 
[Musa acuminata subsp. malaccensis]
Length=303

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 102/218 (47%), Gaps = 20/218 (9%)
 Frame = +3

Query  258  WLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQTNLAS----VSCSTR  425
            WL+RL SS+GF    +++L+ FL   S+S          P       + S          
Sbjct  18   WLERLHSSRGFSVPAHLHLDHFLSPDSASNPSPNSPPPPPPPPPPEEVLSDPPPPEPLAN  77

Query  426  PGSEKQQVLETPVDPAG---GKQQLFNAFSNALSELFNMGESSNYPA--QKKGSRKQINP  590
            P   K+  L+ P  P     GKQ+LF+     L+ELF MG      A   KK SRKQ NP
Sbjct  78   PRRRKKH-LQPPPPPGASTDGKQRLFDLVGGVLAELFVMGGPPVVRALKAKKSSRKQPNP  136

Query  591  RFFSSELNNVSGSRDD-RGKDKSASPMSDDQSRVemklleqs------eeeekIDAHLFG  749
            +     + + S S D  R    ++ P S D S  E K                +D  L  
Sbjct  137  KVC---VPSASASIDGCRSLPATSPPSSADNSVAEAKKSRSKLRRKRGTAGSPVDLDLSA  193

Query  750  FSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKT  863
            +SR++VTVIDTSC  WK +K++FRK  +WKVRDK+  T
Sbjct  194  YSRTDVTVIDTSCPGWKSEKVIFRKGIMWKVRDKKVWT  231



>ref|XP_009420007.1| PREDICTED: neural Wiskott-Aldrich syndrome protein isoform X1 
[Musa acuminata subsp. malaccensis]
Length=335

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 101/215 (47%), Gaps = 20/215 (9%)
 Frame = +3

Query  258  WLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQTNLAS----VSCSTR  425
            WL+RL SS+GF    +++L+ FL   S+S          P       + S          
Sbjct  18   WLERLHSSRGFSVPAHLHLDHFLSPDSASNPSPNSPPPPPPPPPPEEVLSDPPPPEPLAN  77

Query  426  PGSEKQQVLETPVDPAG---GKQQLFNAFSNALSELFNMGESSNYPA--QKKGSRKQINP  590
            P   K+  L+ P  P     GKQ+LF+     L+ELF MG      A   KK SRKQ NP
Sbjct  78   PRRRKKH-LQPPPPPGASTDGKQRLFDLVGGVLAELFVMGGPPVVRALKAKKSSRKQPNP  136

Query  591  RFFSSELNNVSGSRDD-RGKDKSASPMSDDQSRVemklleqs------eeeekIDAHLFG  749
            +     + + S S D  R    ++ P S D S  E K                +D  L  
Sbjct  137  KVC---VPSASASIDGCRSLPATSPPSSADNSVAEAKKSRSKLRRKRGTAGSPVDLDLSA  193

Query  750  FSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
            +SR++VTVIDTSC  WK +K++FRK  +WKVRDK+
Sbjct  194  YSRTDVTVIDTSCPGWKSEKVIFRKGIMWKVRDKK  228



>emb|CDY05438.1| BnaA02g32530D [Brassica napus]
Length=319

 Score = 85.1 bits (209),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 104/213 (49%), Gaps = 32/213 (15%)
 Frame = +3

Query  246  GTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasinptKLGQTNLA  404
             +S WLDRLR SKG         +G  ++L+ FLR++ S                     
Sbjct  9    ASSTWLDRLRLSKGLSTTEDEDASGTPLSLDDFLRRNHS--------------------T  48

Query  405  SVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQ---KKGSR  575
            S S  + P     ++ ++P DP  G  + +   S+ LSELFN   SS   A    KK  R
Sbjct  49   SDSPPSAPTPSDPELTDSPSDPNPG--EWYGVMSDVLSELFNYSGSSRSTATVPVKKLPR  106

Query  576  KQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAHLFGFS  755
            KQ NP+  S E       +  +   +            E   +E+ EEEE+ +  L GFS
Sbjct  107  KQSNPKHCSVETPPPPPPQRPKFATEKREKKRRRVVEEEDDGVEEEEEEEEGEKDLVGFS  166

Query  756  RSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
            RSEVTVIDTS   WK +K++FR++NVWKVRDK+
Sbjct  167  RSEVTVIDTSFKIWKAEKVVFRRRNVWKVRDKK  199



>ref|XP_010907408.1| PREDICTED: uncharacterized protein LOC105034083 [Elaeis guineensis]
Length=342

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 120/241 (50%), Gaps = 33/241 (14%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKL-GQ  392
            MLCS S+     S WLDRL +SKG      ++L+QFL    +    + P S +P     +
Sbjct  1    MLCSRSS-----SNWLDRLHTSKGLSIPADLDLDQFLSSIPNPNPNSNPKSCSPRPPEAR  55

Query  393  TNLASVSCST--RPGSEKQQVLETPVDP----------AGGKQQLFNAFSNALSELFNMG  536
             + A +S  T  +P + +++  + P  P           G K+QLF+  S+AL+ELF M 
Sbjct  56   PSDAPLSQPTGDKPAASRRRWKQQPPPPEEVAAGNKIFVGEKEQLFDLMSSALAELFIMR  115

Query  537  ESSN---YPAQKKGSRKQINPRFF----SSELNN--VSGSRDDRGKDKSASPMSDDQSRV  689
            + S        KK +RKQ NP+      S+ ++   ++G+        + SP S D S  
Sbjct  116  DHSATGILGPSKKSARKQPNPKACVPSASASIDGSFLAGAAAACHVPPATSPSSADNSVA  175

Query  690  emklleqseee------ekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDK  851
            E K                +++ L  +S++EVTVIDTS   WK +KL+FRK  VWKVRDK
Sbjct  176  EAKKSRTKARRKRGTTGSPVESDLSTYSKTEVTVIDTSSPGWKSEKLIFRKGMVWKVRDK  235

Query  852  R  854
            +
Sbjct  236  K  236



>ref|XP_009130062.1| PREDICTED: protein fantom [Brassica rapa]
Length=303

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/227 (36%), Positives = 112/227 (49%), Gaps = 42/227 (19%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasin  374
            ML S +   S T  WLDRLR SKG         +G  ++L+ FLR+              
Sbjct  1    MLSSDTPVASST--WLDRLRLSKGLSTTEDDDASGTPLSLDDFLRR--------------  44

Query  375  ptKLGQTNLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYP  554
                   + AS S  + P     ++ ++P DP  G  + +   S+ LSELFN   SS   
Sbjct  45   ------NHSASDSPPSAPTPSDPELTDSPSDPNRG--EWYGVMSDVLSELFNYSGSSRST  96

Query  555  AQ---KKGSRKQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSR----Vemklleqs  713
            A    KK  RKQ NP+  S         +    + K A+   + + R     E   +E+ 
Sbjct  97   ATVPVKKLPRKQSNPKHCSVGTPPPPPPQ----RPKFATEKREKKRRRVVEEEDDGIEEE  152

Query  714  eeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
            EEEE+ +  L GFSRSEVTVIDTS   WK +K++FR++NVWKVRDK+
Sbjct  153  EEEEEGEKDLVGFSRSEVTVIDTSFKIWKAEKVVFRRRNVWKVRDKK  199



>ref|XP_008805011.1| PREDICTED: uncharacterized protein LOC103718115 [Phoenix dactylifera]
Length=258

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 116/244 (48%), Gaps = 40/244 (16%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF--PAGDYVNLEQFLRQsssstspnppasinptKLG  389
            MLCS S+     S WLDRL +SKGF  PA D+ +L+ FL    +      P S +P +  
Sbjct  1    MLCSRSS-----SNWLDRLHTSKGFCIPAADH-DLDHFLSSIPNPNPNTNPKSCSPPR--  52

Query  390  QTNLASVSCSTRPGSEKQQVLETPVDP---------------AGGKQQLFNAFSNALSEL  524
                 S +  ++P +EK                         AG K+QLF+  S+AL+EL
Sbjct  53   PETWTSDAPLSQPPAEKPAAPRRRRKQQQQQQPQYAAGNKTFAGEKEQLFDLMSSALAEL  112

Query  525  FNMGESSN---YPAQKKGSRKQINPRFF----SSELNN--VSGSRDDRGKDKSASPMSDD  677
            F MG+ S      A KK +RKQ NP+      S+ ++   ++G+          SP S D
Sbjct  113  FIMGDRSATGILRASKKSARKQANPKACVPSASASIDGSFLAGAAAACHVPPVTSPSSAD  172

Query  678  QSRVemklleqse------eeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWK  839
             S  E K                +++ L  +S+++ TVIDTS   WK +KL+FRK  VWK
Sbjct  173  NSVAEAKNSRTKARWKRGTTGSPVESDLSTYSKTDATVIDTSSPGWKSEKLIFRKGMVWK  232

Query  840  VRDK  851
            VRDK
Sbjct  233  VRDK  236



>ref|XP_006840601.1| hypothetical protein AMTR_s00084p00030860 [Amborella trichopoda]
 gb|ERN02276.1| hypothetical protein AMTR_s00084p00030860 [Amborella trichopoda]
Length=351

 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 105/211 (50%), Gaps = 34/211 (16%)
 Frame = +3

Query  246  GTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQTNLASVSCSTR  425
            G   WLD+LRSSKGFP  + +NLE FL+ SS S +PN    ++P  L  +   S++    
Sbjct  8    GAHNWLDKLRSSKGFPLDNGLNLENFLKSSSPSPNPNFSGDVSPPLLCHSPENSLNLINA  67

Query  426  PGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNY-----PAQKKGSRKQINP  590
             G        T  DP       F+  ++ LS+LFNM  S ++        +K  RKQ  P
Sbjct  68   SGFSA-----TKRDPGA----WFDIMTDVLSDLFNMEGSYDFRRLRDSRDRKNGRKQSRP  118

Query  591  RFFS---SELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAHLFGFSRS  761
            R  +    EL N S +R++   +      S D +                D  +   SR+
Sbjct  119  RICALSAEELPNFS-ARNNADNNSGVGGGSRDDA----------------DVDISSCSRT  161

Query  762  EVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
            EVTVIDTS A WK +K+++RK +VWKVR+++
Sbjct  162  EVTVIDTSIATWKSEKVIYRKAHVWKVRERK  192



>ref|XP_008347320.1| PREDICTED: uncharacterized protein LOC103410393 [Malus domestica]
Length=329

 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 85/174 (49%), Gaps = 33/174 (19%)
 Frame = +3

Query  741   LFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK------------TTIHLGkk  884
             + G+SRSEVTVIDTSC  WK +KL+FR+KNVWKVR+K+ K               H+   
Sbjct  160   MKGYSRSEVTVIDTSCGVWKTEKLVFRRKNVWKVREKKVKGRSFGRHKRKVVVEEHVADD  219

Query  885   kkkrkANDGGAAEDGNFGGIKKHKVSNGEETQISNIIQGLQPGNKFEEGCKKTLDSVGQT  1064
               K+KA    +A D   G         G+E    N IQ  +P N   +      +  G+ 
Sbjct  220   IDKKKAKVSVSALDVEAG---------GDECIALNSIQVQKPQNDTLDNLNDRGEEFGKH  270

Query  1065  L-ERKHRD----FA-------LKKANSSVVLIKNIPASKKSGTGIPKTNLKSSH  1190
             L E K +D    F+       LKK  SSV+LIK +P   K+G  + K  LK S 
Sbjct  271   LPENKTKDTRKGFSLNRSPRNLKKGGSSVILIKGLPTDNKNGGKLHKKTLKDSQ  324



>emb|CAN80175.1| hypothetical protein VITISV_018394 [Vitis vinifera]
Length=420

 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 125/262 (48%), Gaps = 41/262 (16%)
 Frame = +3

Query  477   GKQQLFNAFSNALSELFNMGESSNYP--AQKKGSRKQINPR--FFSS--ELNNVSGSRDD  638
             G+++ F   SN L+ELFNMG+S+  P  + KK SRKQ NP+    SS  + + V  +   
Sbjct  178   GEKEWFGIMSNVLAELFNMGDSNQIPKLSGKKSSRKQTNPKICLLSSVRQEDEVPATAPS  237

Query  639   RGKDKSASPMSDDQSRVemklleqseeeekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLF  818
              G D S + M D    V+     + +    +DA        E    D S      +KLLF
Sbjct  238   SG-DNSLTEMKDSNGEVKTVNQGKVDC---LDAE------EEKCNQDLSAYSRSFEKLLF  287

Query  819   RKKNVWKVRDKRSKTTIHLGkkkkkrkANDGGAAEDGNFGGIKKHKVSNGEETQI-SNII  995
             RKKNVWKVRDK+ K+     KK+K  + ++   A       ++  K  N EE+ + SN  
Sbjct  288   RKKNVWKVRDKKGKSRSIGRKKRKASECDEQLEARKKMKLSVESFKERNEEESAMPSNEE  347

Query  996   QGLQPGNKFEEGCKKTLDSVGQT-------------LERKHRDFALKKANSSVVLIKNIP  1136
             Q   P N  +E CK+T D + Q              L RK R+       S V+L++   
Sbjct  348   QN--PHNAKKEECKETSDGLSQVPKKRQVILSPFSRLPRKSRE-----GGSPVILVR---  397

Query  1137  ASKKSGTGIPKTNLK-SSHHHR  1199
              SKK+G  +PK  LK +S  H+
Sbjct  398   GSKKTGANLPKITLKDTSRRHK  419



>gb|AAS45434.1| At5g24500 [Arabidopsis thaliana]
Length=276

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 89/170 (52%), Gaps = 31/170 (18%)
 Frame = +3

Query  444  QVLETPVD-PAGGKQQLFNAFSNALSELFNMG---ESSNYPAQKKGSRKQINPRFFSSE-  608
            ++ E+P + P  G  + +   S+ L ELFN     +SS  P +KK  RKQ NPR  S E 
Sbjct  45   ELAESPSEEPVPG--EWYGVMSDVLFELFNFSGSSKSSTIPGKKKLPRKQSNPRHCSLET  102

Query  609  ------------------LNNV-----SGSRDDRGKDKSASPMSDDQSRVemklleqsee  719
                              L +V     S SR    K K  +P   ++ R  ++     EE
Sbjct  103  PEDVVVPLVNQKSDDANCLPSVREFATSSSRSSYNK-KPPAPEIRERRRSVVEGDGVDEE  161

Query  720  eekIDAHLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSKTTI  869
            EEK +  L GFSRSEVTVIDTS   WK +KL+FR++NVWKVR+K+ K+ +
Sbjct  162  EEKGEKDLVGFSRSEVTVIDTSFKIWKSEKLVFRRRNVWKVREKKGKSRV  211



>ref|XP_004502756.1| PREDICTED: uncharacterized protein LOC101513070 isoform X1 [Cicer 
arietinum]
 ref|XP_004502757.1| PREDICTED: uncharacterized protein LOC101513070 isoform X2 [Cicer 
arietinum]
Length=216

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 96/215 (45%), Gaps = 41/215 (19%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            M+CS    KSG S WLDRLR +KG P  D ++L+ FL + ++ +            +  T
Sbjct  1    MICS---TKSG-SNWLDRLRFNKGIPTDDDLDLDSFLLRIAAHSHSPHTR-----PIHPT  51

Query  396  NLASVSCSTRPGSEKQQVLETPVDPAGGKQQLFNAFSNALSELFNMGESSNYPAQKKGSR  575
            N     C T        V   P              S  L+ELFN G +      KK  R
Sbjct  52   NNPVRKCPT--------VTHDP------------PLSALLAELFNPGTNLTL-ISKKCPR  90

Query  576  KQINPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeeekIDAHLFGFS  755
            KQ NP+ F +     S      G   +A  + D     +    +           L GF+
Sbjct  91   KQTNPKIFLASSATTSSHAPAGGDADAAVVVEDRGEEGDEGDED-----------LKGFT  139

Query  756  RSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
            RSEVTVIDTSC  WK DK LFRK +VWK+R+++ K
Sbjct  140  RSEVTVIDTSCPAWKVDKFLFRKNSVWKIRERKPK  174



>ref|XP_010493611.1| PREDICTED: uncharacterized protein LOC104770849 [Camelina sativa]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 114/255 (45%), Gaps = 58/255 (23%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasin  374
            ML SI+  K   S WL RLR ++G         +G+ + L+ FLR++  +          
Sbjct  1    MLSSITDDKPVASTWLTRLRLNRGLTTTEDDDASGNPLTLDDFLRRNHHT----------  50

Query  375  ptKLGQTNLASVSCSTRPGSEKQQVLETPV-DPAGGKQQLFNAFSNALSELFNMGESSNY  551
              ++  T+ AS S  + P     ++ E+P  DP  G  + +   ++ LSELFN       
Sbjct  51   --EITGTSSASDSPPSAPIRSDPELAESPSEDPNPG--EWYGVMTDVLSELFNFDGGGGS  106

Query  552  PA-------QKKGSRKQINPRFFSSE---------LNN-----------------VSGSR  632
                     +KK  RKQ NPR  S E         L N                  S SR
Sbjct  107  SKSSTIQGKKKKLPRKQSNPRHCSLETPEEDVVVPLANHQKITDANCVPSVREFATSSSR  166

Query  633  DDRGKDKSASPMSDDQSRVemklleqseeeekIDAH---LFGFSRSEVTVIDTSCAPWKC  803
                K   A  + + +  V  +   +  EEE+ +     L GFSRSEVTVIDTS   WK 
Sbjct  167  SSYNKKPPAKEIKERRRSVVAEEEVEGVEEEEEEKGEKDLVGFSRSEVTVIDTSFKVWKS  226

Query  804  DKLLFRKKNVWKVRD  848
            +KL+FR++NVWKVRD
Sbjct  227  EKLVFRRRNVWKVRD  241



>gb|EPS62702.1| hypothetical protein M569_12088 [Genlisea aurea]
Length=213

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 100/226 (44%), Gaps = 49/226 (22%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGFPAGDYVNLEQFLRQsssstspnppasinptKLGQT  395
            M  ++   KS + +WLDRL +S+GF   D  + E  L+                      
Sbjct  1    MFGTVPAGKS-SHRWLDRLWTSRGF--SDSTDPENLLQNPR-------------------  38

Query  396  NLASVSCSTRPGSEKQQVLETPVD------PAG--GKQQLFNAFSNALSELFNMGESSNY  551
                     RP      + ETP D      P G  G + + +  S+ L+ELF  G+    
Sbjct  39   --------NRP------ISETPEDSSQIGCPHGDDGDRNIRDTVSDVLNELFYFGDGCRS  84

Query  552  PAQKKGSRKQ--INPRFFSSELNNVSGSRDDRGKDKSASPMSDDQSRVemklleqseeee  725
             +       +   NPR  +    N   ++  R +D+S+      +S    +  E++    
Sbjct  85   SSSHIKKSSRKAANPRNCAFPNGNKRDAKLWRCEDRSSRVAERKESNHNYENEEEARRGG  144

Query  726  kIDAH---LFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKR  854
                    L GFSR+EVTVIDTSCA WK +KLL+RK+NVWKVRD++
Sbjct  145  GASGEGNSLSGFSRTEVTVIDTSCAVWKLEKLLYRKRNVWKVRDRK  190



>ref|XP_010454767.1| PREDICTED: uncharacterized protein LOC104736472 [Camelina sativa]
Length=344

 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 78/252 (31%), Positives = 115/252 (46%), Gaps = 55/252 (22%)
 Frame = +3

Query  216  MLCSISTQKSGTSKWLDRLRSSKGF-------PAGDYVNLEQFLRQsssstspnppasin  374
            ML SI+  K   S WL RLR ++G         +G+ + L+ FLR++  +          
Sbjct  1    MLSSITDDKPVASTWLTRLRLNRGLTTTDDDDASGNPLTLDDFLRRNHHT----------  50

Query  375  ptKLGQTNLASVSCSTRPGSEKQQVLETPVD-PAGGKQQLFNAFSNALSELFNM----GE  539
              ++  T+ A  S  + P     ++ E+P + P  G  + +   ++ LSELFN     G 
Sbjct  51   --EITGTSSAFDSPPSAPIRSDPELAESPSEEPNPG--EWYGVMTDVLSELFNFDGGGGA  106

Query  540  SSNYPAQKKGS----RKQINPRFFS------------------SELNNVSGSRD----DR  641
            S +   Q K      RKQ NPR  S                  ++ N V   R+      
Sbjct  107  SKSSTIQGKKKKKLPRKQSNPRHCSLDTPEEDVVVPLANHQKITDANCVPSVREFATSSY  166

Query  642  GKDKSASPMSDDQSRVemklleqseeeekIDA---HLFGFSRSEVTVIDTSCAPWKCDKL  812
             K   A  + + +  V  +   +  EEE+ +     L GFSRSEVTVIDTS   WK +KL
Sbjct  167  NKKPPAKEIRERRRSVVAEEEGEGVEEEEEEKGEKDLVGFSRSEVTVIDTSFKVWKSEKL  226

Query  813  LFRKKNVWKVRD  848
            +FR++NVWKVRD
Sbjct  227  VFRRRNVWKVRD  238



>gb|KHN23302.1| hypothetical protein glysoja_015604 [Glycine soja]
Length=104

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  738  HLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
             L GF++SEVTVIDTSC  WK DK +FRK NVWKVR+++ K
Sbjct  37   ELKGFTKSEVTVIDTSCPGWKVDKFVFRKNNVWKVRERKPK  77



>gb|KHN19561.1| hypothetical protein glysoja_027818 [Glycine soja]
Length=81

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  738  HLFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
             L GF++SEVTVIDTS   WK DK +FRK NVWKVR+K++K
Sbjct  14   ELKGFTKSEVTVIDTSSPGWKVDKFVFRKNNVWKVREKKTK  54



>ref|XP_010424276.1| PREDICTED: uncharacterized protein LOC104709344 [Camelina sativa]
Length=248

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  741  LFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRD  848
            L GFSRSEVTVIDTS   WK +KL+FR++NVWKVRD
Sbjct  104  LVGFSRSEVTVIDTSFKVWKSEKLVFRRRNVWKVRD  139



>ref|XP_003598530.1| hypothetical protein MTR_3g014780 [Medicago truncatula]
Length=365

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  741  LFGFSRSEVTVIDTSCAPWKCDKLLFRKKNVWKVRDKRSK  860
            L GF++SEVTVIDTSC  WK DK +FR KN WK+R+++ K
Sbjct  30   LKGFTKSEVTVIDTSCRVWKVDKFVFR-KNDWKIRERKQK  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4744209259384